F489679

General Info

Members Datasets Scaffolds Average Seq Length
1081 485 2163 484

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10136773|Ga0207678_101367731
Length 552
Sequence MKPAHTDASAAAKVFEGPTTLLPQPCQLVIFGGPGDLSWRKLLPAVYNLDVDGVLPSHFTVVAFGVPAEGASDADPDEYIRARAKSGIARFSRQAIDEATWANFARGLFFVQGSFNDMRAYEQLKARLDSLDQQFGIPGSRVYYLAVSPGLVGQCVEHLQAAGMIRDPADTTAFTRVIIEKPIGRDLESARAVNRVVGAAFAESQTYRIDHYLGKETVQNLLVLRFANSIFEPLWNSKSIDHVQITVAEDEGLAQYDPITGELIATRAGYYEGIGALRDMVQNHMLQVLCVMAMEPPWSLAPEVVRDAKVGVLNCLRPLSKADVDKQVVRGQYIEGDVHGQRVPGYRKEVRASFEAMGRTLPRSSVNSTTETFVALRLFIDNWRWAGVPFYLRTGKRLPKRVSEVAIQFKDVPQILFNANPEFQLEPTVLSVRVQPEEGLSMRIASKLPGPKIRIYPVKMEFNYASSFGGSSPEAYERLILDAMRGDHTLFNTAEGIERLWEVSTPLLEAPPPVRLYAPGSWGPNAIHQLIAPRAWRLPFERVWRDPNKAGA

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
106 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
206 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
207 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
208 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
226 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
250 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
251 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
252 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
253 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
254 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
255 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
256 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
360 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
361 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
362 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
373 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
379 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
380 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
381 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
382 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
383 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
384 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
385 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
391 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
392 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
393 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
394 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
395 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
396 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
397 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
398 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
399 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
400 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
401 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
402 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
403 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
404 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
405 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
406 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
407 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
408 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
409 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
410 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
411 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
412 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
413 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
414 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
415 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
416 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
417 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
418 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
419 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
420 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
421 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
422 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
423 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
424 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
425 2519899620 Rhizobium sp. Pop5 Isolate Nodule
426 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
427 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
428 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
429 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
430 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
431 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
432 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
433 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
434 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
435 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
436 2643221561 Nocardioides sp. Root151 Isolate Unclassified
437 2643221576 Nocardioides sp. Root614 Isolate Unclassified
438 2643221590 Nocardioides sp. Root682 Isolate Unclassified
439 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
440 2643221604 Nocardioides sp. Root190 Isolate Unclassified
441 2643221615 Nocardioides sp. Root224 Isolate Unclassified
442 2643221617 Nocardioides sp. Root79 Isolate Unclassified
443 2643221620 Nocardioides sp. Root240 Isolate Unclassified
444 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
445 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
446 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
447 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
448 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
449 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
450 2643221696 Nocardioides sp. Root140 Isolate Unclassified
451 2643221718 Rhizobium sp. Root268 Isolate Unclassified
452 2738541277 Variovorax sp. GV051 Isolate Unclassified
453 2738541305 Nocardioides sp. CF167 Isolate Unclassified
454 2738541307 Variovorax sp. GV008 Isolate Unclassified
455 2738543019 Variovorax sp. GV040 Isolate Unclassified
456 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
457 2739367898 Nocardioides sp. CF479 Isolate Unclassified
458 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
459 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
460 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
461 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
462 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
463 2791355260 Rhizobium sp. L9 Isolate Nodule
464 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
465 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
466 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
467 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
468 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
469 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
470 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
471 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
472 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
473 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
474 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
475 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
476 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
477 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
478 2909042592 Labrys sp. LIt4 Isolate Nodule
479 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
480 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
481 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
482 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
483 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
484 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
485 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.34
Metatranscriptomes 0.09
Isolates 6.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.04
Nodule 2.31
Rhizoplane 6.48
Rhizosphere 66.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10136773 3300026067 Bacteria 2090
2 JGI24744J21845_10004395 3300002077 Bacteria 2913
3 JGI25158J39367_1000043 3300002739 Bacteria 28682
4 JGI25152J39213_1001831 3300002773 Bacteria 8576
5 JGI25152J39213_1007690 3300002773 Bacteria 2765
6 JGI25153J46596_10003067 3300003215 Bacteria 9436
7 rootH1_10008151 3300003316 Bacteria 4564
8 rootH1_10008151 3300003323 Bacteria 6827
9 rootH1_10117972 3300003323 Bacteria 2674
10 JGI25160J50197_1009936 3300003354 Bacteria 3484
11 JGI25161J50226_1000027 3300003374 Bacteria 145847
12 Ga0055526_1001863 3300003771 Bacteria 14611
13 Ga0055526_1013303 3300003771 Bacteria 3493
14 Ga0055528_1015656 3300003790 Bacteria 2727
15 Ga0055540_1004588 3300003792 Bacteria 6138
16 Ga0055543_1000100 3300004625 Bacteria 74795
17 Ga0065165_1001841 3300005262 Bacteria 20687
18 Ga0065707_10085008 3300005295 Bacteria 6545
19 Ga0070676_10006514 3300005328 Bacteria 6238
20 Ga0070683_100008299 3300005329 Bacteria 8828
21 Ga0070683_100009231 3300005329 Bacteria 8424
22 Ga0070683_100061774 3300005329 Bacteria 3483
23 Ga0070683_100167254 3300005329 Bacteria 2087
24 Ga0070690_100041805 3300005330 Bacteria 2903
25 Ga0070670_100064046 3300005331 Bacteria 3155
26 Ga0070677_10000706 3300005333 Bacteria 11224
27 Ga0070677_10007124 3300005333 Bacteria 3726
28 Ga0068869_100033427 3300005334 Bacteria 3630
29 Ga0070666_10012082 3300005335 Bacteria 5438
30 Ga0070666_10066872 3300005335 Bacteria 2440
31 Ga0070680_100002950 3300005336 Bacteria 12645
32 Ga0070682_100000061 3300005337 Bacteria 105134
33 Ga0070682_100003688 3300005337 Bacteria 8507
34 Ga0070682_100064723 3300005337 Bacteria 2321
35 Ga0068868_100020471 3300005338 Bacteria 4972
36 Ga0068868_100069539 3300005338 Bacteria 2806
37 Ga0068868_100095259 3300005338 Bacteria 2403
38 Ga0068868_100223581 3300005338 Bacteria 1577
39 Ga0070660_100022184 3300005339 Bacteria 4692
40 Ga0070689_100001851 3300005340 Bacteria 13625
41 Ga0070689_100083681 3300005340 Bacteria 2507
42 Ga0070692_10007517 3300005345 Bacteria 4803
43 Ga0070675_100022065 3300005354 Bacteria 5087
44 Ga0070675_100025410 3300005354 Bacteria 4749
45 Ga0070671_100020733 3300005355 Bacteria 5361
46 Ga0070673_100024552 3300005364 Bacteria 4422
47 Ga0070688_100011943 3300005365 Bacteria 4850
48 Ga0070688_100062643 3300005365 Bacteria 2355
49 Ga0070667_100000967 3300005367 Bacteria 26443
50 Ga0070667_100002581 3300005367 Bacteria 15733
51 Ga0070667_100034441 3300005367 Bacteria 4236
52 Ga0070667_100178439 3300005367 Bacteria 1878
53 Ga0070709_10025237 3300005434 Bacteria 3509
54 Ga0070714_100059436 3300005435 Bacteria 3278
55 Ga0070713_100141208 3300005436 Bacteria 2134
56 Ga0070701_10038650 3300005438 Bacteria 2417
57 Ga0070701_10050854 3300005438 Bacteria 2148
58 Ga0070711_100008954 3300005439 Bacteria 6143
59 Ga0070705_100052090 3300005440 Bacteria 2390
60 Ga0070700_100092156 3300005441 Bacteria 1980
61 Ga0070708_100058413 3300005445 Bacteria 3437
62 Ga0070681_10002000 3300005458 Bacteria 18452
63 Ga0070681_10027724 3300005458 Bacteria 5695
64 Ga0068867_100001469 3300005459 Bacteria 16336
65 Ga0068867_100047796 3300005459 Bacteria 3146
66 Ga0070706_100004269 3300005467 Bacteria 13866
67 Ga0070706_100114382 3300005467 Bacteria 2513
68 Ga0070706_100194924 3300005467 Bacteria 1893
69 Ga0070698_100001386 3300005471 Bacteria 26868
70 Ga0070698_100046507 3300005471 Bacteria 4437
71 Ga0070699_100046067 3300005518 Bacteria 3774
72 Ga0070699_100151915 3300005518 Bacteria 2048
73 Ga0070679_100013436 3300005530 Bacteria 7840
74 Ga0070679_100027028 3300005530 Bacteria 5642
75 Ga0070679_100073717 3300005530 Bacteria 3404
76 Ga0070684_100004622 3300005535 Bacteria 10498
77 Ga0070697_100023957 3300005536 Bacteria 4857
78 Ga0070672_100000005 3300005543 Bacteria 121014
79 Ga0070672_100001159 3300005543 Bacteria 16111
80 Ga0070672_100005485 3300005543 Bacteria 8411
81 Ga0070672_100040468 3300005543 Bacteria 3576
82 Ga0070672_100054676 3300005543 Bacteria 3126
83 Ga0070672_100067276 3300005543 Bacteria 2838
84 Ga0070672_100122881 3300005543 Bacteria 2127
85 Ga0070686_100004637 3300005544 Bacteria 7580
86 Ga0070686_100021257 3300005544 Bacteria 3854
87 Ga0070665_100000566 3300005548 Bacteria 51646
88 Ga0070665_100001336 3300005548 Bacteria 29314
89 Ga0070665_100002579 3300005548 Bacteria 19853
90 Ga0070665_100008692 3300005548 Bacteria 10277
91 Ga0070665_100012031 3300005548 Bacteria 8730
92 Ga0070665_100034625 3300005548 Bacteria 5079
93 Ga0070665_100041042 3300005548 Bacteria 4650
94 Ga0070665_100055601 3300005548 Bacteria 3969
95 Ga0068855_100000327 3300005563 Bacteria 59054
96 Ga0068855_100000479 3300005563 Bacteria 49224
97 Ga0068855_100004779 3300005563 Bacteria 16536
98 Ga0068855_100048599 3300005563 Bacteria 5006
99 Ga0068855_100134114 3300005563 Bacteria 2826
100 Ga0068855_100136947 3300005563 Bacteria 2793
101 Ga0070664_100019671 3300005564 Bacteria 5556
102 Ga0070664_100054357 3300005564 Bacteria 3397
103 Ga0068856_100005787 3300005614 Bacteria 12182
104 Ga0068856_100104020 3300005614 Bacteria 2832
105 Ga0068856_100132386 3300005614 Bacteria 2499
106 Ga0068856_100192913 3300005614 Bacteria 2051
107 Ga0070702_100019013 3300005615 Bacteria 3573
108 Ga0070702_100031825 3300005615 Bacteria 2889
109 Ga0070702_100116255 3300005615 Bacteria 1667
110 Ga0068852_100004825 3300005616 Bacteria 9580
111 Ga0068852_100035444 3300005616 Bacteria 4163
112 Ga0068852_100080734 3300005616 Bacteria 2885
113 Ga0068852_100175914 3300005616 Bacteria 2010
114 Ga0068859_100006016 3300005617 Bacteria 12327
115 Ga0068859_100018500 3300005617 Bacteria 7001
116 Ga0068859_100068400 3300005617 Bacteria 3586
117 Ga0068859_100141878 3300005617 Bacteria 2476
118 Ga0068859_100176913 3300005617 Bacteria 2215
119 Ga0068864_100008855 3300005618 Bacteria 8296
120 Ga0068864_100014290 3300005618 Bacteria 6594
121 Ga0068864_100031966 3300005618 Bacteria 4468
122 Ga0068864_100094347 3300005618 Bacteria 2645
123 Ga0068866_10008363 3300005718 Bacteria 4357
124 Ga0068866_10016882 3300005718 Bacteria 3272
125 Ga0068861_100001686 3300005719 Bacteria 14171
126 Ga0068861_100004568 3300005719 Bacteria 9295
127 Ga0068861_100005967 3300005719 Bacteria 8273
128 Ga0068861_100034539 3300005719 Bacteria 3740
129 Ga0068861_100050147 3300005719 Bacteria 3164
130 Ga0068861_100065417 3300005719 Bacteria 2801
131 Ga0068861_100082644 3300005719 Bacteria 2518
132 Ga0068870_10016817 3300005840 Bacteria 3505
133 Ga0068870_10088242 3300005840 Bacteria 1728
134 Ga0068863_100011481 3300005841 Bacteria 8565
135 Ga0068863_100078590 3300005841 Bacteria 3124
136 Ga0068863_100127377 3300005841 Bacteria 2430
137 Ga0068863_100155869 3300005841 Bacteria 2187
138 Ga0068858_100002321 3300005842 Bacteria 19227
139 Ga0068858_100004646 3300005842 Bacteria 13454
140 Ga0068858_100007963 3300005842 Bacteria 10211
141 Ga0068858_100040576 3300005842 Bacteria 4317
142 Ga0068860_100000470 3300005843 Bacteria 50165
143 Ga0068860_100082225 3300005843 Bacteria 3063
144 Ga0068860_100094501 3300005843 Bacteria 2850
145 Ga0068862_100036157 3300005844 Bacteria 4185
146 Ga0081455_10002149 3300005937 Bacteria 23509
147 Ga0081455_10002595 3300005937 Bacteria 21431
148 Ga0081455_10012181 3300005937 Bacteria 8588
149 Ga0081455_10020543 3300005937 Bacteria 6214
150 Ga0081455_10033753 3300005937 Bacteria 4594
151 Ga0081455_10050302 3300005937 Bacteria 3585
152 Ga0081538_10000022 3300005981 Bacteria 131167
153 Ga0081540_1005379 3300005983 Bacteria 9573
154 Ga0081540_1012367 3300005983 Bacteria 5630
155 Ga0081539_10000159 3300005985 Bacteria 157561
156 Ga0081539_10003942 3300005985 Bacteria 17196
157 Ga0081539_10009579 3300005985 Bacteria 8058
158 Ga0070717_10016752 3300006028 Bacteria 5688
159 Ga0075365_10001309 3300006038 Bacteria 11113
160 Ga0075365_10003178 3300006038 Bacteria 8388
161 Ga0075365_10005649 3300006038 Bacteria 6773
162 Ga0075365_10016962 3300006038 Bacteria 4446
163 Ga0075365_10019010 3300006038 Bacteria 4232
164 Ga0075365_10046261 3300006038 Bacteria 2857
165 Ga0075365_10053282 3300006038 Bacteria 2679
166 Ga0075368_10001032 3300006042 Bacteria 8718
167 Ga0075368_10001687 3300006042 Bacteria 7093
168 Ga0075368_10009161 3300006042 Bacteria 3557
169 Ga0075368_10014667 3300006042 Bacteria 2899
170 Ga0075363_100004619 3300006048 Bacteria 6049
171 Ga0075363_100008063 3300006048 Bacteria 4885
172 Ga0075363_100014602 3300006048 Bacteria 3843
173 Ga0075363_100056895 3300006048 Bacteria 2097
174 Ga0075364_10000624 3300006051 Bacteria 18225
175 Ga0075364_10003803 3300006051 Bacteria 8635
176 Ga0075364_10003820 3300006051 Bacteria 8623
177 Ga0075364_10017125 3300006051 Bacteria 4522
178 Ga0075364_10020301 3300006051 Bacteria 4178
179 Ga0075364_10032639 3300006051 Bacteria 3348
180 Ga0075364_10068764 3300006051 Bacteria 2329
181 Ga0070715_10006280 3300006163 Bacteria 4027
182 Ga0070712_100044730 3300006175 Bacteria 3054
183 Ga0070712_100059186 3300006175 Bacteria 2697
184 Ga0075367_10004567 3300006178 Bacteria 6775
185 Ga0075367_10005175 3300006178 Bacteria 6446
186 Ga0075369_10000119 3300006186 Bacteria 21759
187 Ga0075369_10018822 3300006186 Bacteria 2815
188 Ga0075366_10006300 3300006195 Bacteria 6491
189 Ga0075366_10007947 3300006195 Bacteria 5871
190 Ga0075366_10010334 3300006195 Bacteria 5239
191 Ga0075366_10010484 3300006195 Bacteria 5203
192 Ga0075366_10063026 3300006195 Bacteria 2203
193 Ga0097621_100003890 3300006237 Bacteria 10352
194 Ga0097621_100009897 3300006237 Bacteria 6946
195 Ga0075370_10000383 3300006353 Bacteria 16303
196 Ga0075370_10002885 3300006353 Bacteria 8061
197 Ga0075370_10007701 3300006353 Bacteria 5499
198 Ga0075370_10008408 3300006353 Bacteria 5312
199 Ga0075370_10030970 3300006353 Bacteria 2985
200 Ga0075370_10038957 3300006353 Bacteria 2677
201 Ga0075370_10085917 3300006353 Bacteria 1812
202 Ga0068871_100007165 3300006358 Bacteria 7957
203 Ga0075428_100001401 3300006844 Bacteria 25642
204 Ga0075428_100027074 3300006844 Bacteria 6348
205 Ga0075428_100073956 3300006844 Bacteria 3722
206 Ga0075430_100004725 3300006846 Bacteria 11455
207 Ga0075431_100004352 3300006847 Bacteria 13890
208 Ga0075431_100019791 3300006847 Bacteria 6871
209 Ga0075431_100133566 3300006847 Bacteria 2559
210 Ga0075434_100082889 3300006871 Bacteria 3204
211 Ga0075434_100132129 3300006871 Bacteria 2516
212 Ga0075429_100001477 3300006880 Bacteria 19337
213 Ga0068865_100010323 3300006881 Bacteria 5809
214 Ga0097620_100006016 3300006931 Bacteria 12327
215 Ga0097620_100018500 3300006931 Bacteria 7001
216 Ga0097620_100068400 3300006931 Bacteria 3586
217 Ga0097620_100141867 3300006931 Bacteria 2476
218 Ga0097620_100176918 3300006931 Bacteria 2215
219 Ga0099794_10001837 3300007265 Bacteria 7592
220 Ga0099794_10006637 3300007265 Bacteria 4700
221 Ga0099794_10066949 3300007265 Bacteria 1753
222 Ga0099795_10000213 3300007788 Bacteria 10001
223 Ga0105250_10000005 3300009092 Bacteria 422580
224 Ga0105240_10000215 3300009093 Bacteria 115967
225 Ga0105240_10000587 3300009093 Bacteria 67507
226 Ga0105240_10002394 3300009093 Bacteria 30190
227 Ga0105240_10011765 3300009093 Bacteria 12157
228 Ga0105240_10011928 3300009093 Bacteria 12050
229 Ga0105240_10025141 3300009093 Bacteria 7831
230 Ga0105240_10049046 3300009093 Bacteria 5333
231 Ga0105240_10127737 3300009093 Bacteria 3053
232 Ga0105240_10157215 3300009093 Bacteria 2702
233 Ga0105240_10223337 3300009093 Bacteria 2193
234 Ga0105240_10226453 3300009093 Bacteria 2175
235 Ga0111539_10049954 3300009094 Bacteria 4984
236 Ga0111539_10212266 3300009094 Bacteria 2255
237 Ga0105245_10003386 3300009098 Bacteria 14283
238 Ga0105245_10005468 3300009098 Bacteria 11159
239 Ga0105245_10068852 3300009098 Bacteria 3208
240 Ga0105247_10002551 3300009101 Bacteria 12355
241 Ga0105247_10014662 3300009101 Bacteria 4699
242 Ga0105247_10019262 3300009101 Bacteria 4095
243 Ga0105247_10025217 3300009101 Bacteria 3587
244 Ga0114129_10001245 3300009147 Bacteria 33926
245 Ga0105243_10007737 3300009148 Bacteria 8262
246 Ga0105243_10038713 3300009148 Bacteria 3714
247 Ga0105243_10126363 3300009148 Bacteria 2164
248 Ga0105243_10160217 3300009148 Bacteria 1939
249 Ga0105241_10080097 3300009174 Bacteria 2555
250 Ga0105242_10021791 3300009176 Bacteria 5035
251 Ga0105242_10113114 3300009176 Bacteria 2318
252 Ga0105248_10206868 3300009177 Bacteria 2211
253 Ga0105237_10000560 3300009545 Bacteria 52008
254 Ga0105237_10004790 3300009545 Bacteria 15552
255 Ga0105237_10044948 3300009545 Bacteria 4447
256 Ga0105237_10187773 3300009545 Bacteria 2067
257 Ga0105237_10223109 3300009545 Bacteria 1885
258 Ga0105238_10000607 3300009551 Bacteria 37628
259 Ga0105238_10010367 3300009551 Bacteria 9353
260 Ga0105249_10020374 3300009553 Bacteria 5929
261 Ga0105249_10034441 3300009553 Bacteria 4590
262 Ga0123341_1000008 3300009765 Bacteria 134834
263 Ga0123342_1005465 3300009766 Bacteria 18393
264 Ga0105239_10000025 3300010375 Bacteria 254049
265 Ga0105239_10000269 3300010375 Bacteria 76932
266 Ga0105239_10019971 3300010375 Bacteria 7395
267 Ga0105239_10022212 3300010375 Bacteria 6993
268 Ga0105239_10153090 3300010375 Bacteria 2574
269 Ga0105246_10003455 3300011119 Bacteria 9577
270 Ga0105246_10015747 3300011119 Bacteria 4780
271 Ga0157371_10129035 3300013102 Bacteria 1798
272 Ga0157370_10050953 3300013104 Bacteria 3955
273 Ga0157374_10007450 3300013296 Bacteria 9334
274 Ga0157378_10276432 3300013297 Bacteria 1617
275 Ga0163162_10014396 3300013306 Bacteria 7729
276 Ga0163162_10047916 3300013306 Bacteria 4282
277 Ga0163162_10250446 3300013306 Bacteria 1903
278 Ga0157372_10006775 3300013307 Bacteria 12184
279 Ga0157375_10004470 3300013308 Bacteria 12146
280 Ga0157375_10008041 3300013308 Bacteria 9234
281 Ga0157375_10009166 3300013308 Bacteria 8673
282 Ga0157375_10030639 3300013308 Bacteria 5075
283 Ga0157375_10038969 3300013308 Bacteria 4568
284 Ga0157375_10260599 3300013308 Bacteria 1895
285 Ga0163163_10000044 3300014325 Bacteria 135713
286 Ga0163163_10000876 3300014325 Bacteria 25650
287 Ga0163163_10016691 3300014325 Bacteria 6829
288 Ga0163163_10037049 3300014325 Bacteria 4743
289 Ga0163163_10192228 3300014325 Bacteria 2089
290 Ga0157380_10066780 3300014326 Bacteria 2894
291 Ga0157380_10131909 3300014326 Bacteria 2133
292 Ga0182008_10035582 3300014497 Bacteria 2493
293 Ga0157377_10036186 3300014745 Bacteria 2714
294 Ga0157377_10045571 3300014745 Bacteria 2450
295 Ga0157379_10000038 3300014968 Bacteria 81063
296 Ga0157379_10007099 3300014968 Bacteria 9686
297 Ga0157379_10008491 3300014968 Bacteria 8935
298 Ga0157379_10012604 3300014968 Bacteria 7384
299 Ga0157379_10022185 3300014968 Bacteria 5626
300 Ga0157379_10031631 3300014968 Bacteria 4715
301 Ga0157379_10037973 3300014968 Bacteria 4296
302 Ga0157379_10142457 3300014968 Bacteria 2161
303 Ga0157376_10013434 3300014969 Bacteria 6109
304 Ga0157376_10018397 3300014969 Bacteria 5356
305 Ga0157376_10165202 3300014969 Bacteria 2010
306 Ga0182006_1030966 3300015261 Bacteria 2159
307 Ga0182007_10001637 3300015262 Bacteria 11859
308 Ga0163161_10055223 3300017792 Bacteria 2883
309 Ga0213875_10020700 3300021388 Bacteria 3156
310 Ga0209436_100009 3300025208 Bacteria 143684
311 Ga0207425_1004443 3300025245 Bacteria 4202
312 Ga0209129_1000041 3300025258 Bacteria 307590
313 Ga0209129_1000333 3300025258 Bacteria 40851
314 Ga0209673_1000013 3300025273 Bacteria 571633
315 Ga0209673_1007377 3300025273 Bacteria 5087
316 Ga0209130_1000022 3300025284 Bacteria 361244
317 Ga0209025_1019064 3300025294 Bacteria 3838
318 Ga0209564_1000029 3300025295 Bacteria 505995
319 Ga0209564_1000264 3300025295 Bacteria 111404
320 Ga0209564_1001353 3300025295 Bacteria 25873
321 Ga0209564_1002363 3300025295 Bacteria 15182
322 Ga0209758_1000043 3300025297 Bacteria 402310
323 Ga0209758_1000057 3300025297 Bacteria 333111
324 Ga0209758_1007042 3300025297 Bacteria 7806
325 Ga0209050_1000149 3300025298 Bacteria 163252
326 Ga0209256_1005145 3300025299 Bacteria 7728
327 Ga0209256_1006523 3300025299 Bacteria 6131
328 Ga0209256_1008410 3300025299 Bacteria 4793
329 Ga0209256_1018531 3300025299 Bacteria 2256
330 Ga0207426_1000042 3300025302 Bacteria 433289
331 Ga0207426_1000537 3300025302 Bacteria 54262
332 Ga0209051_1000489 3300025303 Bacteria 51077
333 Ga0209051_1007353 3300025303 Bacteria 6039
334 Ga0207656_10000244 3300025321 Bacteria 18974
335 Ga0207696_1000276 3300025711 Bacteria 60824
336 Ga0207692_10015057 3300025898 Bacteria 3394
337 Ga0207642_10013793 3300025899 Bacteria 2960
338 Ga0207642_10030691 3300025899 Bacteria 2242
339 Ga0207710_10000593 3300025900 Bacteria 21302
340 Ga0207710_10011463 3300025900 Bacteria 3732
341 Ga0207688_10001626 3300025901 Bacteria 11858
342 Ga0207688_10006136 3300025901 Bacteria 6541
343 Ga0207680_10005598 3300025903 Bacteria 6009
344 Ga0207647_10058303 3300025904 Bacteria 2365
345 Ga0207685_10001766 3300025905 Bacteria 4704
346 Ga0207645_10003682 3300025907 Bacteria 11561
347 Ga0207645_10014754 3300025907 Bacteria 5218
348 Ga0207645_10040690 3300025907 Bacteria 2976
349 Ga0207643_10001184 3300025908 Bacteria 15445
350 Ga0207643_10024032 3300025908 Bacteria 3363
351 Ga0207705_10024663 3300025909 Bacteria 4291
352 Ga0207684_10005060 3300025910 Bacteria 12285
353 Ga0207684_10061918 3300025910 Bacteria 3177
354 Ga0207684_10138169 3300025910 Bacteria 2093
355 Ga0207707_10001863 3300025912 Bacteria 19260
356 Ga0207707_10141546 3300025912 Bacteria 2103
357 Ga0207695_10000347 3300025913 Bacteria 107013
358 Ga0207695_10004517 3300025913 Bacteria 18930
359 Ga0207695_10016693 3300025913 Bacteria 8579
360 Ga0207695_10018105 3300025913 Bacteria 8153
361 Ga0207695_10020509 3300025913 Bacteria 7568
362 Ga0207695_10039933 3300025913 Bacteria 5039
363 Ga0207695_10061366 3300025913 Bacteria 3885
364 Ga0207695_10158749 3300025913 Bacteria 2194
365 Ga0207671_10000952 3300025914 Bacteria 35982
366 Ga0207671_10024013 3300025914 Bacteria 4589
367 Ga0207671_10138007 3300025914 Bacteria 1876
368 Ga0207693_10052265 3300025915 Bacteria 3205
369 Ga0207663_10017023 3300025916 Bacteria 4042
370 Ga0207660_10025425 3300025917 Bacteria 4018
371 Ga0207660_10025885 3300025917 Bacteria 3988
372 Ga0207657_10002307 3300025919 Bacteria 20684
373 Ga0207657_10058970 3300025919 Bacteria 3301
374 Ga0207652_10019486 3300025921 Bacteria 5580
375 Ga0207652_10055163 3300025921 Bacteria 3417
376 Ga0207652_10063785 3300025921 Bacteria 3187
377 Ga0207681_10024501 3300025923 Bacteria 3874
378 Ga0207694_10000606 3300025924 Bacteria 32510
379 Ga0207694_10021736 3300025924 Bacteria 4862
380 Ga0207694_10040384 3300025924 Bacteria 3591
381 Ga0207650_10135964 3300025925 Bacteria 1928
382 Ga0207659_10116440 3300025926 Bacteria 2040
383 Ga0207687_10005646 3300025927 Bacteria 8276
384 Ga0207687_10011372 3300025927 Bacteria 5817
385 Ga0207700_10039730 3300025928 Bacteria 3427
386 Ga0207700_10146165 3300025928 Bacteria 1949
387 Ga0207664_10061884 3300025929 Bacteria 2988
388 Ga0207644_10002169 3300025931 Bacteria 12734
389 Ga0207644_10078058 3300025931 Bacteria 2440
390 Ga0207706_10003325 3300025933 Bacteria 15389
391 Ga0207686_10082739 3300025934 Bacteria 2099
392 Ga0207709_10003330 3300025935 Bacteria 9625
393 Ga0207709_10009011 3300025935 Bacteria 5501
394 Ga0207709_10032358 3300025935 Bacteria 3062
395 Ga0207709_10076289 3300025935 Bacteria 2145
396 Ga0207670_10035363 3300025936 Bacteria 3238
397 Ga0207669_10021936 3300025937 Bacteria 3382
398 Ga0207669_10082467 3300025937 Bacteria 2064
399 Ga0207704_10022274 3300025938 Bacteria 3391
400 Ga0207704_10057054 3300025938 Bacteria 2396
401 Ga0207691_10000028 3300025940 Bacteria 121090
402 Ga0207691_10002487 3300025940 Bacteria 18018
403 Ga0207691_10008483 3300025940 Bacteria 9869
404 Ga0207691_10010326 3300025940 Bacteria 8956
405 Ga0207691_10034149 3300025940 Bacteria 4732
406 Ga0207691_10102659 3300025940 Bacteria 2550
407 Ga0207691_10158855 3300025940 Bacteria 1984
408 Ga0207711_10031272 3300025941 Bacteria 4493
409 Ga0207711_10087780 3300025941 Bacteria 2729
410 Ga0207711_10110637 3300025941 Bacteria 2443
411 Ga0207689_10014440 3300025942 Bacteria 6718
412 Ga0207689_10028770 3300025942 Bacteria 4647
413 Ga0207689_10033405 3300025942 Bacteria 4276
414 Ga0207661_10039718 3300025944 Bacteria 3695
415 Ga0207661_10228557 3300025944 Bacteria 1647
416 Ga0207667_10000175 3300025949 Bacteria 93793
417 Ga0207667_10003104 3300025949 Bacteria 20565
418 Ga0207667_10008252 3300025949 Bacteria 12395
419 Ga0207667_10034111 3300025949 Bacteria 5468
420 Ga0207667_10034807 3300025949 Bacteria 5406
421 Ga0207651_10218098 3300025960 Bacteria 1540
422 Ga0207712_10108531 3300025961 Bacteria 2077
423 Ga0207712_10137628 3300025961 Bacteria 1870
424 Ga0207640_10000077 3300025981 Bacteria 76155
425 Ga0207640_10165641 3300025981 Bacteria 1641
426 Ga0207658_10000800 3300025986 Bacteria 26430
427 Ga0207658_10117507 3300025986 Bacteria 2114
428 Ga0207677_10000929 3300026023 Bacteria 16369
429 Ga0207703_10000957 3300026035 Bacteria 27938
430 Ga0207703_10001166 3300026035 Bacteria 24812
431 Ga0207703_10004717 3300026035 Bacteria 11123
432 Ga0207703_10033934 3300026035 Bacteria 4047
433 Ga0207703_10064578 3300026035 Bacteria 3005
434 Ga0207639_10018300 3300026041 Bacteria 4978
435 Ga0207678_10024110 3300026067 Bacteria 5316
436 Ga0207708_10002529 3300026075 Bacteria 13451
437 Ga0207708_10049932 3300026075 Bacteria 3185
438 Ga0207708_10126415 3300026075 Bacteria 1996
439 Ga0207702_10010110 3300026078 Bacteria 7906
440 Ga0207702_10048313 3300026078 Bacteria 3588
441 Ga0207702_10278556 3300026078 Bacteria 1580
442 Ga0207641_10001175 3300026088 Bacteria 26305
443 Ga0207641_10007318 3300026088 Bacteria 9195
444 Ga0207641_10013250 3300026088 Bacteria 6761
445 Ga0207641_10072629 3300026088 Bacteria 2963
446 Ga0207641_10122262 3300026088 Bacteria 2325
447 Ga0207641_10125292 3300026088 Bacteria 2299
448 Ga0207648_10000550 3300026089 Bacteria 42009
449 Ga0207648_10028619 3300026089 Bacteria 4939
450 Ga0207648_10052060 3300026089 Bacteria 3579
451 Ga0207648_10061086 3300026089 Bacteria 3286
452 Ga0207648_10078057 3300026089 Bacteria 2888
453 Ga0207676_10004867 3300026095 Bacteria 9508
454 Ga0207676_10031838 3300026095 Bacteria 3968
455 Ga0207676_10086857 3300026095 Bacteria 2556
456 Ga0207674_10018743 3300026116 Bacteria 7512
457 Ga0207674_10032831 3300026116 Bacteria 5441
458 Ga0207674_10115649 3300026116 Bacteria 2654
459 Ga0207675_100006048 3300026118 Bacteria 11514
460 Ga0207675_100007010 3300026118 Bacteria 10656
461 Ga0207675_100012751 3300026118 Bacteria 7853
462 Ga0207675_100017246 3300026118 Bacteria 6742
463 Ga0207675_100030556 3300026118 Bacteria 5019
464 Ga0207675_100209559 3300026118 Bacteria 1874
465 Ga0207675_100262402 3300026118 Bacteria 1674
466 Ga0207683_10169056 3300026121 Bacteria 1979
467 Ga0207698_10019128 3300026142 Bacteria 4681
468 Ga0207698_10023374 3300026142 Bacteria 4317
469 Ga0207698_10080992 3300026142 Bacteria 2618
470 Ga0207698_10153374 3300026142 Bacteria 2003
471 Ga0209813_10000255 3300027866 Bacteria 15495
472 Ga0209813_10004191 3300027866 Bacteria 3427
473 Ga0207428_10097293 3300027907 Bacteria 2278
474 Ga0268266_10000596 3300028379 Bacteria 49462
475 Ga0268266_10001984 3300028379 Bacteria 22953
476 Ga0268266_10003195 3300028379 Bacteria 16585
477 Ga0268266_10003489 3300028379 Bacteria 15655
478 Ga0268266_10009083 3300028379 Bacteria 8777
479 Ga0268266_10024997 3300028379 Bacteria 5084
480 Ga0268266_10025515 3300028379 Bacteria 5027
481 Ga0268266_10073745 3300028379 Bacteria 2962
482 Ga0268265_10048388 3300028380 Bacteria 3192
483 Ga0268264_10000287 3300028381 Bacteria 85050
484 Ga0268264_10000420 3300028381 Bacteria 59901
485 Ga0268264_10028551 3300028381 Bacteria 4564
486 Ga0268264_10064052 3300028381 Bacteria 3093
487 Ga0268264_10144640 3300028381 Bacteria 2124
488 Ga0265337_1006149 3300028556 Bacteria 4668
489 Ga0265326_10010375 3300028558 Bacteria 2762
490 Ga0265334_10000014 3300028573 Bacteria 154345
491 Ga0307517_10004912 3300028786 Bacteria 20370
492 Ga0307517_10065457 3300028786 Bacteria 3362
493 Ga0307517_10093494 3300028786 Bacteria 2437
494 Ga0307515_10000011 3300028794 Bacteria 633903
495 Ga0307515_10000186 3300028794 Bacteria 153531
496 Ga0307515_10050257 3300028794 Bacteria 6250
497 Ga0307515_10058448 3300028794 Bacteria 5553
498 Ga0307515_10065339 3300028794 Bacteria 5066
499 Ga0307515_10097341 3300028794 Bacteria 3597
500 Ga0307515_10111006 3300028794 Bacteria 3204
501 Ga0307515_10176786 3300028794 Bacteria 2102
502 Ga0265338_10000377 3300028800 Bacteria 79902
503 Ga0265338_10004531 3300028800 Bacteria 18718
504 Ga0265338_10006711 3300028800 Bacteria 14542
505 Ga0265338_10047374 3300028800 Bacteria 3926
506 Ga0307511_10000037 3300030521 Bacteria 103008
507 Ga0307511_10054297 3300030521 Bacteria 3161
508 Ga0307512_10061925 3300030522 Bacteria 2876
509 Ga0316182_1299158 3300030745 Bacteria 7088
510 Ga0265760_10016520 3300031090 Bacteria 2118
511 Ga0265328_10038116 3300031239 Bacteria 1774
512 Ga0265320_10006123 3300031240 Bacteria 7620
513 Ga0265325_10000155 3300031241 Bacteria 48142
514 Ga0265340_10000121 3300031247 Bacteria 38466
515 Ga0265339_10048068 3300031249 Bacteria 2340
516 Ga0265331_10004523 3300031250 Bacteria 8675
517 Ga0265331_10004710 3300031250 Bacteria 8443
518 Ga0265327_10000487 3300031251 Bacteria 69944
519 Ga0265316_10004680 3300031344 Bacteria 13553
520 Ga0307513_10002991 3300031456 Bacteria 23045
521 Ga0307513_10015253 3300031456 Bacteria 9325
522 Ga0307513_10016687 3300031456 Bacteria 8841
523 Ga0307513_10053100 3300031456 Bacteria 4359
524 Ga0307513_10083111 3300031456 Bacteria 3294
525 Ga0307513_10092686 3300031456 Bacteria 3074
526 Ga0307513_10234044 3300031456 Bacteria 1647
527 Ga0307509_10000001 3300031507 Bacteria 629324
528 Ga0307509_10000044 3300031507 Bacteria 176718
529 Ga0307509_10003432 3300031507 Bacteria 24057
530 Ga0307509_10004147 3300031507 Bacteria 21173
531 Ga0307509_10004183 3300031507 Bacteria 21075
532 Ga0307509_10021431 3300031507 Bacteria 7305
533 Ga0307509_10061981 3300031507 Bacteria 3945
534 Ga0307509_10095132 3300031507 Bacteria 3035
535 Ga0307408_100000006 3300031548 Bacteria 472824
536 Ga0265313_10001336 3300031595 Bacteria 23225
537 Ga0307508_10005121 3300031616 Bacteria 12567
538 Ga0307508_10011794 3300031616 Bacteria 7987
539 Ga0307508_10012983 3300031616 Bacteria 7616
540 Ga0307508_10031568 3300031616 Bacteria 4788
541 Ga0307514_10020475 3300031649 Bacteria 5398
542 Ga0307514_10040937 3300031649 Bacteria 3650
543 Ga0265314_10012680 3300031711 Bacteria 6858
544 Ga0265314_10025791 3300031711 Bacteria 4427
545 Ga0265342_10016314 3300031712 Bacteria 4859
546 Ga0265342_10018466 3300031712 Bacteria 4517
547 Ga0316576_10006578 3300031727 Bacteria 7252
548 Ga0307516_10005815 3300031730 Bacteria 14613
549 Ga0307516_10016202 3300031730 Bacteria 7808
550 Ga0307516_10017271 3300031730 Bacteria 7528
551 Ga0307516_10018714 3300031730 Bacteria 7193
552 Ga0307516_10095107 3300031730 Bacteria 2803
553 Ga0307516_10157445 3300031730 Bacteria 2025
554 Ga0307413_10003854 3300031824 Bacteria 6405
555 Ga0307409_100016212 3300031995 Bacteria 4922
556 Ga0307409_100028358 3300031995 Bacteria 3987
557 Ga0307409_100097567 3300031995 Bacteria 2428
558 Ga0307416_100013529 3300032002 Bacteria 5551
559 Ga0307510_10000016 3300033180 Bacteria 206932
560 Ga0307510_10005766 3300033180 Bacteria 14762
561 Ga0307510_10006502 3300033180 Bacteria 13936
562 Ga0307510_10008022 3300033180 Bacteria 12565
563 Ga0307510_10067143 3300033180 Bacteria 3613
564 Ga0373936_0005394 3300035113 Bacteria 4818
565 Ga0373936_0034391 3300035113 Bacteria 2013
566 Ga0373945_0013158 3300035116 Bacteria 2758
567 Ga0373946_0021708 3300035171 Bacteria 2492
568 Ga0373931_0007299 3300035691 Bacteria 5200
569 Ga0373931_0010537 3300035691 Bacteria 4444
570 Ga0373927_0063530 3300035695 Bacteria 2388
571 Ga0373933_0069196 3300035724 Bacteria 2145
572 Ga0373937_0033714 3300036401 Bacteria 4652
573 Ga0373937_0068466 3300036401 Bacteria 3273
574 Ga0373937_0148784 3300036401 Bacteria 2193
575 Ga0395899_0047305 3300037312 Bacteria 3203
576 Ga0395899_0058632 3300037312 Bacteria 2839
577 Ga0395900_0006806 3300037418 Bacteria 11855
578 Ga0395900_0014634 3300037418 Bacteria 8002
579 Ga0395900_0151595 3300037418 Bacteria 2368
580 Ga0395898_0004666 3300037466 Bacteria 14932
581 Ga0395898_0024464 3300037466 Bacteria 6091
582 Ga0395898_0150511 3300037466 Bacteria 2227
583 Ga0395905_0102329 3300037471 Bacteria 2689
584 Ga0436364_0457524 3300037853 Bacteria 2139
585 Ga0436364_0748817 3300037853 Bacteria 3432
586 Ga0395901_0020172 3300038443 Bacteria 6822
587 Ga0395901_0032881 3300038443 Bacteria 5351
588 Ga0395901_0245307 3300038443 Bacteria 1867
589 Ga0436365_0002580 3300039437 Bacteria 4922
590 Ga0436365_0327786 3300039437 Bacteria 9722
591 Ga0436365_0592429 3300039437 Bacteria 2289
592 Ga0436365_0898810 3300039437 Bacteria 2969
593 Ga0436365_1619143 3300039437 Bacteria 6286
594 Ga0436360_0112640 3300039438 Bacteria 1912
595 Ga0436360_0738491 3300039438 Bacteria 5353
596 Ga0436360_1026710 3300039438 Bacteria 2090
597 Ga0436360_1129771 3300039438 Bacteria 5578
598 Ga0436361_0395058 3300039447 Bacteria 1519
599 Ga0436361_0611431 3300039447 Bacteria 2208
600 Ga0436361_0899139 3300039447 Bacteria 2367
601 Ga0436363_0481565 3300039450 Bacteria 3760
602 Ga0436363_1106384 3300039450 Bacteria 3922
603 Ga0436362_0757178 3300039453 Bacteria 1888
604 Ga0436362_1106345 3300039453 Bacteria 2044
605 Ga0451791_0356334 3300041451 Bacteria 2488
606 Ga0451798_0226398 3300041458 Bacteria 3712
607 Ga0451800_0869303 3300041459 Bacteria 3532
608 Ga0451839_0104998 3300041496 Bacteria 2277
609 Ga0451847_0654707 3300041503 Bacteria 5399
610 Ga0451851_0138487 3300041507 Bacteria 1843
611 Ga0451855_0184220 3300041511 Bacteria 3498
612 Ga0439462_0017763 3300042015 Bacteria 1843
613 Ga0451577_0133997 3300042876 Bacteria 2224
614 Ga0466969_0002439 3300044656 Bacteria 9913
615 Ga0466965_0021990 3300044683 Bacteria 3074
616 Ga0466965_0026025 3300044683 Bacteria 2835
617 Ga0466965_0037781 3300044683 Bacteria 2371
618 Ga0466966_0006687 3300044684 Bacteria 7637
619 Ga0466966_0029066 3300044684 Bacteria 3598
620 Ga0466961_0021280 3300044693 Bacteria 4176
621 Ga0466963_0115462 3300044694 Bacteria 1845
622 Ga0466971_0073324 3300044719 Bacteria 1556
623 Ga0466970_0018274 3300044765 Bacteria 3627
624 Ga0466970_0046920 3300044765 Bacteria 2301
625 Ga0466970_0052692 3300044765 Bacteria 2172
626 Ga0466957_0019120 3300044842 Bacteria 4028
627 Ga0466960_0014516 3300044901 Bacteria 3374
628 Ga0466960_0023325 3300044901 Bacteria 2777
629 Ga0466960_0056478 3300044901 Bacteria 1911
630 Ga0466959_0061889 3300045049 Bacteria 2721
631 Ga0451576_0020730 3300045051 Bacteria 7155
632 Ga0466958_0014007 3300045836 Bacteria 4574
633 Ga0466967_0023032 3300045976 Bacteria 5096
634 Ga0466967_0043364 3300045976 Bacteria 3894
635 Ga0466967_0062820 3300045976 Bacteria 3298
636 Ga0466967_0073790 3300045976 Bacteria 3062
637 Ga0495627_008967 3300046453 Bacteria 3699
638 Ga0495592_0000203 3300046454 Bacteria 50733
639 Ga0495592_0073735 3300046454 Bacteria 2481
640 Ga0495603_0051288 3300046455 Bacteria 2452
641 Ga0495603_0098352 3300046455 Bacteria 1709
642 Ga0495590_0031669 3300046457 Bacteria 1851
643 Ga0495638_0004766 3300046460 Bacteria 10231
644 Ga0495638_0029580 3300046460 Bacteria 3532
645 Ga0495638_0036493 3300046460 Bacteria 3132
646 Ga0495653_0004980 3300046463 Bacteria 10780
647 Ga0495650_0010731 3300046471 Bacteria 5090
648 Ga0495650_0012066 3300046471 Bacteria 4674
649 Ga0495650_0025838 3300046471 Bacteria 2743
650 Ga0495582_0038368 3300046473 Bacteria 2636
651 Ga0495605_0015688 3300046474 Bacteria 4117
652 Ga0495639_0001912 3300046475 Bacteria 9238
653 Ga0495662_0051399 3300046476 Bacteria 1989
654 Ga0495664_0105373 3300046477 Bacteria 1700
655 Ga0495584_0005419 3300046491 Bacteria 6757
656 Ga0495585_0088494 3300046492 Bacteria 1670
657 Ga0495607_0072375 3300046501 Bacteria 1919
658 Ga0495583_0004172 3300046506 Bacteria 10531
659 Ga0495583_0069357 3300046506 Bacteria 1553
660 Ga0495606_0000253 3300046507 Bacteria 94485
661 Ga0495606_0000895 3300046507 Bacteria 44393
662 Ga0495606_0006342 3300046507 Bacteria 10942
663 Ga0495608_0000013 3300046511 Bacteria 228481
664 Ga0495608_0145297 3300046511 Bacteria 1513
665 Ga0495616_0001686 3300046513 Bacteria 15063
666 Ga0495616_0014165 3300046513 Bacteria 4474
667 Ga0495620_0054441 3300046515 Bacteria 1690
668 Ga0495630_0072872 3300046517 Bacteria 2586
669 Ga0495630_0107710 3300046517 Bacteria 2111
670 Ga0495632_0002177 3300046519 Bacteria 15118
671 Ga0495632_0002541 3300046519 Bacteria 13831
672 Ga0495632_0026675 3300046519 Bacteria 3038
673 Ga0495643_0016469 3300046522 Bacteria 4341
674 Ga0495643_0033054 3300046522 Bacteria 2865
675 Ga0495648_0033094 3300046524 Bacteria 3382
676 Ga0495665_0056714 3300046531 Bacteria 2068
677 Ga0495597_0014009 3300046542 Bacteria 3829
678 Ga0495622_0000566 3300046557 Bacteria 22206
679 Ga0495622_0017920 3300046557 Bacteria 3298
680 Ga0495633_0009942 3300046558 Bacteria 5223
681 Ga0495633_0054782 3300046558 Bacteria 1876
682 Ga0495656_0000232 3300046615 Bacteria 19679
683 Ga0495656_0045982 3300046615 Bacteria 1845
684 Ga0495668_0042200 3300046616 Bacteria 2540
685 Ga0495625_0005672 3300046660 Bacteria 11308
686 Ga0495625_0015246 3300046660 Bacteria 6095
687 Ga0495625_0015952 3300046660 Bacteria 5926
688 Ga0495625_0030593 3300046660 Bacteria 4015
689 Ga0495625_0109271 3300046660 Bacteria 1892
690 Ga0495635_0119992 3300046663 Bacteria 1794
691 Ga0495588_0001503 3300046674 Bacteria 9988
692 Ga0495657_0000003 3300046675 Bacteria 279680
693 Ga0495671_0019063 3300046692 Bacteria 3632
694 Ga0495649_0009300 3300046694 Bacteria 5849
695 Ga0495649_0032383 3300046694 Bacteria 2879
696 Ga0495649_0070413 3300046694 Bacteria 1875
697 Ga0495649_0106081 3300046694 Bacteria 1491
698 Ga0495660_0019406 3300046810 Bacteria 3903
699 Ga0495674_0011969 3300047319 Bacteria 8182
700 Ga0495672_0001753 3300047320 Bacteria 20929
701 Ga0495676_0089584 3300047321 Bacteria 2305
702 Ga0495680_0143410 3300047322 Bacteria 1746
703 Ga0495680_0152583 3300047322 Bacteria 1683
704 Ga0495683_0045896 3300047323 Bacteria 2194
705 Ga0495687_001076 3300047443 Bacteria 26881
706 Ga0495687_006562 3300047443 Bacteria 7098
707 Ga0495687_024614 3300047443 Bacteria 2858
708 Ga0495675_0000094 3300047444 Bacteria 63338
709 Ga0495684_0056481 3300047471 Bacteria 2993
710 Ga0495686_0000923 3300047472 Bacteria 36619
711 Ga0496100_0001473 3300048903 Bacteria 11524
712 Ga0496101_0002555 3300048904 Bacteria 11168
713 Ga0496101_0012522 3300048904 Bacteria 5661
714 Ga0496101_0018822 3300048904 Bacteria 4703
715 Ga0496101_0024641 3300048904 Bacteria 4166
716 Ga0496101_0060520 3300048904 Bacteria 2748
717 Ga0496102_0002386 3300048905 Bacteria 16031
718 Ga0496102_0005870 3300048905 Bacteria 10453
719 Ga0496102_0040624 3300048905 Bacteria 4208
720 Ga0496102_0042726 3300048905 Bacteria 4109
721 Ga0496102_0044793 3300048905 Bacteria 4016
722 Ga0496102_0104688 3300048905 Bacteria 2632
723 Ga0496104_0010103 3300048907 Bacteria 8428
724 Ga0496104_0016340 3300048907 Bacteria 6740
725 Ga0496104_0039296 3300048907 Bacteria 4430
726 Ga0496104_0048594 3300048907 Bacteria 3999
727 Ga0496104_0052297 3300048907 Bacteria 3857
728 Ga0496104_0098459 3300048907 Bacteria 2799
729 Ga0496104_0202856 3300048907 Bacteria 1895
730 Ga0496105_0000649 3300048908 Bacteria 23327
731 Ga0496105_0011401 3300048908 Bacteria 7021
732 Ga0496105_0011580 3300048908 Bacteria 6975
733 Ga0496105_0018169 3300048908 Bacteria 5646
734 Ga0496105_0020997 3300048908 Bacteria 5281
735 Ga0496105_0057220 3300048908 Bacteria 3220
736 Ga0496105_0082879 3300048908 Bacteria 2649
737 Ga0496105_0100044 3300048908 Bacteria 2394
738 Ga0496107_0002401 3300048910 Bacteria 12126
739 Ga0496107_0034810 3300048910 Bacteria 3609
740 Ga0496107_0042839 3300048910 Bacteria 3252
741 Ga0496107_0106667 3300048910 Bacteria 2058
742 Ga0496108_0003961 3300048911 Bacteria 11896
743 Ga0496108_0006730 3300048911 Bacteria 9308
744 Ga0496108_0047157 3300048911 Bacteria 3602
745 Ga0496108_0051740 3300048911 Bacteria 3441
746 Ga0496108_0072384 3300048911 Bacteria 2909
747 Ga0496109_0000011 3300048912 Bacteria 234908
748 Ga0496109_0008248 3300048912 Bacteria 8846
749 Ga0496109_0042602 3300048912 Bacteria 4112
750 Ga0496109_0062929 3300048912 Bacteria 3393
751 Ga0496109_0141433 3300048912 Bacteria 2250
752 Ga0496110_0003748 3300048913 Bacteria 11706
753 Ga0496110_0032013 3300048913 Bacteria 4539
754 Ga0496110_0040232 3300048913 Bacteria 4074
755 Ga0496110_0044209 3300048913 Bacteria 3890
756 Ga0496110_0062681 3300048913 Bacteria 3284
757 Ga0496110_0075894 3300048913 Bacteria 2987
758 Ga0496110_0220366 3300048913 Bacteria 1725
759 Ga0496110_0221404 3300048913 Bacteria 1721
760 Ga0496111_0004320 3300048914 Bacteria 8962
761 Ga0496111_0031555 3300048914 Bacteria 3775
762 Ga0496111_0048660 3300048914 Bacteria 3054
763 Ga0496111_0055314 3300048914 Bacteria 2870
764 Ga0496112_0061691 3300048915 Bacteria 3697
765 Ga0496113_0009214 3300048916 Bacteria 6474
766 Ga0496113_0043947 3300048916 Bacteria 3308
767 Ga0496114_0000691 3300048917 Bacteria 25121
768 Ga0496114_0004625 3300048917 Bacteria 10691
769 Ga0496114_0014043 3300048917 Bacteria 6423
770 Ga0496114_0021689 3300048917 Bacteria 5226
771 Ga0496114_0055385 3300048917 Bacteria 3307
772 Ga0496114_0087299 3300048917 Bacteria 2645
773 Ga0496115_0004033 3300048918 Bacteria 10603
774 Ga0496115_0005460 3300048918 Bacteria 9247
775 Ga0496115_0128209 3300048918 Bacteria 2090
776 Ga0496115_0143409 3300048918 Bacteria 1970
777 Ga0496116_0006937 3300048919 Bacteria 10158
778 Ga0496116_0009097 3300048919 Bacteria 8515
779 Ga0496117_0000211 3300048920 Bacteria 112609
780 Ga0496117_0002066 3300048920 Bacteria 26549
781 Ga0496117_0059146 3300048920 Bacteria 2650
782 Ga0496118_0000005 3300048921 Bacteria 697350
783 Ga0496118_0001422 3300048921 Bacteria 36121
784 Ga0496118_0008974 3300048921 Bacteria 10198
785 Ga0496118_0093165 3300048921 Bacteria 2065
786 Ga0496119_0001007 3300048922 Bacteria 36111
787 Ga0496119_0020348 3300048922 Bacteria 4845
788 Ga0496120_0000242 3300048923 Bacteria 93148
789 Ga0496121_0000245 3300048924 Bacteria 116316
790 Ga0496121_0001299 3300048924 Bacteria 42922
791 Ga0496121_0001771 3300048924 Bacteria 35100
792 Ga0496121_0006402 3300048924 Bacteria 14641
793 Ga0496121_0016052 3300048924 Bacteria 7761
794 Ga0496121_0016227 3300048924 Bacteria 7707
795 Ga0496122_0043664 3300048925 Bacteria 3509
796 Ga0496123_0026983 3300048926 Bacteria 4288
797 Ga0496125_0000220 3300048928 Bacteria 116658
798 Ga0496125_0002613 3300048928 Bacteria 23120
799 Ga0496125_0017234 3300048928 Bacteria 6901
800 Ga0496125_0056000 3300048928 Bacteria 3206
801 Ga0496126_0000082 3300048929 Bacteria 218571
802 Ga0496126_0007294 3300048929 Bacteria 12146
803 Ga0496126_0012911 3300048929 Bacteria 8531
804 Ga0496126_0030405 3300048929 Bacteria 5117
805 Ga0496126_0070007 3300048929 Bacteria 3127
806 Ga0496126_0100817 3300048929 Bacteria 2526
807 Ga0496126_0228916 3300048929 Bacteria 1558
808 Ga0495678_046199 3300049459 Bacteria 1713
809 Ga0501031_0009449 3300049568 Bacteria 6339
810 Ga0501031_0017540 3300049568 Bacteria 4654
811 Ga0501032_0001352 3300049569 Bacteria 19486
812 Ga0501032_0016245 3300049569 Bacteria 5236
813 Ga0501032_0093024 3300049569 Bacteria 2000
814 Ga0501033_0002715 3300049570 Bacteria 14846
815 Ga0501033_0009073 3300049570 Bacteria 7672
816 Ga0501033_0014485 3300049570 Bacteria 5986
817 Ga0501033_0031456 3300049570 Bacteria 3988
818 Ga0501033_0044138 3300049570 Bacteria 3318
819 Ga0501033_0058023 3300049570 Bacteria 2860
820 Ga0501034_0006801 3300049571 Bacteria 12232
821 Ga0501034_0015328 3300049571 Bacteria 7879
822 Ga0501034_0043680 3300049571 Bacteria 4534
823 Ga0501034_0096216 3300049571 Bacteria 2957
824 Ga0501034_0096509 3300049571 Bacteria 2952
825 Ga0501034_0148802 3300049571 Bacteria 2318
826 Ga0501034_0273039 3300049571 Bacteria 1631
827 Ga0501036_0010613 3300049572 Bacteria 7609
828 Ga0501036_0015326 3300049572 Bacteria 6402
829 Ga0501036_0062996 3300049572 Bacteria 3140
830 Ga0501037_0002323 3300049573 Bacteria 13743
831 Ga0501037_0008734 3300049573 Bacteria 7425
832 Ga0501037_0030998 3300049573 Bacteria 3948
833 Ga0501038_0012761 3300049574 Bacteria 7675
834 Ga0501038_0019872 3300049574 Bacteria 6045
835 Ga0501038_0045082 3300049574 Bacteria 3828
836 Ga0501038_0058778 3300049574 Bacteria 3295
837 Ga0501038_0080373 3300049574 Bacteria 2748
838 Ga0501038_0081980 3300049574 Bacteria 2717
839 Ga0501039_0040228 3300049575 Bacteria 3609
840 Ga0501039_0056362 3300049575 Bacteria 3044
841 Ga0501042_0011333 3300049578 Bacteria 6013
842 Ga0501042_0054774 3300049578 Bacteria 2845
843 Ga0501042_0074421 3300049578 Bacteria 2431
844 Ga0501042_0100653 3300049578 Bacteria 2078
845 Ga0501042_0109130 3300049578 Bacteria 1992
846 Ga0501043_0022731 3300049579 Bacteria 4918
847 Ga0501043_0038345 3300049579 Bacteria 3767
848 Ga0501043_0038622 3300049579 Bacteria 3753
849 Ga0501043_0102213 3300049579 Bacteria 2253
850 Ga0501046_0000440 3300049580 Bacteria 41802
851 Ga0501046_0013547 3300049580 Bacteria 6898
852 Ga0501047_0017363 3300049581 Bacteria 6891
853 Ga0501047_0041195 3300049581 Bacteria 4463
854 Ga0501047_0075066 3300049581 Bacteria 3253
855 Ga0501047_0091725 3300049581 Bacteria 2916
856 Ga0501047_0124366 3300049581 Bacteria 2460
857 Ga0501047_0138227 3300049581 Bacteria 2315
858 Ga0501047_0204700 3300049581 Bacteria 1833
859 Ga0501047_0212777 3300049581 Bacteria 1791
860 Ga0501048_0003540 3300049582 Bacteria 11876
861 Ga0501048_0009975 3300049582 Bacteria 7111
862 Ga0501048_0054097 3300049582 Bacteria 2852
863 Ga0501067_0005392 3300049583 Bacteria 7102
864 Ga0501067_0023499 3300049583 Bacteria 3417
865 Ga0501067_0065926 3300049583 Bacteria 2005
866 Ga0501068_0013764 3300049584 Bacteria 4609
867 Ga0501068_0018284 3300049584 Bacteria 4060
868 Ga0501068_0026499 3300049584 Bacteria 3416
869 Ga0501069_0001873 3300049585 Bacteria 10513
870 Ga0501069_0097792 3300049585 Bacteria 1664
871 Ga0501070_0005021 3300049586 Bacteria 11287
872 Ga0501070_0020638 3300049586 Bacteria 5526
873 Ga0501070_0042508 3300049586 Bacteria 3785
874 Ga0501070_0044489 3300049586 Bacteria 3694
875 Ga0501070_0049291 3300049586 Bacteria 3497
876 Ga0501070_0050550 3300049586 Bacteria 3451
877 Ga0501071_0000964 3300049587 Bacteria 15695
878 Ga0501071_0052107 3300049587 Bacteria 2951
879 Ga0501071_0081063 3300049587 Bacteria 2374
880 Ga0501071_0167675 3300049587 Bacteria 1644
881 Ga0501072_0007154 3300049588 Bacteria 8462
882 Ga0501072_0037835 3300049588 Bacteria 3784
883 Ga0501072_0085303 3300049588 Bacteria 2505
884 Ga0501073_0004452 3300049589 Bacteria 10527
885 Ga0501073_0028934 3300049589 Bacteria 3958
886 Ga0501073_0034168 3300049589 Bacteria 3619
887 Ga0501073_0049326 3300049589 Bacteria 2952
888 Ga0501073_0103994 3300049589 Bacteria 1971
889 Ga0501073_0111102 3300049589 Bacteria 1901
890 Ga0501074_0000164 3300049590 Bacteria 35412
891 Ga0501074_0002061 3300049590 Bacteria 13892
892 Ga0501074_0017736 3300049590 Bacteria 5170
893 Ga0501074_0027835 3300049590 Bacteria 4097
894 Ga0501074_0097952 3300049590 Bacteria 2099
895 Ga0501074_0106853 3300049590 Bacteria 2004
896 Ga0501076_0003060 3300049592 Bacteria 11640
897 Ga0501077_0001810 3300049593 Bacteria 12912
898 Ga0501079_0000806 3300049741 Bacteria 21347
899 Ga0501079_0006265 3300049741 Bacteria 8924
900 Ga0501079_0018566 3300049741 Bacteria 5313
901 Ga0501080_0004388 3300049742 Bacteria 12531
902 Ga0501080_0021347 3300049742 Bacteria 5994
903 Ga0501080_0047414 3300049742 Bacteria 3999
904 Ga0501080_0068905 3300049742 Bacteria 3291
905 Ga0501080_0127202 3300049742 Bacteria 2359
906 Ga0501080_0131057 3300049742 Bacteria 2321
907 Ga0501080_0205331 3300049742 Bacteria 1807
908 Ga0501081_0047429 3300049743 Bacteria 2956
909 Ga0501081_0129275 3300049743 Bacteria 1804
910 Ga0501083_0002676 3300049744 Bacteria 12266
911 Ga0501083_0007870 3300049744 Bacteria 7551
912 Ga0501083_0017374 3300049744 Bacteria 5015
913 Ga0501035_0000595 3300049822 Bacteria 39851
914 Ga0501035_0004343 3300049822 Bacteria 13453
915 Ga0501035_0032187 3300049822 Bacteria 4772
916 Ga0501035_0034734 3300049822 Bacteria 4580
917 Ga0501044_0001080 3300049823 Bacteria 32578
918 Ga0501044_0001470 3300049823 Bacteria 27679
919 Ga0501044_0003782 3300049823 Bacteria 16994
920 Ga0501044_0009792 3300049823 Bacteria 10421
921 Ga0501044_0013472 3300049823 Bacteria 8843
922 Ga0501044_0037938 3300049823 Bacteria 5035
923 Ga0501044_0059359 3300049823 Bacteria 3919
924 Ga0501045_0017641 3300049824 Bacteria 5068
925 nmdc:mga03683_26791_c1 3300050489 Bacteria 2277
926 nmdc:mga03683_8566_c1 3300050489 Bacteria 3600
927 nmdc:mga03n38_11631_c1 3300050490 Bacteria 3287
928 nmdc:mga03n38_23432_c1 3300050490 Bacteria 2511
929 nmdc:mga03n38_557_c1 3300050490 Bacteria 9452
930 nmdc:mga00v17_104215_c1 3300050491 Bacteria 1793
931 nmdc:mga00v17_1591_c1 3300050491 Bacteria 11859
932 nmdc:mga00v17_6139_c1 3300050491 Bacteria 6011
933 nmdc:mga00v17_64745_c1 3300050491 Bacteria 2253
934 nmdc:mga00v17_6677_c1 3300050491 Bacteria 6130
935 nmdc:mga00v17_8643_c1 3300050491 Bacteria 5485
936 nmdc:mga0yw44_112001_c1 3300050492 Bacteria 1750
937 nmdc:mga0yw44_13053_c1 3300050492 Bacteria 4357
938 nmdc:mga0yw44_17806_c2 3300050492 Bacteria 2787
939 nmdc:mga0yw44_27806_c1 3300050492 Bacteria 3244
940 nmdc:mga0yw44_29570_c1 3300050492 Bacteria 3164
941 nmdc:mga0yw44_33599_c1 3300050492 Bacteria 2998
942 nmdc:mga0yw44_58716_c1 3300050492 Bacteria 2351
943 nmdc:mga0yw44_6559_c1 3300050492 Bacteria 5635
944 nmdc:mga0k408_23318_c1 3300050493 Bacteria 3489
945 nmdc:mga06z11_3678_c1 3300050494 Bacteria 5955
946 nmdc:mga06z11_60060_c1 3300050494 Bacteria 1978
947 nmdc:mga04h51_4676_c1 3300050495 Bacteria 3427
948 nmdc:mga04h51_6017_c1 3300050495 Bacteria 3124
949 nmdc:mga07m45_136846_c1 3300050496 Bacteria 1418
950 nmdc:mga07m45_1431_c1 3300050496 Bacteria 10940
951 nmdc:mga07m45_14526_c1 3300050496 Bacteria 4197
952 nmdc:mga07m45_15022_c1 3300050496 Bacteria 4135
953 nmdc:mga07m45_1612_c1 3300050496 Bacteria 10389
954 nmdc:mga07m45_22035_c1 3300050496 Bacteria 3476
955 nmdc:mga07m45_37676_c1 3300050496 Bacteria 2697
956 nmdc:mga05p37_411199_c1 3300050507 Bacteria 1577
957 nmdc:mga05p37_4665_c1 3300050507 Bacteria 16015
958 nmdc:mga09592_9512_c1 3300050508 Bacteria 7900
959 nmdc:mga0qj67_142782_c1 3300050509 Bacteria 1941
960 nmdc:mga0qj67_3934_c1 3300050509 Bacteria 10749
961 nmdc:mga06r32_3907_c1 3300050510 Bacteria 13362
962 nmdc:mga08y16_55772_c1 3300050511 Bacteria 4129
963 nmdc:mga0sz30_4483_c1 3300050516 Bacteria 4410
964 Ga0495601_0010824 3300053077 Bacteria 5442
965 Ga0495601_0062416 3300053077 Bacteria 2367
966 Ga0495655_0001453 3300053083 Bacteria 3626
967 Ga0495595_0000007 3300053084 Bacteria 228504
968 Ga0495595_0018898 3300053084 Bacteria 2984
969 Ga0495595_0050785 3300053084 Bacteria 1921
970 Ga0495619_0000067 3300053085 Bacteria 83418
971 Ga0495619_0020724 3300053085 Bacteria 4192
972 Ga0500578_0000011 3300053086 Bacteria 217243
973 Ga0500643_000008 3300053087 Bacteria 457931
974 Ga0500644_0000204 3300053088 Bacteria 35880
975 Ga0500583_0034679 3300053092 Bacteria 2245
976 Ga0500651_0002949 3300053093 Bacteria 9158
977 Ga0500566_0000162 3300053094 Bacteria 34256
978 Ga0500566_0008386 3300053094 Bacteria 6111
979 Ga0500556_0000317 3300053104 Bacteria 36403
980 Ga0500556_0001079 3300053104 Bacteria 13767
981 Ga0500593_002351 3300053117 Bacteria 6931
982 Ga0500593_010832 3300053117 Bacteria 3836
983 Ga0500595_003028 3300053119 Bacteria 7984
984 Ga0500607_038321 3300053121 Bacteria 2609
985 Ga0500617_023549 3300053124 Bacteria 2723
986 Ga0500628_000798 3300053129 Bacteria 5590
987 Ga0500652_000189 3300053131 Bacteria 23838
988 Ga0500658_0008263 3300053134 Bacteria 3846
989 Ga0500559_0000097 3300053136 Bacteria 70124
990 Ga0500559_0012325 3300053136 Bacteria 3636
991 Ga0500568_0004967 3300053139 Bacteria 6989
992 Ga0500588_0000286 3300053146 Bacteria 7441
993 Ga0500590_000044 3300053148 Bacteria 29977
994 Ga0500590_025761 3300053148 Bacteria 3054
995 Ga0500616_0000491 3300053153 Bacteria 51066
996 Ga0500616_0018420 3300053153 Bacteria 3948
997 Ga0500622_0000097 3300053156 Bacteria 89802
998 Ga0500622_0000434 3300053156 Bacteria 39656
999 Ga0500622_0000978 3300053156 Bacteria 24237
1000 Ga0500622_0001119 3300053156 Bacteria 22384
1001 Ga0500622_0007159 3300053156 Bacteria 6361
1002 Ga0500633_0000920 3300053160 Bacteria 5140
1003 Ga0500645_001558 3300053730 Bacteria 11410
1004 Ga0500587_001071 3300053739 Bacteria 3744
1005 Ga0501084_0001034 3300054114 Bacteria 21610
1006 Ga0501084_0005366 3300054114 Bacteria 10507
1007 Ga0501084_0024439 3300054114 Bacteria 5040
1008 Ga0501082_0001324 3300060353 Bacteria 21681
1009 Ga0501082_0002035 3300060353 Bacteria 17775
1010 Ga0501082_0004992 3300060353 Bacteria 11584
1011 Ga0501082_0067845 3300060353 Bacteria 3072
1012 2509391201 2509276021 Bacteria 7634384
1013 2510892209 2510461076 Bacteria 8618824
1014 2511194983 2510917030 Bacteria 7460662
1015 2513599358 2513237088 Bacteria 6927906
1016 2513713614 2513237103 Bacteria 7647401
1017 2514023313 2513237162 Bacteria 7468464
1018 2515632134 2515154113 Bacteria 7807172
1019 2515644564 2515154114 Bacteria 7848616
1020 2515660011 2515154116 Bacteria 7552979
1021 2517409976 2517287029 Bacteria 6905599
1022 2520375415 2519899620 Bacteria 6499161
1023 2535520758 2534681796 Bacteria 7146037
1024 2585205188 2582581294 Bacteria 6626667
1025 2585226332 2582581298 Bacteria 7315509
1026 2585404916 2582581867 Bacteria 7184437
1027 2585548748 2585427529 Bacteria 7395659
1028 2587730368 2585428057 Bacteria 6737412
1029 2587736862 2585428058 Bacteria 6853932
1030 2588291765 2588253510 Bacteria 6901809
1031 2600201911 2599185354 Bacteria 4398675
1032 2617386532 2617270742 Bacteria 6808054
1033 2643825025 2643221561 Bacteria 4984412
1034 2643893200 2643221576 Bacteria 5214352
1035 2643961741 2643221590 Bacteria 5214697
1036 2643972410 2643221592 Bacteria 6608788
1037 2644034069 2643221604 Bacteria 5014917
1038 2644092719 2643221615 Bacteria 5487866
1039 2644099492 2643221617 Bacteria 5139111
1040 2644116315 2643221620 Bacteria 5134593
1041 2644138582 2643221625 Bacteria 6512927
1042 2644193921 2643221634 Bacteria 6705461
1043 2644207894 2643221637 Bacteria 5345260
1044 2644272918 2643221648 Bacteria 6521465
1045 2644305233 2643221654 Bacteria 5273570
1046 2644322332 2643221657 Bacteria 5490246
1047 2644534668 2643221696 Bacteria 5431823
1048 2644651169 2643221718 Bacteria 5345506
1049 2738723276 2738541277 Bacteria 7458140
1050 2738871271 2738541305 Bacteria 4910150
1051 2738885599 2738541307 Bacteria 8606193
1052 2739284007 2738543019 Bacteria 7459457
1053 2739362073 2738543034 Bacteria 6084756
1054 2740167923 2739367898 Bacteria 4367674
1055 2753036132 2751185725 Bacteria 5740550
1056 2753324004 2751185792 Bacteria 5739090
1057 2753766660 2751185897 Bacteria 5322941
1058 2766066970 2765235942 Bacteria 7445910
1059 2793316665 2791355259 Bacteria 7254731
1060 2793319950 2791355260 Bacteria 6598818
1061 2812333868 2811994874 Bacteria 5367947
1062 2819425480 2818991318 Bacteria 5266538
1063 2819667850 2818991458 Bacteria 4794049
1064 2819690248 2818991462 Bacteria 4320267
1065 2819726204 2818991469 Bacteria 4644110
1066 2841868673 2841864319 Bacteria 6742987
1067 2842111837 2842110456 Bacteria 7656360
1068 2842219608 2842217011 Bacteria 7497767
1069 2842342621 2842341865 Bacteria 7003929
1070 2842365603 2842363717 Bacteria 6844742
1071 2857485428 2857481737 Bacteria 4761446
1072 2861695604 2861691609 Bacteria 5628931
1073 2894657232 2894652903 Bacteria 4587256
1074 2904579755 2904578770 Bacteria 5302906
1075 2909048386 2909042592 Bacteria 6499737
1076 2919120577 2919119836 Bacteria 5208557
1077 2928120481 2928115317 Bacteria 6477646
1078 2933588113 2933586486 Bacteria 7667493
1079 639645320 639633055 Bacteria 7751309
1080 8005548531 8005542996 Bacteria 7077758
1081 8024487374 8024486573 Bacteria 6540512
1082 8046772967 8046767195 Bacteria 7547379
1083 Ga0207678_10136773
1084 JGI24744J21845_10004395
1085 JGI25158J39367_1000043
1086 JGI25152J39213_1001831
1087 JGI25152J39213_1007690
1088 JGI25153J46596_10003067
1089 rootH1_10008151
1090 rootH1_10117972
1091 JGI25160J50197_1009936
1092 JGI25161J50226_1000027
1093 Ga0055526_1001863
1094 Ga0055526_1013303
1095 Ga0055528_1015656
1096 Ga0055540_1004588
1097 Ga0055543_1000100
1098 Ga0065165_1001841
1099 Ga0065707_10085008
1100 Ga0070676_10006514
1101 Ga0070683_100008299
1102 Ga0070683_100009231
1103 Ga0070683_100061774
1104 Ga0070683_100167254
1105 Ga0070690_100041805
1106 Ga0070670_100064046
1107 Ga0070677_10000706
1108 Ga0070677_10007124
1109 Ga0068869_100033427
1110 Ga0070666_10012082
1111 Ga0070666_10066872
1112 Ga0070680_100002950
1113 Ga0070682_100000061
1114 Ga0070682_100003688
1115 Ga0070682_100064723
1116 Ga0068868_100020471
1117 Ga0068868_100069539
1118 Ga0068868_100095259
1119 Ga0068868_100223581
1120 Ga0070660_100022184
1121 Ga0070689_100001851
1122 Ga0070689_100083681
1123 Ga0070692_10007517
1124 Ga0070675_100022065
1125 Ga0070675_100025410
1126 Ga0070671_100020733
1127 Ga0070673_100024552
1128 Ga0070688_100011943
1129 Ga0070688_100062643
1130 Ga0070667_100000967
1131 Ga0070667_100002581
1132 Ga0070667_100034441
1133 Ga0070667_100178439
1134 Ga0070709_10025237
1135 Ga0070714_100059436
1136 Ga0070713_100141208
1137 Ga0070701_10038650
1138 Ga0070701_10050854
1139 Ga0070711_100008954
1140 Ga0070705_100052090
1141 Ga0070700_100092156
1142 Ga0070708_100058413
1143 Ga0070681_10002000
1144 Ga0070681_10027724
1145 Ga0068867_100001469
1146 Ga0068867_100047796
1147 Ga0070706_100004269
1148 Ga0070706_100114382
1149 Ga0070706_100194924
1150 Ga0070698_100001386
1151 Ga0070698_100046507
1152 Ga0070699_100046067
1153 Ga0070699_100151915
1154 Ga0070679_100013436
1155 Ga0070679_100027028
1156 Ga0070679_100073717
1157 Ga0070684_100004622
1158 Ga0070697_100023957
1159 Ga0070672_100000005
1160 Ga0070672_100001159
1161 Ga0070672_100005485
1162 Ga0070672_100040468
1163 Ga0070672_100054676
1164 Ga0070672_100067276
1165 Ga0070672_100122881
1166 Ga0070686_100004637
1167 Ga0070686_100021257
1168 Ga0070665_100000566
1169 Ga0070665_100001336
1170 Ga0070665_100002579
1171 Ga0070665_100008692
1172 Ga0070665_100012031
1173 Ga0070665_100034625
1174 Ga0070665_100041042
1175 Ga0070665_100055601
1176 Ga0068855_100000327
1177 Ga0068855_100000479
1178 Ga0068855_100004779
1179 Ga0068855_100048599
1180 Ga0068855_100134114
1181 Ga0068855_100136947
1182 Ga0070664_100019671
1183 Ga0070664_100054357
1184 Ga0068856_100005787
1185 Ga0068856_100104020
1186 Ga0068856_100132386
1187 Ga0068856_100192913
1188 Ga0070702_100019013
1189 Ga0070702_100031825
1190 Ga0070702_100116255
1191 Ga0068852_100004825
1192 Ga0068852_100035444
1193 Ga0068852_100080734
1194 Ga0068852_100175914
1195 Ga0068859_100006016
1196 Ga0068859_100018500
1197 Ga0068859_100068400
1198 Ga0068859_100141878
1199 Ga0068859_100176913
1200 Ga0068864_100008855
1201 Ga0068864_100014290
1202 Ga0068864_100031966
1203 Ga0068864_100094347
1204 Ga0068866_10008363
1205 Ga0068866_10016882
1206 Ga0068861_100001686
1207 Ga0068861_100004568
1208 Ga0068861_100005967
1209 Ga0068861_100034539
1210 Ga0068861_100050147
1211 Ga0068861_100065417
1212 Ga0068861_100082644
1213 Ga0068870_10016817
1214 Ga0068870_10088242
1215 Ga0068863_100011481
1216 Ga0068863_100078590
1217 Ga0068863_100127377
1218 Ga0068863_100155869
1219 Ga0068858_100002321
1220 Ga0068858_100004646
1221 Ga0068858_100007963
1222 Ga0068858_100040576
1223 Ga0068860_100000470
1224 Ga0068860_100082225
1225 Ga0068860_100094501
1226 Ga0068862_100036157
1227 Ga0081455_10002149
1228 Ga0081455_10002595
1229 Ga0081455_10012181
1230 Ga0081455_10020543
1231 Ga0081455_10033753
1232 Ga0081455_10050302
1233 Ga0081538_10000022
1234 Ga0081540_1005379
1235 Ga0081540_1012367
1236 Ga0081539_10000159
1237 Ga0081539_10003942
1238 Ga0081539_10009579
1239 Ga0070717_10016752
1240 Ga0075365_10001309
1241 Ga0075365_10003178
1242 Ga0075365_10005649
1243 Ga0075365_10016962
1244 Ga0075365_10019010
1245 Ga0075365_10046261
1246 Ga0075365_10053282
1247 Ga0075368_10001032
1248 Ga0075368_10001687
1249 Ga0075368_10009161
1250 Ga0075368_10014667
1251 Ga0075363_100004619
1252 Ga0075363_100008063
1253 Ga0075363_100014602
1254 Ga0075363_100056895
1255 Ga0075364_10000624
1256 Ga0075364_10003803
1257 Ga0075364_10003820
1258 Ga0075364_10017125
1259 Ga0075364_10020301
1260 Ga0075364_10032639
1261 Ga0075364_10068764
1262 Ga0070715_10006280
1263 Ga0070712_100044730
1264 Ga0070712_100059186
1265 Ga0075367_10004567
1266 Ga0075367_10005175
1267 Ga0075369_10000119
1268 Ga0075369_10018822
1269 Ga0075366_10006300
1270 Ga0075366_10007947
1271 Ga0075366_10010334
1272 Ga0075366_10010484
1273 Ga0075366_10063026
1274 Ga0097621_100003890
1275 Ga0097621_100009897
1276 Ga0075370_10000383
1277 Ga0075370_10002885
1278 Ga0075370_10007701
1279 Ga0075370_10008408
1280 Ga0075370_10030970
1281 Ga0075370_10038957
1282 Ga0075370_10085917
1283 Ga0068871_100007165
1284 Ga0075428_100001401
1285 Ga0075428_100027074
1286 Ga0075428_100073956
1287 Ga0075430_100004725
1288 Ga0075431_100004352
1289 Ga0075431_100019791
1290 Ga0075431_100133566
1291 Ga0075434_100082889
1292 Ga0075434_100132129
1293 Ga0075429_100001477
1294 Ga0068865_100010323
1295 Ga0097620_100006016
1296 Ga0097620_100018500
1297 Ga0097620_100068400
1298 Ga0097620_100141867
1299 Ga0097620_100176918
1300 Ga0099794_10001837
1301 Ga0099794_10006637
1302 Ga0099794_10066949
1303 Ga0099795_10000213
1304 Ga0105250_10000005
1305 Ga0105240_10000215
1306 Ga0105240_10000587
1307 Ga0105240_10002394
1308 Ga0105240_10011765
1309 Ga0105240_10011928
1310 Ga0105240_10025141
1311 Ga0105240_10049046
1312 Ga0105240_10127737
1313 Ga0105240_10157215
1314 Ga0105240_10223337
1315 Ga0105240_10226453
1316 Ga0111539_10049954
1317 Ga0111539_10212266
1318 Ga0105245_10003386
1319 Ga0105245_10005468
1320 Ga0105245_10068852
1321 Ga0105247_10002551
1322 Ga0105247_10014662
1323 Ga0105247_10019262
1324 Ga0105247_10025217
1325 Ga0114129_10001245
1326 Ga0105243_10007737
1327 Ga0105243_10038713
1328 Ga0105243_10126363
1329 Ga0105243_10160217
1330 Ga0105241_10080097
1331 Ga0105242_10021791
1332 Ga0105242_10113114
1333 Ga0105248_10206868
1334 Ga0105237_10000560
1335 Ga0105237_10004790
1336 Ga0105237_10044948
1337 Ga0105237_10187773
1338 Ga0105237_10223109
1339 Ga0105238_10000607
1340 Ga0105238_10010367
1341 Ga0105249_10020374
1342 Ga0105249_10034441
1343 Ga0123341_1000008
1344 Ga0123342_1005465
1345 Ga0105239_10000025
1346 Ga0105239_10000269
1347 Ga0105239_10019971
1348 Ga0105239_10022212
1349 Ga0105239_10153090
1350 Ga0105246_10003455
1351 Ga0105246_10015747
1352 Ga0157371_10129035
1353 Ga0157370_10050953
1354 Ga0157374_10007450
1355 Ga0157378_10276432
1356 Ga0163162_10014396
1357 Ga0163162_10047916
1358 Ga0163162_10250446
1359 Ga0157372_10006775
1360 Ga0157375_10004470
1361 Ga0157375_10008041
1362 Ga0157375_10009166
1363 Ga0157375_10030639
1364 Ga0157375_10038969
1365 Ga0157375_10260599
1366 Ga0163163_10000044
1367 Ga0163163_10000876
1368 Ga0163163_10016691
1369 Ga0163163_10037049
1370 Ga0163163_10192228
1371 Ga0157380_10066780
1372 Ga0157380_10131909
1373 Ga0182008_10035582
1374 Ga0157377_10036186
1375 Ga0157377_10045571
1376 Ga0157379_10000038
1377 Ga0157379_10007099
1378 Ga0157379_10008491
1379 Ga0157379_10012604
1380 Ga0157379_10022185
1381 Ga0157379_10031631
1382 Ga0157379_10037973
1383 Ga0157379_10142457
1384 Ga0157376_10013434
1385 Ga0157376_10018397
1386 Ga0157376_10165202
1387 Ga0182006_1030966
1388 Ga0182007_10001637
1389 Ga0163161_10055223
1390 Ga0213875_10020700
1391 Ga0209436_100009
1392 Ga0207425_1004443
1393 Ga0209129_1000041
1394 Ga0209129_1000333
1395 Ga0209673_1000013
1396 Ga0209673_1007377
1397 Ga0209130_1000022
1398 Ga0209025_1019064
1399 Ga0209564_1000029
1400 Ga0209564_1000264
1401 Ga0209564_1001353
1402 Ga0209564_1002363
1403 Ga0209758_1000043
1404 Ga0209758_1000057
1405 Ga0209758_1007042
1406 Ga0209050_1000149
1407 Ga0209256_1005145
1408 Ga0209256_1006523
1409 Ga0209256_1008410
1410 Ga0209256_1018531
1411 Ga0207426_1000042
1412 Ga0207426_1000537
1413 Ga0209051_1000489
1414 Ga0209051_1007353
1415 Ga0207656_10000244
1416 Ga0207696_1000276
1417 Ga0207692_10015057
1418 Ga0207642_10013793
1419 Ga0207642_10030691
1420 Ga0207710_10000593
1421 Ga0207710_10011463
1422 Ga0207688_10001626
1423 Ga0207688_10006136
1424 Ga0207680_10005598
1425 Ga0207647_10058303
1426 Ga0207685_10001766
1427 Ga0207645_10003682
1428 Ga0207645_10014754
1429 Ga0207645_10040690
1430 Ga0207643_10001184
1431 Ga0207643_10024032
1432 Ga0207705_10024663
1433 Ga0207684_10005060
1434 Ga0207684_10061918
1435 Ga0207684_10138169
1436 Ga0207707_10001863
1437 Ga0207707_10141546
1438 Ga0207695_10000347
1439 Ga0207695_10004517
1440 Ga0207695_10016693
1441 Ga0207695_10018105
1442 Ga0207695_10020509
1443 Ga0207695_10039933
1444 Ga0207695_10061366
1445 Ga0207695_10158749
1446 Ga0207671_10000952
1447 Ga0207671_10024013
1448 Ga0207671_10138007
1449 Ga0207693_10052265
1450 Ga0207663_10017023
1451 Ga0207660_10025425
1452 Ga0207660_10025885
1453 Ga0207657_10002307
1454 Ga0207657_10058970
1455 Ga0207652_10019486
1456 Ga0207652_10055163
1457 Ga0207652_10063785
1458 Ga0207681_10024501
1459 Ga0207694_10000606
1460 Ga0207694_10021736
1461 Ga0207694_10040384
1462 Ga0207650_10135964
1463 Ga0207659_10116440
1464 Ga0207687_10005646
1465 Ga0207687_10011372
1466 Ga0207700_10039730
1467 Ga0207700_10146165
1468 Ga0207664_10061884
1469 Ga0207644_10002169
1470 Ga0207644_10078058
1471 Ga0207706_10003325
1472 Ga0207686_10082739
1473 Ga0207709_10003330
1474 Ga0207709_10009011
1475 Ga0207709_10032358
1476 Ga0207709_10076289
1477 Ga0207670_10035363
1478 Ga0207669_10021936
1479 Ga0207669_10082467
1480 Ga0207704_10022274
1481 Ga0207704_10057054
1482 Ga0207691_10000028
1483 Ga0207691_10002487
1484 Ga0207691_10008483
1485 Ga0207691_10010326
1486 Ga0207691_10034149
1487 Ga0207691_10102659
1488 Ga0207691_10158855
1489 Ga0207711_10031272
1490 Ga0207711_10087780
1491 Ga0207711_10110637
1492 Ga0207689_10014440
1493 Ga0207689_10028770
1494 Ga0207689_10033405
1495 Ga0207661_10039718
1496 Ga0207661_10228557
1497 Ga0207667_10000175
1498 Ga0207667_10003104
1499 Ga0207667_10008252
1500 Ga0207667_10034111
1501 Ga0207667_10034807
1502 Ga0207651_10218098
1503 Ga0207712_10108531
1504 Ga0207712_10137628
1505 Ga0207640_10000077
1506 Ga0207640_10165641
1507 Ga0207658_10000800
1508 Ga0207658_10117507
1509 Ga0207677_10000929
1510 Ga0207703_10000957
1511 Ga0207703_10001166
1512 Ga0207703_10004717
1513 Ga0207703_10033934
1514 Ga0207703_10064578
1515 Ga0207639_10018300
1516 Ga0207678_10024110
1517 Ga0207708_10002529
1518 Ga0207708_10049932
1519 Ga0207708_10126415
1520 Ga0207702_10010110
1521 Ga0207702_10048313
1522 Ga0207702_10278556
1523 Ga0207641_10001175
1524 Ga0207641_10007318
1525 Ga0207641_10013250
1526 Ga0207641_10072629
1527 Ga0207641_10122262
1528 Ga0207641_10125292
1529 Ga0207648_10000550
1530 Ga0207648_10028619
1531 Ga0207648_10052060
1532 Ga0207648_10061086
1533 Ga0207648_10078057
1534 Ga0207676_10004867
1535 Ga0207676_10031838
1536 Ga0207676_10086857
1537 Ga0207674_10018743
1538 Ga0207674_10032831
1539 Ga0207674_10115649
1540 Ga0207675_100006048
1541 Ga0207675_100007010
1542 Ga0207675_100012751
1543 Ga0207675_100017246
1544 Ga0207675_100030556
1545 Ga0207675_100209559
1546 Ga0207675_100262402
1547 Ga0207683_10169056
1548 Ga0207698_10019128
1549 Ga0207698_10023374
1550 Ga0207698_10080992
1551 Ga0207698_10153374
1552 Ga0209813_10000255
1553 Ga0209813_10004191
1554 Ga0207428_10097293
1555 Ga0268266_10000596
1556 Ga0268266_10001984
1557 Ga0268266_10003195
1558 Ga0268266_10003489
1559 Ga0268266_10009083
1560 Ga0268266_10024997
1561 Ga0268266_10025515
1562 Ga0268266_10073745
1563 Ga0268265_10048388
1564 Ga0268264_10000287
1565 Ga0268264_10000420
1566 Ga0268264_10028551
1567 Ga0268264_10064052
1568 Ga0268264_10144640
1569 Ga0265337_1006149
1570 Ga0265326_10010375
1571 Ga0265334_10000014
1572 Ga0307517_10004912
1573 Ga0307517_10065457
1574 Ga0307517_10093494
1575 Ga0307515_10000011
1576 Ga0307515_10000186
1577 Ga0307515_10050257
1578 Ga0307515_10058448
1579 Ga0307515_10065339
1580 Ga0307515_10097341
1581 Ga0307515_10111006
1582 Ga0307515_10176786
1583 Ga0265338_10000377
1584 Ga0265338_10004531
1585 Ga0265338_10006711
1586 Ga0265338_10047374
1587 Ga0307511_10000037
1588 Ga0307511_10054297
1589 Ga0307512_10061925
1590 Ga0316182_1299158
1591 Ga0265760_10016520
1592 Ga0265328_10038116
1593 Ga0265320_10006123
1594 Ga0265325_10000155
1595 Ga0265340_10000121
1596 Ga0265339_10048068
1597 Ga0265331_10004523
1598 Ga0265331_10004710
1599 Ga0265327_10000487
1600 Ga0265316_10004680
1601 Ga0307513_10002991
1602 Ga0307513_10015253
1603 Ga0307513_10016687
1604 Ga0307513_10053100
1605 Ga0307513_10083111
1606 Ga0307513_10092686
1607 Ga0307513_10234044
1608 Ga0307509_10000001
1609 Ga0307509_10000044
1610 Ga0307509_10003432
1611 Ga0307509_10004147
1612 Ga0307509_10004183
1613 Ga0307509_10021431
1614 Ga0307509_10061981
1615 Ga0307509_10095132
1616 Ga0307408_100000006
1617 Ga0265313_10001336
1618 Ga0307508_10005121
1619 Ga0307508_10011794
1620 Ga0307508_10012983
1621 Ga0307508_10031568
1622 Ga0307514_10020475
1623 Ga0307514_10040937
1624 Ga0265314_10012680
1625 Ga0265314_10025791
1626 Ga0265342_10016314
1627 Ga0265342_10018466
1628 Ga0316576_10006578
1629 Ga0307516_10005815
1630 Ga0307516_10016202
1631 Ga0307516_10017271
1632 Ga0307516_10018714
1633 Ga0307516_10095107
1634 Ga0307516_10157445
1635 Ga0307413_10003854
1636 Ga0307409_100016212
1637 Ga0307409_100028358
1638 Ga0307409_100097567
1639 Ga0307416_100013529
1640 Ga0307510_10000016
1641 Ga0307510_10005766
1642 Ga0307510_10006502
1643 Ga0307510_10008022
1644 Ga0307510_10067143
1645 Ga0373936_0005394
1646 Ga0373936_0034391
1647 Ga0373945_0013158
1648 Ga0373946_0021708
1649 Ga0373931_0007299
1650 Ga0373931_0010537
1651 Ga0373927_0063530
1652 Ga0373933_0069196
1653 Ga0373937_0033714
1654 Ga0373937_0068466
1655 Ga0373937_0148784
1656 Ga0395899_0047305
1657 Ga0395899_0058632
1658 Ga0395900_0006806
1659 Ga0395900_0014634
1660 Ga0395900_0151595
1661 Ga0395898_0004666
1662 Ga0395898_0024464
1663 Ga0395898_0150511
1664 Ga0395905_0102329
1665 Ga0436364_0457524
1666 Ga0436364_0748817
1667 Ga0395901_0020172
1668 Ga0395901_0032881
1669 Ga0395901_0245307
1670 Ga0436365_0002580
1671 Ga0436365_0327786
1672 Ga0436365_0592429
1673 Ga0436365_0898810
1674 Ga0436365_1619143
1675 Ga0436360_0112640
1676 Ga0436360_0738491
1677 Ga0436360_1026710
1678 Ga0436360_1129771
1679 Ga0436361_0395058
1680 Ga0436361_0611431
1681 Ga0436361_0899139
1682 Ga0436363_0481565
1683 Ga0436363_1106384
1684 Ga0436362_0757178
1685 Ga0436362_1106345
1686 Ga0451791_0356334
1687 Ga0451798_0226398
1688 Ga0451800_0869303
1689 Ga0451839_0104998
1690 Ga0451847_0654707
1691 Ga0451851_0138487
1692 Ga0451855_0184220
1693 Ga0439462_0017763
1694 Ga0451577_0133997
1695 Ga0466969_0002439
1696 Ga0466965_0021990
1697 Ga0466965_0026025
1698 Ga0466965_0037781
1699 Ga0466966_0006687
1700 Ga0466966_0029066
1701 Ga0466961_0021280
1702 Ga0466963_0115462
1703 Ga0466971_0073324
1704 Ga0466970_0018274
1705 Ga0466970_0046920
1706 Ga0466970_0052692
1707 Ga0466957_0019120
1708 Ga0466960_0014516
1709 Ga0466960_0023325
1710 Ga0466960_0056478
1711 Ga0466959_0061889
1712 Ga0451576_0020730
1713 Ga0466958_0014007
1714 Ga0466967_0023032
1715 Ga0466967_0043364
1716 Ga0466967_0062820
1717 Ga0466967_0073790
1718 Ga0495627_008967
1719 Ga0495592_0000203
1720 Ga0495592_0073735
1721 Ga0495603_0051288
1722 Ga0495603_0098352
1723 Ga0495590_0031669
1724 Ga0495638_0004766
1725 Ga0495638_0029580
1726 Ga0495638_0036493
1727 Ga0495653_0004980
1728 Ga0495650_0010731
1729 Ga0495650_0012066
1730 Ga0495650_0025838
1731 Ga0495582_0038368
1732 Ga0495605_0015688
1733 Ga0495639_0001912
1734 Ga0495662_0051399
1735 Ga0495664_0105373
1736 Ga0495584_0005419
1737 Ga0495585_0088494
1738 Ga0495607_0072375
1739 Ga0495583_0004172
1740 Ga0495583_0069357
1741 Ga0495606_0000253
1742 Ga0495606_0000895
1743 Ga0495606_0006342
1744 Ga0495608_0000013
1745 Ga0495608_0145297
1746 Ga0495616_0001686
1747 Ga0495616_0014165
1748 Ga0495620_0054441
1749 Ga0495630_0072872
1750 Ga0495630_0107710
1751 Ga0495632_0002177
1752 Ga0495632_0002541
1753 Ga0495632_0026675
1754 Ga0495643_0016469
1755 Ga0495643_0033054
1756 Ga0495648_0033094
1757 Ga0495665_0056714
1758 Ga0495597_0014009
1759 Ga0495622_0000566
1760 Ga0495622_0017920
1761 Ga0495633_0009942
1762 Ga0495633_0054782
1763 Ga0495656_0000232
1764 Ga0495656_0045982
1765 Ga0495668_0042200
1766 Ga0495625_0005672
1767 Ga0495625_0015246
1768 Ga0495625_0015952
1769 Ga0495625_0030593
1770 Ga0495625_0109271
1771 Ga0495635_0119992
1772 Ga0495588_0001503
1773 Ga0495657_0000003
1774 Ga0495671_0019063
1775 Ga0495649_0009300
1776 Ga0495649_0032383
1777 Ga0495649_0070413
1778 Ga0495649_0106081
1779 Ga0495660_0019406
1780 Ga0495674_0011969
1781 Ga0495672_0001753
1782 Ga0495676_0089584
1783 Ga0495680_0143410
1784 Ga0495680_0152583
1785 Ga0495683_0045896
1786 Ga0495687_001076
1787 Ga0495687_006562
1788 Ga0495687_024614
1789 Ga0495675_0000094
1790 Ga0495684_0056481
1791 Ga0495686_0000923
1792 Ga0496100_0001473
1793 Ga0496101_0002555
1794 Ga0496101_0012522
1795 Ga0496101_0018822
1796 Ga0496101_0024641
1797 Ga0496101_0060520
1798 Ga0496102_0002386
1799 Ga0496102_0005870
1800 Ga0496102_0040624
1801 Ga0496102_0042726
1802 Ga0496102_0044793
1803 Ga0496102_0104688
1804 Ga0496104_0010103
1805 Ga0496104_0016340
1806 Ga0496104_0039296
1807 Ga0496104_0048594
1808 Ga0496104_0052297
1809 Ga0496104_0098459
1810 Ga0496104_0202856
1811 Ga0496105_0000649
1812 Ga0496105_0011401
1813 Ga0496105_0011580
1814 Ga0496105_0018169
1815 Ga0496105_0020997
1816 Ga0496105_0057220
1817 Ga0496105_0082879
1818 Ga0496105_0100044
1819 Ga0496107_0002401
1820 Ga0496107_0034810
1821 Ga0496107_0042839
1822 Ga0496107_0106667
1823 Ga0496108_0003961
1824 Ga0496108_0006730
1825 Ga0496108_0047157
1826 Ga0496108_0051740
1827 Ga0496108_0072384
1828 Ga0496109_0000011
1829 Ga0496109_0008248
1830 Ga0496109_0042602
1831 Ga0496109_0062929
1832 Ga0496109_0141433
1833 Ga0496110_0003748
1834 Ga0496110_0032013
1835 Ga0496110_0040232
1836 Ga0496110_0044209
1837 Ga0496110_0062681
1838 Ga0496110_0075894
1839 Ga0496110_0220366
1840 Ga0496110_0221404
1841 Ga0496111_0004320
1842 Ga0496111_0031555
1843 Ga0496111_0048660
1844 Ga0496111_0055314
1845 Ga0496112_0061691
1846 Ga0496113_0009214
1847 Ga0496113_0043947
1848 Ga0496114_0000691
1849 Ga0496114_0004625
1850 Ga0496114_0014043
1851 Ga0496114_0021689
1852 Ga0496114_0055385
1853 Ga0496114_0087299
1854 Ga0496115_0004033
1855 Ga0496115_0005460
1856 Ga0496115_0128209
1857 Ga0496115_0143409
1858 Ga0496116_0006937
1859 Ga0496116_0009097
1860 Ga0496117_0000211
1861 Ga0496117_0002066
1862 Ga0496117_0059146
1863 Ga0496118_0000005
1864 Ga0496118_0001422
1865 Ga0496118_0008974
1866 Ga0496118_0093165
1867 Ga0496119_0001007
1868 Ga0496119_0020348
1869 Ga0496120_0000242
1870 Ga0496121_0000245
1871 Ga0496121_0001299
1872 Ga0496121_0001771
1873 Ga0496121_0006402
1874 Ga0496121_0016052
1875 Ga0496121_0016227
1876 Ga0496122_0043664
1877 Ga0496123_0026983
1878 Ga0496125_0000220
1879 Ga0496125_0002613
1880 Ga0496125_0017234
1881 Ga0496125_0056000
1882 Ga0496126_0000082
1883 Ga0496126_0007294
1884 Ga0496126_0012911
1885 Ga0496126_0030405
1886 Ga0496126_0070007
1887 Ga0496126_0100817
1888 Ga0496126_0228916
1889 Ga0495678_046199
1890 Ga0501031_0009449
1891 Ga0501031_0017540
1892 Ga0501032_0001352
1893 Ga0501032_0016245
1894 Ga0501032_0093024
1895 Ga0501033_0002715
1896 Ga0501033_0009073
1897 Ga0501033_0014485
1898 Ga0501033_0031456
1899 Ga0501033_0044138
1900 Ga0501033_0058023
1901 Ga0501034_0006801
1902 Ga0501034_0015328
1903 Ga0501034_0043680
1904 Ga0501034_0096216
1905 Ga0501034_0096509
1906 Ga0501034_0148802
1907 Ga0501034_0273039
1908 Ga0501036_0010613
1909 Ga0501036_0015326
1910 Ga0501036_0062996
1911 Ga0501037_0002323
1912 Ga0501037_0008734
1913 Ga0501037_0030998
1914 Ga0501038_0012761
1915 Ga0501038_0019872
1916 Ga0501038_0045082
1917 Ga0501038_0058778
1918 Ga0501038_0080373
1919 Ga0501038_0081980
1920 Ga0501039_0040228
1921 Ga0501039_0056362
1922 Ga0501042_0011333
1923 Ga0501042_0054774
1924 Ga0501042_0074421
1925 Ga0501042_0100653
1926 Ga0501042_0109130
1927 Ga0501043_0022731
1928 Ga0501043_0038345
1929 Ga0501043_0038622
1930 Ga0501043_0102213
1931 Ga0501046_0000440
1932 Ga0501046_0013547
1933 Ga0501047_0017363
1934 Ga0501047_0041195
1935 Ga0501047_0075066
1936 Ga0501047_0091725
1937 Ga0501047_0124366
1938 Ga0501047_0138227
1939 Ga0501047_0204700
1940 Ga0501047_0212777
1941 Ga0501048_0003540
1942 Ga0501048_0009975
1943 Ga0501048_0054097
1944 Ga0501067_0005392
1945 Ga0501067_0023499
1946 Ga0501067_0065926
1947 Ga0501068_0013764
1948 Ga0501068_0018284
1949 Ga0501068_0026499
1950 Ga0501069_0001873
1951 Ga0501069_0097792
1952 Ga0501070_0005021
1953 Ga0501070_0020638
1954 Ga0501070_0042508
1955 Ga0501070_0044489
1956 Ga0501070_0049291
1957 Ga0501070_0050550
1958 Ga0501071_0000964
1959 Ga0501071_0052107
1960 Ga0501071_0081063
1961 Ga0501071_0167675
1962 Ga0501072_0007154
1963 Ga0501072_0037835
1964 Ga0501072_0085303
1965 Ga0501073_0004452
1966 Ga0501073_0028934
1967 Ga0501073_0034168
1968 Ga0501073_0049326
1969 Ga0501073_0103994
1970 Ga0501073_0111102
1971 Ga0501074_0000164
1972 Ga0501074_0002061
1973 Ga0501074_0017736
1974 Ga0501074_0027835
1975 Ga0501074_0097952
1976 Ga0501074_0106853
1977 Ga0501076_0003060
1978 Ga0501077_0001810
1979 Ga0501079_0000806
1980 Ga0501079_0006265
1981 Ga0501079_0018566
1982 Ga0501080_0004388
1983 Ga0501080_0021347
1984 Ga0501080_0047414
1985 Ga0501080_0068905
1986 Ga0501080_0127202
1987 Ga0501080_0131057
1988 Ga0501080_0205331
1989 Ga0501081_0047429
1990 Ga0501081_0129275
1991 Ga0501083_0002676
1992 Ga0501083_0007870
1993 Ga0501083_0017374
1994 Ga0501035_0000595
1995 Ga0501035_0004343
1996 Ga0501035_0032187
1997 Ga0501035_0034734
1998 Ga0501044_0001080
1999 Ga0501044_0001470
2000 Ga0501044_0003782
2001 Ga0501044_0009792
2002 Ga0501044_0013472
2003 Ga0501044_0037938
2004 Ga0501044_0059359
2005 Ga0501045_0017641
2006 nmdc:mga03683_26791_c1
2007 nmdc:mga03683_8566_c1
2008 nmdc:mga03n38_11631_c1
2009 nmdc:mga03n38_23432_c1
2010 nmdc:mga03n38_557_c1
2011 nmdc:mga00v17_104215_c1
2012 nmdc:mga00v17_1591_c1
2013 nmdc:mga00v17_6139_c1
2014 nmdc:mga00v17_64745_c1
2015 nmdc:mga00v17_6677_c1
2016 nmdc:mga00v17_8643_c1
2017 nmdc:mga0yw44_112001_c1
2018 nmdc:mga0yw44_13053_c1
2019 nmdc:mga0yw44_17806_c2
2020 nmdc:mga0yw44_27806_c1
2021 nmdc:mga0yw44_29570_c1
2022 nmdc:mga0yw44_33599_c1
2023 nmdc:mga0yw44_58716_c1
2024 nmdc:mga0yw44_6559_c1
2025 nmdc:mga0k408_23318_c1
2026 nmdc:mga06z11_3678_c1
2027 nmdc:mga06z11_60060_c1
2028 nmdc:mga04h51_4676_c1
2029 nmdc:mga04h51_6017_c1
2030 nmdc:mga07m45_136846_c1
2031 nmdc:mga07m45_1431_c1
2032 nmdc:mga07m45_14526_c1
2033 nmdc:mga07m45_15022_c1
2034 nmdc:mga07m45_1612_c1
2035 nmdc:mga07m45_22035_c1
2036 nmdc:mga07m45_37676_c1
2037 nmdc:mga05p37_411199_c1
2038 nmdc:mga05p37_4665_c1
2039 nmdc:mga09592_9512_c1
2040 nmdc:mga0qj67_142782_c1
2041 nmdc:mga0qj67_3934_c1
2042 nmdc:mga06r32_3907_c1
2043 nmdc:mga08y16_55772_c1
2044 nmdc:mga0sz30_4483_c1
2045 Ga0495601_0010824
2046 Ga0495601_0062416
2047 Ga0495655_0001453
2048 Ga0495595_0000007
2049 Ga0495595_0018898
2050 Ga0495595_0050785
2051 Ga0495619_0000067
2052 Ga0495619_0020724
2053 Ga0500578_0000011
2054 Ga0500643_000008
2055 Ga0500644_0000204
2056 Ga0500583_0034679
2057 Ga0500651_0002949
2058 Ga0500566_0000162
2059 Ga0500566_0008386
2060 Ga0500556_0000317
2061 Ga0500556_0001079
2062 Ga0500593_002351
2063 Ga0500593_010832
2064 Ga0500595_003028
2065 Ga0500607_038321
2066 Ga0500617_023549
2067 Ga0500628_000798
2068 Ga0500652_000189
2069 Ga0500658_0008263
2070 Ga0500559_0000097
2071 Ga0500559_0012325
2072 Ga0500568_0004967
2073 Ga0500588_0000286
2074 Ga0500590_000044
2075 Ga0500590_025761
2076 Ga0500616_0000491
2077 Ga0500616_0018420
2078 Ga0500622_0000097
2079 Ga0500622_0000434
2080 Ga0500622_0000978
2081 Ga0500622_0001119
2082 Ga0500622_0007159
2083 Ga0500633_0000920
2084 Ga0500645_001558
2085 Ga0500587_001071
2086 Ga0501084_0001034
2087 Ga0501084_0005366
2088 Ga0501084_0024439
2089 Ga0501082_0001324
2090 Ga0501082_0002035
2091 Ga0501082_0004992
2092 Ga0501082_0067845
2093 2509391201
2094 2510892209
2095 2511194983
2096 2513599358
2097 2513713614
2098 2514023313
2099 2515632134
2100 2515644564
2101 2515660011
2102 2517409976
2103 2520375415
2104 2535520758
2105 2585205188
2106 2585226332
2107 2585404916
2108 2585548748
2109 2587730368
2110 2587736862
2111 2588291765
2112 2600201911
2113 2617386532
2114 2643825025
2115 2643893200
2116 2643961741
2117 2643972410
2118 2644034069
2119 2644092719
2120 2644099492
2121 2644116315
2122 2644138582
2123 2644193921
2124 2644207894
2125 2644272918
2126 2644305233
2127 2644322332
2128 2644534668
2129 2644651169
2130 2738723276
2131 2738871271
2132 2738885599
2133 2739284007
2134 2739362073
2135 2740167923
2136 2753036132
2137 2753324004
2138 2753766660
2139 2766066970
2140 2793316665
2141 2793319950
2142 2812333868
2143 2819425480
2144 2819667850
2145 2819690248
2146 2819726204
2147 2841868673
2148 2842111837
2149 2842219608
2150 2842342621
2151 2842365603
2152 2857485428
2153 2861695604
2154 2894657232
2155 2904579755
2156 2909048386
2157 2919120577
2158 2928120481
2159 2933588113
2160 639645320
2161 8005548531
2162 8024487374
2163 8046772967

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

222

544

0.91

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

29

220

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8899 13 474
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8817 9 474
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8804 13 474
5ukw-assembly1.cif.gz_A crystal structure of human glucose 6-phosphate dehydrogenase mutant (a277c) complexed with g6p 0.8761 12 473
4lgv-assembly1.cif.gz_A x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.8753 12 474
ID Description Score Start End Superfamily
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9249 18 181 3.40.50.720
1e7mA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9087 13 178 3.40.50.720
af_O14137_1_171_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9037 14 178 3.40.50.720
af_Q557D2_7_178_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8813 12 178 3.40.50.720
4lgvD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8804 13 178 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6P0DV66-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9853 28 164 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A534WCE8-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9802 1 171 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A6P0DV66-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9782 28 164 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A534WCE8-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9746 1 171 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A6N9V909-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9699 219 333 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Map