F489688

General Info

Members Datasets Scaffolds Average Seq Length
1081 599 2154 398

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_034405|Ga0500645_034405_59_1375
Length 438
Sequence MYTKSSSRFSIDLVRGARAPFLQGIPPKELPMLQYSFAKSGRHFLQIPGPTNVPDRILRAIDRPTIDHRGPEFGVLGKKVLEGMKAIFQTKSPVIIYPASGTGAWEAALVNTLSPGDTVLMYESGQFATLWKNMAVKVGLKPEFIEGDWRRAADPAAIEARLKEDMSQSGGHTIKAVCVVHNETSTGCTARIPEIRRAIDRAGHPALLLVDTISSLGSIDYRHDEWGVDVTVGGSQKGLMLPPGISFNAISDKALAAAKSSKSLKSFWGWEEMLASNKTGYFPYTPNTNLLYGLHEAIDMLMEEGLSNVFARHNRHAEATRRAVRAWGMEVFCQIPEEYSGALTTILMPEGHNADALRKVILEKFDMSLGQGLGKISGKVFRIGHLGDFNDLTLMGTLSGVEMGFEVAGVPHQKGGAQAAIDYLAQCAKAPAALKAAA

Samples

Sample ID Description Type Environment
1 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
97 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
127 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
128 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
129 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
203 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
206 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
207 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
215 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
216 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
217 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
218 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
219 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
223 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
226 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
227 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
228 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
243 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
250 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
251 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
252 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
272 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
278 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
298 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
362 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
401 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
402 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
403 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
404 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
405 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
406 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
407 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
408 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
409 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
410 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
411 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
412 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
413 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
414 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
415 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
416 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
417 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
418 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
419 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
420 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
421 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
422 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
423 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
424 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
425 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
426 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
427 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
430 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
431 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
432 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
433 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
434 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
435 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
436 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
437 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
438 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
439 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
440 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
441 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
442 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
443 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
444 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
445 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
446 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
447 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
448 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
449 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
450 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
451 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
452 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
453 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
454 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
455 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
456 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
457 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
458 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
459 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
460 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
461 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
462 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
463 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
464 2791355199
465 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
466 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
467 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
468 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
469 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
470 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
471 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
472 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
473 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
474 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
475 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
476 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
477 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
478 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
479 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
480 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
481 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
482 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
483 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
484 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
485 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
486 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
487 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
488 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
489 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
490 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
491 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
492 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
493 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
494 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
495 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
496 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
497 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
498 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
499 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
500 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
501 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
502 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
503 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
504 2904699407
505 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
506 2906610324
507 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
508 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
509 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
510 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
511 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
512 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
513 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
514 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
515 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
516 2922368715
517 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
518 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
519 2922425934
520 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
521 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
522 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
523 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
524 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
525 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
526 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
527 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
528 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
529 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
530 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
531 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
532 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
533 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
534 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
535 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
536 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
537 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
538 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
539 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
540 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
541 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
542 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
543 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
544 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
545 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
546 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
547 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
548 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
549 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
550 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
551 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
552 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
553 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
554 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
555 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
556 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
557 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
558 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
559 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
560 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
561 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
562 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
563 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
564 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
565 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
566 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
567 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
568 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
569 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
570 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
571 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
572 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
573 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
574 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
575 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
576 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
577 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
578 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
579 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
580 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
581 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
582 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
583 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
584 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
585 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
586 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
587 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
588 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
589 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
590 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
591 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
592 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
593 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
594 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
595 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
596 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
597 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
598 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
599 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.04
Metatranscriptomes 0.37
Isolates 14.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 11.66
Rhizoplane 3.33
Rhizosphere 66.98
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500645_034405 3300053730 Bacteria 1513
2 JGI25151J46595_10000304 3300003187 Bacteria 53759
3 JGI25151J46595_10000631 3300003187 Bacteria 30567
4 JGI25153J46596_10002594 3300003215 Bacteria 10363
5 JGI25153J46596_10006592 3300003215 Bacteria 5850
6 JGI25160J50197_1008713 3300003354 Bacteria 3841
7 JGI25407J50210_10028083 3300003373 Bacteria 1460
8 JGI25404J52841_10002130 3300003659 Bacteria 3684
9 Ga0055535_1000449 3300003761 Bacteria 37935
10 Ga0055542_1000021 3300003762 Bacteria 331499
11 Ga0055526_1000274 3300003771 Bacteria 43546
12 Ga0055543_1002331 3300004625 Bacteria 6365
13 Ga0058861_11860130 3300004800 Bacteria 1824
14 Ga0058862_12887444 3300004803 Bacteria 1370
15 Ga0065165_1000387 3300005262 Bacteria 71385
16 Ga0065714_10079457 3300005288 Bacteria 2515
17 Ga0065712_10074830 3300005290 Bacteria 3997
18 Ga0065715_10003511 3300005293 Bacteria 5011
19 Ga0070658_10020638 3300005327 Bacteria 5279
20 Ga0070658_10048661 3300005327 Bacteria 3433
21 Ga0070676_10014697 3300005328 Bacteria 4306
22 Ga0070683_100002543 3300005329 Bacteria 14568
23 Ga0070683_100014342 3300005329 Bacteria 6931
24 Ga0070683_100074896 3300005329 Bacteria 3162
25 Ga0070690_100022827 3300005330 Bacteria 3832
26 Ga0070670_100001672 3300005331 Bacteria 18004
27 Ga0070670_100003550 3300005331 Bacteria 12975
28 Ga0070677_10011450 3300005333 Bacteria 3059
29 Ga0070677_10044447 3300005333 Bacteria 1767
30 Ga0068869_100007127 3300005334 Bacteria 7123
31 Ga0070666_10033193 3300005335 Bacteria 3414
32 Ga0070666_10035624 3300005335 Bacteria 3301
33 Ga0070680_100003205 3300005336 Bacteria 12167
34 Ga0070680_100120419 3300005336 Bacteria 2190
35 Ga0070680_100121432 3300005336 Bacteria 2181
36 Ga0068868_100000732 3300005338 Bacteria 22193
37 Ga0068868_100003524 3300005338 Bacteria 10904
38 Ga0068868_100021095 3300005338 Bacteria 4904
39 Ga0068868_100102554 3300005338 Bacteria 2317
40 Ga0068868_100193480 3300005338 Bacteria 1692
41 Ga0070660_100001026 3300005339 Bacteria 18747
42 Ga0070660_100043859 3300005339 Bacteria 3418
43 Ga0070661_100000659 3300005344 Bacteria 25350
44 Ga0070661_100001562 3300005344 Bacteria 15939
45 Ga0070661_100006984 3300005344 Bacteria 7793
46 Ga0070661_100098337 3300005344 Bacteria 2174
47 Ga0070692_10084268 3300005345 Bacteria 1718
48 Ga0070668_100007414 3300005347 Bacteria 8141
49 Ga0070668_100089465 3300005347 Bacteria 2425
50 Ga0070668_100097333 3300005347 Bacteria 2327
51 Ga0070668_100134901 3300005347 Bacteria 1984
52 Ga0070669_100008959 3300005353 Bacteria 7142
53 Ga0070669_100077945 3300005353 Bacteria 2463
54 Ga0070675_100000909 3300005354 Bacteria 21059
55 Ga0070675_100003113 3300005354 Bacteria 12541
56 Ga0070671_100000836 3300005355 Bacteria 22365
57 Ga0070671_100003711 3300005355 Bacteria 11985
58 Ga0070671_100048347 3300005355 Bacteria 3537
59 Ga0070671_100120512 3300005355 Bacteria 2207
60 Ga0070671_100303358 3300005355 Bacteria 1360
61 Ga0070674_100014087 3300005356 Bacteria 4963
62 Ga0070673_100000415 3300005364 Bacteria 22516
63 Ga0070673_100077331 3300005364 Bacteria 2689
64 Ga0070673_100084649 3300005364 Bacteria 2579
65 Ga0070659_100013383 3300005366 Bacteria 6104
66 Ga0070659_100107845 3300005366 Bacteria 2246
67 Ga0070659_100133981 3300005366 Bacteria 2014
68 Ga0070667_100001323 3300005367 Bacteria 22254
69 Ga0070667_100011922 3300005367 Bacteria 7193
70 Ga0070667_100040845 3300005367 Bacteria 3891
71 Ga0070709_10001625 3300005434 Bacteria 12157
72 Ga0070709_10005194 3300005434 Bacteria 7044
73 Ga0070709_10048202 3300005434 Bacteria 2658
74 Ga0070714_100001230 3300005435 Bacteria 18485
75 Ga0070714_100049268 3300005435 Bacteria 3586
76 Ga0070714_100052864 3300005435 Bacteria 3465
77 Ga0070713_100057831 3300005436 Bacteria 3230
78 Ga0070713_100209287 3300005436 Bacteria 1765
79 Ga0070710_10001955 3300005437 Bacteria 9757
80 Ga0070711_100000864 3300005439 Bacteria 15936
81 Ga0070711_100020766 3300005439 Bacteria 4238
82 Ga0070711_100033716 3300005439 Bacteria 3411
83 Ga0070711_100079974 3300005439 Bacteria 2326
84 Ga0070700_100003662 3300005441 Bacteria 7944
85 Ga0070700_100048678 3300005441 Bacteria 2628
86 Ga0070708_100000447 3300005445 Bacteria 30884
87 Ga0070663_100126611 3300005455 Bacteria 1935
88 Ga0070663_100138257 3300005455 Bacteria 1857
89 Ga0070678_100000308 3300005456 Bacteria 22695
90 Ga0070678_100011586 3300005456 Bacteria 5446
91 Ga0070678_100055577 3300005456 Bacteria 2890
92 Ga0070662_100003497 3300005457 Bacteria 9797
93 Ga0070662_100090113 3300005457 Bacteria 2301
94 Ga0070681_10000556 3300005458 Bacteria 30697
95 Ga0070681_10011881 3300005458 Bacteria 8634
96 Ga0070681_10012768 3300005458 Bacteria 8335
97 Ga0070681_10032524 3300005458 Bacteria 5235
98 Ga0070681_10058628 3300005458 Bacteria 3829
99 Ga0070681_10065786 3300005458 Bacteria 3594
100 Ga0068867_100002001 3300005459 Bacteria 14223
101 Ga0068867_100005583 3300005459 Bacteria 8913
102 Ga0068867_100021754 3300005459 Bacteria 4578
103 Ga0068867_100147418 3300005459 Bacteria 1846
104 Ga0068867_100153725 3300005459 Bacteria 1809
105 Ga0070706_100008748 3300005467 Bacteria 9432
106 Ga0070707_100087854 3300005468 Bacteria 3007
107 Ga0070698_100056495 3300005471 Bacteria 3977
108 Ga0070698_100228974 3300005471 Bacteria 1792
109 Ga0070679_100000724 3300005530 Bacteria 28496
110 Ga0070679_100012464 3300005530 Bacteria 8126
111 Ga0070679_100014399 3300005530 Bacteria 7596
112 Ga0070679_100039481 3300005530 Bacteria 4691
113 Ga0070684_100042424 3300005535 Bacteria 3927
114 Ga0068853_100010070 3300005539 Bacteria 7638
115 Ga0068853_100018013 3300005539 Bacteria 5838
116 Ga0068853_100393010 3300005539 Bacteria 1297
117 Ga0070672_100000177 3300005543 Bacteria 35110
118 Ga0070672_100000186 3300005543 Bacteria 34186
119 Ga0070672_100085759 3300005543 Bacteria 2531
120 Ga0070672_100149660 3300005543 Bacteria 1930
121 Ga0070696_100112145 3300005546 Bacteria 1965
122 Ga0070665_100004123 3300005548 Bacteria 15290
123 Ga0070665_100019233 3300005548 Bacteria 6852
124 Ga0070665_100038817 3300005548 Bacteria 4787
125 Ga0070665_100039261 3300005548 Bacteria 4760
126 Ga0070665_100067737 3300005548 Bacteria 3579
127 Ga0070704_100086079 3300005549 Bacteria 2328
128 Ga0070704_100267632 3300005549 Bacteria 1411
129 Ga0068855_100007555 3300005563 Bacteria 13153
130 Ga0068855_100017631 3300005563 Bacteria 8586
131 Ga0068855_100245709 3300005563 Bacteria 1998
132 Ga0070664_100000157 3300005564 Bacteria 47128
133 Ga0070664_100001930 3300005564 Bacteria 16661
134 Ga0070664_100086346 3300005564 Bacteria 2711
135 Ga0068857_100002118 3300005577 Bacteria 16141
136 Ga0068857_100053287 3300005577 Bacteria 3589
137 Ga0068857_100090846 3300005577 Bacteria 2732
138 Ga0068854_100002001 3300005578 Bacteria 12483
139 Ga0068854_100025797 3300005578 Bacteria 4033
140 Ga0068854_100043871 3300005578 Bacteria 3172
141 Ga0068854_100072435 3300005578 Bacteria 2523
142 Ga0068856_100003357 3300005614 Bacteria 16236
143 Ga0068856_100095788 3300005614 Bacteria 2956
144 Ga0068852_100000221 3300005616 Bacteria 38665
145 Ga0068852_100000826 3300005616 Bacteria 20462
146 Ga0068852_100016450 3300005616 Bacteria 5769
147 Ga0068852_100027970 3300005616 Bacteria 4606
148 Ga0068852_100187497 3300005616 Bacteria 1949
149 Ga0068859_100102420 3300005617 Bacteria 2921
150 Ga0068864_100024601 3300005618 Bacteria 5067
151 Ga0068864_100060153 3300005618 Bacteria 3289
152 Ga0068864_100068763 3300005618 Bacteria 3078
153 Ga0068864_100075383 3300005618 Bacteria 2945
154 Ga0068861_100006231 3300005719 Bacteria 8115
155 Ga0068861_100019550 3300005719 Bacteria 4838
156 Ga0068861_100073735 3300005719 Bacteria 2652
157 Ga0068851_10093005 3300005834 Bacteria 1590
158 Ga0068863_100003043 3300005841 Bacteria 16570
159 Ga0068863_100048937 3300005841 Bacteria 4008
160 Ga0068863_100051594 3300005841 Bacteria 3898
161 Ga0068863_100138175 3300005841 Bacteria 2328
162 Ga0068863_100292326 3300005841 Bacteria 1579
163 Ga0068858_100016214 3300005842 Bacteria 6999
164 Ga0068858_100032450 3300005842 Bacteria 4849
165 Ga0068858_100033479 3300005842 Bacteria 4767
166 Ga0068860_100014528 3300005843 Bacteria 7705
167 Ga0068860_100042534 3300005843 Bacteria 4337
168 Ga0068862_100007699 3300005844 Bacteria 8912
169 Ga0068862_100030313 3300005844 Bacteria 4557
170 Ga0068862_100062781 3300005844 Bacteria 3196
171 Ga0081455_10004548 3300005937 Bacteria 15486
172 Ga0081455_10007292 3300005937 Bacteria 11670
173 Ga0081455_10008955 3300005937 Bacteria 10343
174 Ga0081455_10080131 3300005937 Bacteria 2678
175 Ga0081538_10003622 3300005981 Bacteria 14521
176 Ga0081540_1000745 3300005983 Bacteria 29937
177 Ga0081540_1003399 3300005983 Bacteria 12610
178 Ga0081540_1006214 3300005983 Bacteria 8756
179 Ga0081540_1009249 3300005983 Bacteria 6796
180 Ga0081540_1010444 3300005983 Bacteria 6287
181 Ga0081540_1013078 3300005983 Bacteria 5420
182 Ga0081540_1014387 3300005983 Bacteria 5070
183 Ga0081540_1022848 3300005983 Bacteria 3680
184 Ga0081540_1031419 3300005983 Bacteria 2919
185 Ga0081540_1034982 3300005983 Bacteria 2700
186 Ga0081539_10027525 3300005985 Bacteria 3598
187 Ga0075368_10000198 3300006042 Bacteria 16616
188 Ga0075363_100028435 3300006048 Bacteria 2876
189 Ga0070715_10066040 3300006163 Bacteria 1603
190 Ga0070716_100018886 3300006173 Bacteria 3596
191 Ga0070712_100089096 3300006175 Bacteria 2256
192 Ga0070712_100138991 3300006175 Bacteria 1851
193 Ga0075367_10015991 3300006178 Bacteria 4090
194 Ga0097621_100000202 3300006237 Bacteria 38810
195 Ga0097621_100025322 3300006237 Bacteria 4640
196 Ga0097621_100035686 3300006237 Bacteria 3975
197 Ga0097621_100152815 3300006237 Bacteria 1980
198 Ga0075370_10023535 3300006353 Bacteria 3393
199 Ga0075370_10050736 3300006353 Bacteria 2354
200 Ga0068871_100000840 3300006358 Bacteria 20567
201 Ga0068871_100071907 3300006358 Bacteria 2847
202 Ga0068871_100113418 3300006358 Bacteria 2283
203 Ga0075428_100000580 3300006844 Bacteria 37416
204 Ga0075428_100067152 3300006844 Bacteria 3926
205 Ga0075430_100028026 3300006846 Bacteria 4785
206 Ga0075431_100000518 3300006847 Bacteria 32306
207 Ga0075433_10008386 3300006852 Bacteria 8245
208 Ga0075433_10305129 3300006852 Bacteria 1409
209 Ga0075434_100039202 3300006871 Bacteria 4694
210 Ga0075429_100005751 3300006880 Bacteria 10704
211 Ga0075429_100104260 3300006880 Bacteria 2477
212 Ga0068865_100069910 3300006881 Bacteria 2486
213 Ga0068865_100073297 3300006881 Bacteria 2434
214 Ga0068865_100077599 3300006881 Bacteria 2374
215 Ga0075436_100211176 3300006914 Bacteria 1376
216 Ga0097620_100102431 3300006931 Bacteria 2921
217 Ga0099825_1035458 3300006941 Bacteria 1783
218 Ga0099824_1016897 3300006942 Bacteria 6485
219 Ga0075435_100012082 3300007076 Bacteria 6383
220 Ga0075435_100106968 3300007076 Unclassified 2323
221 Ga0075435_100128943 3300007076 Bacteria 2116
222 Ga0075435_100157609 3300007076 Bacteria 1911
223 Ga0075435_100170271 3300007076 Bacteria 1837
224 Ga0105240_10001724 3300009093 Bacteria 36906
225 Ga0105240_10007858 3300009093 Bacteria 15392
226 Ga0105240_10010644 3300009093 Bacteria 12916
227 Ga0105240_10341283 3300009093 Bacteria 1701
228 Ga0105240_10402506 3300009093 Bacteria 1541
229 Ga0111539_10000651 3300009094 Bacteria 44838
230 Ga0111539_10061654 3300009094 Bacteria 4442
231 Ga0111539_10437085 3300009094 Bacteria 1524
232 Ga0105245_10007672 3300009098 Bacteria 9449
233 Ga0105245_10025858 3300009098 Bacteria 5163
234 Ga0105245_10026441 3300009098 Bacteria 5107
235 Ga0105245_10031273 3300009098 Bacteria 4709
236 Ga0105245_10102254 3300009098 Bacteria 2654
237 Ga0114129_10000505 3300009147 Bacteria 47605
238 Ga0114129_10003700 3300009147 Bacteria 21537
239 Ga0114129_10019741 3300009147 Bacteria 9592
240 Ga0114129_10131325 3300009147 Bacteria 3439
241 Ga0114129_10165612 3300009147 Unclassified 3017
242 Ga0105241_10054338 3300009174 Bacteria 3066
243 Ga0105241_10072385 3300009174 Bacteria 2679
244 Ga0105241_10142475 3300009174 Bacteria 1953
245 Ga0105241_10188774 3300009174 Bacteria 1714
246 Ga0105242_10005776 3300009176 Bacteria 9534
247 Ga0105242_10055417 3300009176 Bacteria 3243
248 Ga0105248_10022137 3300009177 Bacteria 7045
249 Ga0105248_10083121 3300009177 Bacteria 3602
250 Ga0105248_10208068 3300009177 Bacteria 2204
251 Ga0105248_10233089 3300009177 Bacteria 2072
252 Ga0105248_10469087 3300009177 Bacteria 1419
253 Ga0105237_10006524 3300009545 Bacteria 12913
254 Ga0105237_10091157 3300009545 Bacteria 3038
255 Ga0105238_10000203 3300009551 Bacteria 65825
256 Ga0105238_10003461 3300009551 Bacteria 15706
257 Ga0105238_10042740 3300009551 Bacteria 4588
258 Ga0105238_10114570 3300009551 Bacteria 2675
259 Ga0105249_10162936 3300009553 Bacteria 2156
260 Ga0105239_10050052 3300010375 Bacteria 4583
261 Ga0105239_10058326 3300010375 Bacteria 4236
262 Ga0105239_10143600 3300010375 Bacteria 2661
263 Ga0105239_10157662 3300010375 Bacteria 2536
264 Ga0105246_10013973 3300011119 Bacteria 5041
265 Ga0157373_10032306 3300013100 Bacteria 3768
266 Ga0157371_10026840 3300013102 Bacteria 4182
267 Ga0157370_10028168 3300013104 Bacteria 5530
268 Ga0157370_10285437 3300013104 Bacteria 1525
269 Ga0157369_10005960 3300013105 Bacteria 14157
270 Ga0157369_10011596 3300013105 Bacteria 10007
271 Ga0157369_10018830 3300013105 Bacteria 7737
272 Ga0157369_10135432 3300013105 Bacteria 2608
273 Ga0157374_10001953 3300013296 Bacteria 17298
274 Ga0157374_10009479 3300013296 Bacteria 8360
275 Ga0157374_10010653 3300013296 Bacteria 7919
276 Ga0157374_10073614 3300013296 Bacteria 3224
277 Ga0157374_10240195 3300013296 Bacteria 1781
278 Ga0157378_10217421 3300013297 Bacteria 1815
279 Ga0163162_10102021 3300013306 Bacteria 2962
280 Ga0163162_10147944 3300013306 Bacteria 2466
281 Ga0163162_10322113 3300013306 Bacteria 1678
282 Ga0163162_10355879 3300013306 Bacteria 1597
283 Ga0157372_10001409 3300013307 Bacteria 25953
284 Ga0157372_10020476 3300013307 Bacteria 7137
285 Ga0157372_10161855 3300013307 Bacteria 2587
286 Ga0157375_10004073 3300013308 Bacteria 12676
287 Ga0157375_10030596 3300013308 Bacteria 5079
288 Ga0157375_10047417 3300013308 Bacteria 4196
289 Ga0157375_10144763 3300013308 Bacteria 2506
290 Ga0157375_10172449 3300013308 Bacteria 2311
291 Ga0157375_10292512 3300013308 Bacteria 1792
292 Ga0163163_10000090 3300014325 Bacteria 97441
293 Ga0163163_10009881 3300014325 Bacteria 8550
294 Ga0163163_10090300 3300014325 Bacteria 3077
295 Ga0157380_10084448 3300014326 Bacteria 2603
296 Ga0182008_10007140 3300014497 Bacteria 6184
297 Ga0182008_10037367 3300014497 Bacteria 2429
298 Ga0157379_10004907 3300014968 Bacteria 11484
299 Ga0157379_10006862 3300014968 Bacteria 9844
300 Ga0157379_10017175 3300014968 Bacteria 6375
301 Ga0157379_10045315 3300014968 Bacteria 3925
302 Ga0157379_10058923 3300014968 Bacteria 3434
303 Ga0157379_10102599 3300014968 Bacteria 2567
304 Ga0157376_10001708 3300014969 Bacteria 14611
305 Ga0157376_10055032 3300014969 Bacteria 3319
306 Ga0157376_10056182 3300014969 Bacteria 3287
307 Ga0157376_10060308 3300014969 Bacteria 3185
308 Ga0157376_10295420 3300014969 Bacteria 1531
309 Ga0163161_10060111 3300017792 Bacteria 2765
310 Ga0214544_1000055 3300021320 Bacteria 133217
311 Ga0214542_1000196 3300021321 Bacteria 95225
312 Ga0214545_1000028 3300021324 Bacteria 127957
313 Ga0214543_1000044 3300021327 Bacteria 158132
314 Ga0213876_10014155 3300021384 Bacteria 4231
315 Ga0213876_10018389 3300021384 Bacteria 3690
316 Ga0213875_10002599 3300021388 Bacteria 10730
317 Ga0209672_100295 3300025228 Bacteria 34529
318 Ga0209147_101997 3300025229 Bacteria 5929
319 Ga0209258_100058 3300025242 Bacteria 331567
320 Ga0209677_100757 3300025253 Bacteria 16368
321 Ga0209148_1000071 3300025254 Bacteria 331551
322 Ga0209148_1000711 3300025254 Bacteria 26722
323 Ga0209129_1011203 3300025258 Bacteria 2162
324 Ga0209233_1001618 3300025261 Bacteria 8764
325 Ga0209233_1004243 3300025261 Bacteria 4907
326 Ga0209233_1025754 3300025261 Bacteria 1450
327 Ga0209455_1001451 3300025272 Bacteria 10671
328 Ga0209455_1006522 3300025272 Bacteria 3430
329 Ga0209130_1000190 3300025284 Bacteria 86573
330 Ga0209025_1000446 3300025294 Bacteria 80985
331 Ga0209564_1000023 3300025295 Bacteria 555102
332 Ga0209564_1008860 3300025295 Bacteria 4895
333 Ga0209758_1000187 3300025297 Bacteria 138759
334 Ga0209758_1003975 3300025297 Bacteria 12816
335 Ga0209758_1013916 3300025297 Bacteria 4333
336 Ga0209758_1015628 3300025297 Bacteria 3915
337 Ga0209758_1019218 3300025297 Bacteria 3307
338 Ga0209758_1037382 3300025297 Bacteria 1878
339 Ga0209758_1048794 3300025297 Bacteria 1501
340 Ga0207426_1000160 3300025302 Bacteria 174540
341 Ga0207697_10004750 3300025315 Bacteria 6429
342 Ga0207697_10057009 3300025315 Bacteria 1621
343 Ga0207656_10015034 3300025321 Bacteria 2992
344 Ga0207692_10042307 3300025898 Bacteria 2260
345 Ga0207692_10131970 3300025898 Bacteria 1412
346 Ga0207688_10019853 3300025901 Bacteria 3664
347 Ga0207680_10034716 3300025903 Bacteria 2888
348 Ga0207699_10001076 3300025906 Bacteria 12922
349 Ga0207699_10022268 3300025906 Bacteria 3431
350 Ga0207645_10059908 3300025907 Bacteria 2431
351 Ga0207645_10112722 3300025907 Bacteria 1762
352 Ga0207705_10016820 3300025909 Bacteria 5238
353 Ga0207705_10026329 3300025909 Bacteria 4148
354 Ga0207707_10000139 3300025912 Bacteria 74831
355 Ga0207707_10010142 3300025912 Bacteria 8175
356 Ga0207707_10017242 3300025912 Bacteria 6294
357 Ga0207707_10032631 3300025912 Bacteria 4558
358 Ga0207707_10076677 3300025912 Bacteria 2918
359 Ga0207707_10078356 3300025912 Bacteria 2886
360 Ga0207707_10128879 3300025912 Bacteria 2212
361 Ga0207695_10000029 3300025913 Bacteria 548364
362 Ga0207695_10016171 3300025913 Bacteria 8749
363 Ga0207695_10023967 3300025913 Bacteria 6882
364 Ga0207695_10221532 3300025913 Bacteria 1799
365 Ga0207695_10258050 3300025913 Bacteria 1641
366 Ga0207671_10003418 3300025914 Bacteria 15862
367 Ga0207693_10004880 3300025915 Bacteria 11271
368 Ga0207693_10015116 3300025915 Bacteria 6196
369 Ga0207693_10068602 3300025915 Bacteria 2775
370 Ga0207693_10076727 3300025915 Bacteria 2617
371 Ga0207693_10086602 3300025915 Bacteria 2455
372 Ga0207663_10001558 3300025916 Bacteria 10748
373 Ga0207663_10016591 3300025916 Bacteria 4088
374 Ga0207663_10053754 3300025916 Bacteria 2518
375 Ga0207663_10130073 3300025916 Bacteria 1738
376 Ga0207660_10002090 3300025917 Bacteria 13239
377 Ga0207660_10009649 3300025917 Bacteria 6248
378 Ga0207660_10078766 3300025917 Bacteria 2416
379 Ga0207657_10002729 3300025919 Bacteria 19002
380 Ga0207657_10047977 3300025919 Bacteria 3730
381 Ga0207657_10053852 3300025919 Bacteria 3483
382 Ga0207657_10212039 3300025919 Bacteria 1554
383 Ga0207649_10003878 3300025920 Bacteria 8155
384 Ga0207649_10007536 3300025920 Bacteria 5916
385 Ga0207649_10014878 3300025920 Bacteria 4364
386 Ga0207652_10003895 3300025921 Bacteria 12208
387 Ga0207652_10008960 3300025921 Bacteria 8064
388 Ga0207652_10029251 3300025921 Bacteria 4604
389 Ga0207652_10039342 3300025921 Bacteria 4013
390 Ga0207652_10136739 3300025921 Bacteria 2189
391 Ga0207681_10009609 3300025923 Bacteria 5912
392 Ga0207681_10031794 3300025923 Bacteria 3449
393 Ga0207694_10006781 3300025924 Bacteria 8697
394 Ga0207694_10195979 3300025924 Bacteria 1642
395 Ga0207650_10001199 3300025925 Bacteria 19021
396 Ga0207650_10003269 3300025925 Bacteria 11170
397 Ga0207659_10002617 3300025926 Bacteria 10713
398 Ga0207659_10003295 3300025926 Bacteria 9668
399 Ga0207659_10014353 3300025926 Bacteria 5105
400 Ga0207659_10114121 3300025926 Bacteria 2059
401 Ga0207687_10011801 3300025927 Bacteria 5715
402 Ga0207687_10015002 3300025927 Bacteria 5075
403 Ga0207687_10030495 3300025927 Bacteria 3636
404 Ga0207687_10049070 3300025927 Bacteria 2934
405 Ga0207687_10098837 3300025927 Bacteria 2143
406 Ga0207700_10015355 3300025928 Bacteria 5049
407 Ga0207700_10090797 3300025928 Bacteria 2412
408 Ga0207664_10017186 3300025929 Bacteria 5296
409 Ga0207664_10032336 3300025929 Bacteria 4008
410 Ga0207664_10032814 3300025929 Bacteria 3983
411 Ga0207644_10000365 3300025931 Bacteria 29528
412 Ga0207644_10008217 3300025931 Bacteria 6835
413 Ga0207644_10110127 3300025931 Bacteria 2081
414 Ga0207690_10016818 3300025932 Bacteria 4457
415 Ga0207690_10080122 3300025932 Bacteria 2278
416 Ga0207690_10168279 3300025932 Bacteria 1640
417 Ga0207690_10362723 3300025932 Bacteria 1148
418 Ga0207706_10006986 3300025933 Bacteria 10433
419 Ga0207706_10046207 3300025933 Bacteria 3855
420 Ga0207706_10073287 3300025933 Bacteria 3011
421 Ga0207706_10093300 3300025933 Bacteria 2647
422 Ga0207686_10038264 3300025934 Bacteria 2901
423 Ga0207709_10060787 3300025935 Bacteria 2358
424 Ga0207670_10034151 3300025936 Bacteria 3284
425 Ga0207669_10007715 3300025937 Bacteria 5005
426 Ga0207669_10007898 3300025937 Bacteria 4960
427 Ga0207704_10072042 3300025938 Bacteria 2195
428 Ga0207665_10040126 3300025939 Bacteria 3122
429 Ga0207665_10046337 3300025939 Bacteria 2913
430 Ga0207665_10125927 3300025939 Bacteria 1814
431 Ga0207691_10000276 3300025940 Bacteria 50778
432 Ga0207691_10002411 3300025940 Bacteria 18297
433 Ga0207691_10030949 3300025940 Bacteria 4998
434 Ga0207691_10054301 3300025940 Bacteria 3655
435 Ga0207711_10030312 3300025941 Bacteria 4562
436 Ga0207711_10153172 3300025941 Bacteria 2082
437 Ga0207711_10168810 3300025941 Bacteria 1984
438 Ga0207711_10286936 3300025941 Bacteria 1516
439 Ga0207689_10000415 3300025942 Bacteria 39864
440 Ga0207689_10027387 3300025942 Bacteria 4772
441 Ga0207689_10038778 3300025942 Bacteria 3944
442 Ga0207661_10011082 3300025944 Bacteria 6516
443 Ga0207661_10014956 3300025944 Bacteria 5697
444 Ga0207679_10005759 3300025945 Bacteria 7779
445 Ga0207679_10012754 3300025945 Bacteria 5490
446 Ga0207679_10025964 3300025945 Bacteria 4034
447 Ga0207679_10319408 3300025945 Bacteria 1344
448 Ga0207667_10009574 3300025949 Bacteria 11400
449 Ga0207667_10017829 3300025949 Bacteria 7982
450 Ga0207667_10328933 3300025949 Bacteria 1560
451 Ga0207651_10004986 3300025960 Bacteria 6768
452 Ga0207651_10026981 3300025960 Bacteria 3599
453 Ga0207651_10193639 3300025960 Bacteria 1624
454 Ga0207712_10098448 3300025961 Bacteria 2169
455 Ga0207668_10015716 3300025972 Bacteria 4709
456 Ga0207668_10041624 3300025972 Bacteria 3107
457 Ga0207668_10100334 3300025972 Bacteria 2149
458 Ga0207640_10001031 3300025981 Bacteria 15406
459 Ga0207640_10070924 3300025981 Bacteria 2345
460 Ga0207640_10073346 3300025981 Bacteria 2313
461 Ga0207640_10132572 3300025981 Bacteria 1804
462 Ga0207658_10005357 3300025986 Bacteria 8811
463 Ga0207677_10001216 3300026023 Bacteria 13899
464 Ga0207677_10016707 3300026023 Bacteria 4355
465 Ga0207677_10052395 3300026023 Bacteria 2772
466 Ga0207677_10229103 3300026023 Bacteria 1495
467 Ga0207703_10023207 3300026035 Bacteria 4873
468 Ga0207703_10027790 3300026035 Bacteria 4455
469 Ga0207703_10040883 3300026035 Bacteria 3713
470 Ga0207639_10073516 3300026041 Bacteria 2680
471 Ga0207639_10316474 3300026041 Bacteria 1384
472 Ga0207678_10014339 3300026067 Bacteria 6969
473 Ga0207678_10294783 3300026067 Bacteria 1393
474 Ga0207708_10003526 3300026075 Bacteria 11527
475 Ga0207708_10023275 3300026075 Bacteria 4680
476 Ga0207708_10031356 3300026075 Bacteria 4034
477 Ga0207708_10072813 3300026075 Bacteria 2633
478 Ga0207702_10002758 3300026078 Bacteria 16441
479 Ga0207702_10021800 3300026078 Bacteria 5305
480 Ga0207702_10086466 3300026078 Bacteria 2734
481 Ga0207641_10102798 3300026088 Bacteria 2520
482 Ga0207641_10121785 3300026088 Bacteria 2329
483 Ga0207648_10011496 3300026089 Bacteria 8333
484 Ga0207648_10019804 3300026089 Bacteria 6072
485 Ga0207648_10028323 3300026089 Bacteria 4968
486 Ga0207648_10043828 3300026089 Bacteria 3927
487 Ga0207648_10079615 3300026089 Bacteria 2858
488 Ga0207676_10003251 3300026095 Bacteria 11571
489 Ga0207676_10016855 3300026095 Bacteria 5290
490 Ga0207676_10254181 3300026095 Bacteria 1583
491 Ga0207676_10333415 3300026095 Bacteria 1397
492 Ga0207674_10000301 3300026116 Bacteria 62588
493 Ga0207674_10024546 3300026116 Bacteria 6439
494 Ga0207674_10104015 3300026116 Bacteria 2818
495 Ga0207674_10339179 3300026116 Bacteria 1453
496 Ga0207675_100000177 3300026118 Bacteria 57433
497 Ga0207675_100012098 3300026118 Bacteria 8062
498 Ga0207675_100016962 3300026118 Bacteria 6806
499 Ga0207675_100042519 3300026118 Bacteria 4244
500 Ga0207675_100072098 3300026118 Bacteria 3230
501 Ga0207683_10001296 3300026121 Bacteria 22599
502 Ga0207683_10035761 3300026121 Bacteria 4320
503 Ga0207683_10048402 3300026121 Bacteria 3723
504 Ga0207683_10138723 3300026121 Bacteria 2190
505 Ga0207683_10230120 3300026121 Bacteria 1690
506 Ga0207683_10252153 3300026121 Bacteria 1611
507 Ga0207698_10000451 3300026142 Bacteria 23736
508 Ga0207698_10003841 3300026142 Bacteria 9094
509 Ga0207698_10014026 3300026142 Bacteria 5309
510 Ga0207698_10134453 3300026142 Bacteria 2119
511 Ga0207698_10159283 3300026142 Bacteria 1972
512 Ga0209389_1000003 3300027296 Bacteria 268927
513 Ga0209389_1013235 3300027296 Bacteria 7496
514 Ga0209589_1000004 3300027357 Bacteria 578529
515 Ga0209589_1018958 3300027357 Bacteria 6956
516 Ga0209969_1001299 3300027360 Bacteria 3432
517 Ga0209489_100004 3300027361 Bacteria 578529
518 Ga0209489_100022 3300027361 Bacteria 202016
519 Ga0209489_100498 3300027361 Bacteria 73687
520 Ga0209700_100004 3300027363 Bacteria 578529
521 Ga0209700_100023 3300027363 Bacteria 229662
522 Ga0209995_1000129 3300027471 Bacteria 11920
523 Ga0209999_1001230 3300027543 Bacteria 4394
524 Ga0209974_10001304 3300027876 Bacteria 8976
525 Ga0207428_10002244 3300027907 Bacteria 19409
526 Ga0207428_10044812 3300027907 Bacteria 3566
527 Ga0207428_10116536 3300027907 Bacteria 2051
528 Ga0268266_10016506 3300028379 Bacteria 6311
529 Ga0268266_10020042 3300028379 Bacteria 5700
530 Ga0268266_10030718 3300028379 Bacteria 4563
531 Ga0268266_10033577 3300028379 Bacteria 4362
532 Ga0268266_10068376 3300028379 Bacteria 3075
533 Ga0268265_10004529 3300028380 Bacteria 9616
534 Ga0268265_10021741 3300028380 Bacteria 4498
535 Ga0268265_10068962 3300028380 Bacteria 2744
536 Ga0268264_10060301 3300028381 Bacteria 3180
537 Ga0268264_10143054 3300028381 Bacteria 2135
538 Ga0265337_1026833 3300028556 Bacteria 1741
539 Ga0265319_1025769 3300028563 Bacteria 2101
540 Ga0265334_10002844 3300028573 Bacteria 7964
541 Ga0265318_10003531 3300028577 Bacteria 7829
542 Ga0265336_10038645 3300028666 Bacteria 1464
543 Ga0307517_10195693 3300028786 Bacteria 1274
544 Ga0307515_10000346 3300028794 Bacteria 114729
545 Ga0265338_10000013 3300028800 Bacteria 379065
546 Ga0265338_10036574 3300028800 Bacteria 4695
547 Ga0307511_10000911 3300030521 Bacteria 31189
548 Ga0265762_1000974 3300030760 Bacteria 5147
549 Ga0265770_1008006 3300030878 Bacteria 1498
550 Ga0265330_10002701 3300031235 Bacteria 9586
551 Ga0265330_10016691 3300031235 Bacteria 3385
552 Ga0265330_10018614 3300031235 Bacteria 3189
553 Ga0265330_10084151 3300031235 Bacteria 1369
554 Ga0265332_10001762 3300031238 Bacteria 11708
555 Ga0265332_10011531 3300031238 Bacteria 3926
556 Ga0265332_10034645 3300031238 Bacteria 2193
557 Ga0265328_10001075 3300031239 Bacteria 12582
558 Ga0265328_10018349 3300031239 Bacteria 2699
559 Ga0265320_10003447 3300031240 Bacteria 10634
560 Ga0265325_10010884 3300031241 Bacteria 5242
561 Ga0265325_10019513 3300031241 Bacteria 3745
562 Ga0265340_10011815 3300031247 Bacteria 4628
563 Ga0265339_10047117 3300031249 Bacteria 2367
564 Ga0265339_10052634 3300031249 Bacteria 2217
565 Ga0265331_10002915 3300031250 Bacteria 11309
566 Ga0265331_10031305 3300031250 Bacteria 2644
567 Ga0265327_10002317 3300031251 Bacteria 20349
568 Ga0265316_10020579 3300031344 Bacteria 5614
569 Ga0265316_10148551 3300031344 Bacteria 1756
570 Ga0265316_10150662 3300031344 Bacteria 1742
571 Ga0307513_10117435 3300031456 Bacteria 2637
572 Ga0307509_10030149 3300031507 Bacteria 6004
573 Ga0307509_10056601 3300031507 Bacteria 4161
574 Ga0265313_10005096 3300031595 Bacteria 9786
575 Ga0265313_10008779 3300031595 Bacteria 6667
576 Ga0265313_10010102 3300031595 Bacteria 6036
577 Ga0265313_10041293 3300031595 Bacteria 2274
578 Ga0265314_10005350 3300031711 Bacteria 11600
579 Ga0265314_10005790 3300031711 Bacteria 11085
580 Ga0265314_10045348 3300031711 Bacteria 3109
581 Ga0265342_10007979 3300031712 Bacteria 7664
582 Ga0307516_10026755 3300031730 Bacteria 5856
583 Ga0307405_10006482 3300031731 Bacteria 5760
584 Ga0307405_10115435 3300031731 Bacteria 1827
585 Ga0307413_10033804 3300031824 Bacteria 2916
586 Ga0307518_10002453 3300031838 Bacteria 13548
587 Ga0307410_10031925 3300031852 Bacteria 3384
588 Ga0307409_100042722 3300031995 Bacteria 3397
589 Ga0307409_100110520 3300031995 Bacteria 2304
590 Ga0307416_100037183 3300032002 Bacteria 3743
591 Ga0307411_10038649 3300032005 Bacteria 3012
592 Ga0307510_10025985 3300033180 Bacteria 6742
593 Ga0307510_10064626 3300033180 Bacteria 3715
594 Ga0315911_1000014 3300033442 Bacteria 207605
595 Ga0373930_0008781 3300034816 Bacteria 1774
596 Ga0373952_0002091 3300035092 Bacteria 3592
597 Ga0373941_0007836 3300035115 Bacteria 2631
598 Ga0373953_0022929 3300035117 Bacteria 2360
599 Ga0373954_0039281 3300035118 Bacteria 2203
600 Ga0373943_0035367 3300035170 Bacteria 2387
601 Ga0373955_0067167 3300035172 Bacteria 1995
602 Ga0373924_0051526 3300035410 Bacteria 1707
603 Ga0373931_0000651 3300035691 Bacteria 14326
604 Ga0373935_0202814 3300035692 Bacteria 1371
605 Ga0373927_0037396 3300035695 Bacteria 3155
606 Ga0373927_0142158 3300035695 Bacteria 1570
607 Ga0373927_0188298 3300035695 Bacteria 1354
608 Ga0373933_0006984 3300035724 Bacteria 6155
609 Ga0373933_0043532 3300035724 Bacteria 2657
610 Ga0373933_0050912 3300035724 Bacteria 2474
611 Ga0373933_0082337 3300035724 Bacteria 1975
612 Ga0373933_0176435 3300035724 Bacteria 1361
613 Ga0373947_0020564 3300035725 Bacteria 3812
614 Ga0373947_0067382 3300035725 Bacteria 2187
615 Ga0373937_0002894 3300036401 Bacteria 14333
616 Ga0373937_0016007 3300036401 Bacteria 6650
617 Ga0373937_0310329 3300036401 Bacteria 1492
618 Ga0373925_0051407 3300037068 Bacteria 3076
619 Ga0395898_0056203 3300037466 Bacteria 3837
620 Ga0395905_0023182 3300037471 Bacteria 5868
621 Ga0395905_0105928 3300037471 Bacteria 2640
622 Ga0436364_0614112 3300037853 Bacteria 3375
623 Ga0436364_0681123 3300037853 Bacteria 1273
624 Ga0436364_1528058 3300037853 Bacteria 40650
625 Ga0436365_0644345 3300039437 Bacteria 5404
626 Ga0436365_0955306 3300039437 Bacteria 2737
627 Ga0436365_1031159 3300039437 Bacteria 3760
628 Ga0436365_1682025 3300039437 Bacteria 1727
629 Ga0436360_0317573 3300039438 Bacteria 6631
630 Ga0436360_0388551 3300039438 Bacteria 8977
631 Ga0436360_0416689 3300039438 Bacteria 3385
632 Ga0436360_0810186 3300039438 Bacteria 6440
633 Ga0436361_0677831 3300039447 Bacteria 16193
634 Ga0436361_0968143 3300039447 Bacteria 5736
635 Ga0436363_0628506 3300039450 Bacteria 2407
636 Ga0436363_1221684 3300039450 Bacteria 2051
637 Ga0436362_0287411 3300039453 Bacteria 6337
638 Ga0436362_0443667 3300039453 Bacteria 3427
639 Ga0436362_1180616 3300039453 Bacteria 5810
640 Ga0451577_0058147 3300042876 Bacteria 3447
641 Ga0466972_0021164 3300044658 Bacteria 3245
642 Ga0466966_0000940 3300044684 Bacteria 18602
643 Ga0466961_0000029 3300044693 Bacteria 86710
644 Ga0453684_0006879 3300044712 Bacteria 21350
645 Ga0453684_0048765 3300044712 Bacteria 5593
646 Ga0453684_0144446 3300044712 Bacteria 2836
647 Ga0466968_0040411 3300044735 Bacteria 1966
648 Ga0466957_0103182 3300044842 Bacteria 1800
649 Ga0466960_0121513 3300044901 Bacteria 1368
650 Ga0466959_0004320 3300045049 Bacteria 9489
651 Ga0466959_0078618 3300045049 Bacteria 2379
652 Ga0451576_0002059 3300045051 Bacteria 31624
653 Ga0451576_0118441 3300045051 Bacteria 2757
654 Ga0466967_0506998 3300045976 Bacteria 1185
655 Ga0495617_026863 3300046452 Bacteria 1938
656 Ga0495592_0040011 3300046454 Bacteria 3519
657 Ga0495592_0241155 3300046454 Bacteria 1199
658 Ga0495603_0044000 3300046455 Bacteria 2664
659 Ga0495603_0073486 3300046455 Bacteria 2009
660 Ga0495591_020893 3300046458 Bacteria 2150
661 Ga0495638_0000120 3300046460 Bacteria 127382
662 Ga0495638_0013548 3300046460 Bacteria 5544
663 Ga0495638_0085970 3300046460 Bacteria 1901
664 Ga0495638_0200838 3300046460 Bacteria 1125
665 Ga0495651_0030990 3300046462 Bacteria 4171
666 Ga0495653_0032580 3300046463 Bacteria 4135
667 Ga0495653_0097512 3300046463 Bacteria 2136
668 Ga0495580_0036074 3300046472 Bacteria 3551
669 Ga0495582_0063308 3300046473 Bacteria 2044
670 Ga0495639_0014506 3300046475 Bacteria 3412
671 Ga0495664_0002135 3300046477 Bacteria 10562
672 Ga0495584_0009819 3300046491 Bacteria 4922
673 Ga0495584_0026223 3300046491 Bacteria 2952
674 Ga0495585_0005635 3300046492 Bacteria 7864
675 Ga0495585_0010105 3300046492 Bacteria 5637
676 Ga0495596_0010077 3300046500 Bacteria 4131
677 Ga0495583_0014503 3300046506 Bacteria 4345
678 Ga0495583_0076068 3300046506 Bacteria 1467
679 Ga0495606_0043294 3300046507 Bacteria 3004
680 Ga0495606_0077980 3300046507 Bacteria 2067
681 Ga0495606_0088822 3300046507 Bacteria 1905
682 Ga0495606_0178589 3300046507 Bacteria 1226
683 Ga0495608_0019557 3300046511 Bacteria 4660
684 Ga0495610_0020115 3300046512 Bacteria 3714
685 Ga0495628_0312032 3300046516 Bacteria 1162
686 Ga0495631_0021853 3300046518 Bacteria 2977
687 Ga0495632_0077380 3300046519 Bacteria 1590
688 Ga0495637_0006873 3300046520 Bacteria 5683
689 Ga0495643_0007697 3300046522 Bacteria 6903
690 Ga0495643_0057347 3300046522 Bacteria 2075
691 Ga0495648_0040579 3300046524 Bacteria 2950
692 Ga0495648_0042628 3300046524 Bacteria 2853
693 Ga0495648_0061657 3300046524 Bacteria 2226
694 Ga0495642_0022049 3300046528 Bacteria 2507
695 Ga0495642_0024082 3300046528 Bacteria 2407
696 Ga0495652_0033773 3300046529 Bacteria 4463
697 Ga0495640_0082800 3300046533 Bacteria 2130
698 Ga0495587_0012294 3300046536 Bacteria 5396
699 Ga0495587_0052691 3300046536 Bacteria 2400
700 Ga0495609_0010432 3300046538 Bacteria 4454
701 Ga0495609_0054920 3300046538 Bacteria 1767
702 Ga0495622_0013620 3300046557 Bacteria 3770
703 Ga0495633_0026673 3300046558 Bacteria 2833
704 Ga0495667_0006413 3300046559 Bacteria 7979
705 Ga0495668_0084314 3300046616 Bacteria 1742
706 Ga0495611_0031679 3300046648 Bacteria 2328
707 Ga0495661_0001062 3300046665 Bacteria 24266
708 Ga0495661_0059548 3300046665 Bacteria 2272
709 Ga0495599_0051878 3300046678 Bacteria 2570
710 Ga0495599_0059555 3300046678 Bacteria 2389
711 Ga0495669_0084355 3300046684 Bacteria 1461
712 Ga0495613_0121426 3300046689 Bacteria 1876
713 Ga0495670_0011214 3300046691 Bacteria 4406
714 Ga0495670_0028046 3300046691 Bacteria 2790
715 Ga0495670_0045930 3300046691 Bacteria 2181
716 Ga0495671_0096372 3300046692 Bacteria 1447
717 Ga0495649_0112234 3300046694 Bacteria 1445
718 Ga0495660_0034685 3300046810 Bacteria 2822
719 Ga0495604_0212387 3300047317 Bacteria 1336
720 Ga0495636_0020603 3300047318 Bacteria 2658
721 Ga0495672_0006683 3300047320 Bacteria 8859
722 Ga0495676_0100451 3300047321 Bacteria 2142
723 Ga0495680_0040140 3300047322 Bacteria 3730
724 Ga0495687_000002 3300047443 Bacteria 1085770
725 Ga0495687_000007 3300047443 Bacteria 552679
726 Ga0495687_006670 3300047443 Bacteria 7012
727 Ga0495675_0021752 3300047444 Bacteria 4086
728 Ga0495677_0018820 3300047445 Bacteria 2504
729 Ga0495686_0086893 3300047472 Bacteria 1903
730 Ga0495686_0148812 3300047472 Bacteria 1376
731 Ga0495602_0009695 3300048088 Bacteria 10004
732 Ga0495602_0020952 3300048088 Bacteria 6446
733 Ga0495626_0003679 3300048091 Bacteria 9719
734 Ga0495626_0048324 3300048091 Bacteria 1975
735 Ga0495626_0086410 3300048091 Bacteria 1386
736 Ga0496100_0084609 3300048903 Bacteria 2150
737 Ga0496101_0047901 3300048904 Bacteria 3070
738 Ga0496102_0019293 3300048905 Bacteria 6007
739 Ga0496102_0279472 3300048905 Bacteria 1574
740 Ga0496104_0071597 3300048907 Bacteria 3296
741 Ga0496104_0087595 3300048907 Bacteria 2974
742 Ga0496104_0271624 3300048907 Bacteria 1608
743 Ga0496105_0019790 3300048908 Bacteria 5431
744 Ga0496105_0123657 3300048908 Bacteria 2133
745 Ga0496106_0043880 3300048909 Bacteria 3356
746 Ga0496107_0096397 3300048910 Bacteria 2165
747 Ga0496108_0013180 3300048911 Bacteria 6738
748 Ga0496108_0024009 3300048911 Bacteria 5019
749 Ga0496108_0041821 3300048911 Bacteria 3827
750 Ga0496109_0009667 3300048912 Bacteria 8229
751 Ga0496109_0054317 3300048912 Bacteria 3654
752 Ga0496109_0063412 3300048912 Bacteria 3381
753 Ga0496109_0091928 3300048912 Bacteria 2806
754 Ga0496110_0001398 3300048913 Bacteria 17441
755 Ga0496110_0008118 3300048913 Bacteria 8433
756 Ga0496111_0118779 3300048914 Bacteria 1952
757 Ga0496111_0235443 3300048914 Bacteria 1360
758 Ga0496112_0000303 3300048915 Bacteria 31772
759 Ga0496112_0041516 3300048915 Bacteria 4502
760 Ga0496112_0072680 3300048915 Bacteria 3400
761 Ga0496112_0081503 3300048915 Bacteria 3200
762 Ga0496112_0140439 3300048915 Bacteria 2385
763 Ga0496112_0289555 3300048915 Bacteria 1584
764 Ga0496112_0395115 3300048915 Bacteria 1323
765 Ga0496113_0001648 3300048916 Bacteria 12591
766 Ga0496113_0006977 3300048916 Bacteria 7223
767 Ga0496113_0053820 3300048916 Bacteria 3010
768 Ga0496113_0173390 3300048916 Bacteria 1709
769 Ga0496114_0074490 3300048917 Bacteria 2858
770 Ga0496114_0224373 3300048917 Bacteria 1650
771 Ga0496116_0020226 3300048919 Bacteria 5062
772 Ga0496117_0126105 3300048920 Bacteria 1562
773 Ga0496117_0133986 3300048920 Bacteria 1496
774 Ga0496118_0035159 3300048921 Bacteria 4074
775 Ga0496118_0127940 3300048921 Bacteria 1638
776 Ga0496119_0011593 3300048922 Bacteria 7273
777 Ga0496120_0036299 3300048923 Bacteria 2936
778 Ga0496121_0037934 3300048924 Bacteria 4274
779 Ga0496121_0077543 3300048924 Bacteria 2645
780 Ga0496121_0137560 3300048924 Bacteria 1817
781 Ga0496121_0169870 3300048924 Bacteria 1585
782 Ga0496122_0000263 3300048925 Bacteria 117762
783 Ga0496123_0000156 3300048926 Bacteria 139362
784 Ga0496123_0105088 3300048926 Bacteria 1631
785 Ga0496125_0000669 3300048928 Bacteria 57185
786 Ga0496125_0089497 3300048928 Bacteria 2315
787 Ga0496125_0118528 3300048928 Bacteria 1895
788 Ga0496126_0004420 3300048929 Bacteria 16825
789 Ga0496126_0125357 3300048929 Bacteria 2223
790 Ga0495678_000024 3300049459 Bacteria 229034
791 Ga0501031_0129002 3300049568 Bacteria 1652
792 Ga0501037_0110164 3300049573 Bacteria 1984
793 Ga0501039_0000283 3300049575 Bacteria 36268
794 Ga0501039_0122612 3300049575 Bacteria 2038
795 Ga0501040_0173092 3300049576 Bacteria 1529
796 Ga0501041_0046941 3300049577 Bacteria 2628
797 Ga0501041_0060925 3300049577 Bacteria 2310
798 Ga0501046_0254514 3300049580 Bacteria 1292
799 Ga0501047_0189791 3300049581 Bacteria 1919
800 Ga0501067_0152521 3300049583 Bacteria 1287
801 Ga0501069_0051904 3300049585 Bacteria 2283
802 Ga0501070_0127724 3300049586 Bacteria 2101
803 Ga0501070_0288528 3300049586 Bacteria 1338
804 Ga0501071_0014276 3300049587 Bacteria 5433
805 Ga0501071_0126148 3300049587 Bacteria 1900
806 Ga0501072_0069107 3300049588 Bacteria 2789
807 Ga0501073_0153908 3300049589 Bacteria 1594
808 Ga0501075_0029889 3300049591 Bacteria 4031
809 Ga0501075_0072927 3300049591 Bacteria 2596
810 Ga0501075_0092849 3300049591 Bacteria 2291
811 Ga0501076_0161674 3300049592 Bacteria 1824
812 Ga0501077_0006410 3300049593 Bacteria 7219
813 Ga0501079_0015574 3300049741 Bacteria 5805
814 Ga0501079_0042049 3300049741 Bacteria 3529
815 Ga0501080_0066607 3300049742 Bacteria 3350
816 Ga0501080_0235204 3300049742 Bacteria 1674
817 Ga0501080_0326321 3300049742 Bacteria 1389
818 Ga0501081_0005064 3300049743 Bacteria 8482
819 Ga0501081_0079630 3300049743 Bacteria 2291
820 Ga0501083_0057202 3300049744 Bacteria 2611
821 Ga0501044_0110482 3300049823 Bacteria 2758
822 Ga0501045_0009339 3300049824 Bacteria 6856
823 Ga0501045_0023327 3300049824 Bacteria 4435
824 nmdc:mga03n38_20423_c1 3300050490 Bacteria 2649
825 nmdc:mga0yw44_102492_c1 3300050492 Bacteria 1825
826 nmdc:mga0yw44_53338_c1 3300050492 Bacteria 2455
827 nmdc:mga0k408_78158_c1 3300050493 Bacteria 1935
828 nmdc:mga0k408_8341_c1 3300050493 Bacteria 3906
829 nmdc:mga06z11_122218_c1 3300050494 Bacteria 1454
830 nmdc:mga06z11_68410_c1 3300050494 Bacteria 1872
831 nmdc:mga07m45_2281_c1 3300050496 Bacteria 8962
832 nmdc:mga05p37_15057_c1 3300050507 Bacteria 9285
833 nmdc:mga05p37_419_c1 3300050507 Bacteria 45960
834 nmdc:mga05p37_626911_c1 3300050507 Bacteria 1209
835 nmdc:mga09592_13357_c1 3300050508 Bacteria 6706
836 nmdc:mga09592_570_c1 3300050508 Bacteria 27977
837 nmdc:mga0qj67_24041_c1 3300050509 Bacteria 4694
838 nmdc:mga06r32_282001_c1 3300050510 Bacteria 1648
839 nmdc:mga06r32_453_c1 3300050510 Bacteria 34927
840 nmdc:mga08y16_174204_c1 3300050511 Bacteria 2234
841 nmdc:mga08y16_212080_c1 3300050511 Bacteria 2005
842 nmdc:mga08y16_244165_c1 3300050511 Bacteria 1856
843 nmdc:mga08y16_6524_c1 3300050511 Bacteria 12238
844 nmdc:mga08y16_66925_c1 3300050511 Bacteria 3749
845 nmdc:mga08y16_93505_c1 3300050511 Bacteria 3132
846 nmdc:mga0n895_128971_c1 3300050512 Bacteria 2553
847 nmdc:mga0n895_18279_c1 3300050512 Bacteria 6482
848 nmdc:mga0n895_34229_c1 3300050512 Bacteria 4888
849 nmdc:mga0n895_36728_c1 3300050512 Bacteria 4733
850 nmdc:mga0n895_60365_c1 3300050512 Bacteria 3741
851 nmdc:mga0n895_84586_c1 3300050512 Bacteria 3165
852 nmdc:mga0rr50_107347_c1 3300050513 Bacteria 2204
853 nmdc:mga0rr50_8400_c1 3300050513 Bacteria 6426
854 nmdc:mga0rr50_86200_c1 3300050513 Bacteria 2435
855 nmdc:mga0a205_11336_c1 3300050515 Bacteria 8205
856 nmdc:mga0a205_11653_c1 3300050515 Bacteria 8106
857 nmdc:mga0sz30_11356_c1 3300050516 Bacteria 3437
858 nmdc:mga0sz30_18242_c1 3300050516 Bacteria 2807
859 Ga0495601_0000429 3300053077 Bacteria 22002
860 Ga0500643_000037 3300053087 Bacteria 180821
861 Ga0500646_0002806 3300053090 Bacteria 4477
862 Ga0500646_0008598 3300053090 Bacteria 2614
863 Ga0500583_0001825 3300053092 Bacteria 6241
864 Ga0500651_0144840 3300053093 Bacteria 1429
865 Ga0500566_0001075 3300053094 Bacteria 15832
866 Ga0500566_0003368 3300053094 Bacteria 9543
867 Ga0500566_0003623 3300053094 Bacteria 9214
868 Ga0500555_001855 3300053103 Bacteria 6292
869 Ga0500555_030707 3300053103 Bacteria 1524
870 Ga0500555_035827 3300053103 Bacteria 1393
871 Ga0500556_0054338 3300053104 Bacteria 1458
872 Ga0500557_000047 3300053105 Bacteria 59226
873 Ga0500569_000518 3300053109 Bacteria 6434
874 Ga0500572_016523 3300053111 Bacteria 1881
875 Ga0500595_006884 3300053119 Bacteria 4776
876 Ga0500595_026598 3300053119 Bacteria 1992
877 Ga0500595_027317 3300053119 Bacteria 1955
878 Ga0500607_012500 3300053121 Bacteria 4980
879 Ga0500607_141798 3300053121 Bacteria 1129
880 Ga0500608_064472 3300053122 Bacteria 1748
881 Ga0500642_0001382 3300053130 Bacteria 6957
882 Ga0500658_0031714 3300053134 Bacteria 2069
883 Ga0500658_0049478 3300053134 Bacteria 1713
884 Ga0500559_0012586 3300053136 Bacteria 3591
885 Ga0500561_0010738 3300053137 Bacteria 1903
886 Ga0500568_0000101 3300053139 Bacteria 78689
887 Ga0500568_0002259 3300053139 Bacteria 11514
888 Ga0500568_0018020 3300053139 Bacteria 3102
889 Ga0500573_0000009 3300053140 Bacteria 230823
890 Ga0500577_0078290 3300053142 Bacteria 1312
891 Ga0500603_002543 3300053150 Bacteria 3988
892 Ga0500604_0003284 3300053151 Bacteria 4353
893 Ga0500604_0020075 3300053151 Bacteria 1877
894 Ga0500616_0001091 3300053153 Bacteria 28214
895 Ga0500616_0023355 3300053153 Bacteria 3445
896 Ga0500622_0028910 3300053156 Bacteria 2917
897 Ga0500624_006581 3300053157 Bacteria 1577
898 Ga0500627_0051817 3300053158 Bacteria 1791
899 Ga0500630_005372 3300053159 Bacteria 6249
900 Ga0500630_032312 3300053159 Bacteria 2570
901 Ga0500638_055522 3300053162 Bacteria 1909
902 Ga0500639_009086 3300053163 Bacteria 5186
903 Ga0500636_0004313 3300053177 Bacteria 8046
904 Ga0500637_0047261 3300053178 Bacteria 2444
905 Ga0500649_042905 3300053722 Bacteria 1906
906 Ga0500625_011953 3300053729 Bacteria 3960
907 Ga0500645_013978 3300053730 Bacteria 2567
908 Ga0500596_001342 3300053735 Bacteria 4965
909 Ga0500596_001805 3300053735 Bacteria 4302
910 Ga0500596_006217 3300053735 Bacteria 2040
911 Ga0500599_004175 3300053736 Bacteria 1782
912 Ga0500601_000279 3300053737 Bacteria 9696
913 Ga0501084_0008888 3300054114 Bacteria 8313
914 Ga0501082_0000013 3300060353 Bacteria 119623
915 Ga0530510_0088737 3300061734 Bacteria 2254
916 2507510361 2507262055 Bacteria 8048963
917 2509153158 2508501128 Bacteria 8613869
918 2513627334 2513237092 Bacteria 8341956
919 2513640245 2513237094 Bacteria 8789602
920 2513648649 2513237095 Bacteria 8976980
921 2513661231 2513237096 Bacteria 8722461
922 2513674752 2513237098 Bacteria 9902361
923 2513693595 2513237101 Bacteria 7952346
924 2513704234 2513237102 Bacteria 7703324
925 2513715931 2513237104 Bacteria 10034502
926 2513862297 2513237137 Bacteria 9558895
927 2513893805 2513237141 Bacteria 8496279
928 2513922951 2513237145 Bacteria 8979722
929 2517105562 2517093001 Bacteria 9002274
930 2517894270 2517572143 Bacteria 9484767
931 2524442069 2524023205 Bacteria 8918781
932 2524469042 2524023210 Bacteria 9029266
933 2524535696 2524023228 Bacteria 10118060
934 2528852339 2528768022 Bacteria 10457665
935 2586061747 2585427649 Bacteria 9053857
936 2617378663 2617270741 Bacteria 8201522
937 2623589474 2622736626 Bacteria 7181580
938 2671124026 2667528175 Bacteria 7532676
939 2723847477 2721755755 Bacteria 8322773
940 2745076078 2744054633 Bacteria 8678936
941 2793073959 2791355197 Bacteria 8420563
942 2793081497
943 2809590392 2808606522 Bacteria 9488490
944 2818241936 2816332527 Bacteria 8933356
945 2824603875 2824600985 Bacteria 8488197
946 2824612516 2824609381 Bacteria 8672835
947 2824655653 2824653114 Bacteria 8493680
948 2824668873 2824661429 Bacteria 9877870
949 2824680044 2824679649 Bacteria 8248951
950 2824710021 2824704595 Bacteria 9667483
951 2824733710 2824732956 Bacteria 7810675
952 2824747931 2824746037 Bacteria 7911610
953 2824755279 2824753945 Bacteria 9787441
954 2824772157 2824763712 Bacteria 9792355
955 2841959113 2841957949 Bacteria 8652217
956 2842045144 2842038055 Bacteria 8002051
957 2842049195 2842045827 Bacteria 8006841
958 2847934175 2847930680 Bacteria 9342022
959 2857516176 2857509624 Bacteria 7472071
960 2874611457 2874604998 Bacteria 7834745
961 2874612900 2874612657 Bacteria 8252029
962 2874625111 2874620515 Bacteria 8290088
963 2874634770 2874628541 Bacteria 8630250
964 2876769435 2876761206 Bacteria 10111113
965 2876817085 2876808645 Bacteria 8824342
966 2879086840 2879083081 Bacteria 8587928
967 2879117530 2879110137 Bacteria 8907982
968 2881369159 2881364244 Bacteria 7710352
969 2881667595 2881665667 Bacteria 8175609
970 2883577127 2883577096 Bacteria 4709178
971 2884698054 2884693830 Bacteria 11273186
972 2885367460 2885366525 Bacteria 8326213
973 2885376783 2885374607 Bacteria 8927485
974 2888382058 2888378607 Bacteria 9652610
975 2888422668 2888419890 Bacteria 7857137
976 2889042194 2889033259 Bacteria 9099371
977 2894772483 2894772417 Bacteria 5305674
978 2895445114 2895442618 Bacteria 11027144
979 2903751563 2903748898 Bacteria 9972761
980 2904666887 2904666416 Bacteria 8226587
981 2904697269 2904690495 Bacteria 9412302
982 2904705412
983 2904717764 2904711408 Bacteria 9771557
984 2906611096
985 2906626511 2906626472 Bacteria 8826946
986 2906641263 2906635258 Bacteria 8601019
987 2906648121 2906643746 Bacteria 8722424
988 2906667556 2906660503 Bacteria 8595048
989 2908744612 2908739725 Bacteria 8628932
990 2908762232 2908756301 Bacteria 8864324
991 2908778304 2908775508 Bacteria 8092255
992 2912764486 2912757875 Bacteria 7940295
993 2915774408 2915768154 Bacteria 8424322
994 2922372098
995 2922390574 2922386360 Bacteria 7017218
996 2922399257 2922393267 Bacteria 8285685
997 2922428218
998 2929616658 2929615660 Bacteria 9193770
999 2929625402 2929624759 Bacteria 9339455
1000 2932792170 2932784394 Bacteria 9704911
1001 2932798813 2932794094 Bacteria 7915132
1002 2932803583 2932801729 Bacteria 7987968
1003 2932814463 2932809354 Bacteria 9135765
1004 2932824550 2932818245 Bacteria 9955613
1005 2932837339 2932828146 Bacteria 9745859
1006 2933578059 2933577622 Bacteria 9116884
1007 2935623422 2935616580 Bacteria 9032984
1008 2935637345 2935630451 Bacteria 8169952
1009 2935646829 2935638405 Bacteria 10015038
1010 2935672748 2935665750 Bacteria 9571747
1011 2935684468 2935675223 Bacteria 9928132
1012 2935692069 2935684952 Bacteria 9590419
1013 2935694994 2935694250 Bacteria 9291695
1014 2935707905 2935703347 Bacteria 10242284
1015 2935721908 2935713505 Bacteria 9608509
1016 2935731094 2935722832 Bacteria 9608746
1017 2935739044 2935732158 Bacteria 9706831
1018 2935747771 2935741537 Bacteria 9707219
1019 2935756355 2935750917 Bacteria 9590372
1020 2935761676 2935760218 Bacteria 9817913
1021 2935774353 2935769743 Bacteria 7878163
1022 2935782759 2935777560 Bacteria 8077691
1023 2935793415 2935785616 Bacteria 7962367
1024 2935801245 2935793552 Bacteria 8012592
1025 2935810362 2935801545 Bacteria 9301974
1026 2935819546 2935810662 Bacteria 9401221
1027 2935836096 2935827899 Bacteria 10038562
1028 2935845028 2935837841 Bacteria 9454360
1029 2935861578 2935855204 Bacteria 9035059
1030 2935881489 2935873716 Bacteria 9632195
1031 2935887798 2935883170 Bacteria 7964738
1032 2935963614 2935959822 Bacteria 7869783
1033 2936001565 2935992306 Bacteria 9802711
1034 2936005356 2936002035 Bacteria 9362176
1035 2936046313 2936037263 Bacteria 9446081
1036 2940562269 2940556831 Bacteria 9590747
1037 2941513923 2941507105 Bacteria 8166816
1038 2941521884 2941515067 Bacteria 8166720
1039 2941529553 2941523033 Bacteria 8169134
1040 2941535179 2941531003 Bacteria 7653939
1041 2941546763 2941538514 Bacteria 9402094
1042 2996228354 2996221748 Bacteria 6799777
1043 3005478203 3005474847 Bacteria 9259049
1044 3005489703 3005483717 Bacteria 7877331
1045 3005593620 3005587118 Bacteria 7794411
1046 3005597103 3005594810 Bacteria 8716512
1047 3005713125 3005710791 Bacteria 7622528
1048 8006943013 8006933436 Bacteria 10410654
1049 8006970197 8006964411 Bacteria 8966052
1050 8006982809 8006973647 Bacteria 10679141
1051 8006985476 8006984368 Bacteria 9651211
1052 8006994479 8006994254 Bacteria 8309700
1053 8016515580 8016511872 Bacteria 9921665
1054 8016523245 8016522445 Bacteria 8156687
1055 8016536732 8016530956 Bacteria 8155261
1056 8016541011 8016539877 Bacteria 8155419
1057 8016552242 8016548790 Bacteria 8155074
1058 8016566394 8016566248 Bacteria 8158151
1059 8016579145 8016575299 Bacteria 8154085
1060 8016590427 8016583857 Bacteria 10421953
1061 8016598516 8016595262 Bacteria 8149947
1062 8016612613 8016603502 Bacteria 8731218
1063 8016621205 8016613128 Bacteria 8794220
1064 8016628800 8016622563 Bacteria 7999408
1065 8017060912 8017057580 Bacteria 10023680
1066 8019543016 8019538911 Bacteria 7872763
1067 8019547720 8019547302 Bacteria 7996444
1068 8019558831 8019555841 Bacteria 9642137
1069 8019566478 8019565922 Bacteria 9639779
1070 8019580370 8019576017 Bacteria 10049540
1071 8019588093 8019586578 Bacteria 10212056
1072 8019603247 8019597564 Bacteria 10041141
1073 8019643225 8019638758 Bacteria 9062356
1074 8019656081 8019648815 Bacteria 10014479
1075 8055748304 8055742211 Bacteria 9226248
1076 8056681210 8056673599 Bacteria 7871253
1077 8056684332 8056681323 Bacteria 8472857
1078 Ga0500645_034405
1079 JGI25151J46595_10000304
1080 JGI25151J46595_10000631
1081 JGI25153J46596_10002594
1082 JGI25153J46596_10006592
1083 JGI25160J50197_1008713
1084 JGI25407J50210_10028083
1085 JGI25404J52841_10002130
1086 Ga0055535_1000449
1087 Ga0055542_1000021
1088 Ga0055526_1000274
1089 Ga0055543_1002331
1090 Ga0058861_11860130
1091 Ga0058862_12887444
1092 Ga0065165_1000387
1093 Ga0065714_10079457
1094 Ga0065712_10074830
1095 Ga0065715_10003511
1096 Ga0070658_10020638
1097 Ga0070658_10048661
1098 Ga0070676_10014697
1099 Ga0070683_100002543
1100 Ga0070683_100014342
1101 Ga0070683_100074896
1102 Ga0070690_100022827
1103 Ga0070670_100001672
1104 Ga0070670_100003550
1105 Ga0070677_10011450
1106 Ga0070677_10044447
1107 Ga0068869_100007127
1108 Ga0070666_10033193
1109 Ga0070666_10035624
1110 Ga0070680_100003205
1111 Ga0070680_100120419
1112 Ga0070680_100121432
1113 Ga0068868_100000732
1114 Ga0068868_100003524
1115 Ga0068868_100021095
1116 Ga0068868_100102554
1117 Ga0068868_100193480
1118 Ga0070660_100001026
1119 Ga0070660_100043859
1120 Ga0070661_100000659
1121 Ga0070661_100001562
1122 Ga0070661_100006984
1123 Ga0070661_100098337
1124 Ga0070692_10084268
1125 Ga0070668_100007414
1126 Ga0070668_100089465
1127 Ga0070668_100097333
1128 Ga0070668_100134901
1129 Ga0070669_100008959
1130 Ga0070669_100077945
1131 Ga0070675_100000909
1132 Ga0070675_100003113
1133 Ga0070671_100000836
1134 Ga0070671_100003711
1135 Ga0070671_100048347
1136 Ga0070671_100120512
1137 Ga0070671_100303358
1138 Ga0070674_100014087
1139 Ga0070673_100000415
1140 Ga0070673_100077331
1141 Ga0070673_100084649
1142 Ga0070659_100013383
1143 Ga0070659_100107845
1144 Ga0070659_100133981
1145 Ga0070667_100001323
1146 Ga0070667_100011922
1147 Ga0070667_100040845
1148 Ga0070709_10001625
1149 Ga0070709_10005194
1150 Ga0070709_10048202
1151 Ga0070714_100001230
1152 Ga0070714_100049268
1153 Ga0070714_100052864
1154 Ga0070713_100057831
1155 Ga0070713_100209287
1156 Ga0070710_10001955
1157 Ga0070711_100000864
1158 Ga0070711_100020766
1159 Ga0070711_100033716
1160 Ga0070711_100079974
1161 Ga0070700_100003662
1162 Ga0070700_100048678
1163 Ga0070708_100000447
1164 Ga0070663_100126611
1165 Ga0070663_100138257
1166 Ga0070678_100000308
1167 Ga0070678_100011586
1168 Ga0070678_100055577
1169 Ga0070662_100003497
1170 Ga0070662_100090113
1171 Ga0070681_10000556
1172 Ga0070681_10011881
1173 Ga0070681_10012768
1174 Ga0070681_10032524
1175 Ga0070681_10058628
1176 Ga0070681_10065786
1177 Ga0068867_100002001
1178 Ga0068867_100005583
1179 Ga0068867_100021754
1180 Ga0068867_100147418
1181 Ga0068867_100153725
1182 Ga0070706_100008748
1183 Ga0070707_100087854
1184 Ga0070698_100056495
1185 Ga0070698_100228974
1186 Ga0070679_100000724
1187 Ga0070679_100012464
1188 Ga0070679_100014399
1189 Ga0070679_100039481
1190 Ga0070684_100042424
1191 Ga0068853_100010070
1192 Ga0068853_100018013
1193 Ga0068853_100393010
1194 Ga0070672_100000177
1195 Ga0070672_100000186
1196 Ga0070672_100085759
1197 Ga0070672_100149660
1198 Ga0070696_100112145
1199 Ga0070665_100004123
1200 Ga0070665_100019233
1201 Ga0070665_100038817
1202 Ga0070665_100039261
1203 Ga0070665_100067737
1204 Ga0070704_100086079
1205 Ga0070704_100267632
1206 Ga0068855_100007555
1207 Ga0068855_100017631
1208 Ga0068855_100245709
1209 Ga0070664_100000157
1210 Ga0070664_100001930
1211 Ga0070664_100086346
1212 Ga0068857_100002118
1213 Ga0068857_100053287
1214 Ga0068857_100090846
1215 Ga0068854_100002001
1216 Ga0068854_100025797
1217 Ga0068854_100043871
1218 Ga0068854_100072435
1219 Ga0068856_100003357
1220 Ga0068856_100095788
1221 Ga0068852_100000221
1222 Ga0068852_100000826
1223 Ga0068852_100016450
1224 Ga0068852_100027970
1225 Ga0068852_100187497
1226 Ga0068859_100102420
1227 Ga0068864_100024601
1228 Ga0068864_100060153
1229 Ga0068864_100068763
1230 Ga0068864_100075383
1231 Ga0068861_100006231
1232 Ga0068861_100019550
1233 Ga0068861_100073735
1234 Ga0068851_10093005
1235 Ga0068863_100003043
1236 Ga0068863_100048937
1237 Ga0068863_100051594
1238 Ga0068863_100138175
1239 Ga0068863_100292326
1240 Ga0068858_100016214
1241 Ga0068858_100032450
1242 Ga0068858_100033479
1243 Ga0068860_100014528
1244 Ga0068860_100042534
1245 Ga0068862_100007699
1246 Ga0068862_100030313
1247 Ga0068862_100062781
1248 Ga0081455_10004548
1249 Ga0081455_10007292
1250 Ga0081455_10008955
1251 Ga0081455_10080131
1252 Ga0081538_10003622
1253 Ga0081540_1000745
1254 Ga0081540_1003399
1255 Ga0081540_1006214
1256 Ga0081540_1009249
1257 Ga0081540_1010444
1258 Ga0081540_1013078
1259 Ga0081540_1014387
1260 Ga0081540_1022848
1261 Ga0081540_1031419
1262 Ga0081540_1034982
1263 Ga0081539_10027525
1264 Ga0075368_10000198
1265 Ga0075363_100028435
1266 Ga0070715_10066040
1267 Ga0070716_100018886
1268 Ga0070712_100089096
1269 Ga0070712_100138991
1270 Ga0075367_10015991
1271 Ga0097621_100000202
1272 Ga0097621_100025322
1273 Ga0097621_100035686
1274 Ga0097621_100152815
1275 Ga0075370_10023535
1276 Ga0075370_10050736
1277 Ga0068871_100000840
1278 Ga0068871_100071907
1279 Ga0068871_100113418
1280 Ga0075428_100000580
1281 Ga0075428_100067152
1282 Ga0075430_100028026
1283 Ga0075431_100000518
1284 Ga0075433_10008386
1285 Ga0075433_10305129
1286 Ga0075434_100039202
1287 Ga0075429_100005751
1288 Ga0075429_100104260
1289 Ga0068865_100069910
1290 Ga0068865_100073297
1291 Ga0068865_100077599
1292 Ga0075436_100211176
1293 Ga0097620_100102431
1294 Ga0099825_1035458
1295 Ga0099824_1016897
1296 Ga0075435_100012082
1297 Ga0075435_100106968
1298 Ga0075435_100128943
1299 Ga0075435_100157609
1300 Ga0075435_100170271
1301 Ga0105240_10001724
1302 Ga0105240_10007858
1303 Ga0105240_10010644
1304 Ga0105240_10341283
1305 Ga0105240_10402506
1306 Ga0111539_10000651
1307 Ga0111539_10061654
1308 Ga0111539_10437085
1309 Ga0105245_10007672
1310 Ga0105245_10025858
1311 Ga0105245_10026441
1312 Ga0105245_10031273
1313 Ga0105245_10102254
1314 Ga0114129_10000505
1315 Ga0114129_10003700
1316 Ga0114129_10019741
1317 Ga0114129_10131325
1318 Ga0114129_10165612
1319 Ga0105241_10054338
1320 Ga0105241_10072385
1321 Ga0105241_10142475
1322 Ga0105241_10188774
1323 Ga0105242_10005776
1324 Ga0105242_10055417
1325 Ga0105248_10022137
1326 Ga0105248_10083121
1327 Ga0105248_10208068
1328 Ga0105248_10233089
1329 Ga0105248_10469087
1330 Ga0105237_10006524
1331 Ga0105237_10091157
1332 Ga0105238_10000203
1333 Ga0105238_10003461
1334 Ga0105238_10042740
1335 Ga0105238_10114570
1336 Ga0105249_10162936
1337 Ga0105239_10050052
1338 Ga0105239_10058326
1339 Ga0105239_10143600
1340 Ga0105239_10157662
1341 Ga0105246_10013973
1342 Ga0157373_10032306
1343 Ga0157371_10026840
1344 Ga0157370_10028168
1345 Ga0157370_10285437
1346 Ga0157369_10005960
1347 Ga0157369_10011596
1348 Ga0157369_10018830
1349 Ga0157369_10135432
1350 Ga0157374_10001953
1351 Ga0157374_10009479
1352 Ga0157374_10010653
1353 Ga0157374_10073614
1354 Ga0157374_10240195
1355 Ga0157378_10217421
1356 Ga0163162_10102021
1357 Ga0163162_10147944
1358 Ga0163162_10322113
1359 Ga0163162_10355879
1360 Ga0157372_10001409
1361 Ga0157372_10020476
1362 Ga0157372_10161855
1363 Ga0157375_10004073
1364 Ga0157375_10030596
1365 Ga0157375_10047417
1366 Ga0157375_10144763
1367 Ga0157375_10172449
1368 Ga0157375_10292512
1369 Ga0163163_10000090
1370 Ga0163163_10009881
1371 Ga0163163_10090300
1372 Ga0157380_10084448
1373 Ga0182008_10007140
1374 Ga0182008_10037367
1375 Ga0157379_10004907
1376 Ga0157379_10006862
1377 Ga0157379_10017175
1378 Ga0157379_10045315
1379 Ga0157379_10058923
1380 Ga0157379_10102599
1381 Ga0157376_10001708
1382 Ga0157376_10055032
1383 Ga0157376_10056182
1384 Ga0157376_10060308
1385 Ga0157376_10295420
1386 Ga0163161_10060111
1387 Ga0214544_1000055
1388 Ga0214542_1000196
1389 Ga0214545_1000028
1390 Ga0214543_1000044
1391 Ga0213876_10014155
1392 Ga0213876_10018389
1393 Ga0213875_10002599
1394 Ga0209672_100295
1395 Ga0209147_101997
1396 Ga0209258_100058
1397 Ga0209677_100757
1398 Ga0209148_1000071
1399 Ga0209148_1000711
1400 Ga0209129_1011203
1401 Ga0209233_1001618
1402 Ga0209233_1004243
1403 Ga0209233_1025754
1404 Ga0209455_1001451
1405 Ga0209455_1006522
1406 Ga0209130_1000190
1407 Ga0209025_1000446
1408 Ga0209564_1000023
1409 Ga0209564_1008860
1410 Ga0209758_1000187
1411 Ga0209758_1003975
1412 Ga0209758_1013916
1413 Ga0209758_1015628
1414 Ga0209758_1019218
1415 Ga0209758_1037382
1416 Ga0209758_1048794
1417 Ga0207426_1000160
1418 Ga0207697_10004750
1419 Ga0207697_10057009
1420 Ga0207656_10015034
1421 Ga0207692_10042307
1422 Ga0207692_10131970
1423 Ga0207688_10019853
1424 Ga0207680_10034716
1425 Ga0207699_10001076
1426 Ga0207699_10022268
1427 Ga0207645_10059908
1428 Ga0207645_10112722
1429 Ga0207705_10016820
1430 Ga0207705_10026329
1431 Ga0207707_10000139
1432 Ga0207707_10010142
1433 Ga0207707_10017242
1434 Ga0207707_10032631
1435 Ga0207707_10076677
1436 Ga0207707_10078356
1437 Ga0207707_10128879
1438 Ga0207695_10000029
1439 Ga0207695_10016171
1440 Ga0207695_10023967
1441 Ga0207695_10221532
1442 Ga0207695_10258050
1443 Ga0207671_10003418
1444 Ga0207693_10004880
1445 Ga0207693_10015116
1446 Ga0207693_10068602
1447 Ga0207693_10076727
1448 Ga0207693_10086602
1449 Ga0207663_10001558
1450 Ga0207663_10016591
1451 Ga0207663_10053754
1452 Ga0207663_10130073
1453 Ga0207660_10002090
1454 Ga0207660_10009649
1455 Ga0207660_10078766
1456 Ga0207657_10002729
1457 Ga0207657_10047977
1458 Ga0207657_10053852
1459 Ga0207657_10212039
1460 Ga0207649_10003878
1461 Ga0207649_10007536
1462 Ga0207649_10014878
1463 Ga0207652_10003895
1464 Ga0207652_10008960
1465 Ga0207652_10029251
1466 Ga0207652_10039342
1467 Ga0207652_10136739
1468 Ga0207681_10009609
1469 Ga0207681_10031794
1470 Ga0207694_10006781
1471 Ga0207694_10195979
1472 Ga0207650_10001199
1473 Ga0207650_10003269
1474 Ga0207659_10002617
1475 Ga0207659_10003295
1476 Ga0207659_10014353
1477 Ga0207659_10114121
1478 Ga0207687_10011801
1479 Ga0207687_10015002
1480 Ga0207687_10030495
1481 Ga0207687_10049070
1482 Ga0207687_10098837
1483 Ga0207700_10015355
1484 Ga0207700_10090797
1485 Ga0207664_10017186
1486 Ga0207664_10032336
1487 Ga0207664_10032814
1488 Ga0207644_10000365
1489 Ga0207644_10008217
1490 Ga0207644_10110127
1491 Ga0207690_10016818
1492 Ga0207690_10080122
1493 Ga0207690_10168279
1494 Ga0207690_10362723
1495 Ga0207706_10006986
1496 Ga0207706_10046207
1497 Ga0207706_10073287
1498 Ga0207706_10093300
1499 Ga0207686_10038264
1500 Ga0207709_10060787
1501 Ga0207670_10034151
1502 Ga0207669_10007715
1503 Ga0207669_10007898
1504 Ga0207704_10072042
1505 Ga0207665_10040126
1506 Ga0207665_10046337
1507 Ga0207665_10125927
1508 Ga0207691_10000276
1509 Ga0207691_10002411
1510 Ga0207691_10030949
1511 Ga0207691_10054301
1512 Ga0207711_10030312
1513 Ga0207711_10153172
1514 Ga0207711_10168810
1515 Ga0207711_10286936
1516 Ga0207689_10000415
1517 Ga0207689_10027387
1518 Ga0207689_10038778
1519 Ga0207661_10011082
1520 Ga0207661_10014956
1521 Ga0207679_10005759
1522 Ga0207679_10012754
1523 Ga0207679_10025964
1524 Ga0207679_10319408
1525 Ga0207667_10009574
1526 Ga0207667_10017829
1527 Ga0207667_10328933
1528 Ga0207651_10004986
1529 Ga0207651_10026981
1530 Ga0207651_10193639
1531 Ga0207712_10098448
1532 Ga0207668_10015716
1533 Ga0207668_10041624
1534 Ga0207668_10100334
1535 Ga0207640_10001031
1536 Ga0207640_10070924
1537 Ga0207640_10073346
1538 Ga0207640_10132572
1539 Ga0207658_10005357
1540 Ga0207677_10001216
1541 Ga0207677_10016707
1542 Ga0207677_10052395
1543 Ga0207677_10229103
1544 Ga0207703_10023207
1545 Ga0207703_10027790
1546 Ga0207703_10040883
1547 Ga0207639_10073516
1548 Ga0207639_10316474
1549 Ga0207678_10014339
1550 Ga0207678_10294783
1551 Ga0207708_10003526
1552 Ga0207708_10023275
1553 Ga0207708_10031356
1554 Ga0207708_10072813
1555 Ga0207702_10002758
1556 Ga0207702_10021800
1557 Ga0207702_10086466
1558 Ga0207641_10102798
1559 Ga0207641_10121785
1560 Ga0207648_10011496
1561 Ga0207648_10019804
1562 Ga0207648_10028323
1563 Ga0207648_10043828
1564 Ga0207648_10079615
1565 Ga0207676_10003251
1566 Ga0207676_10016855
1567 Ga0207676_10254181
1568 Ga0207676_10333415
1569 Ga0207674_10000301
1570 Ga0207674_10024546
1571 Ga0207674_10104015
1572 Ga0207674_10339179
1573 Ga0207675_100000177
1574 Ga0207675_100012098
1575 Ga0207675_100016962
1576 Ga0207675_100042519
1577 Ga0207675_100072098
1578 Ga0207683_10001296
1579 Ga0207683_10035761
1580 Ga0207683_10048402
1581 Ga0207683_10138723
1582 Ga0207683_10230120
1583 Ga0207683_10252153
1584 Ga0207698_10000451
1585 Ga0207698_10003841
1586 Ga0207698_10014026
1587 Ga0207698_10134453
1588 Ga0207698_10159283
1589 Ga0209389_1000003
1590 Ga0209389_1013235
1591 Ga0209589_1000004
1592 Ga0209589_1018958
1593 Ga0209969_1001299
1594 Ga0209489_100004
1595 Ga0209489_100022
1596 Ga0209489_100498
1597 Ga0209700_100004
1598 Ga0209700_100023
1599 Ga0209995_1000129
1600 Ga0209999_1001230
1601 Ga0209974_10001304
1602 Ga0207428_10002244
1603 Ga0207428_10044812
1604 Ga0207428_10116536
1605 Ga0268266_10016506
1606 Ga0268266_10020042
1607 Ga0268266_10030718
1608 Ga0268266_10033577
1609 Ga0268266_10068376
1610 Ga0268265_10004529
1611 Ga0268265_10021741
1612 Ga0268265_10068962
1613 Ga0268264_10060301
1614 Ga0268264_10143054
1615 Ga0265337_1026833
1616 Ga0265319_1025769
1617 Ga0265334_10002844
1618 Ga0265318_10003531
1619 Ga0265336_10038645
1620 Ga0307517_10195693
1621 Ga0307515_10000346
1622 Ga0265338_10000013
1623 Ga0265338_10036574
1624 Ga0307511_10000911
1625 Ga0265762_1000974
1626 Ga0265770_1008006
1627 Ga0265330_10002701
1628 Ga0265330_10016691
1629 Ga0265330_10018614
1630 Ga0265330_10084151
1631 Ga0265332_10001762
1632 Ga0265332_10011531
1633 Ga0265332_10034645
1634 Ga0265328_10001075
1635 Ga0265328_10018349
1636 Ga0265320_10003447
1637 Ga0265325_10010884
1638 Ga0265325_10019513
1639 Ga0265340_10011815
1640 Ga0265339_10047117
1641 Ga0265339_10052634
1642 Ga0265331_10002915
1643 Ga0265331_10031305
1644 Ga0265327_10002317
1645 Ga0265316_10020579
1646 Ga0265316_10148551
1647 Ga0265316_10150662
1648 Ga0307513_10117435
1649 Ga0307509_10030149
1650 Ga0307509_10056601
1651 Ga0265313_10005096
1652 Ga0265313_10008779
1653 Ga0265313_10010102
1654 Ga0265313_10041293
1655 Ga0265314_10005350
1656 Ga0265314_10005790
1657 Ga0265314_10045348
1658 Ga0265342_10007979
1659 Ga0307516_10026755
1660 Ga0307405_10006482
1661 Ga0307405_10115435
1662 Ga0307413_10033804
1663 Ga0307518_10002453
1664 Ga0307410_10031925
1665 Ga0307409_100042722
1666 Ga0307409_100110520
1667 Ga0307416_100037183
1668 Ga0307411_10038649
1669 Ga0307510_10025985
1670 Ga0307510_10064626
1671 Ga0315911_1000014
1672 Ga0373930_0008781
1673 Ga0373952_0002091
1674 Ga0373941_0007836
1675 Ga0373953_0022929
1676 Ga0373954_0039281
1677 Ga0373943_0035367
1678 Ga0373955_0067167
1679 Ga0373924_0051526
1680 Ga0373931_0000651
1681 Ga0373935_0202814
1682 Ga0373927_0037396
1683 Ga0373927_0142158
1684 Ga0373927_0188298
1685 Ga0373933_0006984
1686 Ga0373933_0043532
1687 Ga0373933_0050912
1688 Ga0373933_0082337
1689 Ga0373933_0176435
1690 Ga0373947_0020564
1691 Ga0373947_0067382
1692 Ga0373937_0002894
1693 Ga0373937_0016007
1694 Ga0373937_0310329
1695 Ga0373925_0051407
1696 Ga0395898_0056203
1697 Ga0395905_0023182
1698 Ga0395905_0105928
1699 Ga0436364_0614112
1700 Ga0436364_0681123
1701 Ga0436364_1528058
1702 Ga0436365_0644345
1703 Ga0436365_0955306
1704 Ga0436365_1031159
1705 Ga0436365_1682025
1706 Ga0436360_0317573
1707 Ga0436360_0388551
1708 Ga0436360_0416689
1709 Ga0436360_0810186
1710 Ga0436361_0677831
1711 Ga0436361_0968143
1712 Ga0436363_0628506
1713 Ga0436363_1221684
1714 Ga0436362_0287411
1715 Ga0436362_0443667
1716 Ga0436362_1180616
1717 Ga0451577_0058147
1718 Ga0466972_0021164
1719 Ga0466966_0000940
1720 Ga0466961_0000029
1721 Ga0453684_0006879
1722 Ga0453684_0048765
1723 Ga0453684_0144446
1724 Ga0466968_0040411
1725 Ga0466957_0103182
1726 Ga0466960_0121513
1727 Ga0466959_0004320
1728 Ga0466959_0078618
1729 Ga0451576_0002059
1730 Ga0451576_0118441
1731 Ga0466967_0506998
1732 Ga0495617_026863
1733 Ga0495592_0040011
1734 Ga0495592_0241155
1735 Ga0495603_0044000
1736 Ga0495603_0073486
1737 Ga0495591_020893
1738 Ga0495638_0000120
1739 Ga0495638_0013548
1740 Ga0495638_0085970
1741 Ga0495638_0200838
1742 Ga0495651_0030990
1743 Ga0495653_0032580
1744 Ga0495653_0097512
1745 Ga0495580_0036074
1746 Ga0495582_0063308
1747 Ga0495639_0014506
1748 Ga0495664_0002135
1749 Ga0495584_0009819
1750 Ga0495584_0026223
1751 Ga0495585_0005635
1752 Ga0495585_0010105
1753 Ga0495596_0010077
1754 Ga0495583_0014503
1755 Ga0495583_0076068
1756 Ga0495606_0043294
1757 Ga0495606_0077980
1758 Ga0495606_0088822
1759 Ga0495606_0178589
1760 Ga0495608_0019557
1761 Ga0495610_0020115
1762 Ga0495628_0312032
1763 Ga0495631_0021853
1764 Ga0495632_0077380
1765 Ga0495637_0006873
1766 Ga0495643_0007697
1767 Ga0495643_0057347
1768 Ga0495648_0040579
1769 Ga0495648_0042628
1770 Ga0495648_0061657
1771 Ga0495642_0022049
1772 Ga0495642_0024082
1773 Ga0495652_0033773
1774 Ga0495640_0082800
1775 Ga0495587_0012294
1776 Ga0495587_0052691
1777 Ga0495609_0010432
1778 Ga0495609_0054920
1779 Ga0495622_0013620
1780 Ga0495633_0026673
1781 Ga0495667_0006413
1782 Ga0495668_0084314
1783 Ga0495611_0031679
1784 Ga0495661_0001062
1785 Ga0495661_0059548
1786 Ga0495599_0051878
1787 Ga0495599_0059555
1788 Ga0495669_0084355
1789 Ga0495613_0121426
1790 Ga0495670_0011214
1791 Ga0495670_0028046
1792 Ga0495670_0045930
1793 Ga0495671_0096372
1794 Ga0495649_0112234
1795 Ga0495660_0034685
1796 Ga0495604_0212387
1797 Ga0495636_0020603
1798 Ga0495672_0006683
1799 Ga0495676_0100451
1800 Ga0495680_0040140
1801 Ga0495687_000002
1802 Ga0495687_000007
1803 Ga0495687_006670
1804 Ga0495675_0021752
1805 Ga0495677_0018820
1806 Ga0495686_0086893
1807 Ga0495686_0148812
1808 Ga0495602_0009695
1809 Ga0495602_0020952
1810 Ga0495626_0003679
1811 Ga0495626_0048324
1812 Ga0495626_0086410
1813 Ga0496100_0084609
1814 Ga0496101_0047901
1815 Ga0496102_0019293
1816 Ga0496102_0279472
1817 Ga0496104_0071597
1818 Ga0496104_0087595
1819 Ga0496104_0271624
1820 Ga0496105_0019790
1821 Ga0496105_0123657
1822 Ga0496106_0043880
1823 Ga0496107_0096397
1824 Ga0496108_0013180
1825 Ga0496108_0024009
1826 Ga0496108_0041821
1827 Ga0496109_0009667
1828 Ga0496109_0054317
1829 Ga0496109_0063412
1830 Ga0496109_0091928
1831 Ga0496110_0001398
1832 Ga0496110_0008118
1833 Ga0496111_0118779
1834 Ga0496111_0235443
1835 Ga0496112_0000303
1836 Ga0496112_0041516
1837 Ga0496112_0072680
1838 Ga0496112_0081503
1839 Ga0496112_0140439
1840 Ga0496112_0289555
1841 Ga0496112_0395115
1842 Ga0496113_0001648
1843 Ga0496113_0006977
1844 Ga0496113_0053820
1845 Ga0496113_0173390
1846 Ga0496114_0074490
1847 Ga0496114_0224373
1848 Ga0496116_0020226
1849 Ga0496117_0126105
1850 Ga0496117_0133986
1851 Ga0496118_0035159
1852 Ga0496118_0127940
1853 Ga0496119_0011593
1854 Ga0496120_0036299
1855 Ga0496121_0037934
1856 Ga0496121_0077543
1857 Ga0496121_0137560
1858 Ga0496121_0169870
1859 Ga0496122_0000263
1860 Ga0496123_0000156
1861 Ga0496123_0105088
1862 Ga0496125_0000669
1863 Ga0496125_0089497
1864 Ga0496125_0118528
1865 Ga0496126_0004420
1866 Ga0496126_0125357
1867 Ga0495678_000024
1868 Ga0501031_0129002
1869 Ga0501037_0110164
1870 Ga0501039_0000283
1871 Ga0501039_0122612
1872 Ga0501040_0173092
1873 Ga0501041_0046941
1874 Ga0501041_0060925
1875 Ga0501046_0254514
1876 Ga0501047_0189791
1877 Ga0501067_0152521
1878 Ga0501069_0051904
1879 Ga0501070_0127724
1880 Ga0501070_0288528
1881 Ga0501071_0014276
1882 Ga0501071_0126148
1883 Ga0501072_0069107
1884 Ga0501073_0153908
1885 Ga0501075_0029889
1886 Ga0501075_0072927
1887 Ga0501075_0092849
1888 Ga0501076_0161674
1889 Ga0501077_0006410
1890 Ga0501079_0015574
1891 Ga0501079_0042049
1892 Ga0501080_0066607
1893 Ga0501080_0235204
1894 Ga0501080_0326321
1895 Ga0501081_0005064
1896 Ga0501081_0079630
1897 Ga0501083_0057202
1898 Ga0501044_0110482
1899 Ga0501045_0009339
1900 Ga0501045_0023327
1901 nmdc:mga03n38_20423_c1
1902 nmdc:mga0yw44_102492_c1
1903 nmdc:mga0yw44_53338_c1
1904 nmdc:mga0k408_78158_c1
1905 nmdc:mga0k408_8341_c1
1906 nmdc:mga06z11_122218_c1
1907 nmdc:mga06z11_68410_c1
1908 nmdc:mga07m45_2281_c1
1909 nmdc:mga05p37_15057_c1
1910 nmdc:mga05p37_419_c1
1911 nmdc:mga05p37_626911_c1
1912 nmdc:mga09592_13357_c1
1913 nmdc:mga09592_570_c1
1914 nmdc:mga0qj67_24041_c1
1915 nmdc:mga06r32_282001_c1
1916 nmdc:mga06r32_453_c1
1917 nmdc:mga08y16_174204_c1
1918 nmdc:mga08y16_212080_c1
1919 nmdc:mga08y16_244165_c1
1920 nmdc:mga08y16_6524_c1
1921 nmdc:mga08y16_66925_c1
1922 nmdc:mga08y16_93505_c1
1923 nmdc:mga0n895_128971_c1
1924 nmdc:mga0n895_18279_c1
1925 nmdc:mga0n895_34229_c1
1926 nmdc:mga0n895_36728_c1
1927 nmdc:mga0n895_60365_c1
1928 nmdc:mga0n895_84586_c1
1929 nmdc:mga0rr50_107347_c1
1930 nmdc:mga0rr50_8400_c1
1931 nmdc:mga0rr50_86200_c1
1932 nmdc:mga0a205_11336_c1
1933 nmdc:mga0a205_11653_c1
1934 nmdc:mga0sz30_11356_c1
1935 nmdc:mga0sz30_18242_c1
1936 Ga0495601_0000429
1937 Ga0500643_000037
1938 Ga0500646_0002806
1939 Ga0500646_0008598
1940 Ga0500583_0001825
1941 Ga0500651_0144840
1942 Ga0500566_0001075
1943 Ga0500566_0003368
1944 Ga0500566_0003623
1945 Ga0500555_001855
1946 Ga0500555_030707
1947 Ga0500555_035827
1948 Ga0500556_0054338
1949 Ga0500557_000047
1950 Ga0500569_000518
1951 Ga0500572_016523
1952 Ga0500595_006884
1953 Ga0500595_026598
1954 Ga0500595_027317
1955 Ga0500607_012500
1956 Ga0500607_141798
1957 Ga0500608_064472
1958 Ga0500642_0001382
1959 Ga0500658_0031714
1960 Ga0500658_0049478
1961 Ga0500559_0012586
1962 Ga0500561_0010738
1963 Ga0500568_0000101
1964 Ga0500568_0002259
1965 Ga0500568_0018020
1966 Ga0500573_0000009
1967 Ga0500577_0078290
1968 Ga0500603_002543
1969 Ga0500604_0003284
1970 Ga0500604_0020075
1971 Ga0500616_0001091
1972 Ga0500616_0023355
1973 Ga0500622_0028910
1974 Ga0500624_006581
1975 Ga0500627_0051817
1976 Ga0500630_005372
1977 Ga0500630_032312
1978 Ga0500638_055522
1979 Ga0500639_009086
1980 Ga0500636_0004313
1981 Ga0500637_0047261
1982 Ga0500649_042905
1983 Ga0500625_011953
1984 Ga0500645_013978
1985 Ga0500596_001342
1986 Ga0500596_001805
1987 Ga0500596_006217
1988 Ga0500599_004175
1989 Ga0500601_000279
1990 Ga0501084_0008888
1991 Ga0501082_0000013
1992 Ga0530510_0088737
1993 2507510361
1994 2509153158
1995 2513627334
1996 2513640245
1997 2513648649
1998 2513661231
1999 2513674752
2000 2513693595
2001 2513704234
2002 2513715931
2003 2513862297
2004 2513893805
2005 2513922951
2006 2517105562
2007 2517894270
2008 2524442069
2009 2524469042
2010 2524535696
2011 2528852339
2012 2586061747
2013 2617378663
2014 2623589474
2015 2671124026
2016 2723847477
2017 2745076078
2018 2793073959
2019 2793081497
2020 2809590392
2021 2818241936
2022 2824603875
2023 2824612516
2024 2824655653
2025 2824668873
2026 2824680044
2027 2824710021
2028 2824733710
2029 2824747931
2030 2824755279
2031 2824772157
2032 2841959113
2033 2842045144
2034 2842049195
2035 2847934175
2036 2857516176
2037 2874611457
2038 2874612900
2039 2874625111
2040 2874634770
2041 2876769435
2042 2876817085
2043 2879086840
2044 2879117530
2045 2881369159
2046 2881667595
2047 2883577127
2048 2884698054
2049 2885367460
2050 2885376783
2051 2888382058
2052 2888422668
2053 2889042194
2054 2894772483
2055 2895445114
2056 2903751563
2057 2904666887
2058 2904697269
2059 2904705412
2060 2904717764
2061 2906611096
2062 2906626511
2063 2906641263
2064 2906648121
2065 2906667556
2066 2908744612
2067 2908762232
2068 2908778304
2069 2912764486
2070 2915774408
2071 2922372098
2072 2922390574
2073 2922399257
2074 2922428218
2075 2929616658
2076 2929625402
2077 2932792170
2078 2932798813
2079 2932803583
2080 2932814463
2081 2932824550
2082 2932837339
2083 2933578059
2084 2935623422
2085 2935637345
2086 2935646829
2087 2935672748
2088 2935684468
2089 2935692069
2090 2935694994
2091 2935707905
2092 2935721908
2093 2935731094
2094 2935739044
2095 2935747771
2096 2935756355
2097 2935761676
2098 2935774353
2099 2935782759
2100 2935793415
2101 2935801245
2102 2935810362
2103 2935819546
2104 2935836096
2105 2935845028
2106 2935861578
2107 2935881489
2108 2935887798
2109 2935963614
2110 2936001565
2111 2936005356
2112 2936046313
2113 2940562269
2114 2941513923
2115 2941521884
2116 2941529553
2117 2941535179
2118 2941546763
2119 2996228354
2120 3005478203
2121 3005489703
2122 3005593620
2123 3005597103
2124 3005713125
2125 8006943013
2126 8006970197
2127 8006982809
2128 8006985476
2129 8006994479
2130 8016515580
2131 8016523245
2132 8016536732
2133 8016541011
2134 8016552242
2135 8016566394
2136 8016579145
2137 8016590427
2138 8016598516
2139 8016612613
2140 8016621205
2141 8016628800
2142 8017060912
2143 8019543016
2144 8019547720
2145 8019558831
2146 8019566478
2147 8019580370
2148 8019588093
2149 8019603247
2150 8019643225
2151 8019656081
2152 8055748304
2153 8056681210
2154 8056684332

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

44

385

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pk3-assembly1.cif.gz_B alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana 0.9666 6 406
6pk3-assembly1.cif.gz_B alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana 0.9476 6 406
1iug-assembly1.cif.gz_B the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus 0.9463 13 383
1iug-assembly1.cif.gz_B the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus 0.9358 13 383
3f0h-assembly1.cif.gz_A-2 crystal structure of aminotransferase (rer070207000802) from eubacterium rectale at 1.70 a resolution 0.9343 12 386
ID Description Score Start End Superfamily
af_A0A1D6KIH4_267_382_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.971 289 403 3.90.1150.10
af_A0A1D6KIG3_10_230_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9672 23 250 3.40.640.10
af_Q58369_36_182_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9644 41 200 3.40.640.10
af_B6T171_24_270_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9581 26 278 3.40.640.10
af_A0A1D6KIH4_267_382_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9546 289 403 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A7X5WJ28-F1-model_v4 deleted 0.9941 145 233
AF-A0A2E9NWN9-F1-model_v4 Serine--glyoxylate aminotransferase 0.9936 38 401 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A0D9AVS7-F1-model_v4 Serine--glyoxylate aminotransferase 0.9933 1 407 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A352SDU8-F1-model_v4 Serine--glyoxylate aminotransferase 0.9919 157 397 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A7W7VCS5-F1-model_v4 Alanine-glyoxylate transaminase/serine-glyoxylate transaminase/serine-pyruvate transaminase (EC 2.6.1.44, EC 2.6.1.45, EC 2.6.1.51) 0.9918 27 403 GO:0004760
GO:0005777
GO:0008453
GO:0019265
GO:0050281

Map