F489679
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1081 | 485 | 2163 | 484 |
Family's Representative Sequence
| Representative Sequence | 3300026067|Ga0207678_10136773|Ga0207678_101367731 |
| Length | 552 |
| Sequence | MKPAHTDASAAAKVFEGPTTLLPQPCQLVIFGGPGDLSWRKLLPAVYNLDVDGVLPSHFTVVAFGVPAEGASDADPDEYIRARAKSGIARFSRQAIDEATWANFARGLFFVQGSFNDMRAYEQLKARLDSLDQQFGIPGSRVYYLAVSPGLVGQCVEHLQAAGMIRDPADTTAFTRVIIEKPIGRDLESARAVNRVVGAAFAESQTYRIDHYLGKETVQNLLVLRFANSIFEPLWNSKSIDHVQITVAEDEGLAQYDPITGELIATRAGYYEGIGALRDMVQNHMLQVLCVMAMEPPWSLAPEVVRDAKVGVLNCLRPLSKADVDKQVVRGQYIEGDVHGQRVPGYRKEVRASFEAMGRTLPRSSVNSTTETFVALRLFIDNWRWAGVPFYLRTGKRLPKRVSEVAIQFKDVPQILFNANPEFQLEPTVLSVRVQPEEGLSMRIASKLPGPKIRIYPVKMEFNYASSFGGSSPEAYERLILDAMRGDHTLFNTAEGIERLWEVSTPLLEAPPPVRLYAPGSWGPNAIHQLIAPRAWRLPFERVWRDPNKAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 106 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 126 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 206 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 207 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 208 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 226 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 236 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 246 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 249 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 253 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 254 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 255 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 256 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 332 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 335 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 338 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 379 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 391 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 392 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 394 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 395 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 398 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 400 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 401 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 402 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 403 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 405 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 406 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 407 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 408 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 410 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 411 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 413 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 416 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 417 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 418 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 419 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 420 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 421 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 422 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 423 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 424 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 425 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 426 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 427 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 428 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 429 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 430 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 431 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 432 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 433 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 434 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 435 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 436 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 437 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 438 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 439 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 440 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 441 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 442 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 443 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 444 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 445 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 446 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 447 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 448 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 449 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 450 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 451 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 452 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 453 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 454 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 455 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 456 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 457 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 458 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 459 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 460 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 461 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 462 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 463 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 464 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 465 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 466 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 467 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 468 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 469 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 470 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 471 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 472 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 473 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 474 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 475 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 476 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 477 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 478 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 479 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 480 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 481 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 482 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 483 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 484 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 485 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.34 |
| Metatranscriptomes | 0.09 |
| Isolates | 6.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.04 |
| Nodule | 2.31 |
| Rhizoplane | 6.48 |
| Rhizosphere | 66.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207678_10136773 | 3300026067 | Bacteria | 2090 |
| 2 | JGI24744J21845_10004395 | 3300002077 | Bacteria | 2913 |
| 3 | JGI25158J39367_1000043 | 3300002739 | Bacteria | 28682 |
| 4 | JGI25152J39213_1001831 | 3300002773 | Bacteria | 8576 |
| 5 | JGI25152J39213_1007690 | 3300002773 | Bacteria | 2765 |
| 6 | JGI25153J46596_10003067 | 3300003215 | Bacteria | 9436 |
| 7 | rootH1_10008151 | 3300003316 | Bacteria | 4564 |
| 8 | rootH1_10008151 | 3300003323 | Bacteria | 6827 |
| 9 | rootH1_10117972 | 3300003323 | Bacteria | 2674 |
| 10 | JGI25160J50197_1009936 | 3300003354 | Bacteria | 3484 |
| 11 | JGI25161J50226_1000027 | 3300003374 | Bacteria | 145847 |
| 12 | Ga0055526_1001863 | 3300003771 | Bacteria | 14611 |
| 13 | Ga0055526_1013303 | 3300003771 | Bacteria | 3493 |
| 14 | Ga0055528_1015656 | 3300003790 | Bacteria | 2727 |
| 15 | Ga0055540_1004588 | 3300003792 | Bacteria | 6138 |
| 16 | Ga0055543_1000100 | 3300004625 | Bacteria | 74795 |
| 17 | Ga0065165_1001841 | 3300005262 | Bacteria | 20687 |
| 18 | Ga0065707_10085008 | 3300005295 | Bacteria | 6545 |
| 19 | Ga0070676_10006514 | 3300005328 | Bacteria | 6238 |
| 20 | Ga0070683_100008299 | 3300005329 | Bacteria | 8828 |
| 21 | Ga0070683_100009231 | 3300005329 | Bacteria | 8424 |
| 22 | Ga0070683_100061774 | 3300005329 | Bacteria | 3483 |
| 23 | Ga0070683_100167254 | 3300005329 | Bacteria | 2087 |
| 24 | Ga0070690_100041805 | 3300005330 | Bacteria | 2903 |
| 25 | Ga0070670_100064046 | 3300005331 | Bacteria | 3155 |
| 26 | Ga0070677_10000706 | 3300005333 | Bacteria | 11224 |
| 27 | Ga0070677_10007124 | 3300005333 | Bacteria | 3726 |
| 28 | Ga0068869_100033427 | 3300005334 | Bacteria | 3630 |
| 29 | Ga0070666_10012082 | 3300005335 | Bacteria | 5438 |
| 30 | Ga0070666_10066872 | 3300005335 | Bacteria | 2440 |
| 31 | Ga0070680_100002950 | 3300005336 | Bacteria | 12645 |
| 32 | Ga0070682_100000061 | 3300005337 | Bacteria | 105134 |
| 33 | Ga0070682_100003688 | 3300005337 | Bacteria | 8507 |
| 34 | Ga0070682_100064723 | 3300005337 | Bacteria | 2321 |
| 35 | Ga0068868_100020471 | 3300005338 | Bacteria | 4972 |
| 36 | Ga0068868_100069539 | 3300005338 | Bacteria | 2806 |
| 37 | Ga0068868_100095259 | 3300005338 | Bacteria | 2403 |
| 38 | Ga0068868_100223581 | 3300005338 | Bacteria | 1577 |
| 39 | Ga0070660_100022184 | 3300005339 | Bacteria | 4692 |
| 40 | Ga0070689_100001851 | 3300005340 | Bacteria | 13625 |
| 41 | Ga0070689_100083681 | 3300005340 | Bacteria | 2507 |
| 42 | Ga0070692_10007517 | 3300005345 | Bacteria | 4803 |
| 43 | Ga0070675_100022065 | 3300005354 | Bacteria | 5087 |
| 44 | Ga0070675_100025410 | 3300005354 | Bacteria | 4749 |
| 45 | Ga0070671_100020733 | 3300005355 | Bacteria | 5361 |
| 46 | Ga0070673_100024552 | 3300005364 | Bacteria | 4422 |
| 47 | Ga0070688_100011943 | 3300005365 | Bacteria | 4850 |
| 48 | Ga0070688_100062643 | 3300005365 | Bacteria | 2355 |
| 49 | Ga0070667_100000967 | 3300005367 | Bacteria | 26443 |
| 50 | Ga0070667_100002581 | 3300005367 | Bacteria | 15733 |
| 51 | Ga0070667_100034441 | 3300005367 | Bacteria | 4236 |
| 52 | Ga0070667_100178439 | 3300005367 | Bacteria | 1878 |
| 53 | Ga0070709_10025237 | 3300005434 | Bacteria | 3509 |
| 54 | Ga0070714_100059436 | 3300005435 | Bacteria | 3278 |
| 55 | Ga0070713_100141208 | 3300005436 | Bacteria | 2134 |
| 56 | Ga0070701_10038650 | 3300005438 | Bacteria | 2417 |
| 57 | Ga0070701_10050854 | 3300005438 | Bacteria | 2148 |
| 58 | Ga0070711_100008954 | 3300005439 | Bacteria | 6143 |
| 59 | Ga0070705_100052090 | 3300005440 | Bacteria | 2390 |
| 60 | Ga0070700_100092156 | 3300005441 | Bacteria | 1980 |
| 61 | Ga0070708_100058413 | 3300005445 | Bacteria | 3437 |
| 62 | Ga0070681_10002000 | 3300005458 | Bacteria | 18452 |
| 63 | Ga0070681_10027724 | 3300005458 | Bacteria | 5695 |
| 64 | Ga0068867_100001469 | 3300005459 | Bacteria | 16336 |
| 65 | Ga0068867_100047796 | 3300005459 | Bacteria | 3146 |
| 66 | Ga0070706_100004269 | 3300005467 | Bacteria | 13866 |
| 67 | Ga0070706_100114382 | 3300005467 | Bacteria | 2513 |
| 68 | Ga0070706_100194924 | 3300005467 | Bacteria | 1893 |
| 69 | Ga0070698_100001386 | 3300005471 | Bacteria | 26868 |
| 70 | Ga0070698_100046507 | 3300005471 | Bacteria | 4437 |
| 71 | Ga0070699_100046067 | 3300005518 | Bacteria | 3774 |
| 72 | Ga0070699_100151915 | 3300005518 | Bacteria | 2048 |
| 73 | Ga0070679_100013436 | 3300005530 | Bacteria | 7840 |
| 74 | Ga0070679_100027028 | 3300005530 | Bacteria | 5642 |
| 75 | Ga0070679_100073717 | 3300005530 | Bacteria | 3404 |
| 76 | Ga0070684_100004622 | 3300005535 | Bacteria | 10498 |
| 77 | Ga0070697_100023957 | 3300005536 | Bacteria | 4857 |
| 78 | Ga0070672_100000005 | 3300005543 | Bacteria | 121014 |
| 79 | Ga0070672_100001159 | 3300005543 | Bacteria | 16111 |
| 80 | Ga0070672_100005485 | 3300005543 | Bacteria | 8411 |
| 81 | Ga0070672_100040468 | 3300005543 | Bacteria | 3576 |
| 82 | Ga0070672_100054676 | 3300005543 | Bacteria | 3126 |
| 83 | Ga0070672_100067276 | 3300005543 | Bacteria | 2838 |
| 84 | Ga0070672_100122881 | 3300005543 | Bacteria | 2127 |
| 85 | Ga0070686_100004637 | 3300005544 | Bacteria | 7580 |
| 86 | Ga0070686_100021257 | 3300005544 | Bacteria | 3854 |
| 87 | Ga0070665_100000566 | 3300005548 | Bacteria | 51646 |
| 88 | Ga0070665_100001336 | 3300005548 | Bacteria | 29314 |
| 89 | Ga0070665_100002579 | 3300005548 | Bacteria | 19853 |
| 90 | Ga0070665_100008692 | 3300005548 | Bacteria | 10277 |
| 91 | Ga0070665_100012031 | 3300005548 | Bacteria | 8730 |
| 92 | Ga0070665_100034625 | 3300005548 | Bacteria | 5079 |
| 93 | Ga0070665_100041042 | 3300005548 | Bacteria | 4650 |
| 94 | Ga0070665_100055601 | 3300005548 | Bacteria | 3969 |
| 95 | Ga0068855_100000327 | 3300005563 | Bacteria | 59054 |
| 96 | Ga0068855_100000479 | 3300005563 | Bacteria | 49224 |
| 97 | Ga0068855_100004779 | 3300005563 | Bacteria | 16536 |
| 98 | Ga0068855_100048599 | 3300005563 | Bacteria | 5006 |
| 99 | Ga0068855_100134114 | 3300005563 | Bacteria | 2826 |
| 100 | Ga0068855_100136947 | 3300005563 | Bacteria | 2793 |
| 101 | Ga0070664_100019671 | 3300005564 | Bacteria | 5556 |
| 102 | Ga0070664_100054357 | 3300005564 | Bacteria | 3397 |
| 103 | Ga0068856_100005787 | 3300005614 | Bacteria | 12182 |
| 104 | Ga0068856_100104020 | 3300005614 | Bacteria | 2832 |
| 105 | Ga0068856_100132386 | 3300005614 | Bacteria | 2499 |
| 106 | Ga0068856_100192913 | 3300005614 | Bacteria | 2051 |
| 107 | Ga0070702_100019013 | 3300005615 | Bacteria | 3573 |
| 108 | Ga0070702_100031825 | 3300005615 | Bacteria | 2889 |
| 109 | Ga0070702_100116255 | 3300005615 | Bacteria | 1667 |
| 110 | Ga0068852_100004825 | 3300005616 | Bacteria | 9580 |
| 111 | Ga0068852_100035444 | 3300005616 | Bacteria | 4163 |
| 112 | Ga0068852_100080734 | 3300005616 | Bacteria | 2885 |
| 113 | Ga0068852_100175914 | 3300005616 | Bacteria | 2010 |
| 114 | Ga0068859_100006016 | 3300005617 | Bacteria | 12327 |
| 115 | Ga0068859_100018500 | 3300005617 | Bacteria | 7001 |
| 116 | Ga0068859_100068400 | 3300005617 | Bacteria | 3586 |
| 117 | Ga0068859_100141878 | 3300005617 | Bacteria | 2476 |
| 118 | Ga0068859_100176913 | 3300005617 | Bacteria | 2215 |
| 119 | Ga0068864_100008855 | 3300005618 | Bacteria | 8296 |
| 120 | Ga0068864_100014290 | 3300005618 | Bacteria | 6594 |
| 121 | Ga0068864_100031966 | 3300005618 | Bacteria | 4468 |
| 122 | Ga0068864_100094347 | 3300005618 | Bacteria | 2645 |
| 123 | Ga0068866_10008363 | 3300005718 | Bacteria | 4357 |
| 124 | Ga0068866_10016882 | 3300005718 | Bacteria | 3272 |
| 125 | Ga0068861_100001686 | 3300005719 | Bacteria | 14171 |
| 126 | Ga0068861_100004568 | 3300005719 | Bacteria | 9295 |
| 127 | Ga0068861_100005967 | 3300005719 | Bacteria | 8273 |
| 128 | Ga0068861_100034539 | 3300005719 | Bacteria | 3740 |
| 129 | Ga0068861_100050147 | 3300005719 | Bacteria | 3164 |
| 130 | Ga0068861_100065417 | 3300005719 | Bacteria | 2801 |
| 131 | Ga0068861_100082644 | 3300005719 | Bacteria | 2518 |
| 132 | Ga0068870_10016817 | 3300005840 | Bacteria | 3505 |
| 133 | Ga0068870_10088242 | 3300005840 | Bacteria | 1728 |
| 134 | Ga0068863_100011481 | 3300005841 | Bacteria | 8565 |
| 135 | Ga0068863_100078590 | 3300005841 | Bacteria | 3124 |
| 136 | Ga0068863_100127377 | 3300005841 | Bacteria | 2430 |
| 137 | Ga0068863_100155869 | 3300005841 | Bacteria | 2187 |
| 138 | Ga0068858_100002321 | 3300005842 | Bacteria | 19227 |
| 139 | Ga0068858_100004646 | 3300005842 | Bacteria | 13454 |
| 140 | Ga0068858_100007963 | 3300005842 | Bacteria | 10211 |
| 141 | Ga0068858_100040576 | 3300005842 | Bacteria | 4317 |
| 142 | Ga0068860_100000470 | 3300005843 | Bacteria | 50165 |
| 143 | Ga0068860_100082225 | 3300005843 | Bacteria | 3063 |
| 144 | Ga0068860_100094501 | 3300005843 | Bacteria | 2850 |
| 145 | Ga0068862_100036157 | 3300005844 | Bacteria | 4185 |
| 146 | Ga0081455_10002149 | 3300005937 | Bacteria | 23509 |
| 147 | Ga0081455_10002595 | 3300005937 | Bacteria | 21431 |
| 148 | Ga0081455_10012181 | 3300005937 | Bacteria | 8588 |
| 149 | Ga0081455_10020543 | 3300005937 | Bacteria | 6214 |
| 150 | Ga0081455_10033753 | 3300005937 | Bacteria | 4594 |
| 151 | Ga0081455_10050302 | 3300005937 | Bacteria | 3585 |
| 152 | Ga0081538_10000022 | 3300005981 | Bacteria | 131167 |
| 153 | Ga0081540_1005379 | 3300005983 | Bacteria | 9573 |
| 154 | Ga0081540_1012367 | 3300005983 | Bacteria | 5630 |
| 155 | Ga0081539_10000159 | 3300005985 | Bacteria | 157561 |
| 156 | Ga0081539_10003942 | 3300005985 | Bacteria | 17196 |
| 157 | Ga0081539_10009579 | 3300005985 | Bacteria | 8058 |
| 158 | Ga0070717_10016752 | 3300006028 | Bacteria | 5688 |
| 159 | Ga0075365_10001309 | 3300006038 | Bacteria | 11113 |
| 160 | Ga0075365_10003178 | 3300006038 | Bacteria | 8388 |
| 161 | Ga0075365_10005649 | 3300006038 | Bacteria | 6773 |
| 162 | Ga0075365_10016962 | 3300006038 | Bacteria | 4446 |
| 163 | Ga0075365_10019010 | 3300006038 | Bacteria | 4232 |
| 164 | Ga0075365_10046261 | 3300006038 | Bacteria | 2857 |
| 165 | Ga0075365_10053282 | 3300006038 | Bacteria | 2679 |
| 166 | Ga0075368_10001032 | 3300006042 | Bacteria | 8718 |
| 167 | Ga0075368_10001687 | 3300006042 | Bacteria | 7093 |
| 168 | Ga0075368_10009161 | 3300006042 | Bacteria | 3557 |
| 169 | Ga0075368_10014667 | 3300006042 | Bacteria | 2899 |
| 170 | Ga0075363_100004619 | 3300006048 | Bacteria | 6049 |
| 171 | Ga0075363_100008063 | 3300006048 | Bacteria | 4885 |
| 172 | Ga0075363_100014602 | 3300006048 | Bacteria | 3843 |
| 173 | Ga0075363_100056895 | 3300006048 | Bacteria | 2097 |
| 174 | Ga0075364_10000624 | 3300006051 | Bacteria | 18225 |
| 175 | Ga0075364_10003803 | 3300006051 | Bacteria | 8635 |
| 176 | Ga0075364_10003820 | 3300006051 | Bacteria | 8623 |
| 177 | Ga0075364_10017125 | 3300006051 | Bacteria | 4522 |
| 178 | Ga0075364_10020301 | 3300006051 | Bacteria | 4178 |
| 179 | Ga0075364_10032639 | 3300006051 | Bacteria | 3348 |
| 180 | Ga0075364_10068764 | 3300006051 | Bacteria | 2329 |
| 181 | Ga0070715_10006280 | 3300006163 | Bacteria | 4027 |
| 182 | Ga0070712_100044730 | 3300006175 | Bacteria | 3054 |
| 183 | Ga0070712_100059186 | 3300006175 | Bacteria | 2697 |
| 184 | Ga0075367_10004567 | 3300006178 | Bacteria | 6775 |
| 185 | Ga0075367_10005175 | 3300006178 | Bacteria | 6446 |
| 186 | Ga0075369_10000119 | 3300006186 | Bacteria | 21759 |
| 187 | Ga0075369_10018822 | 3300006186 | Bacteria | 2815 |
| 188 | Ga0075366_10006300 | 3300006195 | Bacteria | 6491 |
| 189 | Ga0075366_10007947 | 3300006195 | Bacteria | 5871 |
| 190 | Ga0075366_10010334 | 3300006195 | Bacteria | 5239 |
| 191 | Ga0075366_10010484 | 3300006195 | Bacteria | 5203 |
| 192 | Ga0075366_10063026 | 3300006195 | Bacteria | 2203 |
| 193 | Ga0097621_100003890 | 3300006237 | Bacteria | 10352 |
| 194 | Ga0097621_100009897 | 3300006237 | Bacteria | 6946 |
| 195 | Ga0075370_10000383 | 3300006353 | Bacteria | 16303 |
| 196 | Ga0075370_10002885 | 3300006353 | Bacteria | 8061 |
| 197 | Ga0075370_10007701 | 3300006353 | Bacteria | 5499 |
| 198 | Ga0075370_10008408 | 3300006353 | Bacteria | 5312 |
| 199 | Ga0075370_10030970 | 3300006353 | Bacteria | 2985 |
| 200 | Ga0075370_10038957 | 3300006353 | Bacteria | 2677 |
| 201 | Ga0075370_10085917 | 3300006353 | Bacteria | 1812 |
| 202 | Ga0068871_100007165 | 3300006358 | Bacteria | 7957 |
| 203 | Ga0075428_100001401 | 3300006844 | Bacteria | 25642 |
| 204 | Ga0075428_100027074 | 3300006844 | Bacteria | 6348 |
| 205 | Ga0075428_100073956 | 3300006844 | Bacteria | 3722 |
| 206 | Ga0075430_100004725 | 3300006846 | Bacteria | 11455 |
| 207 | Ga0075431_100004352 | 3300006847 | Bacteria | 13890 |
| 208 | Ga0075431_100019791 | 3300006847 | Bacteria | 6871 |
| 209 | Ga0075431_100133566 | 3300006847 | Bacteria | 2559 |
| 210 | Ga0075434_100082889 | 3300006871 | Bacteria | 3204 |
| 211 | Ga0075434_100132129 | 3300006871 | Bacteria | 2516 |
| 212 | Ga0075429_100001477 | 3300006880 | Bacteria | 19337 |
| 213 | Ga0068865_100010323 | 3300006881 | Bacteria | 5809 |
| 214 | Ga0097620_100006016 | 3300006931 | Bacteria | 12327 |
| 215 | Ga0097620_100018500 | 3300006931 | Bacteria | 7001 |
| 216 | Ga0097620_100068400 | 3300006931 | Bacteria | 3586 |
| 217 | Ga0097620_100141867 | 3300006931 | Bacteria | 2476 |
| 218 | Ga0097620_100176918 | 3300006931 | Bacteria | 2215 |
| 219 | Ga0099794_10001837 | 3300007265 | Bacteria | 7592 |
| 220 | Ga0099794_10006637 | 3300007265 | Bacteria | 4700 |
| 221 | Ga0099794_10066949 | 3300007265 | Bacteria | 1753 |
| 222 | Ga0099795_10000213 | 3300007788 | Bacteria | 10001 |
| 223 | Ga0105250_10000005 | 3300009092 | Bacteria | 422580 |
| 224 | Ga0105240_10000215 | 3300009093 | Bacteria | 115967 |
| 225 | Ga0105240_10000587 | 3300009093 | Bacteria | 67507 |
| 226 | Ga0105240_10002394 | 3300009093 | Bacteria | 30190 |
| 227 | Ga0105240_10011765 | 3300009093 | Bacteria | 12157 |
| 228 | Ga0105240_10011928 | 3300009093 | Bacteria | 12050 |
| 229 | Ga0105240_10025141 | 3300009093 | Bacteria | 7831 |
| 230 | Ga0105240_10049046 | 3300009093 | Bacteria | 5333 |
| 231 | Ga0105240_10127737 | 3300009093 | Bacteria | 3053 |
| 232 | Ga0105240_10157215 | 3300009093 | Bacteria | 2702 |
| 233 | Ga0105240_10223337 | 3300009093 | Bacteria | 2193 |
| 234 | Ga0105240_10226453 | 3300009093 | Bacteria | 2175 |
| 235 | Ga0111539_10049954 | 3300009094 | Bacteria | 4984 |
| 236 | Ga0111539_10212266 | 3300009094 | Bacteria | 2255 |
| 237 | Ga0105245_10003386 | 3300009098 | Bacteria | 14283 |
| 238 | Ga0105245_10005468 | 3300009098 | Bacteria | 11159 |
| 239 | Ga0105245_10068852 | 3300009098 | Bacteria | 3208 |
| 240 | Ga0105247_10002551 | 3300009101 | Bacteria | 12355 |
| 241 | Ga0105247_10014662 | 3300009101 | Bacteria | 4699 |
| 242 | Ga0105247_10019262 | 3300009101 | Bacteria | 4095 |
| 243 | Ga0105247_10025217 | 3300009101 | Bacteria | 3587 |
| 244 | Ga0114129_10001245 | 3300009147 | Bacteria | 33926 |
| 245 | Ga0105243_10007737 | 3300009148 | Bacteria | 8262 |
| 246 | Ga0105243_10038713 | 3300009148 | Bacteria | 3714 |
| 247 | Ga0105243_10126363 | 3300009148 | Bacteria | 2164 |
| 248 | Ga0105243_10160217 | 3300009148 | Bacteria | 1939 |
| 249 | Ga0105241_10080097 | 3300009174 | Bacteria | 2555 |
| 250 | Ga0105242_10021791 | 3300009176 | Bacteria | 5035 |
| 251 | Ga0105242_10113114 | 3300009176 | Bacteria | 2318 |
| 252 | Ga0105248_10206868 | 3300009177 | Bacteria | 2211 |
| 253 | Ga0105237_10000560 | 3300009545 | Bacteria | 52008 |
| 254 | Ga0105237_10004790 | 3300009545 | Bacteria | 15552 |
| 255 | Ga0105237_10044948 | 3300009545 | Bacteria | 4447 |
| 256 | Ga0105237_10187773 | 3300009545 | Bacteria | 2067 |
| 257 | Ga0105237_10223109 | 3300009545 | Bacteria | 1885 |
| 258 | Ga0105238_10000607 | 3300009551 | Bacteria | 37628 |
| 259 | Ga0105238_10010367 | 3300009551 | Bacteria | 9353 |
| 260 | Ga0105249_10020374 | 3300009553 | Bacteria | 5929 |
| 261 | Ga0105249_10034441 | 3300009553 | Bacteria | 4590 |
| 262 | Ga0123341_1000008 | 3300009765 | Bacteria | 134834 |
| 263 | Ga0123342_1005465 | 3300009766 | Bacteria | 18393 |
| 264 | Ga0105239_10000025 | 3300010375 | Bacteria | 254049 |
| 265 | Ga0105239_10000269 | 3300010375 | Bacteria | 76932 |
| 266 | Ga0105239_10019971 | 3300010375 | Bacteria | 7395 |
| 267 | Ga0105239_10022212 | 3300010375 | Bacteria | 6993 |
| 268 | Ga0105239_10153090 | 3300010375 | Bacteria | 2574 |
| 269 | Ga0105246_10003455 | 3300011119 | Bacteria | 9577 |
| 270 | Ga0105246_10015747 | 3300011119 | Bacteria | 4780 |
| 271 | Ga0157371_10129035 | 3300013102 | Bacteria | 1798 |
| 272 | Ga0157370_10050953 | 3300013104 | Bacteria | 3955 |
| 273 | Ga0157374_10007450 | 3300013296 | Bacteria | 9334 |
| 274 | Ga0157378_10276432 | 3300013297 | Bacteria | 1617 |
| 275 | Ga0163162_10014396 | 3300013306 | Bacteria | 7729 |
| 276 | Ga0163162_10047916 | 3300013306 | Bacteria | 4282 |
| 277 | Ga0163162_10250446 | 3300013306 | Bacteria | 1903 |
| 278 | Ga0157372_10006775 | 3300013307 | Bacteria | 12184 |
| 279 | Ga0157375_10004470 | 3300013308 | Bacteria | 12146 |
| 280 | Ga0157375_10008041 | 3300013308 | Bacteria | 9234 |
| 281 | Ga0157375_10009166 | 3300013308 | Bacteria | 8673 |
| 282 | Ga0157375_10030639 | 3300013308 | Bacteria | 5075 |
| 283 | Ga0157375_10038969 | 3300013308 | Bacteria | 4568 |
| 284 | Ga0157375_10260599 | 3300013308 | Bacteria | 1895 |
| 285 | Ga0163163_10000044 | 3300014325 | Bacteria | 135713 |
| 286 | Ga0163163_10000876 | 3300014325 | Bacteria | 25650 |
| 287 | Ga0163163_10016691 | 3300014325 | Bacteria | 6829 |
| 288 | Ga0163163_10037049 | 3300014325 | Bacteria | 4743 |
| 289 | Ga0163163_10192228 | 3300014325 | Bacteria | 2089 |
| 290 | Ga0157380_10066780 | 3300014326 | Bacteria | 2894 |
| 291 | Ga0157380_10131909 | 3300014326 | Bacteria | 2133 |
| 292 | Ga0182008_10035582 | 3300014497 | Bacteria | 2493 |
| 293 | Ga0157377_10036186 | 3300014745 | Bacteria | 2714 |
| 294 | Ga0157377_10045571 | 3300014745 | Bacteria | 2450 |
| 295 | Ga0157379_10000038 | 3300014968 | Bacteria | 81063 |
| 296 | Ga0157379_10007099 | 3300014968 | Bacteria | 9686 |
| 297 | Ga0157379_10008491 | 3300014968 | Bacteria | 8935 |
| 298 | Ga0157379_10012604 | 3300014968 | Bacteria | 7384 |
| 299 | Ga0157379_10022185 | 3300014968 | Bacteria | 5626 |
| 300 | Ga0157379_10031631 | 3300014968 | Bacteria | 4715 |
| 301 | Ga0157379_10037973 | 3300014968 | Bacteria | 4296 |
| 302 | Ga0157379_10142457 | 3300014968 | Bacteria | 2161 |
| 303 | Ga0157376_10013434 | 3300014969 | Bacteria | 6109 |
| 304 | Ga0157376_10018397 | 3300014969 | Bacteria | 5356 |
| 305 | Ga0157376_10165202 | 3300014969 | Bacteria | 2010 |
| 306 | Ga0182006_1030966 | 3300015261 | Bacteria | 2159 |
| 307 | Ga0182007_10001637 | 3300015262 | Bacteria | 11859 |
| 308 | Ga0163161_10055223 | 3300017792 | Bacteria | 2883 |
| 309 | Ga0213875_10020700 | 3300021388 | Bacteria | 3156 |
| 310 | Ga0209436_100009 | 3300025208 | Bacteria | 143684 |
| 311 | Ga0207425_1004443 | 3300025245 | Bacteria | 4202 |
| 312 | Ga0209129_1000041 | 3300025258 | Bacteria | 307590 |
| 313 | Ga0209129_1000333 | 3300025258 | Bacteria | 40851 |
| 314 | Ga0209673_1000013 | 3300025273 | Bacteria | 571633 |
| 315 | Ga0209673_1007377 | 3300025273 | Bacteria | 5087 |
| 316 | Ga0209130_1000022 | 3300025284 | Bacteria | 361244 |
| 317 | Ga0209025_1019064 | 3300025294 | Bacteria | 3838 |
| 318 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 319 | Ga0209564_1000264 | 3300025295 | Bacteria | 111404 |
| 320 | Ga0209564_1001353 | 3300025295 | Bacteria | 25873 |
| 321 | Ga0209564_1002363 | 3300025295 | Bacteria | 15182 |
| 322 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 323 | Ga0209758_1000057 | 3300025297 | Bacteria | 333111 |
| 324 | Ga0209758_1007042 | 3300025297 | Bacteria | 7806 |
| 325 | Ga0209050_1000149 | 3300025298 | Bacteria | 163252 |
| 326 | Ga0209256_1005145 | 3300025299 | Bacteria | 7728 |
| 327 | Ga0209256_1006523 | 3300025299 | Bacteria | 6131 |
| 328 | Ga0209256_1008410 | 3300025299 | Bacteria | 4793 |
| 329 | Ga0209256_1018531 | 3300025299 | Bacteria | 2256 |
| 330 | Ga0207426_1000042 | 3300025302 | Bacteria | 433289 |
| 331 | Ga0207426_1000537 | 3300025302 | Bacteria | 54262 |
| 332 | Ga0209051_1000489 | 3300025303 | Bacteria | 51077 |
| 333 | Ga0209051_1007353 | 3300025303 | Bacteria | 6039 |
| 334 | Ga0207656_10000244 | 3300025321 | Bacteria | 18974 |
| 335 | Ga0207696_1000276 | 3300025711 | Bacteria | 60824 |
| 336 | Ga0207692_10015057 | 3300025898 | Bacteria | 3394 |
| 337 | Ga0207642_10013793 | 3300025899 | Bacteria | 2960 |
| 338 | Ga0207642_10030691 | 3300025899 | Bacteria | 2242 |
| 339 | Ga0207710_10000593 | 3300025900 | Bacteria | 21302 |
| 340 | Ga0207710_10011463 | 3300025900 | Bacteria | 3732 |
| 341 | Ga0207688_10001626 | 3300025901 | Bacteria | 11858 |
| 342 | Ga0207688_10006136 | 3300025901 | Bacteria | 6541 |
| 343 | Ga0207680_10005598 | 3300025903 | Bacteria | 6009 |
| 344 | Ga0207647_10058303 | 3300025904 | Bacteria | 2365 |
| 345 | Ga0207685_10001766 | 3300025905 | Bacteria | 4704 |
| 346 | Ga0207645_10003682 | 3300025907 | Bacteria | 11561 |
| 347 | Ga0207645_10014754 | 3300025907 | Bacteria | 5218 |
| 348 | Ga0207645_10040690 | 3300025907 | Bacteria | 2976 |
| 349 | Ga0207643_10001184 | 3300025908 | Bacteria | 15445 |
| 350 | Ga0207643_10024032 | 3300025908 | Bacteria | 3363 |
| 351 | Ga0207705_10024663 | 3300025909 | Bacteria | 4291 |
| 352 | Ga0207684_10005060 | 3300025910 | Bacteria | 12285 |
| 353 | Ga0207684_10061918 | 3300025910 | Bacteria | 3177 |
| 354 | Ga0207684_10138169 | 3300025910 | Bacteria | 2093 |
| 355 | Ga0207707_10001863 | 3300025912 | Bacteria | 19260 |
| 356 | Ga0207707_10141546 | 3300025912 | Bacteria | 2103 |
| 357 | Ga0207695_10000347 | 3300025913 | Bacteria | 107013 |
| 358 | Ga0207695_10004517 | 3300025913 | Bacteria | 18930 |
| 359 | Ga0207695_10016693 | 3300025913 | Bacteria | 8579 |
| 360 | Ga0207695_10018105 | 3300025913 | Bacteria | 8153 |
| 361 | Ga0207695_10020509 | 3300025913 | Bacteria | 7568 |
| 362 | Ga0207695_10039933 | 3300025913 | Bacteria | 5039 |
| 363 | Ga0207695_10061366 | 3300025913 | Bacteria | 3885 |
| 364 | Ga0207695_10158749 | 3300025913 | Bacteria | 2194 |
| 365 | Ga0207671_10000952 | 3300025914 | Bacteria | 35982 |
| 366 | Ga0207671_10024013 | 3300025914 | Bacteria | 4589 |
| 367 | Ga0207671_10138007 | 3300025914 | Bacteria | 1876 |
| 368 | Ga0207693_10052265 | 3300025915 | Bacteria | 3205 |
| 369 | Ga0207663_10017023 | 3300025916 | Bacteria | 4042 |
| 370 | Ga0207660_10025425 | 3300025917 | Bacteria | 4018 |
| 371 | Ga0207660_10025885 | 3300025917 | Bacteria | 3988 |
| 372 | Ga0207657_10002307 | 3300025919 | Bacteria | 20684 |
| 373 | Ga0207657_10058970 | 3300025919 | Bacteria | 3301 |
| 374 | Ga0207652_10019486 | 3300025921 | Bacteria | 5580 |
| 375 | Ga0207652_10055163 | 3300025921 | Bacteria | 3417 |
| 376 | Ga0207652_10063785 | 3300025921 | Bacteria | 3187 |
| 377 | Ga0207681_10024501 | 3300025923 | Bacteria | 3874 |
| 378 | Ga0207694_10000606 | 3300025924 | Bacteria | 32510 |
| 379 | Ga0207694_10021736 | 3300025924 | Bacteria | 4862 |
| 380 | Ga0207694_10040384 | 3300025924 | Bacteria | 3591 |
| 381 | Ga0207650_10135964 | 3300025925 | Bacteria | 1928 |
| 382 | Ga0207659_10116440 | 3300025926 | Bacteria | 2040 |
| 383 | Ga0207687_10005646 | 3300025927 | Bacteria | 8276 |
| 384 | Ga0207687_10011372 | 3300025927 | Bacteria | 5817 |
| 385 | Ga0207700_10039730 | 3300025928 | Bacteria | 3427 |
| 386 | Ga0207700_10146165 | 3300025928 | Bacteria | 1949 |
| 387 | Ga0207664_10061884 | 3300025929 | Bacteria | 2988 |
| 388 | Ga0207644_10002169 | 3300025931 | Bacteria | 12734 |
| 389 | Ga0207644_10078058 | 3300025931 | Bacteria | 2440 |
| 390 | Ga0207706_10003325 | 3300025933 | Bacteria | 15389 |
| 391 | Ga0207686_10082739 | 3300025934 | Bacteria | 2099 |
| 392 | Ga0207709_10003330 | 3300025935 | Bacteria | 9625 |
| 393 | Ga0207709_10009011 | 3300025935 | Bacteria | 5501 |
| 394 | Ga0207709_10032358 | 3300025935 | Bacteria | 3062 |
| 395 | Ga0207709_10076289 | 3300025935 | Bacteria | 2145 |
| 396 | Ga0207670_10035363 | 3300025936 | Bacteria | 3238 |
| 397 | Ga0207669_10021936 | 3300025937 | Bacteria | 3382 |
| 398 | Ga0207669_10082467 | 3300025937 | Bacteria | 2064 |
| 399 | Ga0207704_10022274 | 3300025938 | Bacteria | 3391 |
| 400 | Ga0207704_10057054 | 3300025938 | Bacteria | 2396 |
| 401 | Ga0207691_10000028 | 3300025940 | Bacteria | 121090 |
| 402 | Ga0207691_10002487 | 3300025940 | Bacteria | 18018 |
| 403 | Ga0207691_10008483 | 3300025940 | Bacteria | 9869 |
| 404 | Ga0207691_10010326 | 3300025940 | Bacteria | 8956 |
| 405 | Ga0207691_10034149 | 3300025940 | Bacteria | 4732 |
| 406 | Ga0207691_10102659 | 3300025940 | Bacteria | 2550 |
| 407 | Ga0207691_10158855 | 3300025940 | Bacteria | 1984 |
| 408 | Ga0207711_10031272 | 3300025941 | Bacteria | 4493 |
| 409 | Ga0207711_10087780 | 3300025941 | Bacteria | 2729 |
| 410 | Ga0207711_10110637 | 3300025941 | Bacteria | 2443 |
| 411 | Ga0207689_10014440 | 3300025942 | Bacteria | 6718 |
| 412 | Ga0207689_10028770 | 3300025942 | Bacteria | 4647 |
| 413 | Ga0207689_10033405 | 3300025942 | Bacteria | 4276 |
| 414 | Ga0207661_10039718 | 3300025944 | Bacteria | 3695 |
| 415 | Ga0207661_10228557 | 3300025944 | Bacteria | 1647 |
| 416 | Ga0207667_10000175 | 3300025949 | Bacteria | 93793 |
| 417 | Ga0207667_10003104 | 3300025949 | Bacteria | 20565 |
| 418 | Ga0207667_10008252 | 3300025949 | Bacteria | 12395 |
| 419 | Ga0207667_10034111 | 3300025949 | Bacteria | 5468 |
| 420 | Ga0207667_10034807 | 3300025949 | Bacteria | 5406 |
| 421 | Ga0207651_10218098 | 3300025960 | Bacteria | 1540 |
| 422 | Ga0207712_10108531 | 3300025961 | Bacteria | 2077 |
| 423 | Ga0207712_10137628 | 3300025961 | Bacteria | 1870 |
| 424 | Ga0207640_10000077 | 3300025981 | Bacteria | 76155 |
| 425 | Ga0207640_10165641 | 3300025981 | Bacteria | 1641 |
| 426 | Ga0207658_10000800 | 3300025986 | Bacteria | 26430 |
| 427 | Ga0207658_10117507 | 3300025986 | Bacteria | 2114 |
| 428 | Ga0207677_10000929 | 3300026023 | Bacteria | 16369 |
| 429 | Ga0207703_10000957 | 3300026035 | Bacteria | 27938 |
| 430 | Ga0207703_10001166 | 3300026035 | Bacteria | 24812 |
| 431 | Ga0207703_10004717 | 3300026035 | Bacteria | 11123 |
| 432 | Ga0207703_10033934 | 3300026035 | Bacteria | 4047 |
| 433 | Ga0207703_10064578 | 3300026035 | Bacteria | 3005 |
| 434 | Ga0207639_10018300 | 3300026041 | Bacteria | 4978 |
| 435 | Ga0207678_10024110 | 3300026067 | Bacteria | 5316 |
| 436 | Ga0207708_10002529 | 3300026075 | Bacteria | 13451 |
| 437 | Ga0207708_10049932 | 3300026075 | Bacteria | 3185 |
| 438 | Ga0207708_10126415 | 3300026075 | Bacteria | 1996 |
| 439 | Ga0207702_10010110 | 3300026078 | Bacteria | 7906 |
| 440 | Ga0207702_10048313 | 3300026078 | Bacteria | 3588 |
| 441 | Ga0207702_10278556 | 3300026078 | Bacteria | 1580 |
| 442 | Ga0207641_10001175 | 3300026088 | Bacteria | 26305 |
| 443 | Ga0207641_10007318 | 3300026088 | Bacteria | 9195 |
| 444 | Ga0207641_10013250 | 3300026088 | Bacteria | 6761 |
| 445 | Ga0207641_10072629 | 3300026088 | Bacteria | 2963 |
| 446 | Ga0207641_10122262 | 3300026088 | Bacteria | 2325 |
| 447 | Ga0207641_10125292 | 3300026088 | Bacteria | 2299 |
| 448 | Ga0207648_10000550 | 3300026089 | Bacteria | 42009 |
| 449 | Ga0207648_10028619 | 3300026089 | Bacteria | 4939 |
| 450 | Ga0207648_10052060 | 3300026089 | Bacteria | 3579 |
| 451 | Ga0207648_10061086 | 3300026089 | Bacteria | 3286 |
| 452 | Ga0207648_10078057 | 3300026089 | Bacteria | 2888 |
| 453 | Ga0207676_10004867 | 3300026095 | Bacteria | 9508 |
| 454 | Ga0207676_10031838 | 3300026095 | Bacteria | 3968 |
| 455 | Ga0207676_10086857 | 3300026095 | Bacteria | 2556 |
| 456 | Ga0207674_10018743 | 3300026116 | Bacteria | 7512 |
| 457 | Ga0207674_10032831 | 3300026116 | Bacteria | 5441 |
| 458 | Ga0207674_10115649 | 3300026116 | Bacteria | 2654 |
| 459 | Ga0207675_100006048 | 3300026118 | Bacteria | 11514 |
| 460 | Ga0207675_100007010 | 3300026118 | Bacteria | 10656 |
| 461 | Ga0207675_100012751 | 3300026118 | Bacteria | 7853 |
| 462 | Ga0207675_100017246 | 3300026118 | Bacteria | 6742 |
| 463 | Ga0207675_100030556 | 3300026118 | Bacteria | 5019 |
| 464 | Ga0207675_100209559 | 3300026118 | Bacteria | 1874 |
| 465 | Ga0207675_100262402 | 3300026118 | Bacteria | 1674 |
| 466 | Ga0207683_10169056 | 3300026121 | Bacteria | 1979 |
| 467 | Ga0207698_10019128 | 3300026142 | Bacteria | 4681 |
| 468 | Ga0207698_10023374 | 3300026142 | Bacteria | 4317 |
| 469 | Ga0207698_10080992 | 3300026142 | Bacteria | 2618 |
| 470 | Ga0207698_10153374 | 3300026142 | Bacteria | 2003 |
| 471 | Ga0209813_10000255 | 3300027866 | Bacteria | 15495 |
| 472 | Ga0209813_10004191 | 3300027866 | Bacteria | 3427 |
| 473 | Ga0207428_10097293 | 3300027907 | Bacteria | 2278 |
| 474 | Ga0268266_10000596 | 3300028379 | Bacteria | 49462 |
| 475 | Ga0268266_10001984 | 3300028379 | Bacteria | 22953 |
| 476 | Ga0268266_10003195 | 3300028379 | Bacteria | 16585 |
| 477 | Ga0268266_10003489 | 3300028379 | Bacteria | 15655 |
| 478 | Ga0268266_10009083 | 3300028379 | Bacteria | 8777 |
| 479 | Ga0268266_10024997 | 3300028379 | Bacteria | 5084 |
| 480 | Ga0268266_10025515 | 3300028379 | Bacteria | 5027 |
| 481 | Ga0268266_10073745 | 3300028379 | Bacteria | 2962 |
| 482 | Ga0268265_10048388 | 3300028380 | Bacteria | 3192 |
| 483 | Ga0268264_10000287 | 3300028381 | Bacteria | 85050 |
| 484 | Ga0268264_10000420 | 3300028381 | Bacteria | 59901 |
| 485 | Ga0268264_10028551 | 3300028381 | Bacteria | 4564 |
| 486 | Ga0268264_10064052 | 3300028381 | Bacteria | 3093 |
| 487 | Ga0268264_10144640 | 3300028381 | Bacteria | 2124 |
| 488 | Ga0265337_1006149 | 3300028556 | Bacteria | 4668 |
| 489 | Ga0265326_10010375 | 3300028558 | Bacteria | 2762 |
| 490 | Ga0265334_10000014 | 3300028573 | Bacteria | 154345 |
| 491 | Ga0307517_10004912 | 3300028786 | Bacteria | 20370 |
| 492 | Ga0307517_10065457 | 3300028786 | Bacteria | 3362 |
| 493 | Ga0307517_10093494 | 3300028786 | Bacteria | 2437 |
| 494 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 495 | Ga0307515_10000186 | 3300028794 | Bacteria | 153531 |
| 496 | Ga0307515_10050257 | 3300028794 | Bacteria | 6250 |
| 497 | Ga0307515_10058448 | 3300028794 | Bacteria | 5553 |
| 498 | Ga0307515_10065339 | 3300028794 | Bacteria | 5066 |
| 499 | Ga0307515_10097341 | 3300028794 | Bacteria | 3597 |
| 500 | Ga0307515_10111006 | 3300028794 | Bacteria | 3204 |
| 501 | Ga0307515_10176786 | 3300028794 | Bacteria | 2102 |
| 502 | Ga0265338_10000377 | 3300028800 | Bacteria | 79902 |
| 503 | Ga0265338_10004531 | 3300028800 | Bacteria | 18718 |
| 504 | Ga0265338_10006711 | 3300028800 | Bacteria | 14542 |
| 505 | Ga0265338_10047374 | 3300028800 | Bacteria | 3926 |
| 506 | Ga0307511_10000037 | 3300030521 | Bacteria | 103008 |
| 507 | Ga0307511_10054297 | 3300030521 | Bacteria | 3161 |
| 508 | Ga0307512_10061925 | 3300030522 | Bacteria | 2876 |
| 509 | Ga0316182_1299158 | 3300030745 | Bacteria | 7088 |
| 510 | Ga0265760_10016520 | 3300031090 | Bacteria | 2118 |
| 511 | Ga0265328_10038116 | 3300031239 | Bacteria | 1774 |
| 512 | Ga0265320_10006123 | 3300031240 | Bacteria | 7620 |
| 513 | Ga0265325_10000155 | 3300031241 | Bacteria | 48142 |
| 514 | Ga0265340_10000121 | 3300031247 | Bacteria | 38466 |
| 515 | Ga0265339_10048068 | 3300031249 | Bacteria | 2340 |
| 516 | Ga0265331_10004523 | 3300031250 | Bacteria | 8675 |
| 517 | Ga0265331_10004710 | 3300031250 | Bacteria | 8443 |
| 518 | Ga0265327_10000487 | 3300031251 | Bacteria | 69944 |
| 519 | Ga0265316_10004680 | 3300031344 | Bacteria | 13553 |
| 520 | Ga0307513_10002991 | 3300031456 | Bacteria | 23045 |
| 521 | Ga0307513_10015253 | 3300031456 | Bacteria | 9325 |
| 522 | Ga0307513_10016687 | 3300031456 | Bacteria | 8841 |
| 523 | Ga0307513_10053100 | 3300031456 | Bacteria | 4359 |
| 524 | Ga0307513_10083111 | 3300031456 | Bacteria | 3294 |
| 525 | Ga0307513_10092686 | 3300031456 | Bacteria | 3074 |
| 526 | Ga0307513_10234044 | 3300031456 | Bacteria | 1647 |
| 527 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 528 | Ga0307509_10000044 | 3300031507 | Bacteria | 176718 |
| 529 | Ga0307509_10003432 | 3300031507 | Bacteria | 24057 |
| 530 | Ga0307509_10004147 | 3300031507 | Bacteria | 21173 |
| 531 | Ga0307509_10004183 | 3300031507 | Bacteria | 21075 |
| 532 | Ga0307509_10021431 | 3300031507 | Bacteria | 7305 |
| 533 | Ga0307509_10061981 | 3300031507 | Bacteria | 3945 |
| 534 | Ga0307509_10095132 | 3300031507 | Bacteria | 3035 |
| 535 | Ga0307408_100000006 | 3300031548 | Bacteria | 472824 |
| 536 | Ga0265313_10001336 | 3300031595 | Bacteria | 23225 |
| 537 | Ga0307508_10005121 | 3300031616 | Bacteria | 12567 |
| 538 | Ga0307508_10011794 | 3300031616 | Bacteria | 7987 |
| 539 | Ga0307508_10012983 | 3300031616 | Bacteria | 7616 |
| 540 | Ga0307508_10031568 | 3300031616 | Bacteria | 4788 |
| 541 | Ga0307514_10020475 | 3300031649 | Bacteria | 5398 |
| 542 | Ga0307514_10040937 | 3300031649 | Bacteria | 3650 |
| 543 | Ga0265314_10012680 | 3300031711 | Bacteria | 6858 |
| 544 | Ga0265314_10025791 | 3300031711 | Bacteria | 4427 |
| 545 | Ga0265342_10016314 | 3300031712 | Bacteria | 4859 |
| 546 | Ga0265342_10018466 | 3300031712 | Bacteria | 4517 |
| 547 | Ga0316576_10006578 | 3300031727 | Bacteria | 7252 |
| 548 | Ga0307516_10005815 | 3300031730 | Bacteria | 14613 |
| 549 | Ga0307516_10016202 | 3300031730 | Bacteria | 7808 |
| 550 | Ga0307516_10017271 | 3300031730 | Bacteria | 7528 |
| 551 | Ga0307516_10018714 | 3300031730 | Bacteria | 7193 |
| 552 | Ga0307516_10095107 | 3300031730 | Bacteria | 2803 |
| 553 | Ga0307516_10157445 | 3300031730 | Bacteria | 2025 |
| 554 | Ga0307413_10003854 | 3300031824 | Bacteria | 6405 |
| 555 | Ga0307409_100016212 | 3300031995 | Bacteria | 4922 |
| 556 | Ga0307409_100028358 | 3300031995 | Bacteria | 3987 |
| 557 | Ga0307409_100097567 | 3300031995 | Bacteria | 2428 |
| 558 | Ga0307416_100013529 | 3300032002 | Bacteria | 5551 |
| 559 | Ga0307510_10000016 | 3300033180 | Bacteria | 206932 |
| 560 | Ga0307510_10005766 | 3300033180 | Bacteria | 14762 |
| 561 | Ga0307510_10006502 | 3300033180 | Bacteria | 13936 |
| 562 | Ga0307510_10008022 | 3300033180 | Bacteria | 12565 |
| 563 | Ga0307510_10067143 | 3300033180 | Bacteria | 3613 |
| 564 | Ga0373936_0005394 | 3300035113 | Bacteria | 4818 |
| 565 | Ga0373936_0034391 | 3300035113 | Bacteria | 2013 |
| 566 | Ga0373945_0013158 | 3300035116 | Bacteria | 2758 |
| 567 | Ga0373946_0021708 | 3300035171 | Bacteria | 2492 |
| 568 | Ga0373931_0007299 | 3300035691 | Bacteria | 5200 |
| 569 | Ga0373931_0010537 | 3300035691 | Bacteria | 4444 |
| 570 | Ga0373927_0063530 | 3300035695 | Bacteria | 2388 |
| 571 | Ga0373933_0069196 | 3300035724 | Bacteria | 2145 |
| 572 | Ga0373937_0033714 | 3300036401 | Bacteria | 4652 |
| 573 | Ga0373937_0068466 | 3300036401 | Bacteria | 3273 |
| 574 | Ga0373937_0148784 | 3300036401 | Bacteria | 2193 |
| 575 | Ga0395899_0047305 | 3300037312 | Bacteria | 3203 |
| 576 | Ga0395899_0058632 | 3300037312 | Bacteria | 2839 |
| 577 | Ga0395900_0006806 | 3300037418 | Bacteria | 11855 |
| 578 | Ga0395900_0014634 | 3300037418 | Bacteria | 8002 |
| 579 | Ga0395900_0151595 | 3300037418 | Bacteria | 2368 |
| 580 | Ga0395898_0004666 | 3300037466 | Bacteria | 14932 |
| 581 | Ga0395898_0024464 | 3300037466 | Bacteria | 6091 |
| 582 | Ga0395898_0150511 | 3300037466 | Bacteria | 2227 |
| 583 | Ga0395905_0102329 | 3300037471 | Bacteria | 2689 |
| 584 | Ga0436364_0457524 | 3300037853 | Bacteria | 2139 |
| 585 | Ga0436364_0748817 | 3300037853 | Bacteria | 3432 |
| 586 | Ga0395901_0020172 | 3300038443 | Bacteria | 6822 |
| 587 | Ga0395901_0032881 | 3300038443 | Bacteria | 5351 |
| 588 | Ga0395901_0245307 | 3300038443 | Bacteria | 1867 |
| 589 | Ga0436365_0002580 | 3300039437 | Bacteria | 4922 |
| 590 | Ga0436365_0327786 | 3300039437 | Bacteria | 9722 |
| 591 | Ga0436365_0592429 | 3300039437 | Bacteria | 2289 |
| 592 | Ga0436365_0898810 | 3300039437 | Bacteria | 2969 |
| 593 | Ga0436365_1619143 | 3300039437 | Bacteria | 6286 |
| 594 | Ga0436360_0112640 | 3300039438 | Bacteria | 1912 |
| 595 | Ga0436360_0738491 | 3300039438 | Bacteria | 5353 |
| 596 | Ga0436360_1026710 | 3300039438 | Bacteria | 2090 |
| 597 | Ga0436360_1129771 | 3300039438 | Bacteria | 5578 |
| 598 | Ga0436361_0395058 | 3300039447 | Bacteria | 1519 |
| 599 | Ga0436361_0611431 | 3300039447 | Bacteria | 2208 |
| 600 | Ga0436361_0899139 | 3300039447 | Bacteria | 2367 |
| 601 | Ga0436363_0481565 | 3300039450 | Bacteria | 3760 |
| 602 | Ga0436363_1106384 | 3300039450 | Bacteria | 3922 |
| 603 | Ga0436362_0757178 | 3300039453 | Bacteria | 1888 |
| 604 | Ga0436362_1106345 | 3300039453 | Bacteria | 2044 |
| 605 | Ga0451791_0356334 | 3300041451 | Bacteria | 2488 |
| 606 | Ga0451798_0226398 | 3300041458 | Bacteria | 3712 |
| 607 | Ga0451800_0869303 | 3300041459 | Bacteria | 3532 |
| 608 | Ga0451839_0104998 | 3300041496 | Bacteria | 2277 |
| 609 | Ga0451847_0654707 | 3300041503 | Bacteria | 5399 |
| 610 | Ga0451851_0138487 | 3300041507 | Bacteria | 1843 |
| 611 | Ga0451855_0184220 | 3300041511 | Bacteria | 3498 |
| 612 | Ga0439462_0017763 | 3300042015 | Bacteria | 1843 |
| 613 | Ga0451577_0133997 | 3300042876 | Bacteria | 2224 |
| 614 | Ga0466969_0002439 | 3300044656 | Bacteria | 9913 |
| 615 | Ga0466965_0021990 | 3300044683 | Bacteria | 3074 |
| 616 | Ga0466965_0026025 | 3300044683 | Bacteria | 2835 |
| 617 | Ga0466965_0037781 | 3300044683 | Bacteria | 2371 |
| 618 | Ga0466966_0006687 | 3300044684 | Bacteria | 7637 |
| 619 | Ga0466966_0029066 | 3300044684 | Bacteria | 3598 |
| 620 | Ga0466961_0021280 | 3300044693 | Bacteria | 4176 |
| 621 | Ga0466963_0115462 | 3300044694 | Bacteria | 1845 |
| 622 | Ga0466971_0073324 | 3300044719 | Bacteria | 1556 |
| 623 | Ga0466970_0018274 | 3300044765 | Bacteria | 3627 |
| 624 | Ga0466970_0046920 | 3300044765 | Bacteria | 2301 |
| 625 | Ga0466970_0052692 | 3300044765 | Bacteria | 2172 |
| 626 | Ga0466957_0019120 | 3300044842 | Bacteria | 4028 |
| 627 | Ga0466960_0014516 | 3300044901 | Bacteria | 3374 |
| 628 | Ga0466960_0023325 | 3300044901 | Bacteria | 2777 |
| 629 | Ga0466960_0056478 | 3300044901 | Bacteria | 1911 |
| 630 | Ga0466959_0061889 | 3300045049 | Bacteria | 2721 |
| 631 | Ga0451576_0020730 | 3300045051 | Bacteria | 7155 |
| 632 | Ga0466958_0014007 | 3300045836 | Bacteria | 4574 |
| 633 | Ga0466967_0023032 | 3300045976 | Bacteria | 5096 |
| 634 | Ga0466967_0043364 | 3300045976 | Bacteria | 3894 |
| 635 | Ga0466967_0062820 | 3300045976 | Bacteria | 3298 |
| 636 | Ga0466967_0073790 | 3300045976 | Bacteria | 3062 |
| 637 | Ga0495627_008967 | 3300046453 | Bacteria | 3699 |
| 638 | Ga0495592_0000203 | 3300046454 | Bacteria | 50733 |
| 639 | Ga0495592_0073735 | 3300046454 | Bacteria | 2481 |
| 640 | Ga0495603_0051288 | 3300046455 | Bacteria | 2452 |
| 641 | Ga0495603_0098352 | 3300046455 | Bacteria | 1709 |
| 642 | Ga0495590_0031669 | 3300046457 | Bacteria | 1851 |
| 643 | Ga0495638_0004766 | 3300046460 | Bacteria | 10231 |
| 644 | Ga0495638_0029580 | 3300046460 | Bacteria | 3532 |
| 645 | Ga0495638_0036493 | 3300046460 | Bacteria | 3132 |
| 646 | Ga0495653_0004980 | 3300046463 | Bacteria | 10780 |
| 647 | Ga0495650_0010731 | 3300046471 | Bacteria | 5090 |
| 648 | Ga0495650_0012066 | 3300046471 | Bacteria | 4674 |
| 649 | Ga0495650_0025838 | 3300046471 | Bacteria | 2743 |
| 650 | Ga0495582_0038368 | 3300046473 | Bacteria | 2636 |
| 651 | Ga0495605_0015688 | 3300046474 | Bacteria | 4117 |
| 652 | Ga0495639_0001912 | 3300046475 | Bacteria | 9238 |
| 653 | Ga0495662_0051399 | 3300046476 | Bacteria | 1989 |
| 654 | Ga0495664_0105373 | 3300046477 | Bacteria | 1700 |
| 655 | Ga0495584_0005419 | 3300046491 | Bacteria | 6757 |
| 656 | Ga0495585_0088494 | 3300046492 | Bacteria | 1670 |
| 657 | Ga0495607_0072375 | 3300046501 | Bacteria | 1919 |
| 658 | Ga0495583_0004172 | 3300046506 | Bacteria | 10531 |
| 659 | Ga0495583_0069357 | 3300046506 | Bacteria | 1553 |
| 660 | Ga0495606_0000253 | 3300046507 | Bacteria | 94485 |
| 661 | Ga0495606_0000895 | 3300046507 | Bacteria | 44393 |
| 662 | Ga0495606_0006342 | 3300046507 | Bacteria | 10942 |
| 663 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 664 | Ga0495608_0145297 | 3300046511 | Bacteria | 1513 |
| 665 | Ga0495616_0001686 | 3300046513 | Bacteria | 15063 |
| 666 | Ga0495616_0014165 | 3300046513 | Bacteria | 4474 |
| 667 | Ga0495620_0054441 | 3300046515 | Bacteria | 1690 |
| 668 | Ga0495630_0072872 | 3300046517 | Bacteria | 2586 |
| 669 | Ga0495630_0107710 | 3300046517 | Bacteria | 2111 |
| 670 | Ga0495632_0002177 | 3300046519 | Bacteria | 15118 |
| 671 | Ga0495632_0002541 | 3300046519 | Bacteria | 13831 |
| 672 | Ga0495632_0026675 | 3300046519 | Bacteria | 3038 |
| 673 | Ga0495643_0016469 | 3300046522 | Bacteria | 4341 |
| 674 | Ga0495643_0033054 | 3300046522 | Bacteria | 2865 |
| 675 | Ga0495648_0033094 | 3300046524 | Bacteria | 3382 |
| 676 | Ga0495665_0056714 | 3300046531 | Bacteria | 2068 |
| 677 | Ga0495597_0014009 | 3300046542 | Bacteria | 3829 |
| 678 | Ga0495622_0000566 | 3300046557 | Bacteria | 22206 |
| 679 | Ga0495622_0017920 | 3300046557 | Bacteria | 3298 |
| 680 | Ga0495633_0009942 | 3300046558 | Bacteria | 5223 |
| 681 | Ga0495633_0054782 | 3300046558 | Bacteria | 1876 |
| 682 | Ga0495656_0000232 | 3300046615 | Bacteria | 19679 |
| 683 | Ga0495656_0045982 | 3300046615 | Bacteria | 1845 |
| 684 | Ga0495668_0042200 | 3300046616 | Bacteria | 2540 |
| 685 | Ga0495625_0005672 | 3300046660 | Bacteria | 11308 |
| 686 | Ga0495625_0015246 | 3300046660 | Bacteria | 6095 |
| 687 | Ga0495625_0015952 | 3300046660 | Bacteria | 5926 |
| 688 | Ga0495625_0030593 | 3300046660 | Bacteria | 4015 |
| 689 | Ga0495625_0109271 | 3300046660 | Bacteria | 1892 |
| 690 | Ga0495635_0119992 | 3300046663 | Bacteria | 1794 |
| 691 | Ga0495588_0001503 | 3300046674 | Bacteria | 9988 |
| 692 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 693 | Ga0495671_0019063 | 3300046692 | Bacteria | 3632 |
| 694 | Ga0495649_0009300 | 3300046694 | Bacteria | 5849 |
| 695 | Ga0495649_0032383 | 3300046694 | Bacteria | 2879 |
| 696 | Ga0495649_0070413 | 3300046694 | Bacteria | 1875 |
| 697 | Ga0495649_0106081 | 3300046694 | Bacteria | 1491 |
| 698 | Ga0495660_0019406 | 3300046810 | Bacteria | 3903 |
| 699 | Ga0495674_0011969 | 3300047319 | Bacteria | 8182 |
| 700 | Ga0495672_0001753 | 3300047320 | Bacteria | 20929 |
| 701 | Ga0495676_0089584 | 3300047321 | Bacteria | 2305 |
| 702 | Ga0495680_0143410 | 3300047322 | Bacteria | 1746 |
| 703 | Ga0495680_0152583 | 3300047322 | Bacteria | 1683 |
| 704 | Ga0495683_0045896 | 3300047323 | Bacteria | 2194 |
| 705 | Ga0495687_001076 | 3300047443 | Bacteria | 26881 |
| 706 | Ga0495687_006562 | 3300047443 | Bacteria | 7098 |
| 707 | Ga0495687_024614 | 3300047443 | Bacteria | 2858 |
| 708 | Ga0495675_0000094 | 3300047444 | Bacteria | 63338 |
| 709 | Ga0495684_0056481 | 3300047471 | Bacteria | 2993 |
| 710 | Ga0495686_0000923 | 3300047472 | Bacteria | 36619 |
| 711 | Ga0496100_0001473 | 3300048903 | Bacteria | 11524 |
| 712 | Ga0496101_0002555 | 3300048904 | Bacteria | 11168 |
| 713 | Ga0496101_0012522 | 3300048904 | Bacteria | 5661 |
| 714 | Ga0496101_0018822 | 3300048904 | Bacteria | 4703 |
| 715 | Ga0496101_0024641 | 3300048904 | Bacteria | 4166 |
| 716 | Ga0496101_0060520 | 3300048904 | Bacteria | 2748 |
| 717 | Ga0496102_0002386 | 3300048905 | Bacteria | 16031 |
| 718 | Ga0496102_0005870 | 3300048905 | Bacteria | 10453 |
| 719 | Ga0496102_0040624 | 3300048905 | Bacteria | 4208 |
| 720 | Ga0496102_0042726 | 3300048905 | Bacteria | 4109 |
| 721 | Ga0496102_0044793 | 3300048905 | Bacteria | 4016 |
| 722 | Ga0496102_0104688 | 3300048905 | Bacteria | 2632 |
| 723 | Ga0496104_0010103 | 3300048907 | Bacteria | 8428 |
| 724 | Ga0496104_0016340 | 3300048907 | Bacteria | 6740 |
| 725 | Ga0496104_0039296 | 3300048907 | Bacteria | 4430 |
| 726 | Ga0496104_0048594 | 3300048907 | Bacteria | 3999 |
| 727 | Ga0496104_0052297 | 3300048907 | Bacteria | 3857 |
| 728 | Ga0496104_0098459 | 3300048907 | Bacteria | 2799 |
| 729 | Ga0496104_0202856 | 3300048907 | Bacteria | 1895 |
| 730 | Ga0496105_0000649 | 3300048908 | Bacteria | 23327 |
| 731 | Ga0496105_0011401 | 3300048908 | Bacteria | 7021 |
| 732 | Ga0496105_0011580 | 3300048908 | Bacteria | 6975 |
| 733 | Ga0496105_0018169 | 3300048908 | Bacteria | 5646 |
| 734 | Ga0496105_0020997 | 3300048908 | Bacteria | 5281 |
| 735 | Ga0496105_0057220 | 3300048908 | Bacteria | 3220 |
| 736 | Ga0496105_0082879 | 3300048908 | Bacteria | 2649 |
| 737 | Ga0496105_0100044 | 3300048908 | Bacteria | 2394 |
| 738 | Ga0496107_0002401 | 3300048910 | Bacteria | 12126 |
| 739 | Ga0496107_0034810 | 3300048910 | Bacteria | 3609 |
| 740 | Ga0496107_0042839 | 3300048910 | Bacteria | 3252 |
| 741 | Ga0496107_0106667 | 3300048910 | Bacteria | 2058 |
| 742 | Ga0496108_0003961 | 3300048911 | Bacteria | 11896 |
| 743 | Ga0496108_0006730 | 3300048911 | Bacteria | 9308 |
| 744 | Ga0496108_0047157 | 3300048911 | Bacteria | 3602 |
| 745 | Ga0496108_0051740 | 3300048911 | Bacteria | 3441 |
| 746 | Ga0496108_0072384 | 3300048911 | Bacteria | 2909 |
| 747 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 748 | Ga0496109_0008248 | 3300048912 | Bacteria | 8846 |
| 749 | Ga0496109_0042602 | 3300048912 | Bacteria | 4112 |
| 750 | Ga0496109_0062929 | 3300048912 | Bacteria | 3393 |
| 751 | Ga0496109_0141433 | 3300048912 | Bacteria | 2250 |
| 752 | Ga0496110_0003748 | 3300048913 | Bacteria | 11706 |
| 753 | Ga0496110_0032013 | 3300048913 | Bacteria | 4539 |
| 754 | Ga0496110_0040232 | 3300048913 | Bacteria | 4074 |
| 755 | Ga0496110_0044209 | 3300048913 | Bacteria | 3890 |
| 756 | Ga0496110_0062681 | 3300048913 | Bacteria | 3284 |
| 757 | Ga0496110_0075894 | 3300048913 | Bacteria | 2987 |
| 758 | Ga0496110_0220366 | 3300048913 | Bacteria | 1725 |
| 759 | Ga0496110_0221404 | 3300048913 | Bacteria | 1721 |
| 760 | Ga0496111_0004320 | 3300048914 | Bacteria | 8962 |
| 761 | Ga0496111_0031555 | 3300048914 | Bacteria | 3775 |
| 762 | Ga0496111_0048660 | 3300048914 | Bacteria | 3054 |
| 763 | Ga0496111_0055314 | 3300048914 | Bacteria | 2870 |
| 764 | Ga0496112_0061691 | 3300048915 | Bacteria | 3697 |
| 765 | Ga0496113_0009214 | 3300048916 | Bacteria | 6474 |
| 766 | Ga0496113_0043947 | 3300048916 | Bacteria | 3308 |
| 767 | Ga0496114_0000691 | 3300048917 | Bacteria | 25121 |
| 768 | Ga0496114_0004625 | 3300048917 | Bacteria | 10691 |
| 769 | Ga0496114_0014043 | 3300048917 | Bacteria | 6423 |
| 770 | Ga0496114_0021689 | 3300048917 | Bacteria | 5226 |
| 771 | Ga0496114_0055385 | 3300048917 | Bacteria | 3307 |
| 772 | Ga0496114_0087299 | 3300048917 | Bacteria | 2645 |
| 773 | Ga0496115_0004033 | 3300048918 | Bacteria | 10603 |
| 774 | Ga0496115_0005460 | 3300048918 | Bacteria | 9247 |
| 775 | Ga0496115_0128209 | 3300048918 | Bacteria | 2090 |
| 776 | Ga0496115_0143409 | 3300048918 | Bacteria | 1970 |
| 777 | Ga0496116_0006937 | 3300048919 | Bacteria | 10158 |
| 778 | Ga0496116_0009097 | 3300048919 | Bacteria | 8515 |
| 779 | Ga0496117_0000211 | 3300048920 | Bacteria | 112609 |
| 780 | Ga0496117_0002066 | 3300048920 | Bacteria | 26549 |
| 781 | Ga0496117_0059146 | 3300048920 | Bacteria | 2650 |
| 782 | Ga0496118_0000005 | 3300048921 | Bacteria | 697350 |
| 783 | Ga0496118_0001422 | 3300048921 | Bacteria | 36121 |
| 784 | Ga0496118_0008974 | 3300048921 | Bacteria | 10198 |
| 785 | Ga0496118_0093165 | 3300048921 | Bacteria | 2065 |
| 786 | Ga0496119_0001007 | 3300048922 | Bacteria | 36111 |
| 787 | Ga0496119_0020348 | 3300048922 | Bacteria | 4845 |
| 788 | Ga0496120_0000242 | 3300048923 | Bacteria | 93148 |
| 789 | Ga0496121_0000245 | 3300048924 | Bacteria | 116316 |
| 790 | Ga0496121_0001299 | 3300048924 | Bacteria | 42922 |
| 791 | Ga0496121_0001771 | 3300048924 | Bacteria | 35100 |
| 792 | Ga0496121_0006402 | 3300048924 | Bacteria | 14641 |
| 793 | Ga0496121_0016052 | 3300048924 | Bacteria | 7761 |
| 794 | Ga0496121_0016227 | 3300048924 | Bacteria | 7707 |
| 795 | Ga0496122_0043664 | 3300048925 | Bacteria | 3509 |
| 796 | Ga0496123_0026983 | 3300048926 | Bacteria | 4288 |
| 797 | Ga0496125_0000220 | 3300048928 | Bacteria | 116658 |
| 798 | Ga0496125_0002613 | 3300048928 | Bacteria | 23120 |
| 799 | Ga0496125_0017234 | 3300048928 | Bacteria | 6901 |
| 800 | Ga0496125_0056000 | 3300048928 | Bacteria | 3206 |
| 801 | Ga0496126_0000082 | 3300048929 | Bacteria | 218571 |
| 802 | Ga0496126_0007294 | 3300048929 | Bacteria | 12146 |
| 803 | Ga0496126_0012911 | 3300048929 | Bacteria | 8531 |
| 804 | Ga0496126_0030405 | 3300048929 | Bacteria | 5117 |
| 805 | Ga0496126_0070007 | 3300048929 | Bacteria | 3127 |
| 806 | Ga0496126_0100817 | 3300048929 | Bacteria | 2526 |
| 807 | Ga0496126_0228916 | 3300048929 | Bacteria | 1558 |
| 808 | Ga0495678_046199 | 3300049459 | Bacteria | 1713 |
| 809 | Ga0501031_0009449 | 3300049568 | Bacteria | 6339 |
| 810 | Ga0501031_0017540 | 3300049568 | Bacteria | 4654 |
| 811 | Ga0501032_0001352 | 3300049569 | Bacteria | 19486 |
| 812 | Ga0501032_0016245 | 3300049569 | Bacteria | 5236 |
| 813 | Ga0501032_0093024 | 3300049569 | Bacteria | 2000 |
| 814 | Ga0501033_0002715 | 3300049570 | Bacteria | 14846 |
| 815 | Ga0501033_0009073 | 3300049570 | Bacteria | 7672 |
| 816 | Ga0501033_0014485 | 3300049570 | Bacteria | 5986 |
| 817 | Ga0501033_0031456 | 3300049570 | Bacteria | 3988 |
| 818 | Ga0501033_0044138 | 3300049570 | Bacteria | 3318 |
| 819 | Ga0501033_0058023 | 3300049570 | Bacteria | 2860 |
| 820 | Ga0501034_0006801 | 3300049571 | Bacteria | 12232 |
| 821 | Ga0501034_0015328 | 3300049571 | Bacteria | 7879 |
| 822 | Ga0501034_0043680 | 3300049571 | Bacteria | 4534 |
| 823 | Ga0501034_0096216 | 3300049571 | Bacteria | 2957 |
| 824 | Ga0501034_0096509 | 3300049571 | Bacteria | 2952 |
| 825 | Ga0501034_0148802 | 3300049571 | Bacteria | 2318 |
| 826 | Ga0501034_0273039 | 3300049571 | Bacteria | 1631 |
| 827 | Ga0501036_0010613 | 3300049572 | Bacteria | 7609 |
| 828 | Ga0501036_0015326 | 3300049572 | Bacteria | 6402 |
| 829 | Ga0501036_0062996 | 3300049572 | Bacteria | 3140 |
| 830 | Ga0501037_0002323 | 3300049573 | Bacteria | 13743 |
| 831 | Ga0501037_0008734 | 3300049573 | Bacteria | 7425 |
| 832 | Ga0501037_0030998 | 3300049573 | Bacteria | 3948 |
| 833 | Ga0501038_0012761 | 3300049574 | Bacteria | 7675 |
| 834 | Ga0501038_0019872 | 3300049574 | Bacteria | 6045 |
| 835 | Ga0501038_0045082 | 3300049574 | Bacteria | 3828 |
| 836 | Ga0501038_0058778 | 3300049574 | Bacteria | 3295 |
| 837 | Ga0501038_0080373 | 3300049574 | Bacteria | 2748 |
| 838 | Ga0501038_0081980 | 3300049574 | Bacteria | 2717 |
| 839 | Ga0501039_0040228 | 3300049575 | Bacteria | 3609 |
| 840 | Ga0501039_0056362 | 3300049575 | Bacteria | 3044 |
| 841 | Ga0501042_0011333 | 3300049578 | Bacteria | 6013 |
| 842 | Ga0501042_0054774 | 3300049578 | Bacteria | 2845 |
| 843 | Ga0501042_0074421 | 3300049578 | Bacteria | 2431 |
| 844 | Ga0501042_0100653 | 3300049578 | Bacteria | 2078 |
| 845 | Ga0501042_0109130 | 3300049578 | Bacteria | 1992 |
| 846 | Ga0501043_0022731 | 3300049579 | Bacteria | 4918 |
| 847 | Ga0501043_0038345 | 3300049579 | Bacteria | 3767 |
| 848 | Ga0501043_0038622 | 3300049579 | Bacteria | 3753 |
| 849 | Ga0501043_0102213 | 3300049579 | Bacteria | 2253 |
| 850 | Ga0501046_0000440 | 3300049580 | Bacteria | 41802 |
| 851 | Ga0501046_0013547 | 3300049580 | Bacteria | 6898 |
| 852 | Ga0501047_0017363 | 3300049581 | Bacteria | 6891 |
| 853 | Ga0501047_0041195 | 3300049581 | Bacteria | 4463 |
| 854 | Ga0501047_0075066 | 3300049581 | Bacteria | 3253 |
| 855 | Ga0501047_0091725 | 3300049581 | Bacteria | 2916 |
| 856 | Ga0501047_0124366 | 3300049581 | Bacteria | 2460 |
| 857 | Ga0501047_0138227 | 3300049581 | Bacteria | 2315 |
| 858 | Ga0501047_0204700 | 3300049581 | Bacteria | 1833 |
| 859 | Ga0501047_0212777 | 3300049581 | Bacteria | 1791 |
| 860 | Ga0501048_0003540 | 3300049582 | Bacteria | 11876 |
| 861 | Ga0501048_0009975 | 3300049582 | Bacteria | 7111 |
| 862 | Ga0501048_0054097 | 3300049582 | Bacteria | 2852 |
| 863 | Ga0501067_0005392 | 3300049583 | Bacteria | 7102 |
| 864 | Ga0501067_0023499 | 3300049583 | Bacteria | 3417 |
| 865 | Ga0501067_0065926 | 3300049583 | Bacteria | 2005 |
| 866 | Ga0501068_0013764 | 3300049584 | Bacteria | 4609 |
| 867 | Ga0501068_0018284 | 3300049584 | Bacteria | 4060 |
| 868 | Ga0501068_0026499 | 3300049584 | Bacteria | 3416 |
| 869 | Ga0501069_0001873 | 3300049585 | Bacteria | 10513 |
| 870 | Ga0501069_0097792 | 3300049585 | Bacteria | 1664 |
| 871 | Ga0501070_0005021 | 3300049586 | Bacteria | 11287 |
| 872 | Ga0501070_0020638 | 3300049586 | Bacteria | 5526 |
| 873 | Ga0501070_0042508 | 3300049586 | Bacteria | 3785 |
| 874 | Ga0501070_0044489 | 3300049586 | Bacteria | 3694 |
| 875 | Ga0501070_0049291 | 3300049586 | Bacteria | 3497 |
| 876 | Ga0501070_0050550 | 3300049586 | Bacteria | 3451 |
| 877 | Ga0501071_0000964 | 3300049587 | Bacteria | 15695 |
| 878 | Ga0501071_0052107 | 3300049587 | Bacteria | 2951 |
| 879 | Ga0501071_0081063 | 3300049587 | Bacteria | 2374 |
| 880 | Ga0501071_0167675 | 3300049587 | Bacteria | 1644 |
| 881 | Ga0501072_0007154 | 3300049588 | Bacteria | 8462 |
| 882 | Ga0501072_0037835 | 3300049588 | Bacteria | 3784 |
| 883 | Ga0501072_0085303 | 3300049588 | Bacteria | 2505 |
| 884 | Ga0501073_0004452 | 3300049589 | Bacteria | 10527 |
| 885 | Ga0501073_0028934 | 3300049589 | Bacteria | 3958 |
| 886 | Ga0501073_0034168 | 3300049589 | Bacteria | 3619 |
| 887 | Ga0501073_0049326 | 3300049589 | Bacteria | 2952 |
| 888 | Ga0501073_0103994 | 3300049589 | Bacteria | 1971 |
| 889 | Ga0501073_0111102 | 3300049589 | Bacteria | 1901 |
| 890 | Ga0501074_0000164 | 3300049590 | Bacteria | 35412 |
| 891 | Ga0501074_0002061 | 3300049590 | Bacteria | 13892 |
| 892 | Ga0501074_0017736 | 3300049590 | Bacteria | 5170 |
| 893 | Ga0501074_0027835 | 3300049590 | Bacteria | 4097 |
| 894 | Ga0501074_0097952 | 3300049590 | Bacteria | 2099 |
| 895 | Ga0501074_0106853 | 3300049590 | Bacteria | 2004 |
| 896 | Ga0501076_0003060 | 3300049592 | Bacteria | 11640 |
| 897 | Ga0501077_0001810 | 3300049593 | Bacteria | 12912 |
| 898 | Ga0501079_0000806 | 3300049741 | Bacteria | 21347 |
| 899 | Ga0501079_0006265 | 3300049741 | Bacteria | 8924 |
| 900 | Ga0501079_0018566 | 3300049741 | Bacteria | 5313 |
| 901 | Ga0501080_0004388 | 3300049742 | Bacteria | 12531 |
| 902 | Ga0501080_0021347 | 3300049742 | Bacteria | 5994 |
| 903 | Ga0501080_0047414 | 3300049742 | Bacteria | 3999 |
| 904 | Ga0501080_0068905 | 3300049742 | Bacteria | 3291 |
| 905 | Ga0501080_0127202 | 3300049742 | Bacteria | 2359 |
| 906 | Ga0501080_0131057 | 3300049742 | Bacteria | 2321 |
| 907 | Ga0501080_0205331 | 3300049742 | Bacteria | 1807 |
| 908 | Ga0501081_0047429 | 3300049743 | Bacteria | 2956 |
| 909 | Ga0501081_0129275 | 3300049743 | Bacteria | 1804 |
| 910 | Ga0501083_0002676 | 3300049744 | Bacteria | 12266 |
| 911 | Ga0501083_0007870 | 3300049744 | Bacteria | 7551 |
| 912 | Ga0501083_0017374 | 3300049744 | Bacteria | 5015 |
| 913 | Ga0501035_0000595 | 3300049822 | Bacteria | 39851 |
| 914 | Ga0501035_0004343 | 3300049822 | Bacteria | 13453 |
| 915 | Ga0501035_0032187 | 3300049822 | Bacteria | 4772 |
| 916 | Ga0501035_0034734 | 3300049822 | Bacteria | 4580 |
| 917 | Ga0501044_0001080 | 3300049823 | Bacteria | 32578 |
| 918 | Ga0501044_0001470 | 3300049823 | Bacteria | 27679 |
| 919 | Ga0501044_0003782 | 3300049823 | Bacteria | 16994 |
| 920 | Ga0501044_0009792 | 3300049823 | Bacteria | 10421 |
| 921 | Ga0501044_0013472 | 3300049823 | Bacteria | 8843 |
| 922 | Ga0501044_0037938 | 3300049823 | Bacteria | 5035 |
| 923 | Ga0501044_0059359 | 3300049823 | Bacteria | 3919 |
| 924 | Ga0501045_0017641 | 3300049824 | Bacteria | 5068 |
| 925 | nmdc:mga03683_26791_c1 | 3300050489 | Bacteria | 2277 |
| 926 | nmdc:mga03683_8566_c1 | 3300050489 | Bacteria | 3600 |
| 927 | nmdc:mga03n38_11631_c1 | 3300050490 | Bacteria | 3287 |
| 928 | nmdc:mga03n38_23432_c1 | 3300050490 | Bacteria | 2511 |
| 929 | nmdc:mga03n38_557_c1 | 3300050490 | Bacteria | 9452 |
| 930 | nmdc:mga00v17_104215_c1 | 3300050491 | Bacteria | 1793 |
| 931 | nmdc:mga00v17_1591_c1 | 3300050491 | Bacteria | 11859 |
| 932 | nmdc:mga00v17_6139_c1 | 3300050491 | Bacteria | 6011 |
| 933 | nmdc:mga00v17_64745_c1 | 3300050491 | Bacteria | 2253 |
| 934 | nmdc:mga00v17_6677_c1 | 3300050491 | Bacteria | 6130 |
| 935 | nmdc:mga00v17_8643_c1 | 3300050491 | Bacteria | 5485 |
| 936 | nmdc:mga0yw44_112001_c1 | 3300050492 | Bacteria | 1750 |
| 937 | nmdc:mga0yw44_13053_c1 | 3300050492 | Bacteria | 4357 |
| 938 | nmdc:mga0yw44_17806_c2 | 3300050492 | Bacteria | 2787 |
| 939 | nmdc:mga0yw44_27806_c1 | 3300050492 | Bacteria | 3244 |
| 940 | nmdc:mga0yw44_29570_c1 | 3300050492 | Bacteria | 3164 |
| 941 | nmdc:mga0yw44_33599_c1 | 3300050492 | Bacteria | 2998 |
| 942 | nmdc:mga0yw44_58716_c1 | 3300050492 | Bacteria | 2351 |
| 943 | nmdc:mga0yw44_6559_c1 | 3300050492 | Bacteria | 5635 |
| 944 | nmdc:mga0k408_23318_c1 | 3300050493 | Bacteria | 3489 |
| 945 | nmdc:mga06z11_3678_c1 | 3300050494 | Bacteria | 5955 |
| 946 | nmdc:mga06z11_60060_c1 | 3300050494 | Bacteria | 1978 |
| 947 | nmdc:mga04h51_4676_c1 | 3300050495 | Bacteria | 3427 |
| 948 | nmdc:mga04h51_6017_c1 | 3300050495 | Bacteria | 3124 |
| 949 | nmdc:mga07m45_136846_c1 | 3300050496 | Bacteria | 1418 |
| 950 | nmdc:mga07m45_1431_c1 | 3300050496 | Bacteria | 10940 |
| 951 | nmdc:mga07m45_14526_c1 | 3300050496 | Bacteria | 4197 |
| 952 | nmdc:mga07m45_15022_c1 | 3300050496 | Bacteria | 4135 |
| 953 | nmdc:mga07m45_1612_c1 | 3300050496 | Bacteria | 10389 |
| 954 | nmdc:mga07m45_22035_c1 | 3300050496 | Bacteria | 3476 |
| 955 | nmdc:mga07m45_37676_c1 | 3300050496 | Bacteria | 2697 |
| 956 | nmdc:mga05p37_411199_c1 | 3300050507 | Bacteria | 1577 |
| 957 | nmdc:mga05p37_4665_c1 | 3300050507 | Bacteria | 16015 |
| 958 | nmdc:mga09592_9512_c1 | 3300050508 | Bacteria | 7900 |
| 959 | nmdc:mga0qj67_142782_c1 | 3300050509 | Bacteria | 1941 |
| 960 | nmdc:mga0qj67_3934_c1 | 3300050509 | Bacteria | 10749 |
| 961 | nmdc:mga06r32_3907_c1 | 3300050510 | Bacteria | 13362 |
| 962 | nmdc:mga08y16_55772_c1 | 3300050511 | Bacteria | 4129 |
| 963 | nmdc:mga0sz30_4483_c1 | 3300050516 | Bacteria | 4410 |
| 964 | Ga0495601_0010824 | 3300053077 | Bacteria | 5442 |
| 965 | Ga0495601_0062416 | 3300053077 | Bacteria | 2367 |
| 966 | Ga0495655_0001453 | 3300053083 | Bacteria | 3626 |
| 967 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 968 | Ga0495595_0018898 | 3300053084 | Bacteria | 2984 |
| 969 | Ga0495595_0050785 | 3300053084 | Bacteria | 1921 |
| 970 | Ga0495619_0000067 | 3300053085 | Bacteria | 83418 |
| 971 | Ga0495619_0020724 | 3300053085 | Bacteria | 4192 |
| 972 | Ga0500578_0000011 | 3300053086 | Bacteria | 217243 |
| 973 | Ga0500643_000008 | 3300053087 | Bacteria | 457931 |
| 974 | Ga0500644_0000204 | 3300053088 | Bacteria | 35880 |
| 975 | Ga0500583_0034679 | 3300053092 | Bacteria | 2245 |
| 976 | Ga0500651_0002949 | 3300053093 | Bacteria | 9158 |
| 977 | Ga0500566_0000162 | 3300053094 | Bacteria | 34256 |
| 978 | Ga0500566_0008386 | 3300053094 | Bacteria | 6111 |
| 979 | Ga0500556_0000317 | 3300053104 | Bacteria | 36403 |
| 980 | Ga0500556_0001079 | 3300053104 | Bacteria | 13767 |
| 981 | Ga0500593_002351 | 3300053117 | Bacteria | 6931 |
| 982 | Ga0500593_010832 | 3300053117 | Bacteria | 3836 |
| 983 | Ga0500595_003028 | 3300053119 | Bacteria | 7984 |
| 984 | Ga0500607_038321 | 3300053121 | Bacteria | 2609 |
| 985 | Ga0500617_023549 | 3300053124 | Bacteria | 2723 |
| 986 | Ga0500628_000798 | 3300053129 | Bacteria | 5590 |
| 987 | Ga0500652_000189 | 3300053131 | Bacteria | 23838 |
| 988 | Ga0500658_0008263 | 3300053134 | Bacteria | 3846 |
| 989 | Ga0500559_0000097 | 3300053136 | Bacteria | 70124 |
| 990 | Ga0500559_0012325 | 3300053136 | Bacteria | 3636 |
| 991 | Ga0500568_0004967 | 3300053139 | Bacteria | 6989 |
| 992 | Ga0500588_0000286 | 3300053146 | Bacteria | 7441 |
| 993 | Ga0500590_000044 | 3300053148 | Bacteria | 29977 |
| 994 | Ga0500590_025761 | 3300053148 | Bacteria | 3054 |
| 995 | Ga0500616_0000491 | 3300053153 | Bacteria | 51066 |
| 996 | Ga0500616_0018420 | 3300053153 | Bacteria | 3948 |
| 997 | Ga0500622_0000097 | 3300053156 | Bacteria | 89802 |
| 998 | Ga0500622_0000434 | 3300053156 | Bacteria | 39656 |
| 999 | Ga0500622_0000978 | 3300053156 | Bacteria | 24237 |
| 1000 | Ga0500622_0001119 | 3300053156 | Bacteria | 22384 |
| 1001 | Ga0500622_0007159 | 3300053156 | Bacteria | 6361 |
| 1002 | Ga0500633_0000920 | 3300053160 | Bacteria | 5140 |
| 1003 | Ga0500645_001558 | 3300053730 | Bacteria | 11410 |
| 1004 | Ga0500587_001071 | 3300053739 | Bacteria | 3744 |
| 1005 | Ga0501084_0001034 | 3300054114 | Bacteria | 21610 |
| 1006 | Ga0501084_0005366 | 3300054114 | Bacteria | 10507 |
| 1007 | Ga0501084_0024439 | 3300054114 | Bacteria | 5040 |
| 1008 | Ga0501082_0001324 | 3300060353 | Bacteria | 21681 |
| 1009 | Ga0501082_0002035 | 3300060353 | Bacteria | 17775 |
| 1010 | Ga0501082_0004992 | 3300060353 | Bacteria | 11584 |
| 1011 | Ga0501082_0067845 | 3300060353 | Bacteria | 3072 |
| 1012 | 2509391201 | 2509276021 | Bacteria | 7634384 |
| 1013 | 2510892209 | 2510461076 | Bacteria | 8618824 |
| 1014 | 2511194983 | 2510917030 | Bacteria | 7460662 |
| 1015 | 2513599358 | 2513237088 | Bacteria | 6927906 |
| 1016 | 2513713614 | 2513237103 | Bacteria | 7647401 |
| 1017 | 2514023313 | 2513237162 | Bacteria | 7468464 |
| 1018 | 2515632134 | 2515154113 | Bacteria | 7807172 |
| 1019 | 2515644564 | 2515154114 | Bacteria | 7848616 |
| 1020 | 2515660011 | 2515154116 | Bacteria | 7552979 |
| 1021 | 2517409976 | 2517287029 | Bacteria | 6905599 |
| 1022 | 2520375415 | 2519899620 | Bacteria | 6499161 |
| 1023 | 2535520758 | 2534681796 | Bacteria | 7146037 |
| 1024 | 2585205188 | 2582581294 | Bacteria | 6626667 |
| 1025 | 2585226332 | 2582581298 | Bacteria | 7315509 |
| 1026 | 2585404916 | 2582581867 | Bacteria | 7184437 |
| 1027 | 2585548748 | 2585427529 | Bacteria | 7395659 |
| 1028 | 2587730368 | 2585428057 | Bacteria | 6737412 |
| 1029 | 2587736862 | 2585428058 | Bacteria | 6853932 |
| 1030 | 2588291765 | 2588253510 | Bacteria | 6901809 |
| 1031 | 2600201911 | 2599185354 | Bacteria | 4398675 |
| 1032 | 2617386532 | 2617270742 | Bacteria | 6808054 |
| 1033 | 2643825025 | 2643221561 | Bacteria | 4984412 |
| 1034 | 2643893200 | 2643221576 | Bacteria | 5214352 |
| 1035 | 2643961741 | 2643221590 | Bacteria | 5214697 |
| 1036 | 2643972410 | 2643221592 | Bacteria | 6608788 |
| 1037 | 2644034069 | 2643221604 | Bacteria | 5014917 |
| 1038 | 2644092719 | 2643221615 | Bacteria | 5487866 |
| 1039 | 2644099492 | 2643221617 | Bacteria | 5139111 |
| 1040 | 2644116315 | 2643221620 | Bacteria | 5134593 |
| 1041 | 2644138582 | 2643221625 | Bacteria | 6512927 |
| 1042 | 2644193921 | 2643221634 | Bacteria | 6705461 |
| 1043 | 2644207894 | 2643221637 | Bacteria | 5345260 |
| 1044 | 2644272918 | 2643221648 | Bacteria | 6521465 |
| 1045 | 2644305233 | 2643221654 | Bacteria | 5273570 |
| 1046 | 2644322332 | 2643221657 | Bacteria | 5490246 |
| 1047 | 2644534668 | 2643221696 | Bacteria | 5431823 |
| 1048 | 2644651169 | 2643221718 | Bacteria | 5345506 |
| 1049 | 2738723276 | 2738541277 | Bacteria | 7458140 |
| 1050 | 2738871271 | 2738541305 | Bacteria | 4910150 |
| 1051 | 2738885599 | 2738541307 | Bacteria | 8606193 |
| 1052 | 2739284007 | 2738543019 | Bacteria | 7459457 |
| 1053 | 2739362073 | 2738543034 | Bacteria | 6084756 |
| 1054 | 2740167923 | 2739367898 | Bacteria | 4367674 |
| 1055 | 2753036132 | 2751185725 | Bacteria | 5740550 |
| 1056 | 2753324004 | 2751185792 | Bacteria | 5739090 |
| 1057 | 2753766660 | 2751185897 | Bacteria | 5322941 |
| 1058 | 2766066970 | 2765235942 | Bacteria | 7445910 |
| 1059 | 2793316665 | 2791355259 | Bacteria | 7254731 |
| 1060 | 2793319950 | 2791355260 | Bacteria | 6598818 |
| 1061 | 2812333868 | 2811994874 | Bacteria | 5367947 |
| 1062 | 2819425480 | 2818991318 | Bacteria | 5266538 |
| 1063 | 2819667850 | 2818991458 | Bacteria | 4794049 |
| 1064 | 2819690248 | 2818991462 | Bacteria | 4320267 |
| 1065 | 2819726204 | 2818991469 | Bacteria | 4644110 |
| 1066 | 2841868673 | 2841864319 | Bacteria | 6742987 |
| 1067 | 2842111837 | 2842110456 | Bacteria | 7656360 |
| 1068 | 2842219608 | 2842217011 | Bacteria | 7497767 |
| 1069 | 2842342621 | 2842341865 | Bacteria | 7003929 |
| 1070 | 2842365603 | 2842363717 | Bacteria | 6844742 |
| 1071 | 2857485428 | 2857481737 | Bacteria | 4761446 |
| 1072 | 2861695604 | 2861691609 | Bacteria | 5628931 |
| 1073 | 2894657232 | 2894652903 | Bacteria | 4587256 |
| 1074 | 2904579755 | 2904578770 | Bacteria | 5302906 |
| 1075 | 2909048386 | 2909042592 | Bacteria | 6499737 |
| 1076 | 2919120577 | 2919119836 | Bacteria | 5208557 |
| 1077 | 2928120481 | 2928115317 | Bacteria | 6477646 |
| 1078 | 2933588113 | 2933586486 | Bacteria | 7667493 |
| 1079 | 639645320 | 639633055 | Bacteria | 7751309 |
| 1080 | 8005548531 | 8005542996 | Bacteria | 7077758 |
| 1081 | 8024487374 | 8024486573 | Bacteria | 6540512 |
| 1082 | 8046772967 | 8046767195 | Bacteria | 7547379 |
| 1083 | Ga0207678_10136773 | |||
| 1084 | JGI24744J21845_10004395 | |||
| 1085 | JGI25158J39367_1000043 | |||
| 1086 | JGI25152J39213_1001831 | |||
| 1087 | JGI25152J39213_1007690 | |||
| 1088 | JGI25153J46596_10003067 | |||
| 1089 | rootH1_10008151 | |||
| 1090 | rootH1_10117972 | |||
| 1091 | JGI25160J50197_1009936 | |||
| 1092 | JGI25161J50226_1000027 | |||
| 1093 | Ga0055526_1001863 | |||
| 1094 | Ga0055526_1013303 | |||
| 1095 | Ga0055528_1015656 | |||
| 1096 | Ga0055540_1004588 | |||
| 1097 | Ga0055543_1000100 | |||
| 1098 | Ga0065165_1001841 | |||
| 1099 | Ga0065707_10085008 | |||
| 1100 | Ga0070676_10006514 | |||
| 1101 | Ga0070683_100008299 | |||
| 1102 | Ga0070683_100009231 | |||
| 1103 | Ga0070683_100061774 | |||
| 1104 | Ga0070683_100167254 | |||
| 1105 | Ga0070690_100041805 | |||
| 1106 | Ga0070670_100064046 | |||
| 1107 | Ga0070677_10000706 | |||
| 1108 | Ga0070677_10007124 | |||
| 1109 | Ga0068869_100033427 | |||
| 1110 | Ga0070666_10012082 | |||
| 1111 | Ga0070666_10066872 | |||
| 1112 | Ga0070680_100002950 | |||
| 1113 | Ga0070682_100000061 | |||
| 1114 | Ga0070682_100003688 | |||
| 1115 | Ga0070682_100064723 | |||
| 1116 | Ga0068868_100020471 | |||
| 1117 | Ga0068868_100069539 | |||
| 1118 | Ga0068868_100095259 | |||
| 1119 | Ga0068868_100223581 | |||
| 1120 | Ga0070660_100022184 | |||
| 1121 | Ga0070689_100001851 | |||
| 1122 | Ga0070689_100083681 | |||
| 1123 | Ga0070692_10007517 | |||
| 1124 | Ga0070675_100022065 | |||
| 1125 | Ga0070675_100025410 | |||
| 1126 | Ga0070671_100020733 | |||
| 1127 | Ga0070673_100024552 | |||
| 1128 | Ga0070688_100011943 | |||
| 1129 | Ga0070688_100062643 | |||
| 1130 | Ga0070667_100000967 | |||
| 1131 | Ga0070667_100002581 | |||
| 1132 | Ga0070667_100034441 | |||
| 1133 | Ga0070667_100178439 | |||
| 1134 | Ga0070709_10025237 | |||
| 1135 | Ga0070714_100059436 | |||
| 1136 | Ga0070713_100141208 | |||
| 1137 | Ga0070701_10038650 | |||
| 1138 | Ga0070701_10050854 | |||
| 1139 | Ga0070711_100008954 | |||
| 1140 | Ga0070705_100052090 | |||
| 1141 | Ga0070700_100092156 | |||
| 1142 | Ga0070708_100058413 | |||
| 1143 | Ga0070681_10002000 | |||
| 1144 | Ga0070681_10027724 | |||
| 1145 | Ga0068867_100001469 | |||
| 1146 | Ga0068867_100047796 | |||
| 1147 | Ga0070706_100004269 | |||
| 1148 | Ga0070706_100114382 | |||
| 1149 | Ga0070706_100194924 | |||
| 1150 | Ga0070698_100001386 | |||
| 1151 | Ga0070698_100046507 | |||
| 1152 | Ga0070699_100046067 | |||
| 1153 | Ga0070699_100151915 | |||
| 1154 | Ga0070679_100013436 | |||
| 1155 | Ga0070679_100027028 | |||
| 1156 | Ga0070679_100073717 | |||
| 1157 | Ga0070684_100004622 | |||
| 1158 | Ga0070697_100023957 | |||
| 1159 | Ga0070672_100000005 | |||
| 1160 | Ga0070672_100001159 | |||
| 1161 | Ga0070672_100005485 | |||
| 1162 | Ga0070672_100040468 | |||
| 1163 | Ga0070672_100054676 | |||
| 1164 | Ga0070672_100067276 | |||
| 1165 | Ga0070672_100122881 | |||
| 1166 | Ga0070686_100004637 | |||
| 1167 | Ga0070686_100021257 | |||
| 1168 | Ga0070665_100000566 | |||
| 1169 | Ga0070665_100001336 | |||
| 1170 | Ga0070665_100002579 | |||
| 1171 | Ga0070665_100008692 | |||
| 1172 | Ga0070665_100012031 | |||
| 1173 | Ga0070665_100034625 | |||
| 1174 | Ga0070665_100041042 | |||
| 1175 | Ga0070665_100055601 | |||
| 1176 | Ga0068855_100000327 | |||
| 1177 | Ga0068855_100000479 | |||
| 1178 | Ga0068855_100004779 | |||
| 1179 | Ga0068855_100048599 | |||
| 1180 | Ga0068855_100134114 | |||
| 1181 | Ga0068855_100136947 | |||
| 1182 | Ga0070664_100019671 | |||
| 1183 | Ga0070664_100054357 | |||
| 1184 | Ga0068856_100005787 | |||
| 1185 | Ga0068856_100104020 | |||
| 1186 | Ga0068856_100132386 | |||
| 1187 | Ga0068856_100192913 | |||
| 1188 | Ga0070702_100019013 | |||
| 1189 | Ga0070702_100031825 | |||
| 1190 | Ga0070702_100116255 | |||
| 1191 | Ga0068852_100004825 | |||
| 1192 | Ga0068852_100035444 | |||
| 1193 | Ga0068852_100080734 | |||
| 1194 | Ga0068852_100175914 | |||
| 1195 | Ga0068859_100006016 | |||
| 1196 | Ga0068859_100018500 | |||
| 1197 | Ga0068859_100068400 | |||
| 1198 | Ga0068859_100141878 | |||
| 1199 | Ga0068859_100176913 | |||
| 1200 | Ga0068864_100008855 | |||
| 1201 | Ga0068864_100014290 | |||
| 1202 | Ga0068864_100031966 | |||
| 1203 | Ga0068864_100094347 | |||
| 1204 | Ga0068866_10008363 | |||
| 1205 | Ga0068866_10016882 | |||
| 1206 | Ga0068861_100001686 | |||
| 1207 | Ga0068861_100004568 | |||
| 1208 | Ga0068861_100005967 | |||
| 1209 | Ga0068861_100034539 | |||
| 1210 | Ga0068861_100050147 | |||
| 1211 | Ga0068861_100065417 | |||
| 1212 | Ga0068861_100082644 | |||
| 1213 | Ga0068870_10016817 | |||
| 1214 | Ga0068870_10088242 | |||
| 1215 | Ga0068863_100011481 | |||
| 1216 | Ga0068863_100078590 | |||
| 1217 | Ga0068863_100127377 | |||
| 1218 | Ga0068863_100155869 | |||
| 1219 | Ga0068858_100002321 | |||
| 1220 | Ga0068858_100004646 | |||
| 1221 | Ga0068858_100007963 | |||
| 1222 | Ga0068858_100040576 | |||
| 1223 | Ga0068860_100000470 | |||
| 1224 | Ga0068860_100082225 | |||
| 1225 | Ga0068860_100094501 | |||
| 1226 | Ga0068862_100036157 | |||
| 1227 | Ga0081455_10002149 | |||
| 1228 | Ga0081455_10002595 | |||
| 1229 | Ga0081455_10012181 | |||
| 1230 | Ga0081455_10020543 | |||
| 1231 | Ga0081455_10033753 | |||
| 1232 | Ga0081455_10050302 | |||
| 1233 | Ga0081538_10000022 | |||
| 1234 | Ga0081540_1005379 | |||
| 1235 | Ga0081540_1012367 | |||
| 1236 | Ga0081539_10000159 | |||
| 1237 | Ga0081539_10003942 | |||
| 1238 | Ga0081539_10009579 | |||
| 1239 | Ga0070717_10016752 | |||
| 1240 | Ga0075365_10001309 | |||
| 1241 | Ga0075365_10003178 | |||
| 1242 | Ga0075365_10005649 | |||
| 1243 | Ga0075365_10016962 | |||
| 1244 | Ga0075365_10019010 | |||
| 1245 | Ga0075365_10046261 | |||
| 1246 | Ga0075365_10053282 | |||
| 1247 | Ga0075368_10001032 | |||
| 1248 | Ga0075368_10001687 | |||
| 1249 | Ga0075368_10009161 | |||
| 1250 | Ga0075368_10014667 | |||
| 1251 | Ga0075363_100004619 | |||
| 1252 | Ga0075363_100008063 | |||
| 1253 | Ga0075363_100014602 | |||
| 1254 | Ga0075363_100056895 | |||
| 1255 | Ga0075364_10000624 | |||
| 1256 | Ga0075364_10003803 | |||
| 1257 | Ga0075364_10003820 | |||
| 1258 | Ga0075364_10017125 | |||
| 1259 | Ga0075364_10020301 | |||
| 1260 | Ga0075364_10032639 | |||
| 1261 | Ga0075364_10068764 | |||
| 1262 | Ga0070715_10006280 | |||
| 1263 | Ga0070712_100044730 | |||
| 1264 | Ga0070712_100059186 | |||
| 1265 | Ga0075367_10004567 | |||
| 1266 | Ga0075367_10005175 | |||
| 1267 | Ga0075369_10000119 | |||
| 1268 | Ga0075369_10018822 | |||
| 1269 | Ga0075366_10006300 | |||
| 1270 | Ga0075366_10007947 | |||
| 1271 | Ga0075366_10010334 | |||
| 1272 | Ga0075366_10010484 | |||
| 1273 | Ga0075366_10063026 | |||
| 1274 | Ga0097621_100003890 | |||
| 1275 | Ga0097621_100009897 | |||
| 1276 | Ga0075370_10000383 | |||
| 1277 | Ga0075370_10002885 | |||
| 1278 | Ga0075370_10007701 | |||
| 1279 | Ga0075370_10008408 | |||
| 1280 | Ga0075370_10030970 | |||
| 1281 | Ga0075370_10038957 | |||
| 1282 | Ga0075370_10085917 | |||
| 1283 | Ga0068871_100007165 | |||
| 1284 | Ga0075428_100001401 | |||
| 1285 | Ga0075428_100027074 | |||
| 1286 | Ga0075428_100073956 | |||
| 1287 | Ga0075430_100004725 | |||
| 1288 | Ga0075431_100004352 | |||
| 1289 | Ga0075431_100019791 | |||
| 1290 | Ga0075431_100133566 | |||
| 1291 | Ga0075434_100082889 | |||
| 1292 | Ga0075434_100132129 | |||
| 1293 | Ga0075429_100001477 | |||
| 1294 | Ga0068865_100010323 | |||
| 1295 | Ga0097620_100006016 | |||
| 1296 | Ga0097620_100018500 | |||
| 1297 | Ga0097620_100068400 | |||
| 1298 | Ga0097620_100141867 | |||
| 1299 | Ga0097620_100176918 | |||
| 1300 | Ga0099794_10001837 | |||
| 1301 | Ga0099794_10006637 | |||
| 1302 | Ga0099794_10066949 | |||
| 1303 | Ga0099795_10000213 | |||
| 1304 | Ga0105250_10000005 | |||
| 1305 | Ga0105240_10000215 | |||
| 1306 | Ga0105240_10000587 | |||
| 1307 | Ga0105240_10002394 | |||
| 1308 | Ga0105240_10011765 | |||
| 1309 | Ga0105240_10011928 | |||
| 1310 | Ga0105240_10025141 | |||
| 1311 | Ga0105240_10049046 | |||
| 1312 | Ga0105240_10127737 | |||
| 1313 | Ga0105240_10157215 | |||
| 1314 | Ga0105240_10223337 | |||
| 1315 | Ga0105240_10226453 | |||
| 1316 | Ga0111539_10049954 | |||
| 1317 | Ga0111539_10212266 | |||
| 1318 | Ga0105245_10003386 | |||
| 1319 | Ga0105245_10005468 | |||
| 1320 | Ga0105245_10068852 | |||
| 1321 | Ga0105247_10002551 | |||
| 1322 | Ga0105247_10014662 | |||
| 1323 | Ga0105247_10019262 | |||
| 1324 | Ga0105247_10025217 | |||
| 1325 | Ga0114129_10001245 | |||
| 1326 | Ga0105243_10007737 | |||
| 1327 | Ga0105243_10038713 | |||
| 1328 | Ga0105243_10126363 | |||
| 1329 | Ga0105243_10160217 | |||
| 1330 | Ga0105241_10080097 | |||
| 1331 | Ga0105242_10021791 | |||
| 1332 | Ga0105242_10113114 | |||
| 1333 | Ga0105248_10206868 | |||
| 1334 | Ga0105237_10000560 | |||
| 1335 | Ga0105237_10004790 | |||
| 1336 | Ga0105237_10044948 | |||
| 1337 | Ga0105237_10187773 | |||
| 1338 | Ga0105237_10223109 | |||
| 1339 | Ga0105238_10000607 | |||
| 1340 | Ga0105238_10010367 | |||
| 1341 | Ga0105249_10020374 | |||
| 1342 | Ga0105249_10034441 | |||
| 1343 | Ga0123341_1000008 | |||
| 1344 | Ga0123342_1005465 | |||
| 1345 | Ga0105239_10000025 | |||
| 1346 | Ga0105239_10000269 | |||
| 1347 | Ga0105239_10019971 | |||
| 1348 | Ga0105239_10022212 | |||
| 1349 | Ga0105239_10153090 | |||
| 1350 | Ga0105246_10003455 | |||
| 1351 | Ga0105246_10015747 | |||
| 1352 | Ga0157371_10129035 | |||
| 1353 | Ga0157370_10050953 | |||
| 1354 | Ga0157374_10007450 | |||
| 1355 | Ga0157378_10276432 | |||
| 1356 | Ga0163162_10014396 | |||
| 1357 | Ga0163162_10047916 | |||
| 1358 | Ga0163162_10250446 | |||
| 1359 | Ga0157372_10006775 | |||
| 1360 | Ga0157375_10004470 | |||
| 1361 | Ga0157375_10008041 | |||
| 1362 | Ga0157375_10009166 | |||
| 1363 | Ga0157375_10030639 | |||
| 1364 | Ga0157375_10038969 | |||
| 1365 | Ga0157375_10260599 | |||
| 1366 | Ga0163163_10000044 | |||
| 1367 | Ga0163163_10000876 | |||
| 1368 | Ga0163163_10016691 | |||
| 1369 | Ga0163163_10037049 | |||
| 1370 | Ga0163163_10192228 | |||
| 1371 | Ga0157380_10066780 | |||
| 1372 | Ga0157380_10131909 | |||
| 1373 | Ga0182008_10035582 | |||
| 1374 | Ga0157377_10036186 | |||
| 1375 | Ga0157377_10045571 | |||
| 1376 | Ga0157379_10000038 | |||
| 1377 | Ga0157379_10007099 | |||
| 1378 | Ga0157379_10008491 | |||
| 1379 | Ga0157379_10012604 | |||
| 1380 | Ga0157379_10022185 | |||
| 1381 | Ga0157379_10031631 | |||
| 1382 | Ga0157379_10037973 | |||
| 1383 | Ga0157379_10142457 | |||
| 1384 | Ga0157376_10013434 | |||
| 1385 | Ga0157376_10018397 | |||
| 1386 | Ga0157376_10165202 | |||
| 1387 | Ga0182006_1030966 | |||
| 1388 | Ga0182007_10001637 | |||
| 1389 | Ga0163161_10055223 | |||
| 1390 | Ga0213875_10020700 | |||
| 1391 | Ga0209436_100009 | |||
| 1392 | Ga0207425_1004443 | |||
| 1393 | Ga0209129_1000041 | |||
| 1394 | Ga0209129_1000333 | |||
| 1395 | Ga0209673_1000013 | |||
| 1396 | Ga0209673_1007377 | |||
| 1397 | Ga0209130_1000022 | |||
| 1398 | Ga0209025_1019064 | |||
| 1399 | Ga0209564_1000029 | |||
| 1400 | Ga0209564_1000264 | |||
| 1401 | Ga0209564_1001353 | |||
| 1402 | Ga0209564_1002363 | |||
| 1403 | Ga0209758_1000043 | |||
| 1404 | Ga0209758_1000057 | |||
| 1405 | Ga0209758_1007042 | |||
| 1406 | Ga0209050_1000149 | |||
| 1407 | Ga0209256_1005145 | |||
| 1408 | Ga0209256_1006523 | |||
| 1409 | Ga0209256_1008410 | |||
| 1410 | Ga0209256_1018531 | |||
| 1411 | Ga0207426_1000042 | |||
| 1412 | Ga0207426_1000537 | |||
| 1413 | Ga0209051_1000489 | |||
| 1414 | Ga0209051_1007353 | |||
| 1415 | Ga0207656_10000244 | |||
| 1416 | Ga0207696_1000276 | |||
| 1417 | Ga0207692_10015057 | |||
| 1418 | Ga0207642_10013793 | |||
| 1419 | Ga0207642_10030691 | |||
| 1420 | Ga0207710_10000593 | |||
| 1421 | Ga0207710_10011463 | |||
| 1422 | Ga0207688_10001626 | |||
| 1423 | Ga0207688_10006136 | |||
| 1424 | Ga0207680_10005598 | |||
| 1425 | Ga0207647_10058303 | |||
| 1426 | Ga0207685_10001766 | |||
| 1427 | Ga0207645_10003682 | |||
| 1428 | Ga0207645_10014754 | |||
| 1429 | Ga0207645_10040690 | |||
| 1430 | Ga0207643_10001184 | |||
| 1431 | Ga0207643_10024032 | |||
| 1432 | Ga0207705_10024663 | |||
| 1433 | Ga0207684_10005060 | |||
| 1434 | Ga0207684_10061918 | |||
| 1435 | Ga0207684_10138169 | |||
| 1436 | Ga0207707_10001863 | |||
| 1437 | Ga0207707_10141546 | |||
| 1438 | Ga0207695_10000347 | |||
| 1439 | Ga0207695_10004517 | |||
| 1440 | Ga0207695_10016693 | |||
| 1441 | Ga0207695_10018105 | |||
| 1442 | Ga0207695_10020509 | |||
| 1443 | Ga0207695_10039933 | |||
| 1444 | Ga0207695_10061366 | |||
| 1445 | Ga0207695_10158749 | |||
| 1446 | Ga0207671_10000952 | |||
| 1447 | Ga0207671_10024013 | |||
| 1448 | Ga0207671_10138007 | |||
| 1449 | Ga0207693_10052265 | |||
| 1450 | Ga0207663_10017023 | |||
| 1451 | Ga0207660_10025425 | |||
| 1452 | Ga0207660_10025885 | |||
| 1453 | Ga0207657_10002307 | |||
| 1454 | Ga0207657_10058970 | |||
| 1455 | Ga0207652_10019486 | |||
| 1456 | Ga0207652_10055163 | |||
| 1457 | Ga0207652_10063785 | |||
| 1458 | Ga0207681_10024501 | |||
| 1459 | Ga0207694_10000606 | |||
| 1460 | Ga0207694_10021736 | |||
| 1461 | Ga0207694_10040384 | |||
| 1462 | Ga0207650_10135964 | |||
| 1463 | Ga0207659_10116440 | |||
| 1464 | Ga0207687_10005646 | |||
| 1465 | Ga0207687_10011372 | |||
| 1466 | Ga0207700_10039730 | |||
| 1467 | Ga0207700_10146165 | |||
| 1468 | Ga0207664_10061884 | |||
| 1469 | Ga0207644_10002169 | |||
| 1470 | Ga0207644_10078058 | |||
| 1471 | Ga0207706_10003325 | |||
| 1472 | Ga0207686_10082739 | |||
| 1473 | Ga0207709_10003330 | |||
| 1474 | Ga0207709_10009011 | |||
| 1475 | Ga0207709_10032358 | |||
| 1476 | Ga0207709_10076289 | |||
| 1477 | Ga0207670_10035363 | |||
| 1478 | Ga0207669_10021936 | |||
| 1479 | Ga0207669_10082467 | |||
| 1480 | Ga0207704_10022274 | |||
| 1481 | Ga0207704_10057054 | |||
| 1482 | Ga0207691_10000028 | |||
| 1483 | Ga0207691_10002487 | |||
| 1484 | Ga0207691_10008483 | |||
| 1485 | Ga0207691_10010326 | |||
| 1486 | Ga0207691_10034149 | |||
| 1487 | Ga0207691_10102659 | |||
| 1488 | Ga0207691_10158855 | |||
| 1489 | Ga0207711_10031272 | |||
| 1490 | Ga0207711_10087780 | |||
| 1491 | Ga0207711_10110637 | |||
| 1492 | Ga0207689_10014440 | |||
| 1493 | Ga0207689_10028770 | |||
| 1494 | Ga0207689_10033405 | |||
| 1495 | Ga0207661_10039718 | |||
| 1496 | Ga0207661_10228557 | |||
| 1497 | Ga0207667_10000175 | |||
| 1498 | Ga0207667_10003104 | |||
| 1499 | Ga0207667_10008252 | |||
| 1500 | Ga0207667_10034111 | |||
| 1501 | Ga0207667_10034807 | |||
| 1502 | Ga0207651_10218098 | |||
| 1503 | Ga0207712_10108531 | |||
| 1504 | Ga0207712_10137628 | |||
| 1505 | Ga0207640_10000077 | |||
| 1506 | Ga0207640_10165641 | |||
| 1507 | Ga0207658_10000800 | |||
| 1508 | Ga0207658_10117507 | |||
| 1509 | Ga0207677_10000929 | |||
| 1510 | Ga0207703_10000957 | |||
| 1511 | Ga0207703_10001166 | |||
| 1512 | Ga0207703_10004717 | |||
| 1513 | Ga0207703_10033934 | |||
| 1514 | Ga0207703_10064578 | |||
| 1515 | Ga0207639_10018300 | |||
| 1516 | Ga0207678_10024110 | |||
| 1517 | Ga0207708_10002529 | |||
| 1518 | Ga0207708_10049932 | |||
| 1519 | Ga0207708_10126415 | |||
| 1520 | Ga0207702_10010110 | |||
| 1521 | Ga0207702_10048313 | |||
| 1522 | Ga0207702_10278556 | |||
| 1523 | Ga0207641_10001175 | |||
| 1524 | Ga0207641_10007318 | |||
| 1525 | Ga0207641_10013250 | |||
| 1526 | Ga0207641_10072629 | |||
| 1527 | Ga0207641_10122262 | |||
| 1528 | Ga0207641_10125292 | |||
| 1529 | Ga0207648_10000550 | |||
| 1530 | Ga0207648_10028619 | |||
| 1531 | Ga0207648_10052060 | |||
| 1532 | Ga0207648_10061086 | |||
| 1533 | Ga0207648_10078057 | |||
| 1534 | Ga0207676_10004867 | |||
| 1535 | Ga0207676_10031838 | |||
| 1536 | Ga0207676_10086857 | |||
| 1537 | Ga0207674_10018743 | |||
| 1538 | Ga0207674_10032831 | |||
| 1539 | Ga0207674_10115649 | |||
| 1540 | Ga0207675_100006048 | |||
| 1541 | Ga0207675_100007010 | |||
| 1542 | Ga0207675_100012751 | |||
| 1543 | Ga0207675_100017246 | |||
| 1544 | Ga0207675_100030556 | |||
| 1545 | Ga0207675_100209559 | |||
| 1546 | Ga0207675_100262402 | |||
| 1547 | Ga0207683_10169056 | |||
| 1548 | Ga0207698_10019128 | |||
| 1549 | Ga0207698_10023374 | |||
| 1550 | Ga0207698_10080992 | |||
| 1551 | Ga0207698_10153374 | |||
| 1552 | Ga0209813_10000255 | |||
| 1553 | Ga0209813_10004191 | |||
| 1554 | Ga0207428_10097293 | |||
| 1555 | Ga0268266_10000596 | |||
| 1556 | Ga0268266_10001984 | |||
| 1557 | Ga0268266_10003195 | |||
| 1558 | Ga0268266_10003489 | |||
| 1559 | Ga0268266_10009083 | |||
| 1560 | Ga0268266_10024997 | |||
| 1561 | Ga0268266_10025515 | |||
| 1562 | Ga0268266_10073745 | |||
| 1563 | Ga0268265_10048388 | |||
| 1564 | Ga0268264_10000287 | |||
| 1565 | Ga0268264_10000420 | |||
| 1566 | Ga0268264_10028551 | |||
| 1567 | Ga0268264_10064052 | |||
| 1568 | Ga0268264_10144640 | |||
| 1569 | Ga0265337_1006149 | |||
| 1570 | Ga0265326_10010375 | |||
| 1571 | Ga0265334_10000014 | |||
| 1572 | Ga0307517_10004912 | |||
| 1573 | Ga0307517_10065457 | |||
| 1574 | Ga0307517_10093494 | |||
| 1575 | Ga0307515_10000011 | |||
| 1576 | Ga0307515_10000186 | |||
| 1577 | Ga0307515_10050257 | |||
| 1578 | Ga0307515_10058448 | |||
| 1579 | Ga0307515_10065339 | |||
| 1580 | Ga0307515_10097341 | |||
| 1581 | Ga0307515_10111006 | |||
| 1582 | Ga0307515_10176786 | |||
| 1583 | Ga0265338_10000377 | |||
| 1584 | Ga0265338_10004531 | |||
| 1585 | Ga0265338_10006711 | |||
| 1586 | Ga0265338_10047374 | |||
| 1587 | Ga0307511_10000037 | |||
| 1588 | Ga0307511_10054297 | |||
| 1589 | Ga0307512_10061925 | |||
| 1590 | Ga0316182_1299158 | |||
| 1591 | Ga0265760_10016520 | |||
| 1592 | Ga0265328_10038116 | |||
| 1593 | Ga0265320_10006123 | |||
| 1594 | Ga0265325_10000155 | |||
| 1595 | Ga0265340_10000121 | |||
| 1596 | Ga0265339_10048068 | |||
| 1597 | Ga0265331_10004523 | |||
| 1598 | Ga0265331_10004710 | |||
| 1599 | Ga0265327_10000487 | |||
| 1600 | Ga0265316_10004680 | |||
| 1601 | Ga0307513_10002991 | |||
| 1602 | Ga0307513_10015253 | |||
| 1603 | Ga0307513_10016687 | |||
| 1604 | Ga0307513_10053100 | |||
| 1605 | Ga0307513_10083111 | |||
| 1606 | Ga0307513_10092686 | |||
| 1607 | Ga0307513_10234044 | |||
| 1608 | Ga0307509_10000001 | |||
| 1609 | Ga0307509_10000044 | |||
| 1610 | Ga0307509_10003432 | |||
| 1611 | Ga0307509_10004147 | |||
| 1612 | Ga0307509_10004183 | |||
| 1613 | Ga0307509_10021431 | |||
| 1614 | Ga0307509_10061981 | |||
| 1615 | Ga0307509_10095132 | |||
| 1616 | Ga0307408_100000006 | |||
| 1617 | Ga0265313_10001336 | |||
| 1618 | Ga0307508_10005121 | |||
| 1619 | Ga0307508_10011794 | |||
| 1620 | Ga0307508_10012983 | |||
| 1621 | Ga0307508_10031568 | |||
| 1622 | Ga0307514_10020475 | |||
| 1623 | Ga0307514_10040937 | |||
| 1624 | Ga0265314_10012680 | |||
| 1625 | Ga0265314_10025791 | |||
| 1626 | Ga0265342_10016314 | |||
| 1627 | Ga0265342_10018466 | |||
| 1628 | Ga0316576_10006578 | |||
| 1629 | Ga0307516_10005815 | |||
| 1630 | Ga0307516_10016202 | |||
| 1631 | Ga0307516_10017271 | |||
| 1632 | Ga0307516_10018714 | |||
| 1633 | Ga0307516_10095107 | |||
| 1634 | Ga0307516_10157445 | |||
| 1635 | Ga0307413_10003854 | |||
| 1636 | Ga0307409_100016212 | |||
| 1637 | Ga0307409_100028358 | |||
| 1638 | Ga0307409_100097567 | |||
| 1639 | Ga0307416_100013529 | |||
| 1640 | Ga0307510_10000016 | |||
| 1641 | Ga0307510_10005766 | |||
| 1642 | Ga0307510_10006502 | |||
| 1643 | Ga0307510_10008022 | |||
| 1644 | Ga0307510_10067143 | |||
| 1645 | Ga0373936_0005394 | |||
| 1646 | Ga0373936_0034391 | |||
| 1647 | Ga0373945_0013158 | |||
| 1648 | Ga0373946_0021708 | |||
| 1649 | Ga0373931_0007299 | |||
| 1650 | Ga0373931_0010537 | |||
| 1651 | Ga0373927_0063530 | |||
| 1652 | Ga0373933_0069196 | |||
| 1653 | Ga0373937_0033714 | |||
| 1654 | Ga0373937_0068466 | |||
| 1655 | Ga0373937_0148784 | |||
| 1656 | Ga0395899_0047305 | |||
| 1657 | Ga0395899_0058632 | |||
| 1658 | Ga0395900_0006806 | |||
| 1659 | Ga0395900_0014634 | |||
| 1660 | Ga0395900_0151595 | |||
| 1661 | Ga0395898_0004666 | |||
| 1662 | Ga0395898_0024464 | |||
| 1663 | Ga0395898_0150511 | |||
| 1664 | Ga0395905_0102329 | |||
| 1665 | Ga0436364_0457524 | |||
| 1666 | Ga0436364_0748817 | |||
| 1667 | Ga0395901_0020172 | |||
| 1668 | Ga0395901_0032881 | |||
| 1669 | Ga0395901_0245307 | |||
| 1670 | Ga0436365_0002580 | |||
| 1671 | Ga0436365_0327786 | |||
| 1672 | Ga0436365_0592429 | |||
| 1673 | Ga0436365_0898810 | |||
| 1674 | Ga0436365_1619143 | |||
| 1675 | Ga0436360_0112640 | |||
| 1676 | Ga0436360_0738491 | |||
| 1677 | Ga0436360_1026710 | |||
| 1678 | Ga0436360_1129771 | |||
| 1679 | Ga0436361_0395058 | |||
| 1680 | Ga0436361_0611431 | |||
| 1681 | Ga0436361_0899139 | |||
| 1682 | Ga0436363_0481565 | |||
| 1683 | Ga0436363_1106384 | |||
| 1684 | Ga0436362_0757178 | |||
| 1685 | Ga0436362_1106345 | |||
| 1686 | Ga0451791_0356334 | |||
| 1687 | Ga0451798_0226398 | |||
| 1688 | Ga0451800_0869303 | |||
| 1689 | Ga0451839_0104998 | |||
| 1690 | Ga0451847_0654707 | |||
| 1691 | Ga0451851_0138487 | |||
| 1692 | Ga0451855_0184220 | |||
| 1693 | Ga0439462_0017763 | |||
| 1694 | Ga0451577_0133997 | |||
| 1695 | Ga0466969_0002439 | |||
| 1696 | Ga0466965_0021990 | |||
| 1697 | Ga0466965_0026025 | |||
| 1698 | Ga0466965_0037781 | |||
| 1699 | Ga0466966_0006687 | |||
| 1700 | Ga0466966_0029066 | |||
| 1701 | Ga0466961_0021280 | |||
| 1702 | Ga0466963_0115462 | |||
| 1703 | Ga0466971_0073324 | |||
| 1704 | Ga0466970_0018274 | |||
| 1705 | Ga0466970_0046920 | |||
| 1706 | Ga0466970_0052692 | |||
| 1707 | Ga0466957_0019120 | |||
| 1708 | Ga0466960_0014516 | |||
| 1709 | Ga0466960_0023325 | |||
| 1710 | Ga0466960_0056478 | |||
| 1711 | Ga0466959_0061889 | |||
| 1712 | Ga0451576_0020730 | |||
| 1713 | Ga0466958_0014007 | |||
| 1714 | Ga0466967_0023032 | |||
| 1715 | Ga0466967_0043364 | |||
| 1716 | Ga0466967_0062820 | |||
| 1717 | Ga0466967_0073790 | |||
| 1718 | Ga0495627_008967 | |||
| 1719 | Ga0495592_0000203 | |||
| 1720 | Ga0495592_0073735 | |||
| 1721 | Ga0495603_0051288 | |||
| 1722 | Ga0495603_0098352 | |||
| 1723 | Ga0495590_0031669 | |||
| 1724 | Ga0495638_0004766 | |||
| 1725 | Ga0495638_0029580 | |||
| 1726 | Ga0495638_0036493 | |||
| 1727 | Ga0495653_0004980 | |||
| 1728 | Ga0495650_0010731 | |||
| 1729 | Ga0495650_0012066 | |||
| 1730 | Ga0495650_0025838 | |||
| 1731 | Ga0495582_0038368 | |||
| 1732 | Ga0495605_0015688 | |||
| 1733 | Ga0495639_0001912 | |||
| 1734 | Ga0495662_0051399 | |||
| 1735 | Ga0495664_0105373 | |||
| 1736 | Ga0495584_0005419 | |||
| 1737 | Ga0495585_0088494 | |||
| 1738 | Ga0495607_0072375 | |||
| 1739 | Ga0495583_0004172 | |||
| 1740 | Ga0495583_0069357 | |||
| 1741 | Ga0495606_0000253 | |||
| 1742 | Ga0495606_0000895 | |||
| 1743 | Ga0495606_0006342 | |||
| 1744 | Ga0495608_0000013 | |||
| 1745 | Ga0495608_0145297 | |||
| 1746 | Ga0495616_0001686 | |||
| 1747 | Ga0495616_0014165 | |||
| 1748 | Ga0495620_0054441 | |||
| 1749 | Ga0495630_0072872 | |||
| 1750 | Ga0495630_0107710 | |||
| 1751 | Ga0495632_0002177 | |||
| 1752 | Ga0495632_0002541 | |||
| 1753 | Ga0495632_0026675 | |||
| 1754 | Ga0495643_0016469 | |||
| 1755 | Ga0495643_0033054 | |||
| 1756 | Ga0495648_0033094 | |||
| 1757 | Ga0495665_0056714 | |||
| 1758 | Ga0495597_0014009 | |||
| 1759 | Ga0495622_0000566 | |||
| 1760 | Ga0495622_0017920 | |||
| 1761 | Ga0495633_0009942 | |||
| 1762 | Ga0495633_0054782 | |||
| 1763 | Ga0495656_0000232 | |||
| 1764 | Ga0495656_0045982 | |||
| 1765 | Ga0495668_0042200 | |||
| 1766 | Ga0495625_0005672 | |||
| 1767 | Ga0495625_0015246 | |||
| 1768 | Ga0495625_0015952 | |||
| 1769 | Ga0495625_0030593 | |||
| 1770 | Ga0495625_0109271 | |||
| 1771 | Ga0495635_0119992 | |||
| 1772 | Ga0495588_0001503 | |||
| 1773 | Ga0495657_0000003 | |||
| 1774 | Ga0495671_0019063 | |||
| 1775 | Ga0495649_0009300 | |||
| 1776 | Ga0495649_0032383 | |||
| 1777 | Ga0495649_0070413 | |||
| 1778 | Ga0495649_0106081 | |||
| 1779 | Ga0495660_0019406 | |||
| 1780 | Ga0495674_0011969 | |||
| 1781 | Ga0495672_0001753 | |||
| 1782 | Ga0495676_0089584 | |||
| 1783 | Ga0495680_0143410 | |||
| 1784 | Ga0495680_0152583 | |||
| 1785 | Ga0495683_0045896 | |||
| 1786 | Ga0495687_001076 | |||
| 1787 | Ga0495687_006562 | |||
| 1788 | Ga0495687_024614 | |||
| 1789 | Ga0495675_0000094 | |||
| 1790 | Ga0495684_0056481 | |||
| 1791 | Ga0495686_0000923 | |||
| 1792 | Ga0496100_0001473 | |||
| 1793 | Ga0496101_0002555 | |||
| 1794 | Ga0496101_0012522 | |||
| 1795 | Ga0496101_0018822 | |||
| 1796 | Ga0496101_0024641 | |||
| 1797 | Ga0496101_0060520 | |||
| 1798 | Ga0496102_0002386 | |||
| 1799 | Ga0496102_0005870 | |||
| 1800 | Ga0496102_0040624 | |||
| 1801 | Ga0496102_0042726 | |||
| 1802 | Ga0496102_0044793 | |||
| 1803 | Ga0496102_0104688 | |||
| 1804 | Ga0496104_0010103 | |||
| 1805 | Ga0496104_0016340 | |||
| 1806 | Ga0496104_0039296 | |||
| 1807 | Ga0496104_0048594 | |||
| 1808 | Ga0496104_0052297 | |||
| 1809 | Ga0496104_0098459 | |||
| 1810 | Ga0496104_0202856 | |||
| 1811 | Ga0496105_0000649 | |||
| 1812 | Ga0496105_0011401 | |||
| 1813 | Ga0496105_0011580 | |||
| 1814 | Ga0496105_0018169 | |||
| 1815 | Ga0496105_0020997 | |||
| 1816 | Ga0496105_0057220 | |||
| 1817 | Ga0496105_0082879 | |||
| 1818 | Ga0496105_0100044 | |||
| 1819 | Ga0496107_0002401 | |||
| 1820 | Ga0496107_0034810 | |||
| 1821 | Ga0496107_0042839 | |||
| 1822 | Ga0496107_0106667 | |||
| 1823 | Ga0496108_0003961 | |||
| 1824 | Ga0496108_0006730 | |||
| 1825 | Ga0496108_0047157 | |||
| 1826 | Ga0496108_0051740 | |||
| 1827 | Ga0496108_0072384 | |||
| 1828 | Ga0496109_0000011 | |||
| 1829 | Ga0496109_0008248 | |||
| 1830 | Ga0496109_0042602 | |||
| 1831 | Ga0496109_0062929 | |||
| 1832 | Ga0496109_0141433 | |||
| 1833 | Ga0496110_0003748 | |||
| 1834 | Ga0496110_0032013 | |||
| 1835 | Ga0496110_0040232 | |||
| 1836 | Ga0496110_0044209 | |||
| 1837 | Ga0496110_0062681 | |||
| 1838 | Ga0496110_0075894 | |||
| 1839 | Ga0496110_0220366 | |||
| 1840 | Ga0496110_0221404 | |||
| 1841 | Ga0496111_0004320 | |||
| 1842 | Ga0496111_0031555 | |||
| 1843 | Ga0496111_0048660 | |||
| 1844 | Ga0496111_0055314 | |||
| 1845 | Ga0496112_0061691 | |||
| 1846 | Ga0496113_0009214 | |||
| 1847 | Ga0496113_0043947 | |||
| 1848 | Ga0496114_0000691 | |||
| 1849 | Ga0496114_0004625 | |||
| 1850 | Ga0496114_0014043 | |||
| 1851 | Ga0496114_0021689 | |||
| 1852 | Ga0496114_0055385 | |||
| 1853 | Ga0496114_0087299 | |||
| 1854 | Ga0496115_0004033 | |||
| 1855 | Ga0496115_0005460 | |||
| 1856 | Ga0496115_0128209 | |||
| 1857 | Ga0496115_0143409 | |||
| 1858 | Ga0496116_0006937 | |||
| 1859 | Ga0496116_0009097 | |||
| 1860 | Ga0496117_0000211 | |||
| 1861 | Ga0496117_0002066 | |||
| 1862 | Ga0496117_0059146 | |||
| 1863 | Ga0496118_0000005 | |||
| 1864 | Ga0496118_0001422 | |||
| 1865 | Ga0496118_0008974 | |||
| 1866 | Ga0496118_0093165 | |||
| 1867 | Ga0496119_0001007 | |||
| 1868 | Ga0496119_0020348 | |||
| 1869 | Ga0496120_0000242 | |||
| 1870 | Ga0496121_0000245 | |||
| 1871 | Ga0496121_0001299 | |||
| 1872 | Ga0496121_0001771 | |||
| 1873 | Ga0496121_0006402 | |||
| 1874 | Ga0496121_0016052 | |||
| 1875 | Ga0496121_0016227 | |||
| 1876 | Ga0496122_0043664 | |||
| 1877 | Ga0496123_0026983 | |||
| 1878 | Ga0496125_0000220 | |||
| 1879 | Ga0496125_0002613 | |||
| 1880 | Ga0496125_0017234 | |||
| 1881 | Ga0496125_0056000 | |||
| 1882 | Ga0496126_0000082 | |||
| 1883 | Ga0496126_0007294 | |||
| 1884 | Ga0496126_0012911 | |||
| 1885 | Ga0496126_0030405 | |||
| 1886 | Ga0496126_0070007 | |||
| 1887 | Ga0496126_0100817 | |||
| 1888 | Ga0496126_0228916 | |||
| 1889 | Ga0495678_046199 | |||
| 1890 | Ga0501031_0009449 | |||
| 1891 | Ga0501031_0017540 | |||
| 1892 | Ga0501032_0001352 | |||
| 1893 | Ga0501032_0016245 | |||
| 1894 | Ga0501032_0093024 | |||
| 1895 | Ga0501033_0002715 | |||
| 1896 | Ga0501033_0009073 | |||
| 1897 | Ga0501033_0014485 | |||
| 1898 | Ga0501033_0031456 | |||
| 1899 | Ga0501033_0044138 | |||
| 1900 | Ga0501033_0058023 | |||
| 1901 | Ga0501034_0006801 | |||
| 1902 | Ga0501034_0015328 | |||
| 1903 | Ga0501034_0043680 | |||
| 1904 | Ga0501034_0096216 | |||
| 1905 | Ga0501034_0096509 | |||
| 1906 | Ga0501034_0148802 | |||
| 1907 | Ga0501034_0273039 | |||
| 1908 | Ga0501036_0010613 | |||
| 1909 | Ga0501036_0015326 | |||
| 1910 | Ga0501036_0062996 | |||
| 1911 | Ga0501037_0002323 | |||
| 1912 | Ga0501037_0008734 | |||
| 1913 | Ga0501037_0030998 | |||
| 1914 | Ga0501038_0012761 | |||
| 1915 | Ga0501038_0019872 | |||
| 1916 | Ga0501038_0045082 | |||
| 1917 | Ga0501038_0058778 | |||
| 1918 | Ga0501038_0080373 | |||
| 1919 | Ga0501038_0081980 | |||
| 1920 | Ga0501039_0040228 | |||
| 1921 | Ga0501039_0056362 | |||
| 1922 | Ga0501042_0011333 | |||
| 1923 | Ga0501042_0054774 | |||
| 1924 | Ga0501042_0074421 | |||
| 1925 | Ga0501042_0100653 | |||
| 1926 | Ga0501042_0109130 | |||
| 1927 | Ga0501043_0022731 | |||
| 1928 | Ga0501043_0038345 | |||
| 1929 | Ga0501043_0038622 | |||
| 1930 | Ga0501043_0102213 | |||
| 1931 | Ga0501046_0000440 | |||
| 1932 | Ga0501046_0013547 | |||
| 1933 | Ga0501047_0017363 | |||
| 1934 | Ga0501047_0041195 | |||
| 1935 | Ga0501047_0075066 | |||
| 1936 | Ga0501047_0091725 | |||
| 1937 | Ga0501047_0124366 | |||
| 1938 | Ga0501047_0138227 | |||
| 1939 | Ga0501047_0204700 | |||
| 1940 | Ga0501047_0212777 | |||
| 1941 | Ga0501048_0003540 | |||
| 1942 | Ga0501048_0009975 | |||
| 1943 | Ga0501048_0054097 | |||
| 1944 | Ga0501067_0005392 | |||
| 1945 | Ga0501067_0023499 | |||
| 1946 | Ga0501067_0065926 | |||
| 1947 | Ga0501068_0013764 | |||
| 1948 | Ga0501068_0018284 | |||
| 1949 | Ga0501068_0026499 | |||
| 1950 | Ga0501069_0001873 | |||
| 1951 | Ga0501069_0097792 | |||
| 1952 | Ga0501070_0005021 | |||
| 1953 | Ga0501070_0020638 | |||
| 1954 | Ga0501070_0042508 | |||
| 1955 | Ga0501070_0044489 | |||
| 1956 | Ga0501070_0049291 | |||
| 1957 | Ga0501070_0050550 | |||
| 1958 | Ga0501071_0000964 | |||
| 1959 | Ga0501071_0052107 | |||
| 1960 | Ga0501071_0081063 | |||
| 1961 | Ga0501071_0167675 | |||
| 1962 | Ga0501072_0007154 | |||
| 1963 | Ga0501072_0037835 | |||
| 1964 | Ga0501072_0085303 | |||
| 1965 | Ga0501073_0004452 | |||
| 1966 | Ga0501073_0028934 | |||
| 1967 | Ga0501073_0034168 | |||
| 1968 | Ga0501073_0049326 | |||
| 1969 | Ga0501073_0103994 | |||
| 1970 | Ga0501073_0111102 | |||
| 1971 | Ga0501074_0000164 | |||
| 1972 | Ga0501074_0002061 | |||
| 1973 | Ga0501074_0017736 | |||
| 1974 | Ga0501074_0027835 | |||
| 1975 | Ga0501074_0097952 | |||
| 1976 | Ga0501074_0106853 | |||
| 1977 | Ga0501076_0003060 | |||
| 1978 | Ga0501077_0001810 | |||
| 1979 | Ga0501079_0000806 | |||
| 1980 | Ga0501079_0006265 | |||
| 1981 | Ga0501079_0018566 | |||
| 1982 | Ga0501080_0004388 | |||
| 1983 | Ga0501080_0021347 | |||
| 1984 | Ga0501080_0047414 | |||
| 1985 | Ga0501080_0068905 | |||
| 1986 | Ga0501080_0127202 | |||
| 1987 | Ga0501080_0131057 | |||
| 1988 | Ga0501080_0205331 | |||
| 1989 | Ga0501081_0047429 | |||
| 1990 | Ga0501081_0129275 | |||
| 1991 | Ga0501083_0002676 | |||
| 1992 | Ga0501083_0007870 | |||
| 1993 | Ga0501083_0017374 | |||
| 1994 | Ga0501035_0000595 | |||
| 1995 | Ga0501035_0004343 | |||
| 1996 | Ga0501035_0032187 | |||
| 1997 | Ga0501035_0034734 | |||
| 1998 | Ga0501044_0001080 | |||
| 1999 | Ga0501044_0001470 | |||
| 2000 | Ga0501044_0003782 | |||
| 2001 | Ga0501044_0009792 | |||
| 2002 | Ga0501044_0013472 | |||
| 2003 | Ga0501044_0037938 | |||
| 2004 | Ga0501044_0059359 | |||
| 2005 | Ga0501045_0017641 | |||
| 2006 | nmdc:mga03683_26791_c1 | |||
| 2007 | nmdc:mga03683_8566_c1 | |||
| 2008 | nmdc:mga03n38_11631_c1 | |||
| 2009 | nmdc:mga03n38_23432_c1 | |||
| 2010 | nmdc:mga03n38_557_c1 | |||
| 2011 | nmdc:mga00v17_104215_c1 | |||
| 2012 | nmdc:mga00v17_1591_c1 | |||
| 2013 | nmdc:mga00v17_6139_c1 | |||
| 2014 | nmdc:mga00v17_64745_c1 | |||
| 2015 | nmdc:mga00v17_6677_c1 | |||
| 2016 | nmdc:mga00v17_8643_c1 | |||
| 2017 | nmdc:mga0yw44_112001_c1 | |||
| 2018 | nmdc:mga0yw44_13053_c1 | |||
| 2019 | nmdc:mga0yw44_17806_c2 | |||
| 2020 | nmdc:mga0yw44_27806_c1 | |||
| 2021 | nmdc:mga0yw44_29570_c1 | |||
| 2022 | nmdc:mga0yw44_33599_c1 | |||
| 2023 | nmdc:mga0yw44_58716_c1 | |||
| 2024 | nmdc:mga0yw44_6559_c1 | |||
| 2025 | nmdc:mga0k408_23318_c1 | |||
| 2026 | nmdc:mga06z11_3678_c1 | |||
| 2027 | nmdc:mga06z11_60060_c1 | |||
| 2028 | nmdc:mga04h51_4676_c1 | |||
| 2029 | nmdc:mga04h51_6017_c1 | |||
| 2030 | nmdc:mga07m45_136846_c1 | |||
| 2031 | nmdc:mga07m45_1431_c1 | |||
| 2032 | nmdc:mga07m45_14526_c1 | |||
| 2033 | nmdc:mga07m45_15022_c1 | |||
| 2034 | nmdc:mga07m45_1612_c1 | |||
| 2035 | nmdc:mga07m45_22035_c1 | |||
| 2036 | nmdc:mga07m45_37676_c1 | |||
| 2037 | nmdc:mga05p37_411199_c1 | |||
| 2038 | nmdc:mga05p37_4665_c1 | |||
| 2039 | nmdc:mga09592_9512_c1 | |||
| 2040 | nmdc:mga0qj67_142782_c1 | |||
| 2041 | nmdc:mga0qj67_3934_c1 | |||
| 2042 | nmdc:mga06r32_3907_c1 | |||
| 2043 | nmdc:mga08y16_55772_c1 | |||
| 2044 | nmdc:mga0sz30_4483_c1 | |||
| 2045 | Ga0495601_0010824 | |||
| 2046 | Ga0495601_0062416 | |||
| 2047 | Ga0495655_0001453 | |||
| 2048 | Ga0495595_0000007 | |||
| 2049 | Ga0495595_0018898 | |||
| 2050 | Ga0495595_0050785 | |||
| 2051 | Ga0495619_0000067 | |||
| 2052 | Ga0495619_0020724 | |||
| 2053 | Ga0500578_0000011 | |||
| 2054 | Ga0500643_000008 | |||
| 2055 | Ga0500644_0000204 | |||
| 2056 | Ga0500583_0034679 | |||
| 2057 | Ga0500651_0002949 | |||
| 2058 | Ga0500566_0000162 | |||
| 2059 | Ga0500566_0008386 | |||
| 2060 | Ga0500556_0000317 | |||
| 2061 | Ga0500556_0001079 | |||
| 2062 | Ga0500593_002351 | |||
| 2063 | Ga0500593_010832 | |||
| 2064 | Ga0500595_003028 | |||
| 2065 | Ga0500607_038321 | |||
| 2066 | Ga0500617_023549 | |||
| 2067 | Ga0500628_000798 | |||
| 2068 | Ga0500652_000189 | |||
| 2069 | Ga0500658_0008263 | |||
| 2070 | Ga0500559_0000097 | |||
| 2071 | Ga0500559_0012325 | |||
| 2072 | Ga0500568_0004967 | |||
| 2073 | Ga0500588_0000286 | |||
| 2074 | Ga0500590_000044 | |||
| 2075 | Ga0500590_025761 | |||
| 2076 | Ga0500616_0000491 | |||
| 2077 | Ga0500616_0018420 | |||
| 2078 | Ga0500622_0000097 | |||
| 2079 | Ga0500622_0000434 | |||
| 2080 | Ga0500622_0000978 | |||
| 2081 | Ga0500622_0001119 | |||
| 2082 | Ga0500622_0007159 | |||
| 2083 | Ga0500633_0000920 | |||
| 2084 | Ga0500645_001558 | |||
| 2085 | Ga0500587_001071 | |||
| 2086 | Ga0501084_0001034 | |||
| 2087 | Ga0501084_0005366 | |||
| 2088 | Ga0501084_0024439 | |||
| 2089 | Ga0501082_0001324 | |||
| 2090 | Ga0501082_0002035 | |||
| 2091 | Ga0501082_0004992 | |||
| 2092 | Ga0501082_0067845 | |||
| 2093 | 2509391201 | |||
| 2094 | 2510892209 | |||
| 2095 | 2511194983 | |||
| 2096 | 2513599358 | |||
| 2097 | 2513713614 | |||
| 2098 | 2514023313 | |||
| 2099 | 2515632134 | |||
| 2100 | 2515644564 | |||
| 2101 | 2515660011 | |||
| 2102 | 2517409976 | |||
| 2103 | 2520375415 | |||
| 2104 | 2535520758 | |||
| 2105 | 2585205188 | |||
| 2106 | 2585226332 | |||
| 2107 | 2585404916 | |||
| 2108 | 2585548748 | |||
| 2109 | 2587730368 | |||
| 2110 | 2587736862 | |||
| 2111 | 2588291765 | |||
| 2112 | 2600201911 | |||
| 2113 | 2617386532 | |||
| 2114 | 2643825025 | |||
| 2115 | 2643893200 | |||
| 2116 | 2643961741 | |||
| 2117 | 2643972410 | |||
| 2118 | 2644034069 | |||
| 2119 | 2644092719 | |||
| 2120 | 2644099492 | |||
| 2121 | 2644116315 | |||
| 2122 | 2644138582 | |||
| 2123 | 2644193921 | |||
| 2124 | 2644207894 | |||
| 2125 | 2644272918 | |||
| 2126 | 2644305233 | |||
| 2127 | 2644322332 | |||
| 2128 | 2644534668 | |||
| 2129 | 2644651169 | |||
| 2130 | 2738723276 | |||
| 2131 | 2738871271 | |||
| 2132 | 2738885599 | |||
| 2133 | 2739284007 | |||
| 2134 | 2739362073 | |||
| 2135 | 2740167923 | |||
| 2136 | 2753036132 | |||
| 2137 | 2753324004 | |||
| 2138 | 2753766660 | |||
| 2139 | 2766066970 | |||
| 2140 | 2793316665 | |||
| 2141 | 2793319950 | |||
| 2142 | 2812333868 | |||
| 2143 | 2819425480 | |||
| 2144 | 2819667850 | |||
| 2145 | 2819690248 | |||
| 2146 | 2819726204 | |||
| 2147 | 2841868673 | |||
| 2148 | 2842111837 | |||
| 2149 | 2842219608 | |||
| 2150 | 2842342621 | |||
| 2151 | 2842365603 | |||
| 2152 | 2857485428 | |||
| 2153 | 2861695604 | |||
| 2154 | 2894657232 | |||
| 2155 | 2904579755 | |||
| 2156 | 2909048386 | |||
| 2157 | 2919120577 | |||
| 2158 | 2928120481 | |||
| 2159 | 2933588113 | |||
| 2160 | 639645320 | |||
| 2161 | 8005548531 | |||
| 2162 | 8024487374 | |||
| 2163 | 8046772967 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lgv-assembly1.cif.gz_D | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.8899 | 13 | 474 |
| 4lgv-assembly1.cif.gz_B | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.8817 | 9 | 474 |
| 4lgv-assembly1.cif.gz_D | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.8804 | 13 | 474 |
| 5ukw-assembly1.cif.gz_A | crystal structure of human glucose 6-phosphate dehydrogenase mutant (a277c) complexed with g6p | 0.8761 | 12 | 473 |
| 4lgv-assembly1.cif.gz_A | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.8753 | 12 | 474 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WN73_32_206_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9249 | 18 | 181 | 3.40.50.720 |
| 1e7mA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9087 | 13 | 178 | 3.40.50.720 |
| af_O14137_1_171_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9037 | 14 | 178 | 3.40.50.720 |
| af_Q557D2_7_178_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8813 | 12 | 178 | 3.40.50.720 |
| 4lgvD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8804 | 13 | 178 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P0DV66-F1-model_v4 | Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) | 0.9853 | 28 | 164 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A534WCE8-F1-model_v4 | Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) | 0.9802 | 1 | 171 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A6P0DV66-F1-model_v4 | Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) | 0.9782 | 28 | 164 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A534WCE8-F1-model_v4 | Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) | 0.9746 | 1 | 171 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A6N9V909-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9699 | 219 | 333 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |