F489688
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1081 | 599 | 2154 | 398 |
Family's Representative Sequence
| Representative Sequence | 3300053730|Ga0500645_034405|Ga0500645_034405_59_1375 |
| Length | 438 |
| Sequence | MYTKSSSRFSIDLVRGARAPFLQGIPPKELPMLQYSFAKSGRHFLQIPGPTNVPDRILRAIDRPTIDHRGPEFGVLGKKVLEGMKAIFQTKSPVIIYPASGTGAWEAALVNTLSPGDTVLMYESGQFATLWKNMAVKVGLKPEFIEGDWRRAADPAAIEARLKEDMSQSGGHTIKAVCVVHNETSTGCTARIPEIRRAIDRAGHPALLLVDTISSLGSIDYRHDEWGVDVTVGGSQKGLMLPPGISFNAISDKALAAAKSSKSLKSFWGWEEMLASNKTGYFPYTPNTNLLYGLHEAIDMLMEEGLSNVFARHNRHAEATRRAVRAWGMEVFCQIPEEYSGALTTILMPEGHNADALRKVILEKFDMSLGQGLGKISGKVFRIGHLGDFNDLTLMGTLSGVEMGFEVAGVPHQKGGAQAAIDYLAQCAKAPAALKAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 97 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 127 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 128 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 129 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 223 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 228 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 244 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 250 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 252 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 269 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 272 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 278 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 279 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 280 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 284 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 343 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 344 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 349 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 350 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 353 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 354 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 355 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 356 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 357 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 358 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 359 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 360 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 361 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 400 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 401 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 402 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 403 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 404 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 407 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 408 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 410 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 411 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 412 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 417 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 418 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 419 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 421 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 423 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 424 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 426 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 427 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 428 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 430 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 432 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 434 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 435 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 438 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 439 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 440 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 441 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 442 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 443 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 444 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 445 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 446 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 447 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 448 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 449 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 450 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 451 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 452 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 453 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 454 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 455 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 456 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 457 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 458 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 459 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 460 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 461 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 462 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 463 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 464 | 2791355199 | |||
| 465 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 466 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 467 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 468 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 469 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 470 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 471 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 472 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 473 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 474 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 475 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 476 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 477 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 478 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 479 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 480 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 481 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 482 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 483 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 484 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 485 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 486 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 487 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 488 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 489 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 490 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 491 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 492 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 493 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 494 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 495 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 496 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 497 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 498 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 499 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 500 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 501 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 502 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 503 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 504 | 2904699407 | |||
| 505 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 506 | 2906610324 | |||
| 507 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 508 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 509 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 510 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 511 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 512 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 513 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 514 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 515 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 516 | 2922368715 | |||
| 517 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 518 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 519 | 2922425934 | |||
| 520 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 521 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 522 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 523 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 524 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 525 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 526 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 527 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 528 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 529 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 530 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 531 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 532 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 533 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 534 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 535 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 536 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 537 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 538 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 539 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 540 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 541 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 542 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 543 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 544 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 545 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 546 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 547 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 548 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 549 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 550 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 551 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 552 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 553 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 554 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 555 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 556 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 557 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 558 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 559 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 560 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 561 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 562 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 563 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 564 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 565 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 566 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 567 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 568 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 569 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 570 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 571 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 572 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 573 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 574 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 575 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 576 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 577 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 578 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 579 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 580 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 581 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 582 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 583 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 584 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 585 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 586 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 587 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 588 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 589 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 590 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 591 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 592 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 593 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 594 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 595 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 596 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 597 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 598 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 599 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.04 |
| Metatranscriptomes | 0.37 |
| Isolates | 14.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.9 |
| Nodule | 11.66 |
| Rhizoplane | 3.33 |
| Rhizosphere | 66.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500645_034405 | 3300053730 | Bacteria | 1513 |
| 2 | JGI25151J46595_10000304 | 3300003187 | Bacteria | 53759 |
| 3 | JGI25151J46595_10000631 | 3300003187 | Bacteria | 30567 |
| 4 | JGI25153J46596_10002594 | 3300003215 | Bacteria | 10363 |
| 5 | JGI25153J46596_10006592 | 3300003215 | Bacteria | 5850 |
| 6 | JGI25160J50197_1008713 | 3300003354 | Bacteria | 3841 |
| 7 | JGI25407J50210_10028083 | 3300003373 | Bacteria | 1460 |
| 8 | JGI25404J52841_10002130 | 3300003659 | Bacteria | 3684 |
| 9 | Ga0055535_1000449 | 3300003761 | Bacteria | 37935 |
| 10 | Ga0055542_1000021 | 3300003762 | Bacteria | 331499 |
| 11 | Ga0055526_1000274 | 3300003771 | Bacteria | 43546 |
| 12 | Ga0055543_1002331 | 3300004625 | Bacteria | 6365 |
| 13 | Ga0058861_11860130 | 3300004800 | Bacteria | 1824 |
| 14 | Ga0058862_12887444 | 3300004803 | Bacteria | 1370 |
| 15 | Ga0065165_1000387 | 3300005262 | Bacteria | 71385 |
| 16 | Ga0065714_10079457 | 3300005288 | Bacteria | 2515 |
| 17 | Ga0065712_10074830 | 3300005290 | Bacteria | 3997 |
| 18 | Ga0065715_10003511 | 3300005293 | Bacteria | 5011 |
| 19 | Ga0070658_10020638 | 3300005327 | Bacteria | 5279 |
| 20 | Ga0070658_10048661 | 3300005327 | Bacteria | 3433 |
| 21 | Ga0070676_10014697 | 3300005328 | Bacteria | 4306 |
| 22 | Ga0070683_100002543 | 3300005329 | Bacteria | 14568 |
| 23 | Ga0070683_100014342 | 3300005329 | Bacteria | 6931 |
| 24 | Ga0070683_100074896 | 3300005329 | Bacteria | 3162 |
| 25 | Ga0070690_100022827 | 3300005330 | Bacteria | 3832 |
| 26 | Ga0070670_100001672 | 3300005331 | Bacteria | 18004 |
| 27 | Ga0070670_100003550 | 3300005331 | Bacteria | 12975 |
| 28 | Ga0070677_10011450 | 3300005333 | Bacteria | 3059 |
| 29 | Ga0070677_10044447 | 3300005333 | Bacteria | 1767 |
| 30 | Ga0068869_100007127 | 3300005334 | Bacteria | 7123 |
| 31 | Ga0070666_10033193 | 3300005335 | Bacteria | 3414 |
| 32 | Ga0070666_10035624 | 3300005335 | Bacteria | 3301 |
| 33 | Ga0070680_100003205 | 3300005336 | Bacteria | 12167 |
| 34 | Ga0070680_100120419 | 3300005336 | Bacteria | 2190 |
| 35 | Ga0070680_100121432 | 3300005336 | Bacteria | 2181 |
| 36 | Ga0068868_100000732 | 3300005338 | Bacteria | 22193 |
| 37 | Ga0068868_100003524 | 3300005338 | Bacteria | 10904 |
| 38 | Ga0068868_100021095 | 3300005338 | Bacteria | 4904 |
| 39 | Ga0068868_100102554 | 3300005338 | Bacteria | 2317 |
| 40 | Ga0068868_100193480 | 3300005338 | Bacteria | 1692 |
| 41 | Ga0070660_100001026 | 3300005339 | Bacteria | 18747 |
| 42 | Ga0070660_100043859 | 3300005339 | Bacteria | 3418 |
| 43 | Ga0070661_100000659 | 3300005344 | Bacteria | 25350 |
| 44 | Ga0070661_100001562 | 3300005344 | Bacteria | 15939 |
| 45 | Ga0070661_100006984 | 3300005344 | Bacteria | 7793 |
| 46 | Ga0070661_100098337 | 3300005344 | Bacteria | 2174 |
| 47 | Ga0070692_10084268 | 3300005345 | Bacteria | 1718 |
| 48 | Ga0070668_100007414 | 3300005347 | Bacteria | 8141 |
| 49 | Ga0070668_100089465 | 3300005347 | Bacteria | 2425 |
| 50 | Ga0070668_100097333 | 3300005347 | Bacteria | 2327 |
| 51 | Ga0070668_100134901 | 3300005347 | Bacteria | 1984 |
| 52 | Ga0070669_100008959 | 3300005353 | Bacteria | 7142 |
| 53 | Ga0070669_100077945 | 3300005353 | Bacteria | 2463 |
| 54 | Ga0070675_100000909 | 3300005354 | Bacteria | 21059 |
| 55 | Ga0070675_100003113 | 3300005354 | Bacteria | 12541 |
| 56 | Ga0070671_100000836 | 3300005355 | Bacteria | 22365 |
| 57 | Ga0070671_100003711 | 3300005355 | Bacteria | 11985 |
| 58 | Ga0070671_100048347 | 3300005355 | Bacteria | 3537 |
| 59 | Ga0070671_100120512 | 3300005355 | Bacteria | 2207 |
| 60 | Ga0070671_100303358 | 3300005355 | Bacteria | 1360 |
| 61 | Ga0070674_100014087 | 3300005356 | Bacteria | 4963 |
| 62 | Ga0070673_100000415 | 3300005364 | Bacteria | 22516 |
| 63 | Ga0070673_100077331 | 3300005364 | Bacteria | 2689 |
| 64 | Ga0070673_100084649 | 3300005364 | Bacteria | 2579 |
| 65 | Ga0070659_100013383 | 3300005366 | Bacteria | 6104 |
| 66 | Ga0070659_100107845 | 3300005366 | Bacteria | 2246 |
| 67 | Ga0070659_100133981 | 3300005366 | Bacteria | 2014 |
| 68 | Ga0070667_100001323 | 3300005367 | Bacteria | 22254 |
| 69 | Ga0070667_100011922 | 3300005367 | Bacteria | 7193 |
| 70 | Ga0070667_100040845 | 3300005367 | Bacteria | 3891 |
| 71 | Ga0070709_10001625 | 3300005434 | Bacteria | 12157 |
| 72 | Ga0070709_10005194 | 3300005434 | Bacteria | 7044 |
| 73 | Ga0070709_10048202 | 3300005434 | Bacteria | 2658 |
| 74 | Ga0070714_100001230 | 3300005435 | Bacteria | 18485 |
| 75 | Ga0070714_100049268 | 3300005435 | Bacteria | 3586 |
| 76 | Ga0070714_100052864 | 3300005435 | Bacteria | 3465 |
| 77 | Ga0070713_100057831 | 3300005436 | Bacteria | 3230 |
| 78 | Ga0070713_100209287 | 3300005436 | Bacteria | 1765 |
| 79 | Ga0070710_10001955 | 3300005437 | Bacteria | 9757 |
| 80 | Ga0070711_100000864 | 3300005439 | Bacteria | 15936 |
| 81 | Ga0070711_100020766 | 3300005439 | Bacteria | 4238 |
| 82 | Ga0070711_100033716 | 3300005439 | Bacteria | 3411 |
| 83 | Ga0070711_100079974 | 3300005439 | Bacteria | 2326 |
| 84 | Ga0070700_100003662 | 3300005441 | Bacteria | 7944 |
| 85 | Ga0070700_100048678 | 3300005441 | Bacteria | 2628 |
| 86 | Ga0070708_100000447 | 3300005445 | Bacteria | 30884 |
| 87 | Ga0070663_100126611 | 3300005455 | Bacteria | 1935 |
| 88 | Ga0070663_100138257 | 3300005455 | Bacteria | 1857 |
| 89 | Ga0070678_100000308 | 3300005456 | Bacteria | 22695 |
| 90 | Ga0070678_100011586 | 3300005456 | Bacteria | 5446 |
| 91 | Ga0070678_100055577 | 3300005456 | Bacteria | 2890 |
| 92 | Ga0070662_100003497 | 3300005457 | Bacteria | 9797 |
| 93 | Ga0070662_100090113 | 3300005457 | Bacteria | 2301 |
| 94 | Ga0070681_10000556 | 3300005458 | Bacteria | 30697 |
| 95 | Ga0070681_10011881 | 3300005458 | Bacteria | 8634 |
| 96 | Ga0070681_10012768 | 3300005458 | Bacteria | 8335 |
| 97 | Ga0070681_10032524 | 3300005458 | Bacteria | 5235 |
| 98 | Ga0070681_10058628 | 3300005458 | Bacteria | 3829 |
| 99 | Ga0070681_10065786 | 3300005458 | Bacteria | 3594 |
| 100 | Ga0068867_100002001 | 3300005459 | Bacteria | 14223 |
| 101 | Ga0068867_100005583 | 3300005459 | Bacteria | 8913 |
| 102 | Ga0068867_100021754 | 3300005459 | Bacteria | 4578 |
| 103 | Ga0068867_100147418 | 3300005459 | Bacteria | 1846 |
| 104 | Ga0068867_100153725 | 3300005459 | Bacteria | 1809 |
| 105 | Ga0070706_100008748 | 3300005467 | Bacteria | 9432 |
| 106 | Ga0070707_100087854 | 3300005468 | Bacteria | 3007 |
| 107 | Ga0070698_100056495 | 3300005471 | Bacteria | 3977 |
| 108 | Ga0070698_100228974 | 3300005471 | Bacteria | 1792 |
| 109 | Ga0070679_100000724 | 3300005530 | Bacteria | 28496 |
| 110 | Ga0070679_100012464 | 3300005530 | Bacteria | 8126 |
| 111 | Ga0070679_100014399 | 3300005530 | Bacteria | 7596 |
| 112 | Ga0070679_100039481 | 3300005530 | Bacteria | 4691 |
| 113 | Ga0070684_100042424 | 3300005535 | Bacteria | 3927 |
| 114 | Ga0068853_100010070 | 3300005539 | Bacteria | 7638 |
| 115 | Ga0068853_100018013 | 3300005539 | Bacteria | 5838 |
| 116 | Ga0068853_100393010 | 3300005539 | Bacteria | 1297 |
| 117 | Ga0070672_100000177 | 3300005543 | Bacteria | 35110 |
| 118 | Ga0070672_100000186 | 3300005543 | Bacteria | 34186 |
| 119 | Ga0070672_100085759 | 3300005543 | Bacteria | 2531 |
| 120 | Ga0070672_100149660 | 3300005543 | Bacteria | 1930 |
| 121 | Ga0070696_100112145 | 3300005546 | Bacteria | 1965 |
| 122 | Ga0070665_100004123 | 3300005548 | Bacteria | 15290 |
| 123 | Ga0070665_100019233 | 3300005548 | Bacteria | 6852 |
| 124 | Ga0070665_100038817 | 3300005548 | Bacteria | 4787 |
| 125 | Ga0070665_100039261 | 3300005548 | Bacteria | 4760 |
| 126 | Ga0070665_100067737 | 3300005548 | Bacteria | 3579 |
| 127 | Ga0070704_100086079 | 3300005549 | Bacteria | 2328 |
| 128 | Ga0070704_100267632 | 3300005549 | Bacteria | 1411 |
| 129 | Ga0068855_100007555 | 3300005563 | Bacteria | 13153 |
| 130 | Ga0068855_100017631 | 3300005563 | Bacteria | 8586 |
| 131 | Ga0068855_100245709 | 3300005563 | Bacteria | 1998 |
| 132 | Ga0070664_100000157 | 3300005564 | Bacteria | 47128 |
| 133 | Ga0070664_100001930 | 3300005564 | Bacteria | 16661 |
| 134 | Ga0070664_100086346 | 3300005564 | Bacteria | 2711 |
| 135 | Ga0068857_100002118 | 3300005577 | Bacteria | 16141 |
| 136 | Ga0068857_100053287 | 3300005577 | Bacteria | 3589 |
| 137 | Ga0068857_100090846 | 3300005577 | Bacteria | 2732 |
| 138 | Ga0068854_100002001 | 3300005578 | Bacteria | 12483 |
| 139 | Ga0068854_100025797 | 3300005578 | Bacteria | 4033 |
| 140 | Ga0068854_100043871 | 3300005578 | Bacteria | 3172 |
| 141 | Ga0068854_100072435 | 3300005578 | Bacteria | 2523 |
| 142 | Ga0068856_100003357 | 3300005614 | Bacteria | 16236 |
| 143 | Ga0068856_100095788 | 3300005614 | Bacteria | 2956 |
| 144 | Ga0068852_100000221 | 3300005616 | Bacteria | 38665 |
| 145 | Ga0068852_100000826 | 3300005616 | Bacteria | 20462 |
| 146 | Ga0068852_100016450 | 3300005616 | Bacteria | 5769 |
| 147 | Ga0068852_100027970 | 3300005616 | Bacteria | 4606 |
| 148 | Ga0068852_100187497 | 3300005616 | Bacteria | 1949 |
| 149 | Ga0068859_100102420 | 3300005617 | Bacteria | 2921 |
| 150 | Ga0068864_100024601 | 3300005618 | Bacteria | 5067 |
| 151 | Ga0068864_100060153 | 3300005618 | Bacteria | 3289 |
| 152 | Ga0068864_100068763 | 3300005618 | Bacteria | 3078 |
| 153 | Ga0068864_100075383 | 3300005618 | Bacteria | 2945 |
| 154 | Ga0068861_100006231 | 3300005719 | Bacteria | 8115 |
| 155 | Ga0068861_100019550 | 3300005719 | Bacteria | 4838 |
| 156 | Ga0068861_100073735 | 3300005719 | Bacteria | 2652 |
| 157 | Ga0068851_10093005 | 3300005834 | Bacteria | 1590 |
| 158 | Ga0068863_100003043 | 3300005841 | Bacteria | 16570 |
| 159 | Ga0068863_100048937 | 3300005841 | Bacteria | 4008 |
| 160 | Ga0068863_100051594 | 3300005841 | Bacteria | 3898 |
| 161 | Ga0068863_100138175 | 3300005841 | Bacteria | 2328 |
| 162 | Ga0068863_100292326 | 3300005841 | Bacteria | 1579 |
| 163 | Ga0068858_100016214 | 3300005842 | Bacteria | 6999 |
| 164 | Ga0068858_100032450 | 3300005842 | Bacteria | 4849 |
| 165 | Ga0068858_100033479 | 3300005842 | Bacteria | 4767 |
| 166 | Ga0068860_100014528 | 3300005843 | Bacteria | 7705 |
| 167 | Ga0068860_100042534 | 3300005843 | Bacteria | 4337 |
| 168 | Ga0068862_100007699 | 3300005844 | Bacteria | 8912 |
| 169 | Ga0068862_100030313 | 3300005844 | Bacteria | 4557 |
| 170 | Ga0068862_100062781 | 3300005844 | Bacteria | 3196 |
| 171 | Ga0081455_10004548 | 3300005937 | Bacteria | 15486 |
| 172 | Ga0081455_10007292 | 3300005937 | Bacteria | 11670 |
| 173 | Ga0081455_10008955 | 3300005937 | Bacteria | 10343 |
| 174 | Ga0081455_10080131 | 3300005937 | Bacteria | 2678 |
| 175 | Ga0081538_10003622 | 3300005981 | Bacteria | 14521 |
| 176 | Ga0081540_1000745 | 3300005983 | Bacteria | 29937 |
| 177 | Ga0081540_1003399 | 3300005983 | Bacteria | 12610 |
| 178 | Ga0081540_1006214 | 3300005983 | Bacteria | 8756 |
| 179 | Ga0081540_1009249 | 3300005983 | Bacteria | 6796 |
| 180 | Ga0081540_1010444 | 3300005983 | Bacteria | 6287 |
| 181 | Ga0081540_1013078 | 3300005983 | Bacteria | 5420 |
| 182 | Ga0081540_1014387 | 3300005983 | Bacteria | 5070 |
| 183 | Ga0081540_1022848 | 3300005983 | Bacteria | 3680 |
| 184 | Ga0081540_1031419 | 3300005983 | Bacteria | 2919 |
| 185 | Ga0081540_1034982 | 3300005983 | Bacteria | 2700 |
| 186 | Ga0081539_10027525 | 3300005985 | Bacteria | 3598 |
| 187 | Ga0075368_10000198 | 3300006042 | Bacteria | 16616 |
| 188 | Ga0075363_100028435 | 3300006048 | Bacteria | 2876 |
| 189 | Ga0070715_10066040 | 3300006163 | Bacteria | 1603 |
| 190 | Ga0070716_100018886 | 3300006173 | Bacteria | 3596 |
| 191 | Ga0070712_100089096 | 3300006175 | Bacteria | 2256 |
| 192 | Ga0070712_100138991 | 3300006175 | Bacteria | 1851 |
| 193 | Ga0075367_10015991 | 3300006178 | Bacteria | 4090 |
| 194 | Ga0097621_100000202 | 3300006237 | Bacteria | 38810 |
| 195 | Ga0097621_100025322 | 3300006237 | Bacteria | 4640 |
| 196 | Ga0097621_100035686 | 3300006237 | Bacteria | 3975 |
| 197 | Ga0097621_100152815 | 3300006237 | Bacteria | 1980 |
| 198 | Ga0075370_10023535 | 3300006353 | Bacteria | 3393 |
| 199 | Ga0075370_10050736 | 3300006353 | Bacteria | 2354 |
| 200 | Ga0068871_100000840 | 3300006358 | Bacteria | 20567 |
| 201 | Ga0068871_100071907 | 3300006358 | Bacteria | 2847 |
| 202 | Ga0068871_100113418 | 3300006358 | Bacteria | 2283 |
| 203 | Ga0075428_100000580 | 3300006844 | Bacteria | 37416 |
| 204 | Ga0075428_100067152 | 3300006844 | Bacteria | 3926 |
| 205 | Ga0075430_100028026 | 3300006846 | Bacteria | 4785 |
| 206 | Ga0075431_100000518 | 3300006847 | Bacteria | 32306 |
| 207 | Ga0075433_10008386 | 3300006852 | Bacteria | 8245 |
| 208 | Ga0075433_10305129 | 3300006852 | Bacteria | 1409 |
| 209 | Ga0075434_100039202 | 3300006871 | Bacteria | 4694 |
| 210 | Ga0075429_100005751 | 3300006880 | Bacteria | 10704 |
| 211 | Ga0075429_100104260 | 3300006880 | Bacteria | 2477 |
| 212 | Ga0068865_100069910 | 3300006881 | Bacteria | 2486 |
| 213 | Ga0068865_100073297 | 3300006881 | Bacteria | 2434 |
| 214 | Ga0068865_100077599 | 3300006881 | Bacteria | 2374 |
| 215 | Ga0075436_100211176 | 3300006914 | Bacteria | 1376 |
| 216 | Ga0097620_100102431 | 3300006931 | Bacteria | 2921 |
| 217 | Ga0099825_1035458 | 3300006941 | Bacteria | 1783 |
| 218 | Ga0099824_1016897 | 3300006942 | Bacteria | 6485 |
| 219 | Ga0075435_100012082 | 3300007076 | Bacteria | 6383 |
| 220 | Ga0075435_100106968 | 3300007076 | Unclassified | 2323 |
| 221 | Ga0075435_100128943 | 3300007076 | Bacteria | 2116 |
| 222 | Ga0075435_100157609 | 3300007076 | Bacteria | 1911 |
| 223 | Ga0075435_100170271 | 3300007076 | Bacteria | 1837 |
| 224 | Ga0105240_10001724 | 3300009093 | Bacteria | 36906 |
| 225 | Ga0105240_10007858 | 3300009093 | Bacteria | 15392 |
| 226 | Ga0105240_10010644 | 3300009093 | Bacteria | 12916 |
| 227 | Ga0105240_10341283 | 3300009093 | Bacteria | 1701 |
| 228 | Ga0105240_10402506 | 3300009093 | Bacteria | 1541 |
| 229 | Ga0111539_10000651 | 3300009094 | Bacteria | 44838 |
| 230 | Ga0111539_10061654 | 3300009094 | Bacteria | 4442 |
| 231 | Ga0111539_10437085 | 3300009094 | Bacteria | 1524 |
| 232 | Ga0105245_10007672 | 3300009098 | Bacteria | 9449 |
| 233 | Ga0105245_10025858 | 3300009098 | Bacteria | 5163 |
| 234 | Ga0105245_10026441 | 3300009098 | Bacteria | 5107 |
| 235 | Ga0105245_10031273 | 3300009098 | Bacteria | 4709 |
| 236 | Ga0105245_10102254 | 3300009098 | Bacteria | 2654 |
| 237 | Ga0114129_10000505 | 3300009147 | Bacteria | 47605 |
| 238 | Ga0114129_10003700 | 3300009147 | Bacteria | 21537 |
| 239 | Ga0114129_10019741 | 3300009147 | Bacteria | 9592 |
| 240 | Ga0114129_10131325 | 3300009147 | Bacteria | 3439 |
| 241 | Ga0114129_10165612 | 3300009147 | Unclassified | 3017 |
| 242 | Ga0105241_10054338 | 3300009174 | Bacteria | 3066 |
| 243 | Ga0105241_10072385 | 3300009174 | Bacteria | 2679 |
| 244 | Ga0105241_10142475 | 3300009174 | Bacteria | 1953 |
| 245 | Ga0105241_10188774 | 3300009174 | Bacteria | 1714 |
| 246 | Ga0105242_10005776 | 3300009176 | Bacteria | 9534 |
| 247 | Ga0105242_10055417 | 3300009176 | Bacteria | 3243 |
| 248 | Ga0105248_10022137 | 3300009177 | Bacteria | 7045 |
| 249 | Ga0105248_10083121 | 3300009177 | Bacteria | 3602 |
| 250 | Ga0105248_10208068 | 3300009177 | Bacteria | 2204 |
| 251 | Ga0105248_10233089 | 3300009177 | Bacteria | 2072 |
| 252 | Ga0105248_10469087 | 3300009177 | Bacteria | 1419 |
| 253 | Ga0105237_10006524 | 3300009545 | Bacteria | 12913 |
| 254 | Ga0105237_10091157 | 3300009545 | Bacteria | 3038 |
| 255 | Ga0105238_10000203 | 3300009551 | Bacteria | 65825 |
| 256 | Ga0105238_10003461 | 3300009551 | Bacteria | 15706 |
| 257 | Ga0105238_10042740 | 3300009551 | Bacteria | 4588 |
| 258 | Ga0105238_10114570 | 3300009551 | Bacteria | 2675 |
| 259 | Ga0105249_10162936 | 3300009553 | Bacteria | 2156 |
| 260 | Ga0105239_10050052 | 3300010375 | Bacteria | 4583 |
| 261 | Ga0105239_10058326 | 3300010375 | Bacteria | 4236 |
| 262 | Ga0105239_10143600 | 3300010375 | Bacteria | 2661 |
| 263 | Ga0105239_10157662 | 3300010375 | Bacteria | 2536 |
| 264 | Ga0105246_10013973 | 3300011119 | Bacteria | 5041 |
| 265 | Ga0157373_10032306 | 3300013100 | Bacteria | 3768 |
| 266 | Ga0157371_10026840 | 3300013102 | Bacteria | 4182 |
| 267 | Ga0157370_10028168 | 3300013104 | Bacteria | 5530 |
| 268 | Ga0157370_10285437 | 3300013104 | Bacteria | 1525 |
| 269 | Ga0157369_10005960 | 3300013105 | Bacteria | 14157 |
| 270 | Ga0157369_10011596 | 3300013105 | Bacteria | 10007 |
| 271 | Ga0157369_10018830 | 3300013105 | Bacteria | 7737 |
| 272 | Ga0157369_10135432 | 3300013105 | Bacteria | 2608 |
| 273 | Ga0157374_10001953 | 3300013296 | Bacteria | 17298 |
| 274 | Ga0157374_10009479 | 3300013296 | Bacteria | 8360 |
| 275 | Ga0157374_10010653 | 3300013296 | Bacteria | 7919 |
| 276 | Ga0157374_10073614 | 3300013296 | Bacteria | 3224 |
| 277 | Ga0157374_10240195 | 3300013296 | Bacteria | 1781 |
| 278 | Ga0157378_10217421 | 3300013297 | Bacteria | 1815 |
| 279 | Ga0163162_10102021 | 3300013306 | Bacteria | 2962 |
| 280 | Ga0163162_10147944 | 3300013306 | Bacteria | 2466 |
| 281 | Ga0163162_10322113 | 3300013306 | Bacteria | 1678 |
| 282 | Ga0163162_10355879 | 3300013306 | Bacteria | 1597 |
| 283 | Ga0157372_10001409 | 3300013307 | Bacteria | 25953 |
| 284 | Ga0157372_10020476 | 3300013307 | Bacteria | 7137 |
| 285 | Ga0157372_10161855 | 3300013307 | Bacteria | 2587 |
| 286 | Ga0157375_10004073 | 3300013308 | Bacteria | 12676 |
| 287 | Ga0157375_10030596 | 3300013308 | Bacteria | 5079 |
| 288 | Ga0157375_10047417 | 3300013308 | Bacteria | 4196 |
| 289 | Ga0157375_10144763 | 3300013308 | Bacteria | 2506 |
| 290 | Ga0157375_10172449 | 3300013308 | Bacteria | 2311 |
| 291 | Ga0157375_10292512 | 3300013308 | Bacteria | 1792 |
| 292 | Ga0163163_10000090 | 3300014325 | Bacteria | 97441 |
| 293 | Ga0163163_10009881 | 3300014325 | Bacteria | 8550 |
| 294 | Ga0163163_10090300 | 3300014325 | Bacteria | 3077 |
| 295 | Ga0157380_10084448 | 3300014326 | Bacteria | 2603 |
| 296 | Ga0182008_10007140 | 3300014497 | Bacteria | 6184 |
| 297 | Ga0182008_10037367 | 3300014497 | Bacteria | 2429 |
| 298 | Ga0157379_10004907 | 3300014968 | Bacteria | 11484 |
| 299 | Ga0157379_10006862 | 3300014968 | Bacteria | 9844 |
| 300 | Ga0157379_10017175 | 3300014968 | Bacteria | 6375 |
| 301 | Ga0157379_10045315 | 3300014968 | Bacteria | 3925 |
| 302 | Ga0157379_10058923 | 3300014968 | Bacteria | 3434 |
| 303 | Ga0157379_10102599 | 3300014968 | Bacteria | 2567 |
| 304 | Ga0157376_10001708 | 3300014969 | Bacteria | 14611 |
| 305 | Ga0157376_10055032 | 3300014969 | Bacteria | 3319 |
| 306 | Ga0157376_10056182 | 3300014969 | Bacteria | 3287 |
| 307 | Ga0157376_10060308 | 3300014969 | Bacteria | 3185 |
| 308 | Ga0157376_10295420 | 3300014969 | Bacteria | 1531 |
| 309 | Ga0163161_10060111 | 3300017792 | Bacteria | 2765 |
| 310 | Ga0214544_1000055 | 3300021320 | Bacteria | 133217 |
| 311 | Ga0214542_1000196 | 3300021321 | Bacteria | 95225 |
| 312 | Ga0214545_1000028 | 3300021324 | Bacteria | 127957 |
| 313 | Ga0214543_1000044 | 3300021327 | Bacteria | 158132 |
| 314 | Ga0213876_10014155 | 3300021384 | Bacteria | 4231 |
| 315 | Ga0213876_10018389 | 3300021384 | Bacteria | 3690 |
| 316 | Ga0213875_10002599 | 3300021388 | Bacteria | 10730 |
| 317 | Ga0209672_100295 | 3300025228 | Bacteria | 34529 |
| 318 | Ga0209147_101997 | 3300025229 | Bacteria | 5929 |
| 319 | Ga0209258_100058 | 3300025242 | Bacteria | 331567 |
| 320 | Ga0209677_100757 | 3300025253 | Bacteria | 16368 |
| 321 | Ga0209148_1000071 | 3300025254 | Bacteria | 331551 |
| 322 | Ga0209148_1000711 | 3300025254 | Bacteria | 26722 |
| 323 | Ga0209129_1011203 | 3300025258 | Bacteria | 2162 |
| 324 | Ga0209233_1001618 | 3300025261 | Bacteria | 8764 |
| 325 | Ga0209233_1004243 | 3300025261 | Bacteria | 4907 |
| 326 | Ga0209233_1025754 | 3300025261 | Bacteria | 1450 |
| 327 | Ga0209455_1001451 | 3300025272 | Bacteria | 10671 |
| 328 | Ga0209455_1006522 | 3300025272 | Bacteria | 3430 |
| 329 | Ga0209130_1000190 | 3300025284 | Bacteria | 86573 |
| 330 | Ga0209025_1000446 | 3300025294 | Bacteria | 80985 |
| 331 | Ga0209564_1000023 | 3300025295 | Bacteria | 555102 |
| 332 | Ga0209564_1008860 | 3300025295 | Bacteria | 4895 |
| 333 | Ga0209758_1000187 | 3300025297 | Bacteria | 138759 |
| 334 | Ga0209758_1003975 | 3300025297 | Bacteria | 12816 |
| 335 | Ga0209758_1013916 | 3300025297 | Bacteria | 4333 |
| 336 | Ga0209758_1015628 | 3300025297 | Bacteria | 3915 |
| 337 | Ga0209758_1019218 | 3300025297 | Bacteria | 3307 |
| 338 | Ga0209758_1037382 | 3300025297 | Bacteria | 1878 |
| 339 | Ga0209758_1048794 | 3300025297 | Bacteria | 1501 |
| 340 | Ga0207426_1000160 | 3300025302 | Bacteria | 174540 |
| 341 | Ga0207697_10004750 | 3300025315 | Bacteria | 6429 |
| 342 | Ga0207697_10057009 | 3300025315 | Bacteria | 1621 |
| 343 | Ga0207656_10015034 | 3300025321 | Bacteria | 2992 |
| 344 | Ga0207692_10042307 | 3300025898 | Bacteria | 2260 |
| 345 | Ga0207692_10131970 | 3300025898 | Bacteria | 1412 |
| 346 | Ga0207688_10019853 | 3300025901 | Bacteria | 3664 |
| 347 | Ga0207680_10034716 | 3300025903 | Bacteria | 2888 |
| 348 | Ga0207699_10001076 | 3300025906 | Bacteria | 12922 |
| 349 | Ga0207699_10022268 | 3300025906 | Bacteria | 3431 |
| 350 | Ga0207645_10059908 | 3300025907 | Bacteria | 2431 |
| 351 | Ga0207645_10112722 | 3300025907 | Bacteria | 1762 |
| 352 | Ga0207705_10016820 | 3300025909 | Bacteria | 5238 |
| 353 | Ga0207705_10026329 | 3300025909 | Bacteria | 4148 |
| 354 | Ga0207707_10000139 | 3300025912 | Bacteria | 74831 |
| 355 | Ga0207707_10010142 | 3300025912 | Bacteria | 8175 |
| 356 | Ga0207707_10017242 | 3300025912 | Bacteria | 6294 |
| 357 | Ga0207707_10032631 | 3300025912 | Bacteria | 4558 |
| 358 | Ga0207707_10076677 | 3300025912 | Bacteria | 2918 |
| 359 | Ga0207707_10078356 | 3300025912 | Bacteria | 2886 |
| 360 | Ga0207707_10128879 | 3300025912 | Bacteria | 2212 |
| 361 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 362 | Ga0207695_10016171 | 3300025913 | Bacteria | 8749 |
| 363 | Ga0207695_10023967 | 3300025913 | Bacteria | 6882 |
| 364 | Ga0207695_10221532 | 3300025913 | Bacteria | 1799 |
| 365 | Ga0207695_10258050 | 3300025913 | Bacteria | 1641 |
| 366 | Ga0207671_10003418 | 3300025914 | Bacteria | 15862 |
| 367 | Ga0207693_10004880 | 3300025915 | Bacteria | 11271 |
| 368 | Ga0207693_10015116 | 3300025915 | Bacteria | 6196 |
| 369 | Ga0207693_10068602 | 3300025915 | Bacteria | 2775 |
| 370 | Ga0207693_10076727 | 3300025915 | Bacteria | 2617 |
| 371 | Ga0207693_10086602 | 3300025915 | Bacteria | 2455 |
| 372 | Ga0207663_10001558 | 3300025916 | Bacteria | 10748 |
| 373 | Ga0207663_10016591 | 3300025916 | Bacteria | 4088 |
| 374 | Ga0207663_10053754 | 3300025916 | Bacteria | 2518 |
| 375 | Ga0207663_10130073 | 3300025916 | Bacteria | 1738 |
| 376 | Ga0207660_10002090 | 3300025917 | Bacteria | 13239 |
| 377 | Ga0207660_10009649 | 3300025917 | Bacteria | 6248 |
| 378 | Ga0207660_10078766 | 3300025917 | Bacteria | 2416 |
| 379 | Ga0207657_10002729 | 3300025919 | Bacteria | 19002 |
| 380 | Ga0207657_10047977 | 3300025919 | Bacteria | 3730 |
| 381 | Ga0207657_10053852 | 3300025919 | Bacteria | 3483 |
| 382 | Ga0207657_10212039 | 3300025919 | Bacteria | 1554 |
| 383 | Ga0207649_10003878 | 3300025920 | Bacteria | 8155 |
| 384 | Ga0207649_10007536 | 3300025920 | Bacteria | 5916 |
| 385 | Ga0207649_10014878 | 3300025920 | Bacteria | 4364 |
| 386 | Ga0207652_10003895 | 3300025921 | Bacteria | 12208 |
| 387 | Ga0207652_10008960 | 3300025921 | Bacteria | 8064 |
| 388 | Ga0207652_10029251 | 3300025921 | Bacteria | 4604 |
| 389 | Ga0207652_10039342 | 3300025921 | Bacteria | 4013 |
| 390 | Ga0207652_10136739 | 3300025921 | Bacteria | 2189 |
| 391 | Ga0207681_10009609 | 3300025923 | Bacteria | 5912 |
| 392 | Ga0207681_10031794 | 3300025923 | Bacteria | 3449 |
| 393 | Ga0207694_10006781 | 3300025924 | Bacteria | 8697 |
| 394 | Ga0207694_10195979 | 3300025924 | Bacteria | 1642 |
| 395 | Ga0207650_10001199 | 3300025925 | Bacteria | 19021 |
| 396 | Ga0207650_10003269 | 3300025925 | Bacteria | 11170 |
| 397 | Ga0207659_10002617 | 3300025926 | Bacteria | 10713 |
| 398 | Ga0207659_10003295 | 3300025926 | Bacteria | 9668 |
| 399 | Ga0207659_10014353 | 3300025926 | Bacteria | 5105 |
| 400 | Ga0207659_10114121 | 3300025926 | Bacteria | 2059 |
| 401 | Ga0207687_10011801 | 3300025927 | Bacteria | 5715 |
| 402 | Ga0207687_10015002 | 3300025927 | Bacteria | 5075 |
| 403 | Ga0207687_10030495 | 3300025927 | Bacteria | 3636 |
| 404 | Ga0207687_10049070 | 3300025927 | Bacteria | 2934 |
| 405 | Ga0207687_10098837 | 3300025927 | Bacteria | 2143 |
| 406 | Ga0207700_10015355 | 3300025928 | Bacteria | 5049 |
| 407 | Ga0207700_10090797 | 3300025928 | Bacteria | 2412 |
| 408 | Ga0207664_10017186 | 3300025929 | Bacteria | 5296 |
| 409 | Ga0207664_10032336 | 3300025929 | Bacteria | 4008 |
| 410 | Ga0207664_10032814 | 3300025929 | Bacteria | 3983 |
| 411 | Ga0207644_10000365 | 3300025931 | Bacteria | 29528 |
| 412 | Ga0207644_10008217 | 3300025931 | Bacteria | 6835 |
| 413 | Ga0207644_10110127 | 3300025931 | Bacteria | 2081 |
| 414 | Ga0207690_10016818 | 3300025932 | Bacteria | 4457 |
| 415 | Ga0207690_10080122 | 3300025932 | Bacteria | 2278 |
| 416 | Ga0207690_10168279 | 3300025932 | Bacteria | 1640 |
| 417 | Ga0207690_10362723 | 3300025932 | Bacteria | 1148 |
| 418 | Ga0207706_10006986 | 3300025933 | Bacteria | 10433 |
| 419 | Ga0207706_10046207 | 3300025933 | Bacteria | 3855 |
| 420 | Ga0207706_10073287 | 3300025933 | Bacteria | 3011 |
| 421 | Ga0207706_10093300 | 3300025933 | Bacteria | 2647 |
| 422 | Ga0207686_10038264 | 3300025934 | Bacteria | 2901 |
| 423 | Ga0207709_10060787 | 3300025935 | Bacteria | 2358 |
| 424 | Ga0207670_10034151 | 3300025936 | Bacteria | 3284 |
| 425 | Ga0207669_10007715 | 3300025937 | Bacteria | 5005 |
| 426 | Ga0207669_10007898 | 3300025937 | Bacteria | 4960 |
| 427 | Ga0207704_10072042 | 3300025938 | Bacteria | 2195 |
| 428 | Ga0207665_10040126 | 3300025939 | Bacteria | 3122 |
| 429 | Ga0207665_10046337 | 3300025939 | Bacteria | 2913 |
| 430 | Ga0207665_10125927 | 3300025939 | Bacteria | 1814 |
| 431 | Ga0207691_10000276 | 3300025940 | Bacteria | 50778 |
| 432 | Ga0207691_10002411 | 3300025940 | Bacteria | 18297 |
| 433 | Ga0207691_10030949 | 3300025940 | Bacteria | 4998 |
| 434 | Ga0207691_10054301 | 3300025940 | Bacteria | 3655 |
| 435 | Ga0207711_10030312 | 3300025941 | Bacteria | 4562 |
| 436 | Ga0207711_10153172 | 3300025941 | Bacteria | 2082 |
| 437 | Ga0207711_10168810 | 3300025941 | Bacteria | 1984 |
| 438 | Ga0207711_10286936 | 3300025941 | Bacteria | 1516 |
| 439 | Ga0207689_10000415 | 3300025942 | Bacteria | 39864 |
| 440 | Ga0207689_10027387 | 3300025942 | Bacteria | 4772 |
| 441 | Ga0207689_10038778 | 3300025942 | Bacteria | 3944 |
| 442 | Ga0207661_10011082 | 3300025944 | Bacteria | 6516 |
| 443 | Ga0207661_10014956 | 3300025944 | Bacteria | 5697 |
| 444 | Ga0207679_10005759 | 3300025945 | Bacteria | 7779 |
| 445 | Ga0207679_10012754 | 3300025945 | Bacteria | 5490 |
| 446 | Ga0207679_10025964 | 3300025945 | Bacteria | 4034 |
| 447 | Ga0207679_10319408 | 3300025945 | Bacteria | 1344 |
| 448 | Ga0207667_10009574 | 3300025949 | Bacteria | 11400 |
| 449 | Ga0207667_10017829 | 3300025949 | Bacteria | 7982 |
| 450 | Ga0207667_10328933 | 3300025949 | Bacteria | 1560 |
| 451 | Ga0207651_10004986 | 3300025960 | Bacteria | 6768 |
| 452 | Ga0207651_10026981 | 3300025960 | Bacteria | 3599 |
| 453 | Ga0207651_10193639 | 3300025960 | Bacteria | 1624 |
| 454 | Ga0207712_10098448 | 3300025961 | Bacteria | 2169 |
| 455 | Ga0207668_10015716 | 3300025972 | Bacteria | 4709 |
| 456 | Ga0207668_10041624 | 3300025972 | Bacteria | 3107 |
| 457 | Ga0207668_10100334 | 3300025972 | Bacteria | 2149 |
| 458 | Ga0207640_10001031 | 3300025981 | Bacteria | 15406 |
| 459 | Ga0207640_10070924 | 3300025981 | Bacteria | 2345 |
| 460 | Ga0207640_10073346 | 3300025981 | Bacteria | 2313 |
| 461 | Ga0207640_10132572 | 3300025981 | Bacteria | 1804 |
| 462 | Ga0207658_10005357 | 3300025986 | Bacteria | 8811 |
| 463 | Ga0207677_10001216 | 3300026023 | Bacteria | 13899 |
| 464 | Ga0207677_10016707 | 3300026023 | Bacteria | 4355 |
| 465 | Ga0207677_10052395 | 3300026023 | Bacteria | 2772 |
| 466 | Ga0207677_10229103 | 3300026023 | Bacteria | 1495 |
| 467 | Ga0207703_10023207 | 3300026035 | Bacteria | 4873 |
| 468 | Ga0207703_10027790 | 3300026035 | Bacteria | 4455 |
| 469 | Ga0207703_10040883 | 3300026035 | Bacteria | 3713 |
| 470 | Ga0207639_10073516 | 3300026041 | Bacteria | 2680 |
| 471 | Ga0207639_10316474 | 3300026041 | Bacteria | 1384 |
| 472 | Ga0207678_10014339 | 3300026067 | Bacteria | 6969 |
| 473 | Ga0207678_10294783 | 3300026067 | Bacteria | 1393 |
| 474 | Ga0207708_10003526 | 3300026075 | Bacteria | 11527 |
| 475 | Ga0207708_10023275 | 3300026075 | Bacteria | 4680 |
| 476 | Ga0207708_10031356 | 3300026075 | Bacteria | 4034 |
| 477 | Ga0207708_10072813 | 3300026075 | Bacteria | 2633 |
| 478 | Ga0207702_10002758 | 3300026078 | Bacteria | 16441 |
| 479 | Ga0207702_10021800 | 3300026078 | Bacteria | 5305 |
| 480 | Ga0207702_10086466 | 3300026078 | Bacteria | 2734 |
| 481 | Ga0207641_10102798 | 3300026088 | Bacteria | 2520 |
| 482 | Ga0207641_10121785 | 3300026088 | Bacteria | 2329 |
| 483 | Ga0207648_10011496 | 3300026089 | Bacteria | 8333 |
| 484 | Ga0207648_10019804 | 3300026089 | Bacteria | 6072 |
| 485 | Ga0207648_10028323 | 3300026089 | Bacteria | 4968 |
| 486 | Ga0207648_10043828 | 3300026089 | Bacteria | 3927 |
| 487 | Ga0207648_10079615 | 3300026089 | Bacteria | 2858 |
| 488 | Ga0207676_10003251 | 3300026095 | Bacteria | 11571 |
| 489 | Ga0207676_10016855 | 3300026095 | Bacteria | 5290 |
| 490 | Ga0207676_10254181 | 3300026095 | Bacteria | 1583 |
| 491 | Ga0207676_10333415 | 3300026095 | Bacteria | 1397 |
| 492 | Ga0207674_10000301 | 3300026116 | Bacteria | 62588 |
| 493 | Ga0207674_10024546 | 3300026116 | Bacteria | 6439 |
| 494 | Ga0207674_10104015 | 3300026116 | Bacteria | 2818 |
| 495 | Ga0207674_10339179 | 3300026116 | Bacteria | 1453 |
| 496 | Ga0207675_100000177 | 3300026118 | Bacteria | 57433 |
| 497 | Ga0207675_100012098 | 3300026118 | Bacteria | 8062 |
| 498 | Ga0207675_100016962 | 3300026118 | Bacteria | 6806 |
| 499 | Ga0207675_100042519 | 3300026118 | Bacteria | 4244 |
| 500 | Ga0207675_100072098 | 3300026118 | Bacteria | 3230 |
| 501 | Ga0207683_10001296 | 3300026121 | Bacteria | 22599 |
| 502 | Ga0207683_10035761 | 3300026121 | Bacteria | 4320 |
| 503 | Ga0207683_10048402 | 3300026121 | Bacteria | 3723 |
| 504 | Ga0207683_10138723 | 3300026121 | Bacteria | 2190 |
| 505 | Ga0207683_10230120 | 3300026121 | Bacteria | 1690 |
| 506 | Ga0207683_10252153 | 3300026121 | Bacteria | 1611 |
| 507 | Ga0207698_10000451 | 3300026142 | Bacteria | 23736 |
| 508 | Ga0207698_10003841 | 3300026142 | Bacteria | 9094 |
| 509 | Ga0207698_10014026 | 3300026142 | Bacteria | 5309 |
| 510 | Ga0207698_10134453 | 3300026142 | Bacteria | 2119 |
| 511 | Ga0207698_10159283 | 3300026142 | Bacteria | 1972 |
| 512 | Ga0209389_1000003 | 3300027296 | Bacteria | 268927 |
| 513 | Ga0209389_1013235 | 3300027296 | Bacteria | 7496 |
| 514 | Ga0209589_1000004 | 3300027357 | Bacteria | 578529 |
| 515 | Ga0209589_1018958 | 3300027357 | Bacteria | 6956 |
| 516 | Ga0209969_1001299 | 3300027360 | Bacteria | 3432 |
| 517 | Ga0209489_100004 | 3300027361 | Bacteria | 578529 |
| 518 | Ga0209489_100022 | 3300027361 | Bacteria | 202016 |
| 519 | Ga0209489_100498 | 3300027361 | Bacteria | 73687 |
| 520 | Ga0209700_100004 | 3300027363 | Bacteria | 578529 |
| 521 | Ga0209700_100023 | 3300027363 | Bacteria | 229662 |
| 522 | Ga0209995_1000129 | 3300027471 | Bacteria | 11920 |
| 523 | Ga0209999_1001230 | 3300027543 | Bacteria | 4394 |
| 524 | Ga0209974_10001304 | 3300027876 | Bacteria | 8976 |
| 525 | Ga0207428_10002244 | 3300027907 | Bacteria | 19409 |
| 526 | Ga0207428_10044812 | 3300027907 | Bacteria | 3566 |
| 527 | Ga0207428_10116536 | 3300027907 | Bacteria | 2051 |
| 528 | Ga0268266_10016506 | 3300028379 | Bacteria | 6311 |
| 529 | Ga0268266_10020042 | 3300028379 | Bacteria | 5700 |
| 530 | Ga0268266_10030718 | 3300028379 | Bacteria | 4563 |
| 531 | Ga0268266_10033577 | 3300028379 | Bacteria | 4362 |
| 532 | Ga0268266_10068376 | 3300028379 | Bacteria | 3075 |
| 533 | Ga0268265_10004529 | 3300028380 | Bacteria | 9616 |
| 534 | Ga0268265_10021741 | 3300028380 | Bacteria | 4498 |
| 535 | Ga0268265_10068962 | 3300028380 | Bacteria | 2744 |
| 536 | Ga0268264_10060301 | 3300028381 | Bacteria | 3180 |
| 537 | Ga0268264_10143054 | 3300028381 | Bacteria | 2135 |
| 538 | Ga0265337_1026833 | 3300028556 | Bacteria | 1741 |
| 539 | Ga0265319_1025769 | 3300028563 | Bacteria | 2101 |
| 540 | Ga0265334_10002844 | 3300028573 | Bacteria | 7964 |
| 541 | Ga0265318_10003531 | 3300028577 | Bacteria | 7829 |
| 542 | Ga0265336_10038645 | 3300028666 | Bacteria | 1464 |
| 543 | Ga0307517_10195693 | 3300028786 | Bacteria | 1274 |
| 544 | Ga0307515_10000346 | 3300028794 | Bacteria | 114729 |
| 545 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 546 | Ga0265338_10036574 | 3300028800 | Bacteria | 4695 |
| 547 | Ga0307511_10000911 | 3300030521 | Bacteria | 31189 |
| 548 | Ga0265762_1000974 | 3300030760 | Bacteria | 5147 |
| 549 | Ga0265770_1008006 | 3300030878 | Bacteria | 1498 |
| 550 | Ga0265330_10002701 | 3300031235 | Bacteria | 9586 |
| 551 | Ga0265330_10016691 | 3300031235 | Bacteria | 3385 |
| 552 | Ga0265330_10018614 | 3300031235 | Bacteria | 3189 |
| 553 | Ga0265330_10084151 | 3300031235 | Bacteria | 1369 |
| 554 | Ga0265332_10001762 | 3300031238 | Bacteria | 11708 |
| 555 | Ga0265332_10011531 | 3300031238 | Bacteria | 3926 |
| 556 | Ga0265332_10034645 | 3300031238 | Bacteria | 2193 |
| 557 | Ga0265328_10001075 | 3300031239 | Bacteria | 12582 |
| 558 | Ga0265328_10018349 | 3300031239 | Bacteria | 2699 |
| 559 | Ga0265320_10003447 | 3300031240 | Bacteria | 10634 |
| 560 | Ga0265325_10010884 | 3300031241 | Bacteria | 5242 |
| 561 | Ga0265325_10019513 | 3300031241 | Bacteria | 3745 |
| 562 | Ga0265340_10011815 | 3300031247 | Bacteria | 4628 |
| 563 | Ga0265339_10047117 | 3300031249 | Bacteria | 2367 |
| 564 | Ga0265339_10052634 | 3300031249 | Bacteria | 2217 |
| 565 | Ga0265331_10002915 | 3300031250 | Bacteria | 11309 |
| 566 | Ga0265331_10031305 | 3300031250 | Bacteria | 2644 |
| 567 | Ga0265327_10002317 | 3300031251 | Bacteria | 20349 |
| 568 | Ga0265316_10020579 | 3300031344 | Bacteria | 5614 |
| 569 | Ga0265316_10148551 | 3300031344 | Bacteria | 1756 |
| 570 | Ga0265316_10150662 | 3300031344 | Bacteria | 1742 |
| 571 | Ga0307513_10117435 | 3300031456 | Bacteria | 2637 |
| 572 | Ga0307509_10030149 | 3300031507 | Bacteria | 6004 |
| 573 | Ga0307509_10056601 | 3300031507 | Bacteria | 4161 |
| 574 | Ga0265313_10005096 | 3300031595 | Bacteria | 9786 |
| 575 | Ga0265313_10008779 | 3300031595 | Bacteria | 6667 |
| 576 | Ga0265313_10010102 | 3300031595 | Bacteria | 6036 |
| 577 | Ga0265313_10041293 | 3300031595 | Bacteria | 2274 |
| 578 | Ga0265314_10005350 | 3300031711 | Bacteria | 11600 |
| 579 | Ga0265314_10005790 | 3300031711 | Bacteria | 11085 |
| 580 | Ga0265314_10045348 | 3300031711 | Bacteria | 3109 |
| 581 | Ga0265342_10007979 | 3300031712 | Bacteria | 7664 |
| 582 | Ga0307516_10026755 | 3300031730 | Bacteria | 5856 |
| 583 | Ga0307405_10006482 | 3300031731 | Bacteria | 5760 |
| 584 | Ga0307405_10115435 | 3300031731 | Bacteria | 1827 |
| 585 | Ga0307413_10033804 | 3300031824 | Bacteria | 2916 |
| 586 | Ga0307518_10002453 | 3300031838 | Bacteria | 13548 |
| 587 | Ga0307410_10031925 | 3300031852 | Bacteria | 3384 |
| 588 | Ga0307409_100042722 | 3300031995 | Bacteria | 3397 |
| 589 | Ga0307409_100110520 | 3300031995 | Bacteria | 2304 |
| 590 | Ga0307416_100037183 | 3300032002 | Bacteria | 3743 |
| 591 | Ga0307411_10038649 | 3300032005 | Bacteria | 3012 |
| 592 | Ga0307510_10025985 | 3300033180 | Bacteria | 6742 |
| 593 | Ga0307510_10064626 | 3300033180 | Bacteria | 3715 |
| 594 | Ga0315911_1000014 | 3300033442 | Bacteria | 207605 |
| 595 | Ga0373930_0008781 | 3300034816 | Bacteria | 1774 |
| 596 | Ga0373952_0002091 | 3300035092 | Bacteria | 3592 |
| 597 | Ga0373941_0007836 | 3300035115 | Bacteria | 2631 |
| 598 | Ga0373953_0022929 | 3300035117 | Bacteria | 2360 |
| 599 | Ga0373954_0039281 | 3300035118 | Bacteria | 2203 |
| 600 | Ga0373943_0035367 | 3300035170 | Bacteria | 2387 |
| 601 | Ga0373955_0067167 | 3300035172 | Bacteria | 1995 |
| 602 | Ga0373924_0051526 | 3300035410 | Bacteria | 1707 |
| 603 | Ga0373931_0000651 | 3300035691 | Bacteria | 14326 |
| 604 | Ga0373935_0202814 | 3300035692 | Bacteria | 1371 |
| 605 | Ga0373927_0037396 | 3300035695 | Bacteria | 3155 |
| 606 | Ga0373927_0142158 | 3300035695 | Bacteria | 1570 |
| 607 | Ga0373927_0188298 | 3300035695 | Bacteria | 1354 |
| 608 | Ga0373933_0006984 | 3300035724 | Bacteria | 6155 |
| 609 | Ga0373933_0043532 | 3300035724 | Bacteria | 2657 |
| 610 | Ga0373933_0050912 | 3300035724 | Bacteria | 2474 |
| 611 | Ga0373933_0082337 | 3300035724 | Bacteria | 1975 |
| 612 | Ga0373933_0176435 | 3300035724 | Bacteria | 1361 |
| 613 | Ga0373947_0020564 | 3300035725 | Bacteria | 3812 |
| 614 | Ga0373947_0067382 | 3300035725 | Bacteria | 2187 |
| 615 | Ga0373937_0002894 | 3300036401 | Bacteria | 14333 |
| 616 | Ga0373937_0016007 | 3300036401 | Bacteria | 6650 |
| 617 | Ga0373937_0310329 | 3300036401 | Bacteria | 1492 |
| 618 | Ga0373925_0051407 | 3300037068 | Bacteria | 3076 |
| 619 | Ga0395898_0056203 | 3300037466 | Bacteria | 3837 |
| 620 | Ga0395905_0023182 | 3300037471 | Bacteria | 5868 |
| 621 | Ga0395905_0105928 | 3300037471 | Bacteria | 2640 |
| 622 | Ga0436364_0614112 | 3300037853 | Bacteria | 3375 |
| 623 | Ga0436364_0681123 | 3300037853 | Bacteria | 1273 |
| 624 | Ga0436364_1528058 | 3300037853 | Bacteria | 40650 |
| 625 | Ga0436365_0644345 | 3300039437 | Bacteria | 5404 |
| 626 | Ga0436365_0955306 | 3300039437 | Bacteria | 2737 |
| 627 | Ga0436365_1031159 | 3300039437 | Bacteria | 3760 |
| 628 | Ga0436365_1682025 | 3300039437 | Bacteria | 1727 |
| 629 | Ga0436360_0317573 | 3300039438 | Bacteria | 6631 |
| 630 | Ga0436360_0388551 | 3300039438 | Bacteria | 8977 |
| 631 | Ga0436360_0416689 | 3300039438 | Bacteria | 3385 |
| 632 | Ga0436360_0810186 | 3300039438 | Bacteria | 6440 |
| 633 | Ga0436361_0677831 | 3300039447 | Bacteria | 16193 |
| 634 | Ga0436361_0968143 | 3300039447 | Bacteria | 5736 |
| 635 | Ga0436363_0628506 | 3300039450 | Bacteria | 2407 |
| 636 | Ga0436363_1221684 | 3300039450 | Bacteria | 2051 |
| 637 | Ga0436362_0287411 | 3300039453 | Bacteria | 6337 |
| 638 | Ga0436362_0443667 | 3300039453 | Bacteria | 3427 |
| 639 | Ga0436362_1180616 | 3300039453 | Bacteria | 5810 |
| 640 | Ga0451577_0058147 | 3300042876 | Bacteria | 3447 |
| 641 | Ga0466972_0021164 | 3300044658 | Bacteria | 3245 |
| 642 | Ga0466966_0000940 | 3300044684 | Bacteria | 18602 |
| 643 | Ga0466961_0000029 | 3300044693 | Bacteria | 86710 |
| 644 | Ga0453684_0006879 | 3300044712 | Bacteria | 21350 |
| 645 | Ga0453684_0048765 | 3300044712 | Bacteria | 5593 |
| 646 | Ga0453684_0144446 | 3300044712 | Bacteria | 2836 |
| 647 | Ga0466968_0040411 | 3300044735 | Bacteria | 1966 |
| 648 | Ga0466957_0103182 | 3300044842 | Bacteria | 1800 |
| 649 | Ga0466960_0121513 | 3300044901 | Bacteria | 1368 |
| 650 | Ga0466959_0004320 | 3300045049 | Bacteria | 9489 |
| 651 | Ga0466959_0078618 | 3300045049 | Bacteria | 2379 |
| 652 | Ga0451576_0002059 | 3300045051 | Bacteria | 31624 |
| 653 | Ga0451576_0118441 | 3300045051 | Bacteria | 2757 |
| 654 | Ga0466967_0506998 | 3300045976 | Bacteria | 1185 |
| 655 | Ga0495617_026863 | 3300046452 | Bacteria | 1938 |
| 656 | Ga0495592_0040011 | 3300046454 | Bacteria | 3519 |
| 657 | Ga0495592_0241155 | 3300046454 | Bacteria | 1199 |
| 658 | Ga0495603_0044000 | 3300046455 | Bacteria | 2664 |
| 659 | Ga0495603_0073486 | 3300046455 | Bacteria | 2009 |
| 660 | Ga0495591_020893 | 3300046458 | Bacteria | 2150 |
| 661 | Ga0495638_0000120 | 3300046460 | Bacteria | 127382 |
| 662 | Ga0495638_0013548 | 3300046460 | Bacteria | 5544 |
| 663 | Ga0495638_0085970 | 3300046460 | Bacteria | 1901 |
| 664 | Ga0495638_0200838 | 3300046460 | Bacteria | 1125 |
| 665 | Ga0495651_0030990 | 3300046462 | Bacteria | 4171 |
| 666 | Ga0495653_0032580 | 3300046463 | Bacteria | 4135 |
| 667 | Ga0495653_0097512 | 3300046463 | Bacteria | 2136 |
| 668 | Ga0495580_0036074 | 3300046472 | Bacteria | 3551 |
| 669 | Ga0495582_0063308 | 3300046473 | Bacteria | 2044 |
| 670 | Ga0495639_0014506 | 3300046475 | Bacteria | 3412 |
| 671 | Ga0495664_0002135 | 3300046477 | Bacteria | 10562 |
| 672 | Ga0495584_0009819 | 3300046491 | Bacteria | 4922 |
| 673 | Ga0495584_0026223 | 3300046491 | Bacteria | 2952 |
| 674 | Ga0495585_0005635 | 3300046492 | Bacteria | 7864 |
| 675 | Ga0495585_0010105 | 3300046492 | Bacteria | 5637 |
| 676 | Ga0495596_0010077 | 3300046500 | Bacteria | 4131 |
| 677 | Ga0495583_0014503 | 3300046506 | Bacteria | 4345 |
| 678 | Ga0495583_0076068 | 3300046506 | Bacteria | 1467 |
| 679 | Ga0495606_0043294 | 3300046507 | Bacteria | 3004 |
| 680 | Ga0495606_0077980 | 3300046507 | Bacteria | 2067 |
| 681 | Ga0495606_0088822 | 3300046507 | Bacteria | 1905 |
| 682 | Ga0495606_0178589 | 3300046507 | Bacteria | 1226 |
| 683 | Ga0495608_0019557 | 3300046511 | Bacteria | 4660 |
| 684 | Ga0495610_0020115 | 3300046512 | Bacteria | 3714 |
| 685 | Ga0495628_0312032 | 3300046516 | Bacteria | 1162 |
| 686 | Ga0495631_0021853 | 3300046518 | Bacteria | 2977 |
| 687 | Ga0495632_0077380 | 3300046519 | Bacteria | 1590 |
| 688 | Ga0495637_0006873 | 3300046520 | Bacteria | 5683 |
| 689 | Ga0495643_0007697 | 3300046522 | Bacteria | 6903 |
| 690 | Ga0495643_0057347 | 3300046522 | Bacteria | 2075 |
| 691 | Ga0495648_0040579 | 3300046524 | Bacteria | 2950 |
| 692 | Ga0495648_0042628 | 3300046524 | Bacteria | 2853 |
| 693 | Ga0495648_0061657 | 3300046524 | Bacteria | 2226 |
| 694 | Ga0495642_0022049 | 3300046528 | Bacteria | 2507 |
| 695 | Ga0495642_0024082 | 3300046528 | Bacteria | 2407 |
| 696 | Ga0495652_0033773 | 3300046529 | Bacteria | 4463 |
| 697 | Ga0495640_0082800 | 3300046533 | Bacteria | 2130 |
| 698 | Ga0495587_0012294 | 3300046536 | Bacteria | 5396 |
| 699 | Ga0495587_0052691 | 3300046536 | Bacteria | 2400 |
| 700 | Ga0495609_0010432 | 3300046538 | Bacteria | 4454 |
| 701 | Ga0495609_0054920 | 3300046538 | Bacteria | 1767 |
| 702 | Ga0495622_0013620 | 3300046557 | Bacteria | 3770 |
| 703 | Ga0495633_0026673 | 3300046558 | Bacteria | 2833 |
| 704 | Ga0495667_0006413 | 3300046559 | Bacteria | 7979 |
| 705 | Ga0495668_0084314 | 3300046616 | Bacteria | 1742 |
| 706 | Ga0495611_0031679 | 3300046648 | Bacteria | 2328 |
| 707 | Ga0495661_0001062 | 3300046665 | Bacteria | 24266 |
| 708 | Ga0495661_0059548 | 3300046665 | Bacteria | 2272 |
| 709 | Ga0495599_0051878 | 3300046678 | Bacteria | 2570 |
| 710 | Ga0495599_0059555 | 3300046678 | Bacteria | 2389 |
| 711 | Ga0495669_0084355 | 3300046684 | Bacteria | 1461 |
| 712 | Ga0495613_0121426 | 3300046689 | Bacteria | 1876 |
| 713 | Ga0495670_0011214 | 3300046691 | Bacteria | 4406 |
| 714 | Ga0495670_0028046 | 3300046691 | Bacteria | 2790 |
| 715 | Ga0495670_0045930 | 3300046691 | Bacteria | 2181 |
| 716 | Ga0495671_0096372 | 3300046692 | Bacteria | 1447 |
| 717 | Ga0495649_0112234 | 3300046694 | Bacteria | 1445 |
| 718 | Ga0495660_0034685 | 3300046810 | Bacteria | 2822 |
| 719 | Ga0495604_0212387 | 3300047317 | Bacteria | 1336 |
| 720 | Ga0495636_0020603 | 3300047318 | Bacteria | 2658 |
| 721 | Ga0495672_0006683 | 3300047320 | Bacteria | 8859 |
| 722 | Ga0495676_0100451 | 3300047321 | Bacteria | 2142 |
| 723 | Ga0495680_0040140 | 3300047322 | Bacteria | 3730 |
| 724 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 725 | Ga0495687_000007 | 3300047443 | Bacteria | 552679 |
| 726 | Ga0495687_006670 | 3300047443 | Bacteria | 7012 |
| 727 | Ga0495675_0021752 | 3300047444 | Bacteria | 4086 |
| 728 | Ga0495677_0018820 | 3300047445 | Bacteria | 2504 |
| 729 | Ga0495686_0086893 | 3300047472 | Bacteria | 1903 |
| 730 | Ga0495686_0148812 | 3300047472 | Bacteria | 1376 |
| 731 | Ga0495602_0009695 | 3300048088 | Bacteria | 10004 |
| 732 | Ga0495602_0020952 | 3300048088 | Bacteria | 6446 |
| 733 | Ga0495626_0003679 | 3300048091 | Bacteria | 9719 |
| 734 | Ga0495626_0048324 | 3300048091 | Bacteria | 1975 |
| 735 | Ga0495626_0086410 | 3300048091 | Bacteria | 1386 |
| 736 | Ga0496100_0084609 | 3300048903 | Bacteria | 2150 |
| 737 | Ga0496101_0047901 | 3300048904 | Bacteria | 3070 |
| 738 | Ga0496102_0019293 | 3300048905 | Bacteria | 6007 |
| 739 | Ga0496102_0279472 | 3300048905 | Bacteria | 1574 |
| 740 | Ga0496104_0071597 | 3300048907 | Bacteria | 3296 |
| 741 | Ga0496104_0087595 | 3300048907 | Bacteria | 2974 |
| 742 | Ga0496104_0271624 | 3300048907 | Bacteria | 1608 |
| 743 | Ga0496105_0019790 | 3300048908 | Bacteria | 5431 |
| 744 | Ga0496105_0123657 | 3300048908 | Bacteria | 2133 |
| 745 | Ga0496106_0043880 | 3300048909 | Bacteria | 3356 |
| 746 | Ga0496107_0096397 | 3300048910 | Bacteria | 2165 |
| 747 | Ga0496108_0013180 | 3300048911 | Bacteria | 6738 |
| 748 | Ga0496108_0024009 | 3300048911 | Bacteria | 5019 |
| 749 | Ga0496108_0041821 | 3300048911 | Bacteria | 3827 |
| 750 | Ga0496109_0009667 | 3300048912 | Bacteria | 8229 |
| 751 | Ga0496109_0054317 | 3300048912 | Bacteria | 3654 |
| 752 | Ga0496109_0063412 | 3300048912 | Bacteria | 3381 |
| 753 | Ga0496109_0091928 | 3300048912 | Bacteria | 2806 |
| 754 | Ga0496110_0001398 | 3300048913 | Bacteria | 17441 |
| 755 | Ga0496110_0008118 | 3300048913 | Bacteria | 8433 |
| 756 | Ga0496111_0118779 | 3300048914 | Bacteria | 1952 |
| 757 | Ga0496111_0235443 | 3300048914 | Bacteria | 1360 |
| 758 | Ga0496112_0000303 | 3300048915 | Bacteria | 31772 |
| 759 | Ga0496112_0041516 | 3300048915 | Bacteria | 4502 |
| 760 | Ga0496112_0072680 | 3300048915 | Bacteria | 3400 |
| 761 | Ga0496112_0081503 | 3300048915 | Bacteria | 3200 |
| 762 | Ga0496112_0140439 | 3300048915 | Bacteria | 2385 |
| 763 | Ga0496112_0289555 | 3300048915 | Bacteria | 1584 |
| 764 | Ga0496112_0395115 | 3300048915 | Bacteria | 1323 |
| 765 | Ga0496113_0001648 | 3300048916 | Bacteria | 12591 |
| 766 | Ga0496113_0006977 | 3300048916 | Bacteria | 7223 |
| 767 | Ga0496113_0053820 | 3300048916 | Bacteria | 3010 |
| 768 | Ga0496113_0173390 | 3300048916 | Bacteria | 1709 |
| 769 | Ga0496114_0074490 | 3300048917 | Bacteria | 2858 |
| 770 | Ga0496114_0224373 | 3300048917 | Bacteria | 1650 |
| 771 | Ga0496116_0020226 | 3300048919 | Bacteria | 5062 |
| 772 | Ga0496117_0126105 | 3300048920 | Bacteria | 1562 |
| 773 | Ga0496117_0133986 | 3300048920 | Bacteria | 1496 |
| 774 | Ga0496118_0035159 | 3300048921 | Bacteria | 4074 |
| 775 | Ga0496118_0127940 | 3300048921 | Bacteria | 1638 |
| 776 | Ga0496119_0011593 | 3300048922 | Bacteria | 7273 |
| 777 | Ga0496120_0036299 | 3300048923 | Bacteria | 2936 |
| 778 | Ga0496121_0037934 | 3300048924 | Bacteria | 4274 |
| 779 | Ga0496121_0077543 | 3300048924 | Bacteria | 2645 |
| 780 | Ga0496121_0137560 | 3300048924 | Bacteria | 1817 |
| 781 | Ga0496121_0169870 | 3300048924 | Bacteria | 1585 |
| 782 | Ga0496122_0000263 | 3300048925 | Bacteria | 117762 |
| 783 | Ga0496123_0000156 | 3300048926 | Bacteria | 139362 |
| 784 | Ga0496123_0105088 | 3300048926 | Bacteria | 1631 |
| 785 | Ga0496125_0000669 | 3300048928 | Bacteria | 57185 |
| 786 | Ga0496125_0089497 | 3300048928 | Bacteria | 2315 |
| 787 | Ga0496125_0118528 | 3300048928 | Bacteria | 1895 |
| 788 | Ga0496126_0004420 | 3300048929 | Bacteria | 16825 |
| 789 | Ga0496126_0125357 | 3300048929 | Bacteria | 2223 |
| 790 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 791 | Ga0501031_0129002 | 3300049568 | Bacteria | 1652 |
| 792 | Ga0501037_0110164 | 3300049573 | Bacteria | 1984 |
| 793 | Ga0501039_0000283 | 3300049575 | Bacteria | 36268 |
| 794 | Ga0501039_0122612 | 3300049575 | Bacteria | 2038 |
| 795 | Ga0501040_0173092 | 3300049576 | Bacteria | 1529 |
| 796 | Ga0501041_0046941 | 3300049577 | Bacteria | 2628 |
| 797 | Ga0501041_0060925 | 3300049577 | Bacteria | 2310 |
| 798 | Ga0501046_0254514 | 3300049580 | Bacteria | 1292 |
| 799 | Ga0501047_0189791 | 3300049581 | Bacteria | 1919 |
| 800 | Ga0501067_0152521 | 3300049583 | Bacteria | 1287 |
| 801 | Ga0501069_0051904 | 3300049585 | Bacteria | 2283 |
| 802 | Ga0501070_0127724 | 3300049586 | Bacteria | 2101 |
| 803 | Ga0501070_0288528 | 3300049586 | Bacteria | 1338 |
| 804 | Ga0501071_0014276 | 3300049587 | Bacteria | 5433 |
| 805 | Ga0501071_0126148 | 3300049587 | Bacteria | 1900 |
| 806 | Ga0501072_0069107 | 3300049588 | Bacteria | 2789 |
| 807 | Ga0501073_0153908 | 3300049589 | Bacteria | 1594 |
| 808 | Ga0501075_0029889 | 3300049591 | Bacteria | 4031 |
| 809 | Ga0501075_0072927 | 3300049591 | Bacteria | 2596 |
| 810 | Ga0501075_0092849 | 3300049591 | Bacteria | 2291 |
| 811 | Ga0501076_0161674 | 3300049592 | Bacteria | 1824 |
| 812 | Ga0501077_0006410 | 3300049593 | Bacteria | 7219 |
| 813 | Ga0501079_0015574 | 3300049741 | Bacteria | 5805 |
| 814 | Ga0501079_0042049 | 3300049741 | Bacteria | 3529 |
| 815 | Ga0501080_0066607 | 3300049742 | Bacteria | 3350 |
| 816 | Ga0501080_0235204 | 3300049742 | Bacteria | 1674 |
| 817 | Ga0501080_0326321 | 3300049742 | Bacteria | 1389 |
| 818 | Ga0501081_0005064 | 3300049743 | Bacteria | 8482 |
| 819 | Ga0501081_0079630 | 3300049743 | Bacteria | 2291 |
| 820 | Ga0501083_0057202 | 3300049744 | Bacteria | 2611 |
| 821 | Ga0501044_0110482 | 3300049823 | Bacteria | 2758 |
| 822 | Ga0501045_0009339 | 3300049824 | Bacteria | 6856 |
| 823 | Ga0501045_0023327 | 3300049824 | Bacteria | 4435 |
| 824 | nmdc:mga03n38_20423_c1 | 3300050490 | Bacteria | 2649 |
| 825 | nmdc:mga0yw44_102492_c1 | 3300050492 | Bacteria | 1825 |
| 826 | nmdc:mga0yw44_53338_c1 | 3300050492 | Bacteria | 2455 |
| 827 | nmdc:mga0k408_78158_c1 | 3300050493 | Bacteria | 1935 |
| 828 | nmdc:mga0k408_8341_c1 | 3300050493 | Bacteria | 3906 |
| 829 | nmdc:mga06z11_122218_c1 | 3300050494 | Bacteria | 1454 |
| 830 | nmdc:mga06z11_68410_c1 | 3300050494 | Bacteria | 1872 |
| 831 | nmdc:mga07m45_2281_c1 | 3300050496 | Bacteria | 8962 |
| 832 | nmdc:mga05p37_15057_c1 | 3300050507 | Bacteria | 9285 |
| 833 | nmdc:mga05p37_419_c1 | 3300050507 | Bacteria | 45960 |
| 834 | nmdc:mga05p37_626911_c1 | 3300050507 | Bacteria | 1209 |
| 835 | nmdc:mga09592_13357_c1 | 3300050508 | Bacteria | 6706 |
| 836 | nmdc:mga09592_570_c1 | 3300050508 | Bacteria | 27977 |
| 837 | nmdc:mga0qj67_24041_c1 | 3300050509 | Bacteria | 4694 |
| 838 | nmdc:mga06r32_282001_c1 | 3300050510 | Bacteria | 1648 |
| 839 | nmdc:mga06r32_453_c1 | 3300050510 | Bacteria | 34927 |
| 840 | nmdc:mga08y16_174204_c1 | 3300050511 | Bacteria | 2234 |
| 841 | nmdc:mga08y16_212080_c1 | 3300050511 | Bacteria | 2005 |
| 842 | nmdc:mga08y16_244165_c1 | 3300050511 | Bacteria | 1856 |
| 843 | nmdc:mga08y16_6524_c1 | 3300050511 | Bacteria | 12238 |
| 844 | nmdc:mga08y16_66925_c1 | 3300050511 | Bacteria | 3749 |
| 845 | nmdc:mga08y16_93505_c1 | 3300050511 | Bacteria | 3132 |
| 846 | nmdc:mga0n895_128971_c1 | 3300050512 | Bacteria | 2553 |
| 847 | nmdc:mga0n895_18279_c1 | 3300050512 | Bacteria | 6482 |
| 848 | nmdc:mga0n895_34229_c1 | 3300050512 | Bacteria | 4888 |
| 849 | nmdc:mga0n895_36728_c1 | 3300050512 | Bacteria | 4733 |
| 850 | nmdc:mga0n895_60365_c1 | 3300050512 | Bacteria | 3741 |
| 851 | nmdc:mga0n895_84586_c1 | 3300050512 | Bacteria | 3165 |
| 852 | nmdc:mga0rr50_107347_c1 | 3300050513 | Bacteria | 2204 |
| 853 | nmdc:mga0rr50_8400_c1 | 3300050513 | Bacteria | 6426 |
| 854 | nmdc:mga0rr50_86200_c1 | 3300050513 | Bacteria | 2435 |
| 855 | nmdc:mga0a205_11336_c1 | 3300050515 | Bacteria | 8205 |
| 856 | nmdc:mga0a205_11653_c1 | 3300050515 | Bacteria | 8106 |
| 857 | nmdc:mga0sz30_11356_c1 | 3300050516 | Bacteria | 3437 |
| 858 | nmdc:mga0sz30_18242_c1 | 3300050516 | Bacteria | 2807 |
| 859 | Ga0495601_0000429 | 3300053077 | Bacteria | 22002 |
| 860 | Ga0500643_000037 | 3300053087 | Bacteria | 180821 |
| 861 | Ga0500646_0002806 | 3300053090 | Bacteria | 4477 |
| 862 | Ga0500646_0008598 | 3300053090 | Bacteria | 2614 |
| 863 | Ga0500583_0001825 | 3300053092 | Bacteria | 6241 |
| 864 | Ga0500651_0144840 | 3300053093 | Bacteria | 1429 |
| 865 | Ga0500566_0001075 | 3300053094 | Bacteria | 15832 |
| 866 | Ga0500566_0003368 | 3300053094 | Bacteria | 9543 |
| 867 | Ga0500566_0003623 | 3300053094 | Bacteria | 9214 |
| 868 | Ga0500555_001855 | 3300053103 | Bacteria | 6292 |
| 869 | Ga0500555_030707 | 3300053103 | Bacteria | 1524 |
| 870 | Ga0500555_035827 | 3300053103 | Bacteria | 1393 |
| 871 | Ga0500556_0054338 | 3300053104 | Bacteria | 1458 |
| 872 | Ga0500557_000047 | 3300053105 | Bacteria | 59226 |
| 873 | Ga0500569_000518 | 3300053109 | Bacteria | 6434 |
| 874 | Ga0500572_016523 | 3300053111 | Bacteria | 1881 |
| 875 | Ga0500595_006884 | 3300053119 | Bacteria | 4776 |
| 876 | Ga0500595_026598 | 3300053119 | Bacteria | 1992 |
| 877 | Ga0500595_027317 | 3300053119 | Bacteria | 1955 |
| 878 | Ga0500607_012500 | 3300053121 | Bacteria | 4980 |
| 879 | Ga0500607_141798 | 3300053121 | Bacteria | 1129 |
| 880 | Ga0500608_064472 | 3300053122 | Bacteria | 1748 |
| 881 | Ga0500642_0001382 | 3300053130 | Bacteria | 6957 |
| 882 | Ga0500658_0031714 | 3300053134 | Bacteria | 2069 |
| 883 | Ga0500658_0049478 | 3300053134 | Bacteria | 1713 |
| 884 | Ga0500559_0012586 | 3300053136 | Bacteria | 3591 |
| 885 | Ga0500561_0010738 | 3300053137 | Bacteria | 1903 |
| 886 | Ga0500568_0000101 | 3300053139 | Bacteria | 78689 |
| 887 | Ga0500568_0002259 | 3300053139 | Bacteria | 11514 |
| 888 | Ga0500568_0018020 | 3300053139 | Bacteria | 3102 |
| 889 | Ga0500573_0000009 | 3300053140 | Bacteria | 230823 |
| 890 | Ga0500577_0078290 | 3300053142 | Bacteria | 1312 |
| 891 | Ga0500603_002543 | 3300053150 | Bacteria | 3988 |
| 892 | Ga0500604_0003284 | 3300053151 | Bacteria | 4353 |
| 893 | Ga0500604_0020075 | 3300053151 | Bacteria | 1877 |
| 894 | Ga0500616_0001091 | 3300053153 | Bacteria | 28214 |
| 895 | Ga0500616_0023355 | 3300053153 | Bacteria | 3445 |
| 896 | Ga0500622_0028910 | 3300053156 | Bacteria | 2917 |
| 897 | Ga0500624_006581 | 3300053157 | Bacteria | 1577 |
| 898 | Ga0500627_0051817 | 3300053158 | Bacteria | 1791 |
| 899 | Ga0500630_005372 | 3300053159 | Bacteria | 6249 |
| 900 | Ga0500630_032312 | 3300053159 | Bacteria | 2570 |
| 901 | Ga0500638_055522 | 3300053162 | Bacteria | 1909 |
| 902 | Ga0500639_009086 | 3300053163 | Bacteria | 5186 |
| 903 | Ga0500636_0004313 | 3300053177 | Bacteria | 8046 |
| 904 | Ga0500637_0047261 | 3300053178 | Bacteria | 2444 |
| 905 | Ga0500649_042905 | 3300053722 | Bacteria | 1906 |
| 906 | Ga0500625_011953 | 3300053729 | Bacteria | 3960 |
| 907 | Ga0500645_013978 | 3300053730 | Bacteria | 2567 |
| 908 | Ga0500596_001342 | 3300053735 | Bacteria | 4965 |
| 909 | Ga0500596_001805 | 3300053735 | Bacteria | 4302 |
| 910 | Ga0500596_006217 | 3300053735 | Bacteria | 2040 |
| 911 | Ga0500599_004175 | 3300053736 | Bacteria | 1782 |
| 912 | Ga0500601_000279 | 3300053737 | Bacteria | 9696 |
| 913 | Ga0501084_0008888 | 3300054114 | Bacteria | 8313 |
| 914 | Ga0501082_0000013 | 3300060353 | Bacteria | 119623 |
| 915 | Ga0530510_0088737 | 3300061734 | Bacteria | 2254 |
| 916 | 2507510361 | 2507262055 | Bacteria | 8048963 |
| 917 | 2509153158 | 2508501128 | Bacteria | 8613869 |
| 918 | 2513627334 | 2513237092 | Bacteria | 8341956 |
| 919 | 2513640245 | 2513237094 | Bacteria | 8789602 |
| 920 | 2513648649 | 2513237095 | Bacteria | 8976980 |
| 921 | 2513661231 | 2513237096 | Bacteria | 8722461 |
| 922 | 2513674752 | 2513237098 | Bacteria | 9902361 |
| 923 | 2513693595 | 2513237101 | Bacteria | 7952346 |
| 924 | 2513704234 | 2513237102 | Bacteria | 7703324 |
| 925 | 2513715931 | 2513237104 | Bacteria | 10034502 |
| 926 | 2513862297 | 2513237137 | Bacteria | 9558895 |
| 927 | 2513893805 | 2513237141 | Bacteria | 8496279 |
| 928 | 2513922951 | 2513237145 | Bacteria | 8979722 |
| 929 | 2517105562 | 2517093001 | Bacteria | 9002274 |
| 930 | 2517894270 | 2517572143 | Bacteria | 9484767 |
| 931 | 2524442069 | 2524023205 | Bacteria | 8918781 |
| 932 | 2524469042 | 2524023210 | Bacteria | 9029266 |
| 933 | 2524535696 | 2524023228 | Bacteria | 10118060 |
| 934 | 2528852339 | 2528768022 | Bacteria | 10457665 |
| 935 | 2586061747 | 2585427649 | Bacteria | 9053857 |
| 936 | 2617378663 | 2617270741 | Bacteria | 8201522 |
| 937 | 2623589474 | 2622736626 | Bacteria | 7181580 |
| 938 | 2671124026 | 2667528175 | Bacteria | 7532676 |
| 939 | 2723847477 | 2721755755 | Bacteria | 8322773 |
| 940 | 2745076078 | 2744054633 | Bacteria | 8678936 |
| 941 | 2793073959 | 2791355197 | Bacteria | 8420563 |
| 942 | 2793081497 | |||
| 943 | 2809590392 | 2808606522 | Bacteria | 9488490 |
| 944 | 2818241936 | 2816332527 | Bacteria | 8933356 |
| 945 | 2824603875 | 2824600985 | Bacteria | 8488197 |
| 946 | 2824612516 | 2824609381 | Bacteria | 8672835 |
| 947 | 2824655653 | 2824653114 | Bacteria | 8493680 |
| 948 | 2824668873 | 2824661429 | Bacteria | 9877870 |
| 949 | 2824680044 | 2824679649 | Bacteria | 8248951 |
| 950 | 2824710021 | 2824704595 | Bacteria | 9667483 |
| 951 | 2824733710 | 2824732956 | Bacteria | 7810675 |
| 952 | 2824747931 | 2824746037 | Bacteria | 7911610 |
| 953 | 2824755279 | 2824753945 | Bacteria | 9787441 |
| 954 | 2824772157 | 2824763712 | Bacteria | 9792355 |
| 955 | 2841959113 | 2841957949 | Bacteria | 8652217 |
| 956 | 2842045144 | 2842038055 | Bacteria | 8002051 |
| 957 | 2842049195 | 2842045827 | Bacteria | 8006841 |
| 958 | 2847934175 | 2847930680 | Bacteria | 9342022 |
| 959 | 2857516176 | 2857509624 | Bacteria | 7472071 |
| 960 | 2874611457 | 2874604998 | Bacteria | 7834745 |
| 961 | 2874612900 | 2874612657 | Bacteria | 8252029 |
| 962 | 2874625111 | 2874620515 | Bacteria | 8290088 |
| 963 | 2874634770 | 2874628541 | Bacteria | 8630250 |
| 964 | 2876769435 | 2876761206 | Bacteria | 10111113 |
| 965 | 2876817085 | 2876808645 | Bacteria | 8824342 |
| 966 | 2879086840 | 2879083081 | Bacteria | 8587928 |
| 967 | 2879117530 | 2879110137 | Bacteria | 8907982 |
| 968 | 2881369159 | 2881364244 | Bacteria | 7710352 |
| 969 | 2881667595 | 2881665667 | Bacteria | 8175609 |
| 970 | 2883577127 | 2883577096 | Bacteria | 4709178 |
| 971 | 2884698054 | 2884693830 | Bacteria | 11273186 |
| 972 | 2885367460 | 2885366525 | Bacteria | 8326213 |
| 973 | 2885376783 | 2885374607 | Bacteria | 8927485 |
| 974 | 2888382058 | 2888378607 | Bacteria | 9652610 |
| 975 | 2888422668 | 2888419890 | Bacteria | 7857137 |
| 976 | 2889042194 | 2889033259 | Bacteria | 9099371 |
| 977 | 2894772483 | 2894772417 | Bacteria | 5305674 |
| 978 | 2895445114 | 2895442618 | Bacteria | 11027144 |
| 979 | 2903751563 | 2903748898 | Bacteria | 9972761 |
| 980 | 2904666887 | 2904666416 | Bacteria | 8226587 |
| 981 | 2904697269 | 2904690495 | Bacteria | 9412302 |
| 982 | 2904705412 | |||
| 983 | 2904717764 | 2904711408 | Bacteria | 9771557 |
| 984 | 2906611096 | |||
| 985 | 2906626511 | 2906626472 | Bacteria | 8826946 |
| 986 | 2906641263 | 2906635258 | Bacteria | 8601019 |
| 987 | 2906648121 | 2906643746 | Bacteria | 8722424 |
| 988 | 2906667556 | 2906660503 | Bacteria | 8595048 |
| 989 | 2908744612 | 2908739725 | Bacteria | 8628932 |
| 990 | 2908762232 | 2908756301 | Bacteria | 8864324 |
| 991 | 2908778304 | 2908775508 | Bacteria | 8092255 |
| 992 | 2912764486 | 2912757875 | Bacteria | 7940295 |
| 993 | 2915774408 | 2915768154 | Bacteria | 8424322 |
| 994 | 2922372098 | |||
| 995 | 2922390574 | 2922386360 | Bacteria | 7017218 |
| 996 | 2922399257 | 2922393267 | Bacteria | 8285685 |
| 997 | 2922428218 | |||
| 998 | 2929616658 | 2929615660 | Bacteria | 9193770 |
| 999 | 2929625402 | 2929624759 | Bacteria | 9339455 |
| 1000 | 2932792170 | 2932784394 | Bacteria | 9704911 |
| 1001 | 2932798813 | 2932794094 | Bacteria | 7915132 |
| 1002 | 2932803583 | 2932801729 | Bacteria | 7987968 |
| 1003 | 2932814463 | 2932809354 | Bacteria | 9135765 |
| 1004 | 2932824550 | 2932818245 | Bacteria | 9955613 |
| 1005 | 2932837339 | 2932828146 | Bacteria | 9745859 |
| 1006 | 2933578059 | 2933577622 | Bacteria | 9116884 |
| 1007 | 2935623422 | 2935616580 | Bacteria | 9032984 |
| 1008 | 2935637345 | 2935630451 | Bacteria | 8169952 |
| 1009 | 2935646829 | 2935638405 | Bacteria | 10015038 |
| 1010 | 2935672748 | 2935665750 | Bacteria | 9571747 |
| 1011 | 2935684468 | 2935675223 | Bacteria | 9928132 |
| 1012 | 2935692069 | 2935684952 | Bacteria | 9590419 |
| 1013 | 2935694994 | 2935694250 | Bacteria | 9291695 |
| 1014 | 2935707905 | 2935703347 | Bacteria | 10242284 |
| 1015 | 2935721908 | 2935713505 | Bacteria | 9608509 |
| 1016 | 2935731094 | 2935722832 | Bacteria | 9608746 |
| 1017 | 2935739044 | 2935732158 | Bacteria | 9706831 |
| 1018 | 2935747771 | 2935741537 | Bacteria | 9707219 |
| 1019 | 2935756355 | 2935750917 | Bacteria | 9590372 |
| 1020 | 2935761676 | 2935760218 | Bacteria | 9817913 |
| 1021 | 2935774353 | 2935769743 | Bacteria | 7878163 |
| 1022 | 2935782759 | 2935777560 | Bacteria | 8077691 |
| 1023 | 2935793415 | 2935785616 | Bacteria | 7962367 |
| 1024 | 2935801245 | 2935793552 | Bacteria | 8012592 |
| 1025 | 2935810362 | 2935801545 | Bacteria | 9301974 |
| 1026 | 2935819546 | 2935810662 | Bacteria | 9401221 |
| 1027 | 2935836096 | 2935827899 | Bacteria | 10038562 |
| 1028 | 2935845028 | 2935837841 | Bacteria | 9454360 |
| 1029 | 2935861578 | 2935855204 | Bacteria | 9035059 |
| 1030 | 2935881489 | 2935873716 | Bacteria | 9632195 |
| 1031 | 2935887798 | 2935883170 | Bacteria | 7964738 |
| 1032 | 2935963614 | 2935959822 | Bacteria | 7869783 |
| 1033 | 2936001565 | 2935992306 | Bacteria | 9802711 |
| 1034 | 2936005356 | 2936002035 | Bacteria | 9362176 |
| 1035 | 2936046313 | 2936037263 | Bacteria | 9446081 |
| 1036 | 2940562269 | 2940556831 | Bacteria | 9590747 |
| 1037 | 2941513923 | 2941507105 | Bacteria | 8166816 |
| 1038 | 2941521884 | 2941515067 | Bacteria | 8166720 |
| 1039 | 2941529553 | 2941523033 | Bacteria | 8169134 |
| 1040 | 2941535179 | 2941531003 | Bacteria | 7653939 |
| 1041 | 2941546763 | 2941538514 | Bacteria | 9402094 |
| 1042 | 2996228354 | 2996221748 | Bacteria | 6799777 |
| 1043 | 3005478203 | 3005474847 | Bacteria | 9259049 |
| 1044 | 3005489703 | 3005483717 | Bacteria | 7877331 |
| 1045 | 3005593620 | 3005587118 | Bacteria | 7794411 |
| 1046 | 3005597103 | 3005594810 | Bacteria | 8716512 |
| 1047 | 3005713125 | 3005710791 | Bacteria | 7622528 |
| 1048 | 8006943013 | 8006933436 | Bacteria | 10410654 |
| 1049 | 8006970197 | 8006964411 | Bacteria | 8966052 |
| 1050 | 8006982809 | 8006973647 | Bacteria | 10679141 |
| 1051 | 8006985476 | 8006984368 | Bacteria | 9651211 |
| 1052 | 8006994479 | 8006994254 | Bacteria | 8309700 |
| 1053 | 8016515580 | 8016511872 | Bacteria | 9921665 |
| 1054 | 8016523245 | 8016522445 | Bacteria | 8156687 |
| 1055 | 8016536732 | 8016530956 | Bacteria | 8155261 |
| 1056 | 8016541011 | 8016539877 | Bacteria | 8155419 |
| 1057 | 8016552242 | 8016548790 | Bacteria | 8155074 |
| 1058 | 8016566394 | 8016566248 | Bacteria | 8158151 |
| 1059 | 8016579145 | 8016575299 | Bacteria | 8154085 |
| 1060 | 8016590427 | 8016583857 | Bacteria | 10421953 |
| 1061 | 8016598516 | 8016595262 | Bacteria | 8149947 |
| 1062 | 8016612613 | 8016603502 | Bacteria | 8731218 |
| 1063 | 8016621205 | 8016613128 | Bacteria | 8794220 |
| 1064 | 8016628800 | 8016622563 | Bacteria | 7999408 |
| 1065 | 8017060912 | 8017057580 | Bacteria | 10023680 |
| 1066 | 8019543016 | 8019538911 | Bacteria | 7872763 |
| 1067 | 8019547720 | 8019547302 | Bacteria | 7996444 |
| 1068 | 8019558831 | 8019555841 | Bacteria | 9642137 |
| 1069 | 8019566478 | 8019565922 | Bacteria | 9639779 |
| 1070 | 8019580370 | 8019576017 | Bacteria | 10049540 |
| 1071 | 8019588093 | 8019586578 | Bacteria | 10212056 |
| 1072 | 8019603247 | 8019597564 | Bacteria | 10041141 |
| 1073 | 8019643225 | 8019638758 | Bacteria | 9062356 |
| 1074 | 8019656081 | 8019648815 | Bacteria | 10014479 |
| 1075 | 8055748304 | 8055742211 | Bacteria | 9226248 |
| 1076 | 8056681210 | 8056673599 | Bacteria | 7871253 |
| 1077 | 8056684332 | 8056681323 | Bacteria | 8472857 |
| 1078 | Ga0500645_034405 | |||
| 1079 | JGI25151J46595_10000304 | |||
| 1080 | JGI25151J46595_10000631 | |||
| 1081 | JGI25153J46596_10002594 | |||
| 1082 | JGI25153J46596_10006592 | |||
| 1083 | JGI25160J50197_1008713 | |||
| 1084 | JGI25407J50210_10028083 | |||
| 1085 | JGI25404J52841_10002130 | |||
| 1086 | Ga0055535_1000449 | |||
| 1087 | Ga0055542_1000021 | |||
| 1088 | Ga0055526_1000274 | |||
| 1089 | Ga0055543_1002331 | |||
| 1090 | Ga0058861_11860130 | |||
| 1091 | Ga0058862_12887444 | |||
| 1092 | Ga0065165_1000387 | |||
| 1093 | Ga0065714_10079457 | |||
| 1094 | Ga0065712_10074830 | |||
| 1095 | Ga0065715_10003511 | |||
| 1096 | Ga0070658_10020638 | |||
| 1097 | Ga0070658_10048661 | |||
| 1098 | Ga0070676_10014697 | |||
| 1099 | Ga0070683_100002543 | |||
| 1100 | Ga0070683_100014342 | |||
| 1101 | Ga0070683_100074896 | |||
| 1102 | Ga0070690_100022827 | |||
| 1103 | Ga0070670_100001672 | |||
| 1104 | Ga0070670_100003550 | |||
| 1105 | Ga0070677_10011450 | |||
| 1106 | Ga0070677_10044447 | |||
| 1107 | Ga0068869_100007127 | |||
| 1108 | Ga0070666_10033193 | |||
| 1109 | Ga0070666_10035624 | |||
| 1110 | Ga0070680_100003205 | |||
| 1111 | Ga0070680_100120419 | |||
| 1112 | Ga0070680_100121432 | |||
| 1113 | Ga0068868_100000732 | |||
| 1114 | Ga0068868_100003524 | |||
| 1115 | Ga0068868_100021095 | |||
| 1116 | Ga0068868_100102554 | |||
| 1117 | Ga0068868_100193480 | |||
| 1118 | Ga0070660_100001026 | |||
| 1119 | Ga0070660_100043859 | |||
| 1120 | Ga0070661_100000659 | |||
| 1121 | Ga0070661_100001562 | |||
| 1122 | Ga0070661_100006984 | |||
| 1123 | Ga0070661_100098337 | |||
| 1124 | Ga0070692_10084268 | |||
| 1125 | Ga0070668_100007414 | |||
| 1126 | Ga0070668_100089465 | |||
| 1127 | Ga0070668_100097333 | |||
| 1128 | Ga0070668_100134901 | |||
| 1129 | Ga0070669_100008959 | |||
| 1130 | Ga0070669_100077945 | |||
| 1131 | Ga0070675_100000909 | |||
| 1132 | Ga0070675_100003113 | |||
| 1133 | Ga0070671_100000836 | |||
| 1134 | Ga0070671_100003711 | |||
| 1135 | Ga0070671_100048347 | |||
| 1136 | Ga0070671_100120512 | |||
| 1137 | Ga0070671_100303358 | |||
| 1138 | Ga0070674_100014087 | |||
| 1139 | Ga0070673_100000415 | |||
| 1140 | Ga0070673_100077331 | |||
| 1141 | Ga0070673_100084649 | |||
| 1142 | Ga0070659_100013383 | |||
| 1143 | Ga0070659_100107845 | |||
| 1144 | Ga0070659_100133981 | |||
| 1145 | Ga0070667_100001323 | |||
| 1146 | Ga0070667_100011922 | |||
| 1147 | Ga0070667_100040845 | |||
| 1148 | Ga0070709_10001625 | |||
| 1149 | Ga0070709_10005194 | |||
| 1150 | Ga0070709_10048202 | |||
| 1151 | Ga0070714_100001230 | |||
| 1152 | Ga0070714_100049268 | |||
| 1153 | Ga0070714_100052864 | |||
| 1154 | Ga0070713_100057831 | |||
| 1155 | Ga0070713_100209287 | |||
| 1156 | Ga0070710_10001955 | |||
| 1157 | Ga0070711_100000864 | |||
| 1158 | Ga0070711_100020766 | |||
| 1159 | Ga0070711_100033716 | |||
| 1160 | Ga0070711_100079974 | |||
| 1161 | Ga0070700_100003662 | |||
| 1162 | Ga0070700_100048678 | |||
| 1163 | Ga0070708_100000447 | |||
| 1164 | Ga0070663_100126611 | |||
| 1165 | Ga0070663_100138257 | |||
| 1166 | Ga0070678_100000308 | |||
| 1167 | Ga0070678_100011586 | |||
| 1168 | Ga0070678_100055577 | |||
| 1169 | Ga0070662_100003497 | |||
| 1170 | Ga0070662_100090113 | |||
| 1171 | Ga0070681_10000556 | |||
| 1172 | Ga0070681_10011881 | |||
| 1173 | Ga0070681_10012768 | |||
| 1174 | Ga0070681_10032524 | |||
| 1175 | Ga0070681_10058628 | |||
| 1176 | Ga0070681_10065786 | |||
| 1177 | Ga0068867_100002001 | |||
| 1178 | Ga0068867_100005583 | |||
| 1179 | Ga0068867_100021754 | |||
| 1180 | Ga0068867_100147418 | |||
| 1181 | Ga0068867_100153725 | |||
| 1182 | Ga0070706_100008748 | |||
| 1183 | Ga0070707_100087854 | |||
| 1184 | Ga0070698_100056495 | |||
| 1185 | Ga0070698_100228974 | |||
| 1186 | Ga0070679_100000724 | |||
| 1187 | Ga0070679_100012464 | |||
| 1188 | Ga0070679_100014399 | |||
| 1189 | Ga0070679_100039481 | |||
| 1190 | Ga0070684_100042424 | |||
| 1191 | Ga0068853_100010070 | |||
| 1192 | Ga0068853_100018013 | |||
| 1193 | Ga0068853_100393010 | |||
| 1194 | Ga0070672_100000177 | |||
| 1195 | Ga0070672_100000186 | |||
| 1196 | Ga0070672_100085759 | |||
| 1197 | Ga0070672_100149660 | |||
| 1198 | Ga0070696_100112145 | |||
| 1199 | Ga0070665_100004123 | |||
| 1200 | Ga0070665_100019233 | |||
| 1201 | Ga0070665_100038817 | |||
| 1202 | Ga0070665_100039261 | |||
| 1203 | Ga0070665_100067737 | |||
| 1204 | Ga0070704_100086079 | |||
| 1205 | Ga0070704_100267632 | |||
| 1206 | Ga0068855_100007555 | |||
| 1207 | Ga0068855_100017631 | |||
| 1208 | Ga0068855_100245709 | |||
| 1209 | Ga0070664_100000157 | |||
| 1210 | Ga0070664_100001930 | |||
| 1211 | Ga0070664_100086346 | |||
| 1212 | Ga0068857_100002118 | |||
| 1213 | Ga0068857_100053287 | |||
| 1214 | Ga0068857_100090846 | |||
| 1215 | Ga0068854_100002001 | |||
| 1216 | Ga0068854_100025797 | |||
| 1217 | Ga0068854_100043871 | |||
| 1218 | Ga0068854_100072435 | |||
| 1219 | Ga0068856_100003357 | |||
| 1220 | Ga0068856_100095788 | |||
| 1221 | Ga0068852_100000221 | |||
| 1222 | Ga0068852_100000826 | |||
| 1223 | Ga0068852_100016450 | |||
| 1224 | Ga0068852_100027970 | |||
| 1225 | Ga0068852_100187497 | |||
| 1226 | Ga0068859_100102420 | |||
| 1227 | Ga0068864_100024601 | |||
| 1228 | Ga0068864_100060153 | |||
| 1229 | Ga0068864_100068763 | |||
| 1230 | Ga0068864_100075383 | |||
| 1231 | Ga0068861_100006231 | |||
| 1232 | Ga0068861_100019550 | |||
| 1233 | Ga0068861_100073735 | |||
| 1234 | Ga0068851_10093005 | |||
| 1235 | Ga0068863_100003043 | |||
| 1236 | Ga0068863_100048937 | |||
| 1237 | Ga0068863_100051594 | |||
| 1238 | Ga0068863_100138175 | |||
| 1239 | Ga0068863_100292326 | |||
| 1240 | Ga0068858_100016214 | |||
| 1241 | Ga0068858_100032450 | |||
| 1242 | Ga0068858_100033479 | |||
| 1243 | Ga0068860_100014528 | |||
| 1244 | Ga0068860_100042534 | |||
| 1245 | Ga0068862_100007699 | |||
| 1246 | Ga0068862_100030313 | |||
| 1247 | Ga0068862_100062781 | |||
| 1248 | Ga0081455_10004548 | |||
| 1249 | Ga0081455_10007292 | |||
| 1250 | Ga0081455_10008955 | |||
| 1251 | Ga0081455_10080131 | |||
| 1252 | Ga0081538_10003622 | |||
| 1253 | Ga0081540_1000745 | |||
| 1254 | Ga0081540_1003399 | |||
| 1255 | Ga0081540_1006214 | |||
| 1256 | Ga0081540_1009249 | |||
| 1257 | Ga0081540_1010444 | |||
| 1258 | Ga0081540_1013078 | |||
| 1259 | Ga0081540_1014387 | |||
| 1260 | Ga0081540_1022848 | |||
| 1261 | Ga0081540_1031419 | |||
| 1262 | Ga0081540_1034982 | |||
| 1263 | Ga0081539_10027525 | |||
| 1264 | Ga0075368_10000198 | |||
| 1265 | Ga0075363_100028435 | |||
| 1266 | Ga0070715_10066040 | |||
| 1267 | Ga0070716_100018886 | |||
| 1268 | Ga0070712_100089096 | |||
| 1269 | Ga0070712_100138991 | |||
| 1270 | Ga0075367_10015991 | |||
| 1271 | Ga0097621_100000202 | |||
| 1272 | Ga0097621_100025322 | |||
| 1273 | Ga0097621_100035686 | |||
| 1274 | Ga0097621_100152815 | |||
| 1275 | Ga0075370_10023535 | |||
| 1276 | Ga0075370_10050736 | |||
| 1277 | Ga0068871_100000840 | |||
| 1278 | Ga0068871_100071907 | |||
| 1279 | Ga0068871_100113418 | |||
| 1280 | Ga0075428_100000580 | |||
| 1281 | Ga0075428_100067152 | |||
| 1282 | Ga0075430_100028026 | |||
| 1283 | Ga0075431_100000518 | |||
| 1284 | Ga0075433_10008386 | |||
| 1285 | Ga0075433_10305129 | |||
| 1286 | Ga0075434_100039202 | |||
| 1287 | Ga0075429_100005751 | |||
| 1288 | Ga0075429_100104260 | |||
| 1289 | Ga0068865_100069910 | |||
| 1290 | Ga0068865_100073297 | |||
| 1291 | Ga0068865_100077599 | |||
| 1292 | Ga0075436_100211176 | |||
| 1293 | Ga0097620_100102431 | |||
| 1294 | Ga0099825_1035458 | |||
| 1295 | Ga0099824_1016897 | |||
| 1296 | Ga0075435_100012082 | |||
| 1297 | Ga0075435_100106968 | |||
| 1298 | Ga0075435_100128943 | |||
| 1299 | Ga0075435_100157609 | |||
| 1300 | Ga0075435_100170271 | |||
| 1301 | Ga0105240_10001724 | |||
| 1302 | Ga0105240_10007858 | |||
| 1303 | Ga0105240_10010644 | |||
| 1304 | Ga0105240_10341283 | |||
| 1305 | Ga0105240_10402506 | |||
| 1306 | Ga0111539_10000651 | |||
| 1307 | Ga0111539_10061654 | |||
| 1308 | Ga0111539_10437085 | |||
| 1309 | Ga0105245_10007672 | |||
| 1310 | Ga0105245_10025858 | |||
| 1311 | Ga0105245_10026441 | |||
| 1312 | Ga0105245_10031273 | |||
| 1313 | Ga0105245_10102254 | |||
| 1314 | Ga0114129_10000505 | |||
| 1315 | Ga0114129_10003700 | |||
| 1316 | Ga0114129_10019741 | |||
| 1317 | Ga0114129_10131325 | |||
| 1318 | Ga0114129_10165612 | |||
| 1319 | Ga0105241_10054338 | |||
| 1320 | Ga0105241_10072385 | |||
| 1321 | Ga0105241_10142475 | |||
| 1322 | Ga0105241_10188774 | |||
| 1323 | Ga0105242_10005776 | |||
| 1324 | Ga0105242_10055417 | |||
| 1325 | Ga0105248_10022137 | |||
| 1326 | Ga0105248_10083121 | |||
| 1327 | Ga0105248_10208068 | |||
| 1328 | Ga0105248_10233089 | |||
| 1329 | Ga0105248_10469087 | |||
| 1330 | Ga0105237_10006524 | |||
| 1331 | Ga0105237_10091157 | |||
| 1332 | Ga0105238_10000203 | |||
| 1333 | Ga0105238_10003461 | |||
| 1334 | Ga0105238_10042740 | |||
| 1335 | Ga0105238_10114570 | |||
| 1336 | Ga0105249_10162936 | |||
| 1337 | Ga0105239_10050052 | |||
| 1338 | Ga0105239_10058326 | |||
| 1339 | Ga0105239_10143600 | |||
| 1340 | Ga0105239_10157662 | |||
| 1341 | Ga0105246_10013973 | |||
| 1342 | Ga0157373_10032306 | |||
| 1343 | Ga0157371_10026840 | |||
| 1344 | Ga0157370_10028168 | |||
| 1345 | Ga0157370_10285437 | |||
| 1346 | Ga0157369_10005960 | |||
| 1347 | Ga0157369_10011596 | |||
| 1348 | Ga0157369_10018830 | |||
| 1349 | Ga0157369_10135432 | |||
| 1350 | Ga0157374_10001953 | |||
| 1351 | Ga0157374_10009479 | |||
| 1352 | Ga0157374_10010653 | |||
| 1353 | Ga0157374_10073614 | |||
| 1354 | Ga0157374_10240195 | |||
| 1355 | Ga0157378_10217421 | |||
| 1356 | Ga0163162_10102021 | |||
| 1357 | Ga0163162_10147944 | |||
| 1358 | Ga0163162_10322113 | |||
| 1359 | Ga0163162_10355879 | |||
| 1360 | Ga0157372_10001409 | |||
| 1361 | Ga0157372_10020476 | |||
| 1362 | Ga0157372_10161855 | |||
| 1363 | Ga0157375_10004073 | |||
| 1364 | Ga0157375_10030596 | |||
| 1365 | Ga0157375_10047417 | |||
| 1366 | Ga0157375_10144763 | |||
| 1367 | Ga0157375_10172449 | |||
| 1368 | Ga0157375_10292512 | |||
| 1369 | Ga0163163_10000090 | |||
| 1370 | Ga0163163_10009881 | |||
| 1371 | Ga0163163_10090300 | |||
| 1372 | Ga0157380_10084448 | |||
| 1373 | Ga0182008_10007140 | |||
| 1374 | Ga0182008_10037367 | |||
| 1375 | Ga0157379_10004907 | |||
| 1376 | Ga0157379_10006862 | |||
| 1377 | Ga0157379_10017175 | |||
| 1378 | Ga0157379_10045315 | |||
| 1379 | Ga0157379_10058923 | |||
| 1380 | Ga0157379_10102599 | |||
| 1381 | Ga0157376_10001708 | |||
| 1382 | Ga0157376_10055032 | |||
| 1383 | Ga0157376_10056182 | |||
| 1384 | Ga0157376_10060308 | |||
| 1385 | Ga0157376_10295420 | |||
| 1386 | Ga0163161_10060111 | |||
| 1387 | Ga0214544_1000055 | |||
| 1388 | Ga0214542_1000196 | |||
| 1389 | Ga0214545_1000028 | |||
| 1390 | Ga0214543_1000044 | |||
| 1391 | Ga0213876_10014155 | |||
| 1392 | Ga0213876_10018389 | |||
| 1393 | Ga0213875_10002599 | |||
| 1394 | Ga0209672_100295 | |||
| 1395 | Ga0209147_101997 | |||
| 1396 | Ga0209258_100058 | |||
| 1397 | Ga0209677_100757 | |||
| 1398 | Ga0209148_1000071 | |||
| 1399 | Ga0209148_1000711 | |||
| 1400 | Ga0209129_1011203 | |||
| 1401 | Ga0209233_1001618 | |||
| 1402 | Ga0209233_1004243 | |||
| 1403 | Ga0209233_1025754 | |||
| 1404 | Ga0209455_1001451 | |||
| 1405 | Ga0209455_1006522 | |||
| 1406 | Ga0209130_1000190 | |||
| 1407 | Ga0209025_1000446 | |||
| 1408 | Ga0209564_1000023 | |||
| 1409 | Ga0209564_1008860 | |||
| 1410 | Ga0209758_1000187 | |||
| 1411 | Ga0209758_1003975 | |||
| 1412 | Ga0209758_1013916 | |||
| 1413 | Ga0209758_1015628 | |||
| 1414 | Ga0209758_1019218 | |||
| 1415 | Ga0209758_1037382 | |||
| 1416 | Ga0209758_1048794 | |||
| 1417 | Ga0207426_1000160 | |||
| 1418 | Ga0207697_10004750 | |||
| 1419 | Ga0207697_10057009 | |||
| 1420 | Ga0207656_10015034 | |||
| 1421 | Ga0207692_10042307 | |||
| 1422 | Ga0207692_10131970 | |||
| 1423 | Ga0207688_10019853 | |||
| 1424 | Ga0207680_10034716 | |||
| 1425 | Ga0207699_10001076 | |||
| 1426 | Ga0207699_10022268 | |||
| 1427 | Ga0207645_10059908 | |||
| 1428 | Ga0207645_10112722 | |||
| 1429 | Ga0207705_10016820 | |||
| 1430 | Ga0207705_10026329 | |||
| 1431 | Ga0207707_10000139 | |||
| 1432 | Ga0207707_10010142 | |||
| 1433 | Ga0207707_10017242 | |||
| 1434 | Ga0207707_10032631 | |||
| 1435 | Ga0207707_10076677 | |||
| 1436 | Ga0207707_10078356 | |||
| 1437 | Ga0207707_10128879 | |||
| 1438 | Ga0207695_10000029 | |||
| 1439 | Ga0207695_10016171 | |||
| 1440 | Ga0207695_10023967 | |||
| 1441 | Ga0207695_10221532 | |||
| 1442 | Ga0207695_10258050 | |||
| 1443 | Ga0207671_10003418 | |||
| 1444 | Ga0207693_10004880 | |||
| 1445 | Ga0207693_10015116 | |||
| 1446 | Ga0207693_10068602 | |||
| 1447 | Ga0207693_10076727 | |||
| 1448 | Ga0207693_10086602 | |||
| 1449 | Ga0207663_10001558 | |||
| 1450 | Ga0207663_10016591 | |||
| 1451 | Ga0207663_10053754 | |||
| 1452 | Ga0207663_10130073 | |||
| 1453 | Ga0207660_10002090 | |||
| 1454 | Ga0207660_10009649 | |||
| 1455 | Ga0207660_10078766 | |||
| 1456 | Ga0207657_10002729 | |||
| 1457 | Ga0207657_10047977 | |||
| 1458 | Ga0207657_10053852 | |||
| 1459 | Ga0207657_10212039 | |||
| 1460 | Ga0207649_10003878 | |||
| 1461 | Ga0207649_10007536 | |||
| 1462 | Ga0207649_10014878 | |||
| 1463 | Ga0207652_10003895 | |||
| 1464 | Ga0207652_10008960 | |||
| 1465 | Ga0207652_10029251 | |||
| 1466 | Ga0207652_10039342 | |||
| 1467 | Ga0207652_10136739 | |||
| 1468 | Ga0207681_10009609 | |||
| 1469 | Ga0207681_10031794 | |||
| 1470 | Ga0207694_10006781 | |||
| 1471 | Ga0207694_10195979 | |||
| 1472 | Ga0207650_10001199 | |||
| 1473 | Ga0207650_10003269 | |||
| 1474 | Ga0207659_10002617 | |||
| 1475 | Ga0207659_10003295 | |||
| 1476 | Ga0207659_10014353 | |||
| 1477 | Ga0207659_10114121 | |||
| 1478 | Ga0207687_10011801 | |||
| 1479 | Ga0207687_10015002 | |||
| 1480 | Ga0207687_10030495 | |||
| 1481 | Ga0207687_10049070 | |||
| 1482 | Ga0207687_10098837 | |||
| 1483 | Ga0207700_10015355 | |||
| 1484 | Ga0207700_10090797 | |||
| 1485 | Ga0207664_10017186 | |||
| 1486 | Ga0207664_10032336 | |||
| 1487 | Ga0207664_10032814 | |||
| 1488 | Ga0207644_10000365 | |||
| 1489 | Ga0207644_10008217 | |||
| 1490 | Ga0207644_10110127 | |||
| 1491 | Ga0207690_10016818 | |||
| 1492 | Ga0207690_10080122 | |||
| 1493 | Ga0207690_10168279 | |||
| 1494 | Ga0207690_10362723 | |||
| 1495 | Ga0207706_10006986 | |||
| 1496 | Ga0207706_10046207 | |||
| 1497 | Ga0207706_10073287 | |||
| 1498 | Ga0207706_10093300 | |||
| 1499 | Ga0207686_10038264 | |||
| 1500 | Ga0207709_10060787 | |||
| 1501 | Ga0207670_10034151 | |||
| 1502 | Ga0207669_10007715 | |||
| 1503 | Ga0207669_10007898 | |||
| 1504 | Ga0207704_10072042 | |||
| 1505 | Ga0207665_10040126 | |||
| 1506 | Ga0207665_10046337 | |||
| 1507 | Ga0207665_10125927 | |||
| 1508 | Ga0207691_10000276 | |||
| 1509 | Ga0207691_10002411 | |||
| 1510 | Ga0207691_10030949 | |||
| 1511 | Ga0207691_10054301 | |||
| 1512 | Ga0207711_10030312 | |||
| 1513 | Ga0207711_10153172 | |||
| 1514 | Ga0207711_10168810 | |||
| 1515 | Ga0207711_10286936 | |||
| 1516 | Ga0207689_10000415 | |||
| 1517 | Ga0207689_10027387 | |||
| 1518 | Ga0207689_10038778 | |||
| 1519 | Ga0207661_10011082 | |||
| 1520 | Ga0207661_10014956 | |||
| 1521 | Ga0207679_10005759 | |||
| 1522 | Ga0207679_10012754 | |||
| 1523 | Ga0207679_10025964 | |||
| 1524 | Ga0207679_10319408 | |||
| 1525 | Ga0207667_10009574 | |||
| 1526 | Ga0207667_10017829 | |||
| 1527 | Ga0207667_10328933 | |||
| 1528 | Ga0207651_10004986 | |||
| 1529 | Ga0207651_10026981 | |||
| 1530 | Ga0207651_10193639 | |||
| 1531 | Ga0207712_10098448 | |||
| 1532 | Ga0207668_10015716 | |||
| 1533 | Ga0207668_10041624 | |||
| 1534 | Ga0207668_10100334 | |||
| 1535 | Ga0207640_10001031 | |||
| 1536 | Ga0207640_10070924 | |||
| 1537 | Ga0207640_10073346 | |||
| 1538 | Ga0207640_10132572 | |||
| 1539 | Ga0207658_10005357 | |||
| 1540 | Ga0207677_10001216 | |||
| 1541 | Ga0207677_10016707 | |||
| 1542 | Ga0207677_10052395 | |||
| 1543 | Ga0207677_10229103 | |||
| 1544 | Ga0207703_10023207 | |||
| 1545 | Ga0207703_10027790 | |||
| 1546 | Ga0207703_10040883 | |||
| 1547 | Ga0207639_10073516 | |||
| 1548 | Ga0207639_10316474 | |||
| 1549 | Ga0207678_10014339 | |||
| 1550 | Ga0207678_10294783 | |||
| 1551 | Ga0207708_10003526 | |||
| 1552 | Ga0207708_10023275 | |||
| 1553 | Ga0207708_10031356 | |||
| 1554 | Ga0207708_10072813 | |||
| 1555 | Ga0207702_10002758 | |||
| 1556 | Ga0207702_10021800 | |||
| 1557 | Ga0207702_10086466 | |||
| 1558 | Ga0207641_10102798 | |||
| 1559 | Ga0207641_10121785 | |||
| 1560 | Ga0207648_10011496 | |||
| 1561 | Ga0207648_10019804 | |||
| 1562 | Ga0207648_10028323 | |||
| 1563 | Ga0207648_10043828 | |||
| 1564 | Ga0207648_10079615 | |||
| 1565 | Ga0207676_10003251 | |||
| 1566 | Ga0207676_10016855 | |||
| 1567 | Ga0207676_10254181 | |||
| 1568 | Ga0207676_10333415 | |||
| 1569 | Ga0207674_10000301 | |||
| 1570 | Ga0207674_10024546 | |||
| 1571 | Ga0207674_10104015 | |||
| 1572 | Ga0207674_10339179 | |||
| 1573 | Ga0207675_100000177 | |||
| 1574 | Ga0207675_100012098 | |||
| 1575 | Ga0207675_100016962 | |||
| 1576 | Ga0207675_100042519 | |||
| 1577 | Ga0207675_100072098 | |||
| 1578 | Ga0207683_10001296 | |||
| 1579 | Ga0207683_10035761 | |||
| 1580 | Ga0207683_10048402 | |||
| 1581 | Ga0207683_10138723 | |||
| 1582 | Ga0207683_10230120 | |||
| 1583 | Ga0207683_10252153 | |||
| 1584 | Ga0207698_10000451 | |||
| 1585 | Ga0207698_10003841 | |||
| 1586 | Ga0207698_10014026 | |||
| 1587 | Ga0207698_10134453 | |||
| 1588 | Ga0207698_10159283 | |||
| 1589 | Ga0209389_1000003 | |||
| 1590 | Ga0209389_1013235 | |||
| 1591 | Ga0209589_1000004 | |||
| 1592 | Ga0209589_1018958 | |||
| 1593 | Ga0209969_1001299 | |||
| 1594 | Ga0209489_100004 | |||
| 1595 | Ga0209489_100022 | |||
| 1596 | Ga0209489_100498 | |||
| 1597 | Ga0209700_100004 | |||
| 1598 | Ga0209700_100023 | |||
| 1599 | Ga0209995_1000129 | |||
| 1600 | Ga0209999_1001230 | |||
| 1601 | Ga0209974_10001304 | |||
| 1602 | Ga0207428_10002244 | |||
| 1603 | Ga0207428_10044812 | |||
| 1604 | Ga0207428_10116536 | |||
| 1605 | Ga0268266_10016506 | |||
| 1606 | Ga0268266_10020042 | |||
| 1607 | Ga0268266_10030718 | |||
| 1608 | Ga0268266_10033577 | |||
| 1609 | Ga0268266_10068376 | |||
| 1610 | Ga0268265_10004529 | |||
| 1611 | Ga0268265_10021741 | |||
| 1612 | Ga0268265_10068962 | |||
| 1613 | Ga0268264_10060301 | |||
| 1614 | Ga0268264_10143054 | |||
| 1615 | Ga0265337_1026833 | |||
| 1616 | Ga0265319_1025769 | |||
| 1617 | Ga0265334_10002844 | |||
| 1618 | Ga0265318_10003531 | |||
| 1619 | Ga0265336_10038645 | |||
| 1620 | Ga0307517_10195693 | |||
| 1621 | Ga0307515_10000346 | |||
| 1622 | Ga0265338_10000013 | |||
| 1623 | Ga0265338_10036574 | |||
| 1624 | Ga0307511_10000911 | |||
| 1625 | Ga0265762_1000974 | |||
| 1626 | Ga0265770_1008006 | |||
| 1627 | Ga0265330_10002701 | |||
| 1628 | Ga0265330_10016691 | |||
| 1629 | Ga0265330_10018614 | |||
| 1630 | Ga0265330_10084151 | |||
| 1631 | Ga0265332_10001762 | |||
| 1632 | Ga0265332_10011531 | |||
| 1633 | Ga0265332_10034645 | |||
| 1634 | Ga0265328_10001075 | |||
| 1635 | Ga0265328_10018349 | |||
| 1636 | Ga0265320_10003447 | |||
| 1637 | Ga0265325_10010884 | |||
| 1638 | Ga0265325_10019513 | |||
| 1639 | Ga0265340_10011815 | |||
| 1640 | Ga0265339_10047117 | |||
| 1641 | Ga0265339_10052634 | |||
| 1642 | Ga0265331_10002915 | |||
| 1643 | Ga0265331_10031305 | |||
| 1644 | Ga0265327_10002317 | |||
| 1645 | Ga0265316_10020579 | |||
| 1646 | Ga0265316_10148551 | |||
| 1647 | Ga0265316_10150662 | |||
| 1648 | Ga0307513_10117435 | |||
| 1649 | Ga0307509_10030149 | |||
| 1650 | Ga0307509_10056601 | |||
| 1651 | Ga0265313_10005096 | |||
| 1652 | Ga0265313_10008779 | |||
| 1653 | Ga0265313_10010102 | |||
| 1654 | Ga0265313_10041293 | |||
| 1655 | Ga0265314_10005350 | |||
| 1656 | Ga0265314_10005790 | |||
| 1657 | Ga0265314_10045348 | |||
| 1658 | Ga0265342_10007979 | |||
| 1659 | Ga0307516_10026755 | |||
| 1660 | Ga0307405_10006482 | |||
| 1661 | Ga0307405_10115435 | |||
| 1662 | Ga0307413_10033804 | |||
| 1663 | Ga0307518_10002453 | |||
| 1664 | Ga0307410_10031925 | |||
| 1665 | Ga0307409_100042722 | |||
| 1666 | Ga0307409_100110520 | |||
| 1667 | Ga0307416_100037183 | |||
| 1668 | Ga0307411_10038649 | |||
| 1669 | Ga0307510_10025985 | |||
| 1670 | Ga0307510_10064626 | |||
| 1671 | Ga0315911_1000014 | |||
| 1672 | Ga0373930_0008781 | |||
| 1673 | Ga0373952_0002091 | |||
| 1674 | Ga0373941_0007836 | |||
| 1675 | Ga0373953_0022929 | |||
| 1676 | Ga0373954_0039281 | |||
| 1677 | Ga0373943_0035367 | |||
| 1678 | Ga0373955_0067167 | |||
| 1679 | Ga0373924_0051526 | |||
| 1680 | Ga0373931_0000651 | |||
| 1681 | Ga0373935_0202814 | |||
| 1682 | Ga0373927_0037396 | |||
| 1683 | Ga0373927_0142158 | |||
| 1684 | Ga0373927_0188298 | |||
| 1685 | Ga0373933_0006984 | |||
| 1686 | Ga0373933_0043532 | |||
| 1687 | Ga0373933_0050912 | |||
| 1688 | Ga0373933_0082337 | |||
| 1689 | Ga0373933_0176435 | |||
| 1690 | Ga0373947_0020564 | |||
| 1691 | Ga0373947_0067382 | |||
| 1692 | Ga0373937_0002894 | |||
| 1693 | Ga0373937_0016007 | |||
| 1694 | Ga0373937_0310329 | |||
| 1695 | Ga0373925_0051407 | |||
| 1696 | Ga0395898_0056203 | |||
| 1697 | Ga0395905_0023182 | |||
| 1698 | Ga0395905_0105928 | |||
| 1699 | Ga0436364_0614112 | |||
| 1700 | Ga0436364_0681123 | |||
| 1701 | Ga0436364_1528058 | |||
| 1702 | Ga0436365_0644345 | |||
| 1703 | Ga0436365_0955306 | |||
| 1704 | Ga0436365_1031159 | |||
| 1705 | Ga0436365_1682025 | |||
| 1706 | Ga0436360_0317573 | |||
| 1707 | Ga0436360_0388551 | |||
| 1708 | Ga0436360_0416689 | |||
| 1709 | Ga0436360_0810186 | |||
| 1710 | Ga0436361_0677831 | |||
| 1711 | Ga0436361_0968143 | |||
| 1712 | Ga0436363_0628506 | |||
| 1713 | Ga0436363_1221684 | |||
| 1714 | Ga0436362_0287411 | |||
| 1715 | Ga0436362_0443667 | |||
| 1716 | Ga0436362_1180616 | |||
| 1717 | Ga0451577_0058147 | |||
| 1718 | Ga0466972_0021164 | |||
| 1719 | Ga0466966_0000940 | |||
| 1720 | Ga0466961_0000029 | |||
| 1721 | Ga0453684_0006879 | |||
| 1722 | Ga0453684_0048765 | |||
| 1723 | Ga0453684_0144446 | |||
| 1724 | Ga0466968_0040411 | |||
| 1725 | Ga0466957_0103182 | |||
| 1726 | Ga0466960_0121513 | |||
| 1727 | Ga0466959_0004320 | |||
| 1728 | Ga0466959_0078618 | |||
| 1729 | Ga0451576_0002059 | |||
| 1730 | Ga0451576_0118441 | |||
| 1731 | Ga0466967_0506998 | |||
| 1732 | Ga0495617_026863 | |||
| 1733 | Ga0495592_0040011 | |||
| 1734 | Ga0495592_0241155 | |||
| 1735 | Ga0495603_0044000 | |||
| 1736 | Ga0495603_0073486 | |||
| 1737 | Ga0495591_020893 | |||
| 1738 | Ga0495638_0000120 | |||
| 1739 | Ga0495638_0013548 | |||
| 1740 | Ga0495638_0085970 | |||
| 1741 | Ga0495638_0200838 | |||
| 1742 | Ga0495651_0030990 | |||
| 1743 | Ga0495653_0032580 | |||
| 1744 | Ga0495653_0097512 | |||
| 1745 | Ga0495580_0036074 | |||
| 1746 | Ga0495582_0063308 | |||
| 1747 | Ga0495639_0014506 | |||
| 1748 | Ga0495664_0002135 | |||
| 1749 | Ga0495584_0009819 | |||
| 1750 | Ga0495584_0026223 | |||
| 1751 | Ga0495585_0005635 | |||
| 1752 | Ga0495585_0010105 | |||
| 1753 | Ga0495596_0010077 | |||
| 1754 | Ga0495583_0014503 | |||
| 1755 | Ga0495583_0076068 | |||
| 1756 | Ga0495606_0043294 | |||
| 1757 | Ga0495606_0077980 | |||
| 1758 | Ga0495606_0088822 | |||
| 1759 | Ga0495606_0178589 | |||
| 1760 | Ga0495608_0019557 | |||
| 1761 | Ga0495610_0020115 | |||
| 1762 | Ga0495628_0312032 | |||
| 1763 | Ga0495631_0021853 | |||
| 1764 | Ga0495632_0077380 | |||
| 1765 | Ga0495637_0006873 | |||
| 1766 | Ga0495643_0007697 | |||
| 1767 | Ga0495643_0057347 | |||
| 1768 | Ga0495648_0040579 | |||
| 1769 | Ga0495648_0042628 | |||
| 1770 | Ga0495648_0061657 | |||
| 1771 | Ga0495642_0022049 | |||
| 1772 | Ga0495642_0024082 | |||
| 1773 | Ga0495652_0033773 | |||
| 1774 | Ga0495640_0082800 | |||
| 1775 | Ga0495587_0012294 | |||
| 1776 | Ga0495587_0052691 | |||
| 1777 | Ga0495609_0010432 | |||
| 1778 | Ga0495609_0054920 | |||
| 1779 | Ga0495622_0013620 | |||
| 1780 | Ga0495633_0026673 | |||
| 1781 | Ga0495667_0006413 | |||
| 1782 | Ga0495668_0084314 | |||
| 1783 | Ga0495611_0031679 | |||
| 1784 | Ga0495661_0001062 | |||
| 1785 | Ga0495661_0059548 | |||
| 1786 | Ga0495599_0051878 | |||
| 1787 | Ga0495599_0059555 | |||
| 1788 | Ga0495669_0084355 | |||
| 1789 | Ga0495613_0121426 | |||
| 1790 | Ga0495670_0011214 | |||
| 1791 | Ga0495670_0028046 | |||
| 1792 | Ga0495670_0045930 | |||
| 1793 | Ga0495671_0096372 | |||
| 1794 | Ga0495649_0112234 | |||
| 1795 | Ga0495660_0034685 | |||
| 1796 | Ga0495604_0212387 | |||
| 1797 | Ga0495636_0020603 | |||
| 1798 | Ga0495672_0006683 | |||
| 1799 | Ga0495676_0100451 | |||
| 1800 | Ga0495680_0040140 | |||
| 1801 | Ga0495687_000002 | |||
| 1802 | Ga0495687_000007 | |||
| 1803 | Ga0495687_006670 | |||
| 1804 | Ga0495675_0021752 | |||
| 1805 | Ga0495677_0018820 | |||
| 1806 | Ga0495686_0086893 | |||
| 1807 | Ga0495686_0148812 | |||
| 1808 | Ga0495602_0009695 | |||
| 1809 | Ga0495602_0020952 | |||
| 1810 | Ga0495626_0003679 | |||
| 1811 | Ga0495626_0048324 | |||
| 1812 | Ga0495626_0086410 | |||
| 1813 | Ga0496100_0084609 | |||
| 1814 | Ga0496101_0047901 | |||
| 1815 | Ga0496102_0019293 | |||
| 1816 | Ga0496102_0279472 | |||
| 1817 | Ga0496104_0071597 | |||
| 1818 | Ga0496104_0087595 | |||
| 1819 | Ga0496104_0271624 | |||
| 1820 | Ga0496105_0019790 | |||
| 1821 | Ga0496105_0123657 | |||
| 1822 | Ga0496106_0043880 | |||
| 1823 | Ga0496107_0096397 | |||
| 1824 | Ga0496108_0013180 | |||
| 1825 | Ga0496108_0024009 | |||
| 1826 | Ga0496108_0041821 | |||
| 1827 | Ga0496109_0009667 | |||
| 1828 | Ga0496109_0054317 | |||
| 1829 | Ga0496109_0063412 | |||
| 1830 | Ga0496109_0091928 | |||
| 1831 | Ga0496110_0001398 | |||
| 1832 | Ga0496110_0008118 | |||
| 1833 | Ga0496111_0118779 | |||
| 1834 | Ga0496111_0235443 | |||
| 1835 | Ga0496112_0000303 | |||
| 1836 | Ga0496112_0041516 | |||
| 1837 | Ga0496112_0072680 | |||
| 1838 | Ga0496112_0081503 | |||
| 1839 | Ga0496112_0140439 | |||
| 1840 | Ga0496112_0289555 | |||
| 1841 | Ga0496112_0395115 | |||
| 1842 | Ga0496113_0001648 | |||
| 1843 | Ga0496113_0006977 | |||
| 1844 | Ga0496113_0053820 | |||
| 1845 | Ga0496113_0173390 | |||
| 1846 | Ga0496114_0074490 | |||
| 1847 | Ga0496114_0224373 | |||
| 1848 | Ga0496116_0020226 | |||
| 1849 | Ga0496117_0126105 | |||
| 1850 | Ga0496117_0133986 | |||
| 1851 | Ga0496118_0035159 | |||
| 1852 | Ga0496118_0127940 | |||
| 1853 | Ga0496119_0011593 | |||
| 1854 | Ga0496120_0036299 | |||
| 1855 | Ga0496121_0037934 | |||
| 1856 | Ga0496121_0077543 | |||
| 1857 | Ga0496121_0137560 | |||
| 1858 | Ga0496121_0169870 | |||
| 1859 | Ga0496122_0000263 | |||
| 1860 | Ga0496123_0000156 | |||
| 1861 | Ga0496123_0105088 | |||
| 1862 | Ga0496125_0000669 | |||
| 1863 | Ga0496125_0089497 | |||
| 1864 | Ga0496125_0118528 | |||
| 1865 | Ga0496126_0004420 | |||
| 1866 | Ga0496126_0125357 | |||
| 1867 | Ga0495678_000024 | |||
| 1868 | Ga0501031_0129002 | |||
| 1869 | Ga0501037_0110164 | |||
| 1870 | Ga0501039_0000283 | |||
| 1871 | Ga0501039_0122612 | |||
| 1872 | Ga0501040_0173092 | |||
| 1873 | Ga0501041_0046941 | |||
| 1874 | Ga0501041_0060925 | |||
| 1875 | Ga0501046_0254514 | |||
| 1876 | Ga0501047_0189791 | |||
| 1877 | Ga0501067_0152521 | |||
| 1878 | Ga0501069_0051904 | |||
| 1879 | Ga0501070_0127724 | |||
| 1880 | Ga0501070_0288528 | |||
| 1881 | Ga0501071_0014276 | |||
| 1882 | Ga0501071_0126148 | |||
| 1883 | Ga0501072_0069107 | |||
| 1884 | Ga0501073_0153908 | |||
| 1885 | Ga0501075_0029889 | |||
| 1886 | Ga0501075_0072927 | |||
| 1887 | Ga0501075_0092849 | |||
| 1888 | Ga0501076_0161674 | |||
| 1889 | Ga0501077_0006410 | |||
| 1890 | Ga0501079_0015574 | |||
| 1891 | Ga0501079_0042049 | |||
| 1892 | Ga0501080_0066607 | |||
| 1893 | Ga0501080_0235204 | |||
| 1894 | Ga0501080_0326321 | |||
| 1895 | Ga0501081_0005064 | |||
| 1896 | Ga0501081_0079630 | |||
| 1897 | Ga0501083_0057202 | |||
| 1898 | Ga0501044_0110482 | |||
| 1899 | Ga0501045_0009339 | |||
| 1900 | Ga0501045_0023327 | |||
| 1901 | nmdc:mga03n38_20423_c1 | |||
| 1902 | nmdc:mga0yw44_102492_c1 | |||
| 1903 | nmdc:mga0yw44_53338_c1 | |||
| 1904 | nmdc:mga0k408_78158_c1 | |||
| 1905 | nmdc:mga0k408_8341_c1 | |||
| 1906 | nmdc:mga06z11_122218_c1 | |||
| 1907 | nmdc:mga06z11_68410_c1 | |||
| 1908 | nmdc:mga07m45_2281_c1 | |||
| 1909 | nmdc:mga05p37_15057_c1 | |||
| 1910 | nmdc:mga05p37_419_c1 | |||
| 1911 | nmdc:mga05p37_626911_c1 | |||
| 1912 | nmdc:mga09592_13357_c1 | |||
| 1913 | nmdc:mga09592_570_c1 | |||
| 1914 | nmdc:mga0qj67_24041_c1 | |||
| 1915 | nmdc:mga06r32_282001_c1 | |||
| 1916 | nmdc:mga06r32_453_c1 | |||
| 1917 | nmdc:mga08y16_174204_c1 | |||
| 1918 | nmdc:mga08y16_212080_c1 | |||
| 1919 | nmdc:mga08y16_244165_c1 | |||
| 1920 | nmdc:mga08y16_6524_c1 | |||
| 1921 | nmdc:mga08y16_66925_c1 | |||
| 1922 | nmdc:mga08y16_93505_c1 | |||
| 1923 | nmdc:mga0n895_128971_c1 | |||
| 1924 | nmdc:mga0n895_18279_c1 | |||
| 1925 | nmdc:mga0n895_34229_c1 | |||
| 1926 | nmdc:mga0n895_36728_c1 | |||
| 1927 | nmdc:mga0n895_60365_c1 | |||
| 1928 | nmdc:mga0n895_84586_c1 | |||
| 1929 | nmdc:mga0rr50_107347_c1 | |||
| 1930 | nmdc:mga0rr50_8400_c1 | |||
| 1931 | nmdc:mga0rr50_86200_c1 | |||
| 1932 | nmdc:mga0a205_11336_c1 | |||
| 1933 | nmdc:mga0a205_11653_c1 | |||
| 1934 | nmdc:mga0sz30_11356_c1 | |||
| 1935 | nmdc:mga0sz30_18242_c1 | |||
| 1936 | Ga0495601_0000429 | |||
| 1937 | Ga0500643_000037 | |||
| 1938 | Ga0500646_0002806 | |||
| 1939 | Ga0500646_0008598 | |||
| 1940 | Ga0500583_0001825 | |||
| 1941 | Ga0500651_0144840 | |||
| 1942 | Ga0500566_0001075 | |||
| 1943 | Ga0500566_0003368 | |||
| 1944 | Ga0500566_0003623 | |||
| 1945 | Ga0500555_001855 | |||
| 1946 | Ga0500555_030707 | |||
| 1947 | Ga0500555_035827 | |||
| 1948 | Ga0500556_0054338 | |||
| 1949 | Ga0500557_000047 | |||
| 1950 | Ga0500569_000518 | |||
| 1951 | Ga0500572_016523 | |||
| 1952 | Ga0500595_006884 | |||
| 1953 | Ga0500595_026598 | |||
| 1954 | Ga0500595_027317 | |||
| 1955 | Ga0500607_012500 | |||
| 1956 | Ga0500607_141798 | |||
| 1957 | Ga0500608_064472 | |||
| 1958 | Ga0500642_0001382 | |||
| 1959 | Ga0500658_0031714 | |||
| 1960 | Ga0500658_0049478 | |||
| 1961 | Ga0500559_0012586 | |||
| 1962 | Ga0500561_0010738 | |||
| 1963 | Ga0500568_0000101 | |||
| 1964 | Ga0500568_0002259 | |||
| 1965 | Ga0500568_0018020 | |||
| 1966 | Ga0500573_0000009 | |||
| 1967 | Ga0500577_0078290 | |||
| 1968 | Ga0500603_002543 | |||
| 1969 | Ga0500604_0003284 | |||
| 1970 | Ga0500604_0020075 | |||
| 1971 | Ga0500616_0001091 | |||
| 1972 | Ga0500616_0023355 | |||
| 1973 | Ga0500622_0028910 | |||
| 1974 | Ga0500624_006581 | |||
| 1975 | Ga0500627_0051817 | |||
| 1976 | Ga0500630_005372 | |||
| 1977 | Ga0500630_032312 | |||
| 1978 | Ga0500638_055522 | |||
| 1979 | Ga0500639_009086 | |||
| 1980 | Ga0500636_0004313 | |||
| 1981 | Ga0500637_0047261 | |||
| 1982 | Ga0500649_042905 | |||
| 1983 | Ga0500625_011953 | |||
| 1984 | Ga0500645_013978 | |||
| 1985 | Ga0500596_001342 | |||
| 1986 | Ga0500596_001805 | |||
| 1987 | Ga0500596_006217 | |||
| 1988 | Ga0500599_004175 | |||
| 1989 | Ga0500601_000279 | |||
| 1990 | Ga0501084_0008888 | |||
| 1991 | Ga0501082_0000013 | |||
| 1992 | Ga0530510_0088737 | |||
| 1993 | 2507510361 | |||
| 1994 | 2509153158 | |||
| 1995 | 2513627334 | |||
| 1996 | 2513640245 | |||
| 1997 | 2513648649 | |||
| 1998 | 2513661231 | |||
| 1999 | 2513674752 | |||
| 2000 | 2513693595 | |||
| 2001 | 2513704234 | |||
| 2002 | 2513715931 | |||
| 2003 | 2513862297 | |||
| 2004 | 2513893805 | |||
| 2005 | 2513922951 | |||
| 2006 | 2517105562 | |||
| 2007 | 2517894270 | |||
| 2008 | 2524442069 | |||
| 2009 | 2524469042 | |||
| 2010 | 2524535696 | |||
| 2011 | 2528852339 | |||
| 2012 | 2586061747 | |||
| 2013 | 2617378663 | |||
| 2014 | 2623589474 | |||
| 2015 | 2671124026 | |||
| 2016 | 2723847477 | |||
| 2017 | 2745076078 | |||
| 2018 | 2793073959 | |||
| 2019 | 2793081497 | |||
| 2020 | 2809590392 | |||
| 2021 | 2818241936 | |||
| 2022 | 2824603875 | |||
| 2023 | 2824612516 | |||
| 2024 | 2824655653 | |||
| 2025 | 2824668873 | |||
| 2026 | 2824680044 | |||
| 2027 | 2824710021 | |||
| 2028 | 2824733710 | |||
| 2029 | 2824747931 | |||
| 2030 | 2824755279 | |||
| 2031 | 2824772157 | |||
| 2032 | 2841959113 | |||
| 2033 | 2842045144 | |||
| 2034 | 2842049195 | |||
| 2035 | 2847934175 | |||
| 2036 | 2857516176 | |||
| 2037 | 2874611457 | |||
| 2038 | 2874612900 | |||
| 2039 | 2874625111 | |||
| 2040 | 2874634770 | |||
| 2041 | 2876769435 | |||
| 2042 | 2876817085 | |||
| 2043 | 2879086840 | |||
| 2044 | 2879117530 | |||
| 2045 | 2881369159 | |||
| 2046 | 2881667595 | |||
| 2047 | 2883577127 | |||
| 2048 | 2884698054 | |||
| 2049 | 2885367460 | |||
| 2050 | 2885376783 | |||
| 2051 | 2888382058 | |||
| 2052 | 2888422668 | |||
| 2053 | 2889042194 | |||
| 2054 | 2894772483 | |||
| 2055 | 2895445114 | |||
| 2056 | 2903751563 | |||
| 2057 | 2904666887 | |||
| 2058 | 2904697269 | |||
| 2059 | 2904705412 | |||
| 2060 | 2904717764 | |||
| 2061 | 2906611096 | |||
| 2062 | 2906626511 | |||
| 2063 | 2906641263 | |||
| 2064 | 2906648121 | |||
| 2065 | 2906667556 | |||
| 2066 | 2908744612 | |||
| 2067 | 2908762232 | |||
| 2068 | 2908778304 | |||
| 2069 | 2912764486 | |||
| 2070 | 2915774408 | |||
| 2071 | 2922372098 | |||
| 2072 | 2922390574 | |||
| 2073 | 2922399257 | |||
| 2074 | 2922428218 | |||
| 2075 | 2929616658 | |||
| 2076 | 2929625402 | |||
| 2077 | 2932792170 | |||
| 2078 | 2932798813 | |||
| 2079 | 2932803583 | |||
| 2080 | 2932814463 | |||
| 2081 | 2932824550 | |||
| 2082 | 2932837339 | |||
| 2083 | 2933578059 | |||
| 2084 | 2935623422 | |||
| 2085 | 2935637345 | |||
| 2086 | 2935646829 | |||
| 2087 | 2935672748 | |||
| 2088 | 2935684468 | |||
| 2089 | 2935692069 | |||
| 2090 | 2935694994 | |||
| 2091 | 2935707905 | |||
| 2092 | 2935721908 | |||
| 2093 | 2935731094 | |||
| 2094 | 2935739044 | |||
| 2095 | 2935747771 | |||
| 2096 | 2935756355 | |||
| 2097 | 2935761676 | |||
| 2098 | 2935774353 | |||
| 2099 | 2935782759 | |||
| 2100 | 2935793415 | |||
| 2101 | 2935801245 | |||
| 2102 | 2935810362 | |||
| 2103 | 2935819546 | |||
| 2104 | 2935836096 | |||
| 2105 | 2935845028 | |||
| 2106 | 2935861578 | |||
| 2107 | 2935881489 | |||
| 2108 | 2935887798 | |||
| 2109 | 2935963614 | |||
| 2110 | 2936001565 | |||
| 2111 | 2936005356 | |||
| 2112 | 2936046313 | |||
| 2113 | 2940562269 | |||
| 2114 | 2941513923 | |||
| 2115 | 2941521884 | |||
| 2116 | 2941529553 | |||
| 2117 | 2941535179 | |||
| 2118 | 2941546763 | |||
| 2119 | 2996228354 | |||
| 2120 | 3005478203 | |||
| 2121 | 3005489703 | |||
| 2122 | 3005593620 | |||
| 2123 | 3005597103 | |||
| 2124 | 3005713125 | |||
| 2125 | 8006943013 | |||
| 2126 | 8006970197 | |||
| 2127 | 8006982809 | |||
| 2128 | 8006985476 | |||
| 2129 | 8006994479 | |||
| 2130 | 8016515580 | |||
| 2131 | 8016523245 | |||
| 2132 | 8016536732 | |||
| 2133 | 8016541011 | |||
| 2134 | 8016552242 | |||
| 2135 | 8016566394 | |||
| 2136 | 8016579145 | |||
| 2137 | 8016590427 | |||
| 2138 | 8016598516 | |||
| 2139 | 8016612613 | |||
| 2140 | 8016621205 | |||
| 2141 | 8016628800 | |||
| 2142 | 8017060912 | |||
| 2143 | 8019543016 | |||
| 2144 | 8019547720 | |||
| 2145 | 8019558831 | |||
| 2146 | 8019566478 | |||
| 2147 | 8019580370 | |||
| 2148 | 8019588093 | |||
| 2149 | 8019603247 | |||
| 2150 | 8019643225 | |||
| 2151 | 8019656081 | |||
| 2152 | 8055748304 | |||
| 2153 | 8056681210 | |||
| 2154 | 8056684332 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pk3-assembly1.cif.gz_B | alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana | 0.9666 | 6 | 406 |
| 6pk3-assembly1.cif.gz_B | alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana | 0.9476 | 6 | 406 |
| 1iug-assembly1.cif.gz_B | the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus | 0.9463 | 13 | 383 |
| 1iug-assembly1.cif.gz_B | the crystal structure of aspartate aminotransferase which belongs to subgroup iv from thermus thermophilus | 0.9358 | 13 | 383 |
| 3f0h-assembly1.cif.gz_A-2 | crystal structure of aminotransferase (rer070207000802) from eubacterium rectale at 1.70 a resolution | 0.9343 | 12 | 386 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6KIH4_267_382_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.971 | 289 | 403 | 3.90.1150.10 |
| af_A0A1D6KIG3_10_230_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9672 | 23 | 250 | 3.40.640.10 |
| af_Q58369_36_182_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9644 | 41 | 200 | 3.40.640.10 |
| af_B6T171_24_270_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9581 | 26 | 278 | 3.40.640.10 |
| af_A0A1D6KIH4_267_382_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9546 | 289 | 403 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5WJ28-F1-model_v4 | deleted | 0.9941 | 145 | 233 |
|
| AF-A0A2E9NWN9-F1-model_v4 | Serine--glyoxylate aminotransferase | 0.9936 | 38 | 401 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A0D9AVS7-F1-model_v4 | Serine--glyoxylate aminotransferase | 0.9933 | 1 | 407 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A352SDU8-F1-model_v4 | Serine--glyoxylate aminotransferase | 0.9919 | 157 | 397 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A7W7VCS5-F1-model_v4 | Alanine-glyoxylate transaminase/serine-glyoxylate transaminase/serine-pyruvate transaminase (EC 2.6.1.44, EC 2.6.1.45, EC 2.6.1.51) | 0.9918 | 27 | 403 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 GO:0050281 |