F489692

General Info

Members Datasets Scaffolds Average Seq Length
1082 750 2164 335

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10012532|Ga0157380_100125324
Length 387
Sequence MAGAATVPAAAASPAPFRKFLLFIVVIGVSPESILLQVEWTITTWSVAMKLSSLNQGRDGRLVIVSKDLTRATDAFFIVPTLQQALDNWEKVEPQLRDLAEQLEHGSIPAFRFHEHDCASPLPRAYQWADGSAYVNHVELVRKARGAEMPASFWTDPLMYQGGSDSFLGPRDEILAIDEAHGIDFEAEIAVITGDVPMGATREQAAAAIRLVVLVNDVSLRNLIPAELAKGFGFFQSKPSSTLSPVAVTPDELGEAWDGGKLNLPLLTSLNGKPFGKANAGVDMTFDFPTLIAHAAKTRPLGAGAIIGSGTVSNKDQGGGPGKPVSDGGLGYSCLAELRTVETILHGEAKTPFLRFGDTVRIEMKDRTGHSIFGAIEQEVKAYRGEV

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
113 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
114 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
210 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
226 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
262 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
265 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
312 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
313 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
314 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
315 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
316 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
319 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
322 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
323 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
330 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
331 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
332 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
333 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
334 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
335 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
336 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
337 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
338 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
339 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
340 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
341 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
342 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
343 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
344 2512875024
345 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
346 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
347 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
348 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
349 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
350 2519899620 Rhizobium sp. Pop5 Isolate Nodule
351 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
352 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
353 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
354 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
355 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
356 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
357 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
358 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
359 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
360 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
361 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
362 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
363 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
364 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
365 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
366 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
367 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
368 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
369 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
370 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
371 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
372 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
373 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
374 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
375 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
376 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
377 2643221607 Rhizobium sp. Root73 Isolate Unclassified
378 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
379 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
380 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
381 2643221734 Bosea sp. Root670 Isolate Unclassified
382 2643221736 Bosea sp. Root483D1 Isolate Unclassified
383 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
384 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
385 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
386 2718217927 Rhizobium sp. N324 Isolate Nodule
387 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
388 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
389 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
390 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
391 2718218423 Rhizobium sp. N941 Isolate Nodule
392 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
393 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
394 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
395 2721755809 Rhizobium sp. N541 Isolate Nodule
396 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
397 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
398 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
399 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
400 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
401 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
402 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
403 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
404 2773857925 Microvirga vignae BR3299 Isolate Unclassified
405 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
406 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
407 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
408 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
409 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
410 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
411 2791355256 Rhizobium sp. M10 Isolate Nodule
412 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
413 2791355260 Rhizobium sp. L9 Isolate Nodule
414 2791355263 Rhizobium chutanense C5 Isolate Nodule
415 2791355264 Rhizobium sp. S9 Isolate Nodule
416 2791355265 Rhizobium sp. H4 Isolate Nodule
417 2791355267 Rhizobium sp. L18 Isolate Nodule
418 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
419 2802429633 Rhizobium anhuiense J3 Isolate Nodule
420 2802429634 Rhizobium anhuiense S10 Isolate Nodule
421 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
422 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
423 2802429637 Rhizobium anhuiense C15 Isolate Nodule
424 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
425 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
426 2818991467 Bosea vestrisii 3192 Isolate Unclassified
427 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
428 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
429 2838048938 Rhizobium pisi 27/80 Isolate Nodule
430 2838061910 Rhizobium phaseoli L15 Isolate Nodule
431 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
432 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
433 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
434 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
435 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
436 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
437 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
438 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
439 2841760612 Bosea sp. Tri-49 Isolate Nodule
440 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
441 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
442 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
443 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
444 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
445 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
446 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
447 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
448 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
449 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
450 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
451 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
452 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
453 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
454 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
455 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
456 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
457 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
458 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
459 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
460 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
461 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
462 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
463 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
464 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
465 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
466 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
467 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
468 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
469 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
470 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
471 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
472 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
473 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
474 2844104063 Bosea sp. Tri-39 Isolate Nodule
475 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
476 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
477 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
478 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
479 2851182111 Bosea sp. Tri-44 Isolate Nodule
480 2851246043 Bosea sp. Tri-54 Isolate Nodule
481 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
482 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
483 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
484 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
485 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
486 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
487 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
488 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
489 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
490 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
491 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
492 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
493 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
494 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
495 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
496 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
497 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
498 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
499 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
500 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
501 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
502 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
503 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
504 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
505 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
506 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
507 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
508 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
509 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
510 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
511 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
512 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
513 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
514 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
515 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
516 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
517 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
518 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
519 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
520 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
521 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
522 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
523 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
524 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
525 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
526 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
527 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
528 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
529 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
530 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
531 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
532 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
533 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
534 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
535 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
536 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
537 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
538 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
539 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
540 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
541 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
542 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
543 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
544 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
545 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
546 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
547 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
548 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
549 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
550 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
551 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
552 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
553 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
554 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
555 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
556 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
557 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
558 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
559 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
560 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
561 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
562 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
563 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
564 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
565 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
566 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
567 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
568 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
569 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
570 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
571 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
572 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
573 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
574 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
575 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
576 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
577 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
578 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
579 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
580 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
581 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
582 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
583 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
584 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
585 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
586 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
587 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
588 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
589 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
590 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
591 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
592 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
593 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
594 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
595 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
596 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
597 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
598 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
599 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
600 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
601 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
602 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
603 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
604 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
605 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
606 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
607 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
608 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
609 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
610 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
611 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
612 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
613 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
614 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
615 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
616 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
617 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
618 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
619 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
620 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
621 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
622 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
623 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
624 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
625 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
626 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
627 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
628 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
629 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
630 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
631 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
632 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
633 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
634 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
635 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
636 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
637 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
638 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
639 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
640 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
641 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
642 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
643 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
644 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
645 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
646 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
647 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
648 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
649 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
650 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
651 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
652 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
653 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
654 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
655 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
656 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
657 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
658 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
659 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
660 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
661 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
662 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
663 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
664 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
665 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
666 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
667 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
668 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
669 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
670 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
671 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
672 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
673 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
674 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
675 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
676 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
677 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
678 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
679 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
680 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
681 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
682 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
683 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
684 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
685 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
686 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
687 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
688 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
689 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
690 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
691 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
692 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
693 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
694 2996893221 Rhizobium sp. R635 Isolate Nodule
695 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
696 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
697 3004167301 Mesorhizobium loti 582 Isolate Unclassified
698 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
699 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
700 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
701 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
702 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
703 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
704 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
705 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
706 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
707 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
708 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
709 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
710 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
711 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
712 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
713 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
714 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
715 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
716 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
717 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
718 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
719 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
720 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
721 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
722 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
723 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
724 8005275841 Rhizobium sp. N4311 Isolate Nodule
725 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
726 8005382845 Rhizobium sp. R634 Isolate Nodule
727 8005395548 Rhizobium sp. R339 Isolate Nodule
728 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
729 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
730 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
731 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
732 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
733 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
734 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
735 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
736 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
737 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
738 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
739 8018176218 Rhizobium sp. N122 Isolate Nodule
740 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
741 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
742 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
743 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
744 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
745 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
746 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
747 8056382006 Rhizobium croatiense 13T Isolate Nodule
748 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
749 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
750 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.35
Metatranscriptomes 0.37
Isolates 39.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.29
Nodule 31.05
Rhizoplane 1.85
Rhizosphere 46.12
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10012532 3300014326 Bacteria 6153
2 JGI24741J21665_1002695 3300001915 Bacteria 4512
3 JGI24740J21852_10004403 3300001979 Bacteria 6056
4 JGI25158J39367_1000155 3300002739 Bacteria 16080
5 JGI25157J39369_1000888 3300002741 Bacteria 14398
6 JGI25159J45721_1000117 3300002987 Bacteria 37812
7 JGI25159J45721_1002627 3300002987 Bacteria 6715
8 JGI25159J45721_1005257 3300002987 Bacteria 4091
9 JGI25151J46595_10000040 3300003187 Bacteria 176750
10 JGI25151J46595_10001002 3300003187 Bacteria 21356
11 JGI25406J46586_10007067 3300003203 Bacteria 5146
12 JGI25165J46597_1000070 3300003214 Bacteria 193557
13 JGI25165J46597_1000440 3300003214 Bacteria 41868
14 JGI25153J46596_10011509 3300003215 Bacteria 3902
15 JGI25160J50197_1000081 3300003354 Bacteria 99495
16 JGI25161J50226_1000025 3300003374 Bacteria 148471
17 JGI25161J50226_1000063 3300003374 Bacteria 99495
18 JGI25161J50226_1003520 3300003374 Bacteria 3554
19 Ga0055542_1000344 3300003762 Bacteria 49138
20 Ga0055542_1000824 3300003762 Bacteria 22231
21 Ga0055526_1000772 3300003771 Bacteria 23855
22 Ga0055526_1001101 3300003771 Bacteria 19634
23 Ga0055526_1001298 3300003771 Bacteria 17909
24 Ga0055526_1001710 3300003771 Bacteria 15299
25 Ga0055526_1009213 3300003771 Bacteria 4790
26 Ga0055524_1000023 3300003775 Bacteria 221408
27 Ga0055524_1008755 3300003775 Bacteria 4178
28 Ga0055534_1020714 3300003784 Bacteria 1108
29 Ga0055528_1000067 3300003790 Bacteria 83853
30 Ga0055528_1007332 3300003790 Bacteria 4891
31 Ga0055540_1000126 3300003792 Bacteria 78462
32 Ga0055531_10017335 3300003794 Bacteria 3047
33 Ga0055543_1000088 3300004625 Bacteria 80513
34 Ga0055543_1000427 3300004625 Bacteria 26126
35 Ga0055543_1000584 3300004625 Bacteria 20156
36 Ga0065165_1000252 3300005262 Bacteria 93001
37 Ga0065165_1000426 3300005262 Bacteria 66367
38 Ga0065165_1042651 3300005262 Bacteria 1337
39 Ga0070658_10002072 3300005327 Bacteria 16828
40 Ga0070658_10002081 3300005327 Bacteria 16791
41 Ga0070658_10007220 3300005327 Bacteria 8966
42 Ga0070658_10137878 3300005327 Bacteria 2037
43 Ga0070658_10278746 3300005327 Bacteria 1423
44 Ga0070658_10378021 3300005327 Bacteria 1215
45 Ga0070683_100029802 3300005329 Bacteria 4945
46 Ga0070670_100000757 3300005331 Bacteria 25060
47 Ga0070666_10000010 3300005335 Bacteria 264789
48 Ga0070680_100020700 3300005336 Bacteria 5220
49 Ga0070680_100121546 3300005336 Bacteria 2180
50 Ga0068868_100135812 3300005338 Bacteria 2016
51 Ga0070660_100044201 3300005339 Bacteria 3406
52 Ga0070689_100128939 3300005340 Bacteria 2027
53 Ga0070689_100416574 3300005340 Bacteria 1138
54 Ga0070691_10017703 3300005341 Bacteria 3279
55 Ga0070691_10025643 3300005341 Bacteria 2745
56 Ga0070661_100061151 3300005344 Bacteria 2764
57 Ga0070661_100089279 3300005344 Bacteria 2282
58 Ga0070692_10002255 3300005345 Bacteria 7400
59 Ga0070692_10024110 3300005345 Bacteria 2987
60 Ga0070692_10117938 3300005345 Bacteria 1476
61 Ga0070668_100107651 3300005347 Bacteria 2216
62 Ga0070675_100098591 3300005354 Bacteria 2458
63 Ga0070675_100107776 3300005354 Bacteria 2353
64 Ga0070659_100037639 3300005366 Bacteria 3772
65 Ga0070709_10026118 3300005434 Bacteria 3457
66 Ga0070701_10027684 3300005438 Bacteria 2779
67 Ga0070694_100195378 3300005444 Bacteria 1505
68 Ga0070663_100107702 3300005455 Bacteria 2089
69 Ga0070663_100173961 3300005455 Bacteria 1666
70 Ga0070678_100007047 3300005456 Bacteria 6644
71 Ga0070662_100444372 3300005457 Bacteria 1075
72 Ga0070681_10004631 3300005458 Bacteria 13129
73 Ga0070685_10037601 3300005466 Bacteria 2742
74 Ga0070707_100075691 3300005468 Bacteria 3247
75 Ga0070679_100052986 3300005530 Bacteria 4039
76 Ga0070679_100168511 3300005530 Bacteria 2163
77 Ga0070684_100070710 3300005535 Bacteria 3071
78 Ga0070684_100083331 3300005535 Bacteria 2833
79 Ga0068853_100053378 3300005539 Bacteria 3481
80 Ga0068853_100058637 3300005539 Bacteria 3323
81 Ga0068853_100064271 3300005539 Bacteria 3181
82 Ga0068853_100103133 3300005539 Bacteria 2525
83 Ga0068853_100137946 3300005539 Bacteria 2188
84 Ga0068853_100179593 3300005539 Bacteria 1919
85 Ga0070672_100037382 3300005543 Bacteria 3703
86 Ga0070695_100001407 3300005545 Bacteria 13330
87 Ga0070695_100157536 3300005545 Bacteria 1591
88 Ga0070696_100031411 3300005546 Bacteria 3639
89 Ga0070696_100142790 3300005546 Bacteria 1751
90 Ga0070696_100311364 3300005546 Bacteria 1209
91 Ga0070693_100002187 3300005547 Bacteria 8959
92 Ga0070693_100104103 3300005547 Bacteria 1734
93 Ga0070665_100000011 3300005548 Bacteria 525539
94 Ga0070665_100006376 3300005548 Bacteria 12025
95 Ga0070665_100015280 3300005548 Bacteria 7707
96 Ga0070665_100017711 3300005548 Bacteria 7153
97 Ga0070665_100091101 3300005548 Bacteria 3054
98 Ga0070665_100596308 3300005548 Bacteria 1118
99 Ga0068855_100003338 3300005563 Bacteria 19637
100 Ga0068855_100021946 3300005563 Bacteria 7654
101 Ga0068855_100035027 3300005563 Bacteria 5981
102 Ga0068855_100073043 3300005563 Bacteria 3986
103 Ga0068855_100165064 3300005563 Bacteria 2511
104 Ga0070664_100025588 3300005564 Bacteria 4894
105 Ga0068857_100081119 3300005577 Bacteria 2897
106 Ga0068857_100084271 3300005577 Bacteria 2840
107 Ga0068857_100094277 3300005577 Bacteria 2681
108 Ga0068854_100032087 3300005578 Bacteria 3652
109 Ga0068854_100116158 3300005578 Bacteria 2025
110 Ga0068854_100207862 3300005578 Bacteria 1542
111 Ga0068856_100025549 3300005614 Bacteria 5759
112 Ga0068856_100071179 3300005614 Bacteria 3442
113 Ga0068856_100077646 3300005614 Bacteria 3291
114 Ga0070702_100201118 3300005615 Bacteria 1319
115 Ga0068852_100016614 3300005616 Bacteria 5747
116 Ga0068852_100036319 3300005616 Bacteria 4122
117 Ga0068852_100052924 3300005616 Bacteria 3492
118 Ga0068852_100135373 3300005616 Bacteria 2274
119 Ga0068859_100004852 3300005617 Bacteria 13683
120 Ga0068859_100037944 3300005617 Bacteria 4835
121 Ga0068859_100334766 3300005617 Bacteria 1608
122 Ga0068861_100175606 3300005719 Bacteria 1779
123 Ga0068861_100198855 3300005719 Bacteria 1681
124 Ga0068863_100162038 3300005841 Bacteria 2143
125 Ga0068863_100417828 3300005841 Bacteria 1313
126 Ga0068858_100127036 3300005842 Bacteria 2388
127 Ga0068858_100196638 3300005842 Bacteria 1906
128 Ga0081455_10000029 3300005937 Bacteria 155672
129 Ga0081455_10000294 3300005937 Bacteria 66269
130 Ga0081540_1000852 3300005983 Bacteria 27762
131 Ga0081539_10003026 3300005985 Bacteria 21797
132 Ga0075365_10002849 3300006038 Bacteria 8680
133 Ga0075365_10006635 3300006038 Bacteria 6390
134 Ga0075365_10014080 3300006038 Bacteria 4804
135 Ga0075365_10017046 3300006038 Bacteria 4435
136 Ga0075365_10032039 3300006038 Bacteria 3377
137 Ga0075365_10051755 3300006038 Bacteria 2714
138 Ga0075365_10091242 3300006038 Bacteria 2075
139 Ga0075368_10034259 3300006042 Bacteria 1978
140 Ga0075363_100022681 3300006048 Bacteria 3175
141 Ga0075363_100074459 3300006048 Bacteria 1849
142 Ga0075363_100134877 3300006048 Bacteria 1387
143 Ga0075362_10087339 3300006177 Bacteria 1444
144 Ga0075369_10002859 3300006186 Bacteria 6223
145 Ga0075366_10022204 3300006195 Bacteria 3691
146 Ga0097621_100085537 3300006237 Bacteria 2630
147 Ga0075370_10033388 3300006353 Bacteria 2881
148 Ga0068871_100032340 3300006358 Bacteria 4132
149 Ga0075428_100021132 3300006844 Bacteria 7209
150 Ga0075433_10003331 3300006852 Bacteria 12410
151 Ga0075434_100001452 3300006871 Bacteria 19928
152 Ga0075434_100474524 3300006871 Unclassified 1272
153 Ga0097620_100004852 3300006931 Bacteria 13683
154 Ga0097620_100037944 3300006931 Bacteria 4835
155 Ga0097620_100334789 3300006931 Bacteria 1608
156 Ga0075435_100012825 3300007076 Bacteria 6212
157 Ga0075435_100157335 3300007076 Bacteria 1912
158 Ga0105240_10000240 3300009093 Bacteria 109195
159 Ga0105240_10059386 3300009093 Bacteria 4773
160 Ga0105240_10549467 3300009093 Bacteria 1278
161 Ga0111539_10035490 3300009094 Bacteria 6037
162 Ga0111539_10047203 3300009094 Bacteria 5148
163 Ga0111539_10102268 3300009094 Bacteria 3363
164 Ga0105245_10063114 3300009098 Bacteria 3345
165 Ga0105245_10162587 3300009098 Bacteria 2120
166 Ga0114129_10050639 3300009147 Bacteria 5833
167 Ga0114129_10065536 3300009147 Bacteria 5069
168 Ga0114129_10069662 3300009147 Bacteria 4903
169 Ga0114129_10694319 3300009147 Bacteria 1309
170 Ga0114129_10699713 3300009147 Bacteria 1303
171 Ga0105243_10278022 3300009148 Bacteria 1507
172 Ga0105243_10288199 3300009148 Bacteria 1482
173 Ga0105241_10021074 3300009174 Bacteria 4818
174 Ga0105248_10017664 3300009177 Bacteria 7867
175 Ga0105248_10182385 3300009177 Bacteria 2365
176 Ga0105237_10001680 3300009545 Bacteria 28647
177 Ga0105237_10029880 3300009545 Bacteria 5535
178 Ga0105237_10128228 3300009545 Bacteria 2531
179 Ga0105238_10014921 3300009551 Bacteria 7864
180 Ga0105238_10038407 3300009551 Bacteria 4863
181 Ga0105238_10053237 3300009551 Bacteria 4067
182 Ga0105238_10369147 3300009551 Bacteria 1425
183 Ga0105238_10419823 3300009551 Bacteria 1332
184 Ga0105249_10188691 3300009553 Bacteria 2010
185 Ga0105249_10236392 3300009553 Bacteria 1804
186 Ga0123341_1000001 3300009765 Bacteria 314908
187 Ga0105239_10021688 3300010375 Bacteria 7080
188 Ga0105239_10022055 3300010375 Bacteria 7020
189 Ga0105239_10071157 3300010375 Bacteria 3821
190 Ga0105239_10138045 3300010375 Bacteria 2715
191 Ga0105239_10175698 3300010375 Bacteria 2395
192 Ga0105239_10191615 3300010375 Bacteria 2288
193 Ga0157373_10023023 3300013100 Bacteria 4518
194 Ga0157371_10040536 3300013102 Bacteria 3325
195 Ga0157370_10006609 3300013104 Bacteria 12745
196 Ga0157370_10044350 3300013104 Bacteria 4275
197 Ga0157370_10072078 3300013104 Bacteria 3260
198 Ga0157370_10266838 3300013104 Bacteria 1582
199 Ga0157369_10008713 3300013105 Bacteria 11631
200 Ga0157369_10053191 3300013105 Bacteria 4377
201 Ga0157369_10078694 3300013105 Bacteria 3532
202 Ga0157369_10118142 3300013105 Bacteria 2815
203 Ga0157369_10480356 3300013105 Bacteria 1286
204 Ga0171462_1038 3300013250 Bacteria 77485
205 Ga0157378_10214820 3300013297 Bacteria 1825
206 Ga0163162_10031244 3300013306 Bacteria 5282
207 Ga0157372_10071000 3300013307 Bacteria 3920
208 Ga0157372_10372240 3300013307 Bacteria 1664
209 Ga0157375_10027774 3300013308 Bacteria 5294
210 Ga0163163_10062475 3300014325 Bacteria 3691
211 Ga0182008_10044863 3300014497 Bacteria 2198
212 Ga0157379_10014721 3300014968 Bacteria 6861
213 Ga0157376_10278400 3300014969 Bacteria 1575
214 Ga0182007_10000579 3300015262 Bacteria 21512
215 Ga0183369_1003 3300015685 Bacteria 726443
216 Ga0163161_10080820 3300017792 Bacteria 2393
217 Ga0163161_10164974 3300017792 Bacteria 1691
218 Ga0197907_10366558 3300020069 Bacteria 2318
219 Ga0206352_10683019 3300020078 Bacteria 3128
220 Ga0206353_11357698 3300020082 Bacteria 3339
221 Ga0214544_1000012 3300021320 Bacteria 229808
222 Ga0214544_1000123 3300021320 Bacteria 110258
223 Ga0214542_1000011 3300021321 Bacteria 238260
224 Ga0214542_1000141 3300021321 Bacteria 104386
225 Ga0214543_1000004 3300021327 Bacteria 527190
226 Ga0214543_1000026 3300021327 Bacteria 220652
227 Ga0213876_10142394 3300021384 Bacteria 1275
228 Ga0209436_100017 3300025208 Bacteria 116238
229 Ga0209437_100064 3300025233 Bacteria 334360
230 Ga0207425_1002417 3300025245 Bacteria 6576
231 Ga0209026_1000002 3300025250 Bacteria 1136158
232 Ga0209677_100261 3300025253 Bacteria 35631
233 Ga0209148_1000123 3300025254 Bacteria 185406
234 Ga0209759_1000677 3300025256 Bacteria 31109
235 Ga0209129_1000846 3300025258 Bacteria 19175
236 Ga0209129_1008892 3300025258 Bacteria 2723
237 Ga0209233_1000081 3300025261 Bacteria 336832
238 Ga0209233_1000131 3300025261 Bacteria 205257
239 Ga0209233_1000203 3300025261 Bacteria 118984
240 Ga0209233_1020783 3300025261 Bacteria 1713
241 Ga0209455_1000129 3300025272 Bacteria 161691
242 Ga0209673_1000310 3300025273 Bacteria 89821
243 Ga0209673_1000348 3300025273 Bacteria 84966
244 Ga0209673_1003692 3300025273 Bacteria 8802
245 Ga0209673_1007972 3300025273 Bacteria 4778
246 Ga0209130_1000001 3300025284 Bacteria 831557
247 Ga0209130_1000116 3300025284 Bacteria 129549
248 Ga0209130_1000162 3300025284 Bacteria 99549
249 Ga0209675_1000454 3300025291 Bacteria 31669
250 Ga0209676_1012158 3300025292 Bacteria 3411
251 Ga0209025_1000016 3300025294 Bacteria 770739
252 Ga0209025_1000097 3300025294 Bacteria 236632
253 Ga0209025_1001381 3300025294 Bacteria 32419
254 Ga0209025_1031157 3300025294 Bacteria 2530
255 Ga0209564_1000023 3300025295 Bacteria 555102
256 Ga0209564_1000076 3300025295 Bacteria 283602
257 Ga0209564_1000137 3300025295 Bacteria 183874
258 Ga0209564_1001306 3300025295 Bacteria 26845
259 Ga0209564_1007213 3300025295 Bacteria 5787
260 Ga0209758_1000237 3300025297 Bacteria 115867
261 Ga0209758_1000714 3300025297 Bacteria 49025
262 Ga0209758_1003449 3300025297 Bacteria 14359
263 Ga0209758_1007231 3300025297 Bacteria 7639
264 Ga0209758_1007411 3300025297 Bacteria 7479
265 Ga0209758_1044995 3300025297 Bacteria 1607
266 Ga0209050_1003339 3300025298 Bacteria 11961
267 Ga0209256_1000083 3300025299 Bacteria 221460
268 Ga0209256_1000397 3300025299 Bacteria 68947
269 Ga0209256_1000608 3300025299 Bacteria 49615
270 Ga0209256_1005667 3300025299 Bacteria 7032
271 Ga0209256_1015266 3300025299 Bacteria 2697
272 Ga0207426_1000005 3300025302 Bacteria 1037188
273 Ga0207426_1000094 3300025302 Bacteria 275293
274 Ga0207426_1000126 3300025302 Bacteria 213341
275 Ga0207426_1013435 3300025302 Bacteria 3035
276 Ga0209051_1000201 3300025303 Bacteria 106123
277 Ga0209051_1001477 3300025303 Bacteria 19852
278 Ga0209051_1025419 3300025303 Bacteria 2410
279 Ga0209257_1011130 3300025304 Bacteria 4391
280 Ga0209257_1011250 3300025304 Bacteria 4341
281 Ga0207656_10008147 3300025321 Bacteria 3848
282 Ga0207688_10020840 3300025901 Bacteria 3579
283 Ga0207680_10000002 3300025903 Bacteria 1018646
284 Ga0207647_10000814 3300025904 Bacteria 24217
285 Ga0207647_10113455 3300025904 Bacteria 1602
286 Ga0207699_10064183 3300025906 Bacteria 2221
287 Ga0207705_10020706 3300025909 Bacteria 4696
288 Ga0207705_10023951 3300025909 Bacteria 4356
289 Ga0207705_10035193 3300025909 Bacteria 3582
290 Ga0207705_10126898 3300025909 Bacteria 1897
291 Ga0207705_10215823 3300025909 Bacteria 1456
292 Ga0207705_10302616 3300025909 Bacteria 1227
293 Ga0207654_10066527 3300025911 Bacteria 2126
294 Ga0207707_10000055 3300025912 Bacteria 114355
295 Ga0207707_10043942 3300025912 Bacteria 3896
296 Ga0207695_10004364 3300025913 Bacteria 19374
297 Ga0207695_10114591 3300025913 Bacteria 2670
298 Ga0207695_10145402 3300025913 Bacteria 2316
299 Ga0207695_10367983 3300025913 Bacteria 1324
300 Ga0207671_10000954 3300025914 Bacteria 35929
301 Ga0207671_10009485 3300025914 Bacteria 8130
302 Ga0207671_10050328 3300025914 Bacteria 3085
303 Ga0207660_10011441 3300025917 Bacteria 5777
304 Ga0207660_10028276 3300025917 Bacteria 3834
305 Ga0207657_10050242 3300025919 Bacteria 3629
306 Ga0207657_10050657 3300025919 Bacteria 3613
307 Ga0207649_10008479 3300025920 Bacteria 5605
308 Ga0207649_10027574 3300025920 Bacteria 3334
309 Ga0207652_10013061 3300025921 Bacteria 6721
310 Ga0207652_10045998 3300025921 Bacteria 3722
311 Ga0207652_10142218 3300025921 Bacteria 2146
312 Ga0207652_10143083 3300025921 Bacteria 2139
313 Ga0207694_10017716 3300025924 Bacteria 5382
314 Ga0207694_10123583 3300025924 Bacteria 2068
315 Ga0207650_10003845 3300025925 Bacteria 10260
316 Ga0207659_10034317 3300025926 Bacteria 3497
317 Ga0207659_10047901 3300025926 Bacteria 3025
318 Ga0207687_10030087 3300025927 Bacteria 3658
319 Ga0207687_10058536 3300025927 Bacteria 2711
320 Ga0207686_10077328 3300025934 Bacteria 2160
321 Ga0207709_10178288 3300025935 Bacteria 1498
322 Ga0207709_10194027 3300025935 Bacteria 1445
323 Ga0207670_10332861 3300025936 Bacteria 1198
324 Ga0207691_10030381 3300025940 Bacteria 5050
325 Ga0207711_10020415 3300025941 Bacteria 5523
326 Ga0207711_10079868 3300025941 Bacteria 2856
327 Ga0207689_10045571 3300025942 Bacteria 3625
328 Ga0207689_10161342 3300025942 Bacteria 1847
329 Ga0207661_10046420 3300025944 Bacteria 3444
330 Ga0207661_10058976 3300025944 Bacteria 3091
331 Ga0207679_10016650 3300025945 Bacteria 4883
332 Ga0207667_10005105 3300025949 Bacteria 16036
333 Ga0207667_10014559 3300025949 Bacteria 8959
334 Ga0207667_10045678 3300025949 Bacteria 4638
335 Ga0207667_10056025 3300025949 Bacteria 4142
336 Ga0207667_10097519 3300025949 Bacteria 3034
337 Ga0207667_10132169 3300025949 Bacteria 2571
338 Ga0207667_10133015 3300025949 Bacteria 2562
339 Ga0207667_10168304 3300025949 Bacteria 2253
340 Ga0207667_10293393 3300025949 Bacteria 1661
341 Ga0207651_10073895 3300025960 Bacteria 2426
342 Ga0207640_10002595 3300025981 Bacteria 9675
343 Ga0207640_10015023 3300025981 Bacteria 4472
344 Ga0207640_10194806 3300025981 Bacteria 1530
345 Ga0207677_10082318 3300026023 Bacteria 2312
346 Ga0207703_10100589 3300026035 Bacteria 2450
347 Ga0207639_10009316 3300026041 Bacteria 6768
348 Ga0207639_10048880 3300026041 Bacteria 3204
349 Ga0207678_10009691 3300026067 Bacteria 8474
350 Ga0207678_10016380 3300026067 Bacteria 6508
351 Ga0207678_10054552 3300026067 Bacteria 3442
352 Ga0207678_10055067 3300026067 Bacteria 3426
353 Ga0207678_10149474 3300026067 Bacteria 1994
354 Ga0207678_10257452 3300026067 Bacteria 1495
355 Ga0207708_10075150 3300026075 Bacteria 2590
356 Ga0207702_10009763 3300026078 Bacteria 8056
357 Ga0207702_10010702 3300026078 Bacteria 7664
358 Ga0207702_10070976 3300026078 Bacteria 2997
359 Ga0207641_10150356 3300026088 Bacteria 2108
360 Ga0207648_10224707 3300026089 Bacteria 1669
361 Ga0207648_10367090 3300026089 Bacteria 1299
362 Ga0207674_10023597 3300026116 Bacteria 6587
363 Ga0207674_10033759 3300026116 Bacteria 5355
364 Ga0207674_10104549 3300026116 Bacteria 2810
365 Ga0207674_10127982 3300026116 Bacteria 2504
366 Ga0207674_10222471 3300026116 Bacteria 1836
367 Ga0207675_100227721 3300026118 Bacteria 1798
368 Ga0207683_10257841 3300026121 Bacteria 1592
369 Ga0207683_10381886 3300026121 Bacteria 1295
370 Ga0207698_10025062 3300026142 Bacteria 4196
371 Ga0207698_10027215 3300026142 Bacteria 4056
372 Ga0207698_10035692 3300026142 Bacteria 3640
373 Ga0207698_10036666 3300026142 Bacteria 3602
374 Ga0207698_10108065 3300026142 Bacteria 2324
375 Ga0207698_10404730 3300026142 Bacteria 1305
376 Ga0207428_10019169 3300027907 Bacteria 5833
377 Ga0268266_10000058 3300028379 Bacteria 277346
378 Ga0268266_10000341 3300028379 Bacteria 72917
379 Ga0268266_10069982 3300028379 Bacteria 3041
380 Ga0268266_10100371 3300028379 Bacteria 2550
381 Ga0268266_10102193 3300028379 Bacteria 2528
382 Ga0268266_10351233 3300028379 Bacteria 1386
383 Ga0268266_10538743 3300028379 Bacteria 1117
384 Ga0307515_10003211 3300028794 Bacteria 34601
385 Ga0307515_10271523 3300028794 Bacteria 1416
386 Ga0265328_10000006 3300031239 Bacteria 227698
387 Ga0265328_10000118 3300031239 Bacteria 37735
388 Ga0265328_10007907 3300031239 Bacteria 4414
389 Ga0265329_10003623 3300031242 Bacteria 6670
390 Ga0265331_10000673 3300031250 Bacteria 29339
391 Ga0265327_10002843 3300031251 Bacteria 17456
392 Ga0265316_10000091 3300031344 Bacteria 96882
393 Ga0265314_10066772 3300031711 Bacteria 2425
394 Ga0307412_10253786 3300031911 Bacteria 1367
395 Ga0307414_10102536 3300032004 Bacteria 2157
396 Ga0316593_10060931 3300032168 Bacteria 1290
397 Ga0373949_0027276 3300035090 Bacteria 1342
398 Ga0373932_0004795 3300035112 Bacteria 3189
399 Ga0373939_0068710 3300035114 Bacteria 1148
400 Ga0373941_0017205 3300035115 Bacteria 1977
401 Ga0373961_0004892 3300035241 Bacteria 3218
402 Ga0373961_0014937 3300035241 Bacteria 1978
403 Ga0373962_0017069 3300035242 Bacteria 1879
404 Ga0316574_0006394 3300035398 Bacteria 6369
405 Ga0316574_0092360 3300035398 Bacteria 1931
406 Ga0373931_0001004 3300035691 Bacteria 11938
407 Ga0373931_0001344 3300035691 Bacteria 10519
408 Ga0373931_0033370 3300035691 Bacteria 2667
409 Ga0373927_0000655 3300035695 Bacteria 26267
410 Ga0373933_0112988 3300035724 Bacteria 1696
411 Ga0373937_0041118 3300036401 Bacteria 4217
412 Ga0373937_0067125 3300036401 Bacteria 3305
413 Ga0316584_0200165 3300036712 Bacteria 1474
414 Ga0373925_0121191 3300037068 Bacteria 2030
415 Ga0373925_0178668 3300037068 Bacteria 1679
416 Ga0395900_0029543 3300037418 Bacteria 5623
417 Ga0395900_0037536 3300037418 Bacteria 4994
418 Ga0395900_0038974 3300037418 Bacteria 4898
419 Ga0395900_0266195 3300037418 Bacteria 1710
420 Ga0395905_0012798 3300037471 Bacteria 8068
421 Ga0395905_0034198 3300037471 Bacteria 4772
422 Ga0395905_0379391 3300037471 Bacteria 1307
423 Ga0395901_0049578 3300038443 Bacteria 4363
424 Ga0395901_0139646 3300038443 Bacteria 2547
425 Ga0395901_0174426 3300038443 Bacteria 2255
426 Ga0395901_0305593 3300038443 Bacteria 1648
427 Ga0400483_121163 3300039062 Bacteria 5810
428 Ga0436365_0331535 3300039437 Bacteria 5432
429 Ga0436365_0427085 3300039437 Bacteria 3722
430 Ga0436365_0570842 3300039437 Bacteria 2531
431 Ga0451851_1016416 3300041507 Bacteria 1113
432 Ga0439458_0012238 3300042157 Bacteria 1924
433 Ga0451577_0209910 3300042876 Bacteria 1759
434 Ga0466966_0031658 3300044684 Bacteria 3430
435 Ga0466961_0163786 3300044693 Bacteria 1385
436 Ga0466968_0014091 3300044735 Bacteria 3154
437 Ga0466957_0026795 3300044842 Bacteria 3421
438 Ga0466960_0121422 3300044901 Bacteria 1369
439 Ga0451576_0092705 3300045051 Bacteria 3142
440 Ga0466967_0396673 3300045976 Bacteria 1342
441 Ga0495638_0004237 3300046460 Bacteria 10914
442 Ga0495638_0007074 3300046460 Bacteria 8094
443 Ga0495651_0004728 3300046462 Bacteria 10423
444 Ga0495653_0039248 3300046463 Bacteria 3710
445 Ga0495580_0181961 3300046472 Bacteria 1451
446 Ga0495584_0049250 3300046491 Bacteria 2123
447 Ga0495585_0044733 3300046492 Bacteria 2473
448 Ga0495596_0044690 3300046500 Bacteria 1743
449 Ga0495583_0007688 3300046506 Bacteria 6718
450 Ga0495606_0018719 3300046507 Bacteria 5182
451 Ga0495606_0020615 3300046507 Bacteria 4852
452 Ga0495610_0065394 3300046512 Bacteria 1716
453 Ga0495630_0177876 3300046517 Bacteria 1622
454 Ga0495631_0019052 3300046518 Bacteria 3223
455 Ga0495632_0003180 3300046519 Bacteria 11837
456 Ga0495637_0000031 3300046520 Bacteria 128804
457 Ga0495643_0001093 3300046522 Bacteria 26979
458 Ga0495643_0050024 3300046522 Bacteria 2251
459 Ga0495642_0014178 3300046528 Bacteria 3088
460 Ga0495652_0096772 3300046529 Bacteria 2403
461 Ga0495654_0044876 3300046530 Bacteria 2183
462 Ga0495645_0009300 3300046543 Bacteria 6872
463 Ga0495667_0014739 3300046559 Bacteria 5283
464 Ga0495625_0059224 3300046660 Bacteria 2718
465 Ga0495625_0070660 3300046660 Bacteria 2451
466 Ga0495625_0127831 3300046660 Bacteria 1724
467 Ga0495588_0142613 3300046674 Bacteria 1266
468 Ga0495599_0036140 3300046678 Bacteria 3101
469 Ga0495623_0031813 3300046679 Bacteria 3392
470 Ga0495646_0143242 3300046680 Bacteria 1335
471 Ga0495649_0000683 3300046694 Bacteria 27625
472 Ga0495604_0021224 3300047317 Bacteria 5185
473 Ga0495604_0156254 3300047317 Bacteria 1615
474 Ga0495681_0042682 3300047470 Bacteria 2193
475 Ga0495684_0149182 3300047471 Bacteria 1749
476 Ga0495686_0058680 3300047472 Bacteria 2398
477 Ga0495626_0055112 3300048091 Bacteria 1824
478 Ga0496101_0224978 3300048904 Bacteria 1457
479 Ga0496102_0145969 3300048905 Bacteria 2221
480 Ga0496102_0399331 3300048905 Bacteria 1292
481 Ga0496104_0015271 3300048907 Bacteria 6954
482 Ga0496105_0036616 3300048908 Bacteria 4043
483 Ga0496106_0000401 3300048909 Bacteria 30792
484 Ga0496106_0233272 3300048909 Bacteria 1470
485 Ga0496108_0022536 3300048911 Bacteria 5179
486 Ga0496108_0103592 3300048911 Bacteria 2428
487 Ga0496109_0047565 3300048912 Bacteria 3901
488 Ga0496109_0047873 3300048912 Bacteria 3889
489 Ga0496110_0041946 3300048913 Bacteria 3994
490 Ga0496110_0070044 3300048913 Bacteria 3106
491 Ga0496112_0019439 3300048915 Bacteria 6412
492 Ga0496112_0169741 3300048915 Bacteria 2147
493 Ga0496114_0051537 3300048917 Bacteria 3427
494 Ga0496115_0004185 3300048918 Bacteria 10427
495 Ga0496115_0018349 3300048918 Bacteria 5369
496 Ga0496116_0074862 3300048919 Bacteria 2127
497 Ga0496116_0106400 3300048919 Bacteria 1661
498 Ga0496117_0010266 3300048920 Bacteria 8569
499 Ga0496118_0002144 3300048921 Bacteria 27530
500 Ga0496118_0043074 3300048921 Bacteria 3553
501 Ga0496119_0008989 3300048922 Bacteria 8672
502 Ga0496119_0045119 3300048922 Bacteria 2767
503 Ga0496120_0001004 3300048923 Bacteria 38046
504 Ga0496120_0001561 3300048923 Bacteria 26795
505 Ga0496121_0003845 3300048924 Bacteria 20886
506 Ga0496121_0152626 3300048924 Bacteria 1698
507 Ga0496122_0016018 3300048925 Bacteria 7125
508 Ga0496122_0023231 3300048925 Bacteria 5475
509 Ga0496123_0012214 3300048926 Bacteria 7347
510 Ga0496123_0039515 3300048926 Bacteria 3299
511 Ga0496123_0088876 3300048926 Bacteria 1842
512 Ga0496124_0012766 3300048927 Bacteria 8258
513 Ga0496124_0017382 3300048927 Bacteria 6778
514 Ga0496124_0049375 3300048927 Bacteria 3590
515 Ga0496124_0053093 3300048927 Bacteria 3439
516 Ga0496125_0005411 3300048928 Bacteria 14223
517 Ga0496125_0093585 3300048928 Bacteria 2242
518 Ga0496126_0131020 3300048929 Bacteria 2167
519 Ga0495678_003335 3300049459 Bacteria 10007
520 Ga0501031_0052291 3300049568 Bacteria 2661
521 Ga0501032_0010364 3300049569 Bacteria 6720
522 Ga0501032_0257707 3300049569 Bacteria 1131
523 Ga0501033_0000035 3300049570 Bacteria 150558
524 Ga0501033_0001819 3300049570 Bacteria 18627
525 Ga0501033_0035544 3300049570 Bacteria 3735
526 Ga0501033_0052647 3300049570 Bacteria 3017
527 Ga0501033_0056482 3300049570 Bacteria 2901
528 Ga0501033_0090710 3300049570 Bacteria 2236
529 Ga0501034_0002386 3300049571 Bacteria 22800
530 Ga0501034_0076388 3300049571 Bacteria 3356
531 Ga0501034_0098015 3300049571 Bacteria 2927
532 Ga0501034_0141561 3300049571 Bacteria 2384
533 Ga0501037_0000544 3300049573 Bacteria 30056
534 Ga0501037_0116886 3300049573 Bacteria 1919
535 Ga0501043_0000081 3300049579 Bacteria 85059
536 Ga0501043_0047049 3300049579 Bacteria 3391
537 Ga0501043_0052048 3300049579 Bacteria 3217
538 Ga0501046_0125104 3300049580 Bacteria 1954
539 Ga0501046_0338851 3300049580 Bacteria 1093
540 Ga0501047_0010894 3300049581 Bacteria 8598
541 Ga0501047_0028624 3300049581 Bacteria 5373
542 Ga0501047_0057007 3300049581 Bacteria 3778
543 Ga0501047_0057636 3300049581 Bacteria 3756
544 Ga0501047_0082646 3300049581 Bacteria 3087
545 Ga0501047_0203903 3300049581 Bacteria 1838
546 Ga0501048_0253740 3300049582 Bacteria 1249
547 Ga0501067_0111166 3300049583 Bacteria 1523
548 Ga0501067_0160516 3300049583 Bacteria 1252
549 Ga0501068_0002018 3300049584 Bacteria 10801
550 Ga0501069_0000134 3300049585 Bacteria 32368
551 Ga0501069_0007803 3300049585 Bacteria 5619
552 Ga0501069_0091103 3300049585 Bacteria 1724
553 Ga0501070_0000127 3300049586 Bacteria 68100
554 Ga0501070_0002984 3300049586 Bacteria 14734
555 Ga0501070_0003125 3300049586 Bacteria 14415
556 Ga0501070_0019893 3300049586 Bacteria 5630
557 Ga0501070_0046685 3300049586 Bacteria 3601
558 Ga0501070_0149083 3300049586 Bacteria 1930
559 Ga0501070_0239053 3300049586 Bacteria 1487
560 Ga0501071_0003589 3300049587 Bacteria 9718
561 Ga0501073_0000445 3300049589 Bacteria 28558
562 Ga0501073_0076615 3300049589 Bacteria 2327
563 Ga0501074_0000062 3300049590 Bacteria 51831
564 Ga0501074_0000251 3300049590 Bacteria 30181
565 Ga0501076_0089325 3300049592 Bacteria 2477
566 Ga0501076_0090440 3300049592 Bacteria 2462
567 Ga0501080_0003969 3300049742 Bacteria 13102
568 Ga0501080_0009602 3300049742 Bacteria 8832
569 Ga0501080_0029534 3300049742 Bacteria 5103
570 Ga0501080_0179828 3300049742 Bacteria 1947
571 Ga0501080_0343242 3300049742 Bacteria 1349
572 Ga0501080_0496466 3300049742 Bacteria 1091
573 Ga0501083_0000090 3300049744 Bacteria 62000
574 Ga0501083_0003993 3300049744 Bacteria 10365
575 Ga0501083_0007064 3300049744 Bacteria 7969
576 Ga0501035_0000017 3300049822 Bacteria 241915
577 Ga0501035_0004245 3300049822 Bacteria 13610
578 Ga0501035_0004321 3300049822 Bacteria 13498
579 Ga0501035_0013116 3300049822 Bacteria 7647
580 Ga0501035_0034269 3300049822 Bacteria 4614
581 Ga0501035_0085951 3300049822 Bacteria 2772
582 Ga0501035_0201291 3300049822 Bacteria 1708
583 Ga0501035_0215921 3300049822 Bacteria 1639
584 Ga0501044_0000034 3300049823 Bacteria 164058
585 Ga0501044_0003154 3300049823 Bacteria 18649
586 Ga0501044_0022766 3300049823 Bacteria 6672
587 Ga0501044_0053672 3300049823 Bacteria 4146
588 Ga0501044_0058582 3300049823 Bacteria 3949
589 Ga0501044_0072621 3300049823 Bacteria 3498
590 Ga0501044_0095442 3300049823 Bacteria 2997
591 Ga0501044_0118976 3300049823 Bacteria 2644
592 Ga0501044_0194282 3300049823 Bacteria 1990
593 nmdc:mga03n38_129080_c1 3300050490 Bacteria 1251
594 nmdc:mga03n38_24034_c1 3300050490 Bacteria 2487
595 nmdc:mga03n38_36100_c1 3300050490 Bacteria 2123
596 nmdc:mga0yw44_11566_c1 3300050492 Bacteria 4564
597 nmdc:mga0yw44_24937_c2 3300050492 Bacteria 2177
598 nmdc:mga0yw44_26416_c1 3300050492 Bacteria 3316
599 nmdc:mga0yw44_32066_c1 3300050492 Bacteria 3059
600 nmdc:mga0yw44_471_c1 3300050492 Bacteria 4203
601 nmdc:mga0yw44_48432_c1 3300050492 Bacteria 2563
602 nmdc:mga0k408_211013_c1 3300050493 Bacteria 1159
603 nmdc:mga07m45_175927_c1 3300050496 Bacteria 1244
604 nmdc:mga05p37_145165_c1 3300050507 Bacteria 2906
605 nmdc:mga05p37_171888_c1 3300050507 Bacteria 2642
606 nmdc:mga05p37_39318_c1 3300050507 Bacteria 5807
607 nmdc:mga05p37_39437_c1 3300050507 Bacteria 5799
608 nmdc:mga05p37_545708_c1 3300050507 Bacteria 1321
609 nmdc:mga05p37_719286_c1 3300050507 Bacteria 1106
610 nmdc:mga09592_174944_c1 3300050508 Bacteria 1857
611 nmdc:mga0qj67_154876_c1 3300050509 Bacteria 1860
612 nmdc:mga0qj67_25049_c1 3300050509 Bacteria 4606
613 nmdc:mga06r32_24241_c1 3300050510 Bacteria 5628
614 nmdc:mga08y16_121585_c1 3300050511 Bacteria 2717
615 nmdc:mga08y16_574_c1 3300050511 Bacteria 34234
616 nmdc:mga08y16_63075_c1 3300050511 Bacteria 3870
617 nmdc:mga0n895_2333_c1 3300050512 Bacteria 14787
618 nmdc:mga0n895_272157_c1 3300050512 Bacteria 1718
619 nmdc:mga0rr50_48130_c1 3300050513 Bacteria 3150
620 nmdc:mga0rr50_54180_c1 3300050513 Bacteria 2987
621 nmdc:mga08x19_29877_c1 3300050514 Bacteria 3420
622 nmdc:mga08x19_98073_c1 3300050514 Bacteria 1941
623 nmdc:mga0a205_152411_c1 3300050515 Bacteria 2210
624 nmdc:mga0a205_222521_c1 3300050515 Bacteria 1772
625 nmdc:mga0a205_233218_c1 3300050515 Bacteria 1723
626 nmdc:mga0a205_351427_c1 3300050515 Bacteria 1341
627 nmdc:mga0a205_4123_c1 3300050515 Bacteria 13005
628 Ga0495601_0170919 3300053077 Bacteria 1421
629 Ga0500610_0003042 3300053079 Bacteria 6338
630 Ga0495595_0062344 3300053084 Bacteria 1748
631 Ga0495619_0009128 3300053085 Bacteria 6261
632 Ga0495619_0086549 3300053085 Bacteria 2118
633 Ga0500651_0003441 3300053093 Bacteria 8653
634 Ga0500555_003771 3300053103 Bacteria 4313
635 Ga0500592_000996 3300053116 Bacteria 4622
636 Ga0500595_000648 3300053119 Bacteria 20943
637 Ga0500607_104104 3300053121 Bacteria 1404
638 Ga0500608_056464 3300053122 Bacteria 1881
639 Ga0500568_0000048 3300053139 Bacteria 119025
640 Ga0500568_0001015 3300053139 Bacteria 19219
641 Ga0500568_0105254 3300053139 Bacteria 1057
642 Ga0500590_004310 3300053148 Bacteria 6696
643 Ga0500604_0007188 3300053151 Bacteria 2948
644 Ga0500616_0000102 3300053153 Bacteria 168834
645 Ga0500616_0006999 3300053153 Bacteria 7254
646 Ga0500616_0007353 3300053153 Bacteria 7019
647 Ga0500616_0041254 3300053153 Bacteria 2478
648 Ga0500622_0000533 3300053156 Bacteria 35317
649 Ga0500622_0002086 3300053156 Bacteria 14890
650 Ga0500627_0000005 3300053158 Bacteria 167950
651 Ga0500634_0009499 3300053161 Bacteria 4926
652 Ga0500636_0007347 3300053177 Bacteria 6368
653 Ga0500611_022805 3300053727 Bacteria 1212
654 Ga0500645_010428 3300053730 Bacteria 3076
655 Ga0501084_0049799 3300054114 Bacteria 3507
656 Ga0501082_0161870 3300060353 Bacteria 1945
657 Ga0466962_0024458 3300061719 Bacteria 2901
658 2503203072 2503198000 Bacteria 6884444
659 2509078232 2508501114 Bacteria 7082538
660 2509110166 2508501122 Bacteria 6292184
661 2509114793 2508501123 Bacteria 6283661
662 2509143388 2508501127 Bacteria 7037543
663 2509373752 2509276018 Bacteria 6910194
664 2509397537 2509276022 Bacteria 6200534
665 2510319390 2510065059 Bacteria 6847884
666 2510893961 2510461076 Bacteria 8618824
667 2510898986 2510461076 Bacteria 8618824
668 2511136423 2510917022 Bacteria 6504556
669 2511174477 2510917026 Bacteria 7046020
670 2511198317 2510917030 Bacteria 7460662
671 2511391073 2511231027 Bacteria 5013807
672 2512930117 2512875016 Bacteria 6529530
673 2512964804 2512875024 Bacteria 7195110
674 2513611810 2513237090 Bacteria 7096802
675 2514033099 2513237164 Bacteria 7563725
676 2514422467 2513237305 Bacteria 7293571
677 2515111621 2515075009 Bacteria 7288508
678 2515638230 2515154113 Bacteria 7807172
679 2520376276 2519899620 Bacteria 6499161
680 2558864543 2558860100 Bacteria 8458965
681 2585167982 2582581283 Bacteria 6030556
682 2585221746 2582581298 Bacteria 7315509
683 2585232021 2582581299 Bacteria 6518058
684 2585274790 2582581307 Bacteria 6597605
685 2585278554 2582581308 Bacteria 7413247
686 2585324587 2582581315 Bacteria 7318924
687 2585335455 2582581316 Bacteria 7774528
688 2585392382 2582581866 Bacteria 6859583
689 2585528948 2585427526 Bacteria 7258840
690 2585535405 2585427527 Bacteria 7273426
691 2585540081 2585427528 Bacteria 6842387
692 2585544084 2585427529 Bacteria 7395659
693 2585556792 2585427530 Bacteria 7383882
694 2585562156 2585427531 Bacteria 6992870
695 2585838279 2585427593 Bacteria 7141551
696 2585907902 2585427609 Bacteria 6667127
697 2585996318 2585427633 Bacteria 6413184
698 2586000926 2585427634 Bacteria 6455027
699 2587983322 2585428125 Bacteria 6662905
700 2588515733 2588253730 Bacteria 6881675
701 2597814804 2597489875 Bacteria 7010078
702 2599937373 2599185301 Bacteria 6161860
703 2616308072 2615840626 Bacteria 7921970
704 2643773523 2643221550 Bacteria 4619371
705 2643986633 2643221595 Bacteria 6565519
706 2644051071 2643221607 Bacteria 6314006
707 2644157568 2643221627 Bacteria 6761570
708 2644205551 2643221636 Bacteria 6583769
709 2644483975 2643221686 Bacteria 6310811
710 2644733394 2643221734 Bacteria 5365412
711 2644744770 2643221736 Bacteria 6608466
712 2692320028 2690316117 Bacteria 6800650
713 2694634003 2693429783 Bacteria 7019804
714 2694638626 2693429784 Bacteria 7241525
715 2719385179 2718217927 Bacteria 6972593
716 2719664942 2718217997 Bacteria 6740740
717 2720491362 2718218199 Bacteria 6740745
718 2720612722 2718218232 Bacteria 6720332
719 2720619562 2718218233 Bacteria 6662049
720 2721398899 2718218423 Bacteria 6438183
721 2723026380 2721755556 Bacteria 6745503
722 2723559923 2721755684 Bacteria 6859907
723 2723576730 2721755686 Bacteria 7343952
724 2724037712 2721755809 Bacteria 6438790
725 2724109644 2721755823 Bacteria 6752556
726 2725951617 2724679232 Bacteria 7646494
727 2730107316 2728369352 Bacteria 6745171
728 2739037796 2738541333 Bacteria 7106503
729 2739652009 2739367664 Bacteria 4114334
730 2740030483 2739367865 Bacteria 4114482
731 2756677845 2756170246 Bacteria 7451806
732 2765467222 2765235802 Bacteria 5618596
733 2774870922 2773857925 Bacteria 6472445
734 2776259481 2775506901 Bacteria 9631051
735 2776273026 2775506902 Bacteria 6208009
736 2776282131 2775506904 Bacteria 5954060
737 2792582460 2791355082 Bacteria 5973319
738 2792641497 2791355094 Bacteria 7011481
739 2792643492 2791355094 Bacteria 7011481
740 2792748911 2791355123 Bacteria 8049106
741 2793296966 2791355256 Bacteria 6798008
742 2793315460 2791355259 Bacteria 7254731
743 2793321430 2791355260 Bacteria 6598818
744 2793342618 2791355263 Bacteria 6872478
745 2793350231 2791355264 Bacteria 6429314
746 2793352071 2791355265 Bacteria 6539969
747 2793366161 2791355267 Bacteria 7222458
748 2805937970 2802429606 Bacteria 6346811
749 2806048557 2802429633 Bacteria 7341974
750 2806056195 2802429634 Bacteria 7083200
751 2806063203 2802429635 Bacteria 7650140
752 2806070451 2802429636 Bacteria 7597525
753 2806077792 2802429637 Bacteria 7067217
754 2819608111 2818991448 Bacteria 6772224
755 2819641001 2818991453 Bacteria 7181617
756 2819717468 2818991467 Bacteria 5893227
757 2835314510 2835312727 Bacteria 7413381
758 2838018508 2838016132 Bacteria 6577831
759 2838054077 2838048938 Bacteria 6044578
760 2838066580 2838061910 Bacteria 6794874
761 2838077535 2838074704 Bacteria 6785777
762 2838669766 2838668709 Bacteria 6671819
763 2838682861 2838680041 Bacteria 6545511
764 2838697493 2838694306 Bacteria 6853137
765 2838702138 2838701080 Bacteria 6669771
766 2838709329 2838707686 Bacteria 6619912
767 2839996441 2839993093 Bacteria 5512535
768 2840770379 2840764183 Bacteria 6358399
769 2841762918 2841760612 Bacteria 6454112
770 2841916962 2841911363 Bacteria 6173697
771 2841922583 2841917233 Bacteria 6173500
772 2842077439 2842077413 Bacteria 6508645
773 2842111211 2842110456 Bacteria 7656360
774 2842120052 2842118031 Bacteria 7033875
775 2842147317 2842146304 Bacteria 5957337
776 2842197253 2842192696 Bacteria 6147454
777 2842201347 2842198810 Bacteria 6608673
778 2842206642 2842205361 Bacteria 6340321
779 2842238740 2842237096 Bacteria 6620661
780 2842252383 2842250916 Bacteria 6579627
781 2842268672 2842264693 Bacteria 6472963
782 2842280099 2842278818 Bacteria 6340002
783 2842287823 2842285085 Bacteria 6011953
784 2842291101 2842291075 Bacteria 7076806
785 2842309889 2842304105 Bacteria 7023636
786 2842315109 2842311132 Bacteria 6616990
787 2842373490 2842370503 Bacteria 7038661
788 2842377497 2842377471 Bacteria 7140707
789 2842386563 2842384541 Bacteria 7057858
790 2842399753 2842395702 Bacteria 6780583
791 2842404649 2842402390 Bacteria 6681310
792 2842411232 2842409023 Bacteria 6687331
793 2842418319 2842415677 Bacteria 6596907
794 2842432805 2842428310 Bacteria 6767288
795 2842439110 2842434925 Bacteria 6502746
796 2842445739 2842441272 Bacteria 6769273
797 2842451411 2842447887 Bacteria 6754142
798 2842466909 2842462802 Bacteria 6588055
799 2842473724 2842469257 Bacteria 6752936
800 2842500535 2842495871 Bacteria 6820686
801 2842874203 2842871566 Bacteria 4827117
802 2844005986 2844002411 Bacteria 7168230
803 2844015197 2844009547 Bacteria 6728125
804 2844109212 2844104063 Bacteria 6440972
805 2847420547 2847417321 Bacteria 6913799
806 2847671163 2847670302 Bacteria 6165597
807 2847687303 2847686936 Bacteria 6278406
808 2848995419 2848992105 Bacteria 6810864
809 2851182206 2851182111 Bacteria 6047226
810 2851251319 2851246043 Bacteria 6439203
811 2852393341 2852387548 Bacteria 8025568
812 2852681383 2852680915 Bacteria 4100189
813 2855876430 2855872281 Bacteria 6964271
814 2856316677 2856314179 Bacteria 6477897
815 2856324607 2856320880 Bacteria 7263508
816 2856333183 2856328259 Bacteria 6528202
817 2856339158 2856334872 Bacteria 7037011
818 2856342212 2856342000 Bacteria 7176905
819 2856352541 2856349417 Bacteria 6230045
820 2856370975 2856364286 Bacteria 6939991
821 2857355277 2857349434 Bacteria 7926032
822 2857368934 2857367948 Bacteria 6965560
823 2869167913 2869162929 Bacteria 6399702
824 2869170215 2869169390 Bacteria 6659796
825 2869238658 2869234852 Bacteria 6654993
826 2869254762 2869249662 Bacteria 6868783
827 2869263169 2869256925 Bacteria 6981691
828 2869268934 2869264136 Bacteria 6880765
829 2869272395 2869271264 Bacteria 6908218
830 2869281397 2869278585 Bacteria 7077053
831 2869292132 2869285874 Bacteria 6901219
832 2871435339 2871429161 Bacteria 6547891
833 2871443811 2871435913 Bacteria 6880295
834 2871447453 2871444079 Bacteria 6423508
835 2871452725 2871451962 Bacteria 7336357
836 2871463841 2871459585 Bacteria 6866887
837 2871467229 2871466892 Bacteria 6923287
838 2871486635 2871481445 Bacteria 6700002
839 2871488812 2871488783 Bacteria 6929816
840 2871495981 2871495908 Bacteria 6935695
841 2874108611 2874102143 Bacteria 6342645
842 2874112445 2874109183 Bacteria 6517025
843 2874123309 2874116593 Bacteria 6674494
844 2874131139 2874123672 Bacteria 7238285
845 2874138933 2874131515 Bacteria 6820270
846 2874140937 2874139085 Bacteria 7021506
847 2874155040 2874146452 Bacteria 7533118
848 2874161359 2874155637 Bacteria 6724144
849 2874164627 2874162495 Bacteria 6174670
850 2876366319 2876363079 Bacteria 6544991
851 2876374068 2876369609 Bacteria 6807521
852 2876387024 2876386047 Bacteria 6698674
853 2876395515 2876392853 Bacteria 6660880
854 2876404036 2876399893 Bacteria 6927900
855 2876411609 2876406927 Bacteria 6191900
856 2876420496 2876413966 Bacteria 6831344
857 2876423310 2876420981 Bacteria 6687741
858 2878036887 2878035449 Bacteria 6555736
859 2878737476 2878730984 Bacteria 6380721
860 2878742716 2878738818 Bacteria 7136951
861 2878752474 2878745973 Bacteria 6867388
862 2878753575 2878753008 Bacteria 6922523
863 2878760214 2878760144 Bacteria 6823465
864 2878767174 2878767105 Bacteria 6898628
865 2878778184 2878774303 Bacteria 6108671
866 2881152293 2881147464 Bacteria 7779814
867 2881156690 2881155292 Bacteria 6461656
868 2881162109 2881161766 Bacteria 7127907
869 2881850188 2881845957 Bacteria 6611900
870 2881857250 2881853255 Bacteria 6698367
871 2881865420 2881861095 Bacteria 7128710
872 2882459134 2882456835 Bacteria 6863978
873 2882633485 2882632389 Bacteria 8154593
874 2882919617 2882912400 Bacteria 6801539
875 2883356487 2883354860 Bacteria 5865246
876 2884299732 2884298095 Bacteria 3823049
877 2885310951 2885305155 Bacteria 7348390
878 2885316594 2885312484 Bacteria 6415165
879 2885319356 2885318864 Bacteria 6729568
880 2885327687 2885326080 Bacteria 7134805
881 2885339152 2885334103 Bacteria 7216818
882 2885350450 2885342637 Bacteria 7011821
883 2885354126 2885350715 Bacteria 6787678
884 2888341111 2888337043 Bacteria 6629336
885 2888357286 2888350351 Bacteria 7372807
886 2889012240 2889010040 Bacteria 6749192
887 2889022867 2889016732 Bacteria 6700763
888 2894656915 2894652903 Bacteria 4587256
889 2896387620 2896384573 Bacteria 7700774
890 2903452578 2903448605 Bacteria 7357801
891 2903495471 2903492973 Bacteria 13473544
892 2903505353 2903492973 Bacteria 13473544
893 2903524187 2903521522 Bacteria 6525694
894 2903533630 2903528002 Bacteria 6586099
895 2903540776 2903540706 Bacteria 7062119
896 2904582573 2904578770 Bacteria 5302906
897 2904662146 2904659560 Bacteria 6685615
898 2906314868 2906308376 Bacteria 6841989
899 2906328040 2906321335 Bacteria 6579571
900 2906332688 2906328253 Bacteria 6585166
901 2906355396 2906354277 Bacteria 6991324
902 2906365461 2906363423 Bacteria 6856682
903 2906377782 2906370794 Bacteria 6881062
904 2906391394 2906386501 Bacteria 5977019
905 2906397838 2906393657 Bacteria 6790866
906 2906403961 2906401398 Bacteria 6693206
907 2906412025 2906408224 Bacteria 6162342
908 2906416814 2906414383 Bacteria 6580790
909 2913299927 2913295892 Bacteria 6333755
910 2917557210 2917554339 Bacteria 4987857
911 2917700979 2917699015 Bacteria 7043791
912 2919103288 2919100787 Bacteria 7710546
913 2919124053 2919119836 Bacteria 5208557
914 2919174585 2919171160 Bacteria 6499771
915 2922174975 2922172374 Bacteria 6167644
916 2922183797 2922178524 Bacteria 6025201
917 2922191956 2922185730 Bacteria 7113964
918 2924714593 2924710171 Bacteria 6752351
919 2924718818 2924718760 Bacteria 6331356
920 2924735178 2924733363 Bacteria 7574837
921 2924743015 2924741084 Bacteria 6661321
922 2924748408 2924748358 Bacteria 6154725
923 2924765729 2924762789 Bacteria 6561353
924 2924780516 2924776078 Bacteria 7492003
925 2924791987 2924784321 Bacteria 7416538
926 2928525057 2928521798 Bacteria 4960112
927 2933576382 2933570622 Bacteria 7023390
928 2933587237 2933586486 Bacteria 7667493
929 2935900372 2935894831 Bacteria 6620579
930 2937821266 2937813078 Bacteria 7783518
931 2937825677 2937822353 Bacteria 7290551
932 2937839450 2937836603 Bacteria 6811263
933 2937855249 2937848649 Bacteria 6983481
934 2937863024 2937861824 Bacteria 6660327
935 2937883042 2937877337 Bacteria 7246526
936 2937973792 2937972304 Bacteria 7532020
937 2937984577 2937980651 Bacteria 6517427
938 2937994631 2937994558 Bacteria 7036190
939 2938015510 2938014810 Bacteria 6700592
940 2954011330 2954011201 Bacteria 4762601
941 2958037359 2958034702 Bacteria 6989922
942 2958047071 2958041894 Bacteria 13082850
943 2958051800 2958041894 Bacteria 13082850
944 2958069605 2958064165 Bacteria 7158582
945 2958076672 2958071322 Bacteria 6815895
946 2958090168 2958084443 Bacteria 7312792
947 2958103438 2958100919 Bacteria 6800575
948 2958113281 2958108152 Bacteria 6681128
949 2958117716 2958115193 Bacteria 6923548
950 2958127573 2958122699 Bacteria 7280457
951 2958136532 2958130278 Bacteria 6897202
952 2958143729 2958137437 Bacteria 6050276
953 2958151648 2958144490 Bacteria 6677056
954 2958159999 2958158011 Bacteria 6058449
955 2958165109 2958165035 Bacteria 6906348
956 2958175883 2958172287 Bacteria 6716688
957 2958186026 2958179912 Bacteria 6874908
958 2961084507 2961077736 Bacteria 7079850
959 2961117300 2961114664 Bacteria 6680456
960 2961127892 2961127735 Bacteria 7196641
961 2961139626 2961136820 Bacteria 6775228
962 2961163569 2961163497 Bacteria 6901077
963 2961170765 2961170736 Bacteria 7072258
964 2961185476 2961183825 Bacteria 6688536
965 2963649115 2963644680 Bacteria 6530403
966 2965018372 2965018300 Bacteria 6883036
967 2965030455 2965025482 Bacteria 6532201
968 2965040065 2965032056 Bacteria 6887443
969 2965041506 2965040258 Bacteria 6855979
970 2965051231 2965047637 Bacteria 6623551
971 2965063083 2965062239 Bacteria 7412989
972 2965090473 2965089291 Bacteria 6866420
973 2965105396 2965102966 Bacteria 6800987
974 2965125139 2965119406 Bacteria 6956431
975 2968003344 2967996073 Bacteria 6787468
976 2968004111 2968003550 Bacteria 6929263
977 2968019800 2968016561 Bacteria 7022047
978 2968084359 2968083720 Bacteria 7351627
979 2968096730 2968091066 Bacteria 6052692
980 2968099932 2968097103 Bacteria 6107094
981 2968113208 2968110612 Bacteria 6814636
982 2968123628 2968117919 Bacteria 6536078
983 2968132896 2968128360 Bacteria 6270294
984 2968142484 2968138860 Bacteria 6605449
985 2968171972 2968171901 Bacteria 6894245
986 2970473121 2970469710 Bacteria 6969209
987 2970495274 2970489779 Bacteria 6517260
988 2970503355 2970503327 Bacteria 7099517
989 2970515729 2970510686 Bacteria 7006402
990 2970536712 2970532167 Bacteria 6553173
991 2970550514 2970547951 Bacteria 6931819
992 2970555065 2970554993 Bacteria 6814252
993 2970596001 2970593180 Bacteria 7073582
994 2970622303 2970619444 Bacteria 6986144
995 2970629280 2970627176 Bacteria 6680862
996 2977822792 2977821940 Bacteria 6906439
997 2977830967 2977828996 Bacteria 7007971
998 2977849533 2977843712 Bacteria 6753583
999 2977855899 2977851361 Bacteria 6694324
1000 2977863063 2977858184 Bacteria 6215359
1001 2977866401 2977864932 Bacteria 7534097
1002 2977876196 2977872689 Bacteria 7270173
1003 2977899544 2977898635 Bacteria 6675551
1004 2977917472 2977915119 Bacteria 6829656
1005 2977926932 2977922695 Bacteria 6956781
1006 2977939354 2977935797 Bacteria 6252826
1007 2977948823 2977942078 Bacteria 7570577
1008 2977952856 2977950692 Bacteria 6893264
1009 2977959237 2977957713 Bacteria 6877875
1010 2977975098 2977971508 Bacteria 7472917
1011 2977988275 2977986579 Bacteria 6581278
1012 2979711538 2979710463 Bacteria 6785254
1013 2979773615 2979772303 Bacteria 6618277
1014 2979780368 2979779861 Bacteria 6219781
1015 2979815584 2979808191 Bacteria 7179355
1016 2987640410 2987636660 Bacteria 8088555
1017 2987651869 2987645492 Bacteria 6117018
1018 2987656216 2987652177 Bacteria 6969023
1019 2987659577 2987659509 Bacteria 6966464
1020 2987673054 2987666974 Bacteria 6509233
1021 2996316700 2996310559 Bacteria 6357320
1022 2996339196 2996336353 Bacteria 5511628
1023 2996343344 2996341866 Bacteria 6643098
1024 2996351755 2996348954 Bacteria 7239054
1025 2996389574 2996386984 Bacteria 6978667
1026 2996893979 2996893221 Bacteria 5823108
1027 3000139024 3000135777 Bacteria 6891109
1028 3002145428 3002141150 Bacteria 5254435
1029 3004170686 3004167301 Bacteria 8330599
1030 3004188620 3004188549 Bacteria 6952365
1031 3004199264 3004195979 Bacteria 6776956
1032 3004208608 3004203850 Bacteria 7307914
1033 3004214857 3004211236 Bacteria 7417683
1034 3004222552 3004218560 Bacteria 7421728
1035 3004239161 3004232784 Bacteria 6662140
1036 3004241024 3004239961 Bacteria 6892290
1037 3004254482 3004248173 Bacteria 6563236
1038 3004271728 3004268573 Bacteria 7043476
1039 3004278455 3004275668 Bacteria 7114440
1040 3004294137 3004289098 Bacteria 6135450
1041 637079900 637000159 Bacteria 7596297
1042 649874409 649633066 Bacteria 6690028
1043 8002289878 8002285264 Bacteria 6717907
1044 8004301786 8004300914 Bacteria 6132239
1045 8004316072 8004312739 Bacteria 7444653
1046 8004367386 8004361976 Bacteria 6858373
1047 8004375148 8004374579 Bacteria 6898112
1048 8004394888 8004387939 Bacteria 7049250
1049 8004450541 8004445564 Bacteria 6322258
1050 8004635339 8004633249 Bacteria 6723080
1051 8004642838 8004640170 Bacteria 6723001
1052 8004696330 8004695233 Bacteria 6731676
1053 8004711599 8004703790 Bacteria 8006957
1054 8004721129 8004714634 Bacteria 6776161
1055 8004728083 8004727605 Bacteria 6643904
1056 8005279951 8005275841 Bacteria 6929066
1057 8005294558 8005289223 Bacteria 6634003
1058 8005384792 8005382845 Bacteria 6732062
1059 8005398242 8005395548 Bacteria 6806915
1060 8005436339 8005430974 Bacteria 6689030
1061 8005462271 8005460587 Bacteria 7157962
1062 8005499673 8005497431 Bacteria 6477605
1063 8005575180 8005570704 Bacteria 6957481
1064 8005620852 8005619151 Bacteria 7030230
1065 8005627355 8005626139 Bacteria 6534237
1066 8005650310 8005645114 Bacteria 6950293
1067 8005671093 8005668836 Bacteria 6953162
1068 8005696405 8005695170 Bacteria 6912330
1069 8018128353 8018127388 Bacteria 7351159
1070 8018164761 8018163183 Bacteria 7277977
1071 8018177742 8018176218 Bacteria 6896178
1072 8024485517 8024479707 Bacteria 6954785
1073 8024490308 8024486573 Bacteria 6540512
1074 8046773660 8046767195 Bacteria 7547379
1075 8049296028 8049293176 Bacteria 6128433
1076 8054560415 8054558443 Bacteria 5204801
1077 8055622483 8055617313 Bacteria 7548464
1078 8056379851 8056375014 Bacteria 7006639
1079 8056387778 8056382006 Bacteria 6408074
1080 8057535072 8057529695 Bacteria 6306553
1081 8057579403 8057575449 Bacteria 7367519
1082 8057875795 8057874678 Bacteria 7494653
1083 Ga0157380_10012532
1084 JGI24741J21665_1002695
1085 JGI24740J21852_10004403
1086 JGI25158J39367_1000155
1087 JGI25157J39369_1000888
1088 JGI25159J45721_1000117
1089 JGI25159J45721_1002627
1090 JGI25159J45721_1005257
1091 JGI25151J46595_10000040
1092 JGI25151J46595_10001002
1093 JGI25406J46586_10007067
1094 JGI25165J46597_1000070
1095 JGI25165J46597_1000440
1096 JGI25153J46596_10011509
1097 JGI25160J50197_1000081
1098 JGI25161J50226_1000025
1099 JGI25161J50226_1000063
1100 JGI25161J50226_1003520
1101 Ga0055542_1000344
1102 Ga0055542_1000824
1103 Ga0055526_1000772
1104 Ga0055526_1001101
1105 Ga0055526_1001298
1106 Ga0055526_1001710
1107 Ga0055526_1009213
1108 Ga0055524_1000023
1109 Ga0055524_1008755
1110 Ga0055534_1020714
1111 Ga0055528_1000067
1112 Ga0055528_1007332
1113 Ga0055540_1000126
1114 Ga0055531_10017335
1115 Ga0055543_1000088
1116 Ga0055543_1000427
1117 Ga0055543_1000584
1118 Ga0065165_1000252
1119 Ga0065165_1000426
1120 Ga0065165_1042651
1121 Ga0070658_10002072
1122 Ga0070658_10002081
1123 Ga0070658_10007220
1124 Ga0070658_10137878
1125 Ga0070658_10278746
1126 Ga0070658_10378021
1127 Ga0070683_100029802
1128 Ga0070670_100000757
1129 Ga0070666_10000010
1130 Ga0070680_100020700
1131 Ga0070680_100121546
1132 Ga0068868_100135812
1133 Ga0070660_100044201
1134 Ga0070689_100128939
1135 Ga0070689_100416574
1136 Ga0070691_10017703
1137 Ga0070691_10025643
1138 Ga0070661_100061151
1139 Ga0070661_100089279
1140 Ga0070692_10002255
1141 Ga0070692_10024110
1142 Ga0070692_10117938
1143 Ga0070668_100107651
1144 Ga0070675_100098591
1145 Ga0070675_100107776
1146 Ga0070659_100037639
1147 Ga0070709_10026118
1148 Ga0070701_10027684
1149 Ga0070694_100195378
1150 Ga0070663_100107702
1151 Ga0070663_100173961
1152 Ga0070678_100007047
1153 Ga0070662_100444372
1154 Ga0070681_10004631
1155 Ga0070685_10037601
1156 Ga0070707_100075691
1157 Ga0070679_100052986
1158 Ga0070679_100168511
1159 Ga0070684_100070710
1160 Ga0070684_100083331
1161 Ga0068853_100053378
1162 Ga0068853_100058637
1163 Ga0068853_100064271
1164 Ga0068853_100103133
1165 Ga0068853_100137946
1166 Ga0068853_100179593
1167 Ga0070672_100037382
1168 Ga0070695_100001407
1169 Ga0070695_100157536
1170 Ga0070696_100031411
1171 Ga0070696_100142790
1172 Ga0070696_100311364
1173 Ga0070693_100002187
1174 Ga0070693_100104103
1175 Ga0070665_100000011
1176 Ga0070665_100006376
1177 Ga0070665_100015280
1178 Ga0070665_100017711
1179 Ga0070665_100091101
1180 Ga0070665_100596308
1181 Ga0068855_100003338
1182 Ga0068855_100021946
1183 Ga0068855_100035027
1184 Ga0068855_100073043
1185 Ga0068855_100165064
1186 Ga0070664_100025588
1187 Ga0068857_100081119
1188 Ga0068857_100084271
1189 Ga0068857_100094277
1190 Ga0068854_100032087
1191 Ga0068854_100116158
1192 Ga0068854_100207862
1193 Ga0068856_100025549
1194 Ga0068856_100071179
1195 Ga0068856_100077646
1196 Ga0070702_100201118
1197 Ga0068852_100016614
1198 Ga0068852_100036319
1199 Ga0068852_100052924
1200 Ga0068852_100135373
1201 Ga0068859_100004852
1202 Ga0068859_100037944
1203 Ga0068859_100334766
1204 Ga0068861_100175606
1205 Ga0068861_100198855
1206 Ga0068863_100162038
1207 Ga0068863_100417828
1208 Ga0068858_100127036
1209 Ga0068858_100196638
1210 Ga0081455_10000029
1211 Ga0081455_10000294
1212 Ga0081540_1000852
1213 Ga0081539_10003026
1214 Ga0075365_10002849
1215 Ga0075365_10006635
1216 Ga0075365_10014080
1217 Ga0075365_10017046
1218 Ga0075365_10032039
1219 Ga0075365_10051755
1220 Ga0075365_10091242
1221 Ga0075368_10034259
1222 Ga0075363_100022681
1223 Ga0075363_100074459
1224 Ga0075363_100134877
1225 Ga0075362_10087339
1226 Ga0075369_10002859
1227 Ga0075366_10022204
1228 Ga0097621_100085537
1229 Ga0075370_10033388
1230 Ga0068871_100032340
1231 Ga0075428_100021132
1232 Ga0075433_10003331
1233 Ga0075434_100001452
1234 Ga0075434_100474524
1235 Ga0097620_100004852
1236 Ga0097620_100037944
1237 Ga0097620_100334789
1238 Ga0075435_100012825
1239 Ga0075435_100157335
1240 Ga0105240_10000240
1241 Ga0105240_10059386
1242 Ga0105240_10549467
1243 Ga0111539_10035490
1244 Ga0111539_10047203
1245 Ga0111539_10102268
1246 Ga0105245_10063114
1247 Ga0105245_10162587
1248 Ga0114129_10050639
1249 Ga0114129_10065536
1250 Ga0114129_10069662
1251 Ga0114129_10694319
1252 Ga0114129_10699713
1253 Ga0105243_10278022
1254 Ga0105243_10288199
1255 Ga0105241_10021074
1256 Ga0105248_10017664
1257 Ga0105248_10182385
1258 Ga0105237_10001680
1259 Ga0105237_10029880
1260 Ga0105237_10128228
1261 Ga0105238_10014921
1262 Ga0105238_10038407
1263 Ga0105238_10053237
1264 Ga0105238_10369147
1265 Ga0105238_10419823
1266 Ga0105249_10188691
1267 Ga0105249_10236392
1268 Ga0123341_1000001
1269 Ga0105239_10021688
1270 Ga0105239_10022055
1271 Ga0105239_10071157
1272 Ga0105239_10138045
1273 Ga0105239_10175698
1274 Ga0105239_10191615
1275 Ga0157373_10023023
1276 Ga0157371_10040536
1277 Ga0157370_10006609
1278 Ga0157370_10044350
1279 Ga0157370_10072078
1280 Ga0157370_10266838
1281 Ga0157369_10008713
1282 Ga0157369_10053191
1283 Ga0157369_10078694
1284 Ga0157369_10118142
1285 Ga0157369_10480356
1286 Ga0171462_1038
1287 Ga0157378_10214820
1288 Ga0163162_10031244
1289 Ga0157372_10071000
1290 Ga0157372_10372240
1291 Ga0157375_10027774
1292 Ga0163163_10062475
1293 Ga0182008_10044863
1294 Ga0157379_10014721
1295 Ga0157376_10278400
1296 Ga0182007_10000579
1297 Ga0183369_1003
1298 Ga0163161_10080820
1299 Ga0163161_10164974
1300 Ga0197907_10366558
1301 Ga0206352_10683019
1302 Ga0206353_11357698
1303 Ga0214544_1000012
1304 Ga0214544_1000123
1305 Ga0214542_1000011
1306 Ga0214542_1000141
1307 Ga0214543_1000004
1308 Ga0214543_1000026
1309 Ga0213876_10142394
1310 Ga0209436_100017
1311 Ga0209437_100064
1312 Ga0207425_1002417
1313 Ga0209026_1000002
1314 Ga0209677_100261
1315 Ga0209148_1000123
1316 Ga0209759_1000677
1317 Ga0209129_1000846
1318 Ga0209129_1008892
1319 Ga0209233_1000081
1320 Ga0209233_1000131
1321 Ga0209233_1000203
1322 Ga0209233_1020783
1323 Ga0209455_1000129
1324 Ga0209673_1000310
1325 Ga0209673_1000348
1326 Ga0209673_1003692
1327 Ga0209673_1007972
1328 Ga0209130_1000001
1329 Ga0209130_1000116
1330 Ga0209130_1000162
1331 Ga0209675_1000454
1332 Ga0209676_1012158
1333 Ga0209025_1000016
1334 Ga0209025_1000097
1335 Ga0209025_1001381
1336 Ga0209025_1031157
1337 Ga0209564_1000023
1338 Ga0209564_1000076
1339 Ga0209564_1000137
1340 Ga0209564_1001306
1341 Ga0209564_1007213
1342 Ga0209758_1000237
1343 Ga0209758_1000714
1344 Ga0209758_1003449
1345 Ga0209758_1007231
1346 Ga0209758_1007411
1347 Ga0209758_1044995
1348 Ga0209050_1003339
1349 Ga0209256_1000083
1350 Ga0209256_1000397
1351 Ga0209256_1000608
1352 Ga0209256_1005667
1353 Ga0209256_1015266
1354 Ga0207426_1000005
1355 Ga0207426_1000094
1356 Ga0207426_1000126
1357 Ga0207426_1013435
1358 Ga0209051_1000201
1359 Ga0209051_1001477
1360 Ga0209051_1025419
1361 Ga0209257_1011130
1362 Ga0209257_1011250
1363 Ga0207656_10008147
1364 Ga0207688_10020840
1365 Ga0207680_10000002
1366 Ga0207647_10000814
1367 Ga0207647_10113455
1368 Ga0207699_10064183
1369 Ga0207705_10020706
1370 Ga0207705_10023951
1371 Ga0207705_10035193
1372 Ga0207705_10126898
1373 Ga0207705_10215823
1374 Ga0207705_10302616
1375 Ga0207654_10066527
1376 Ga0207707_10000055
1377 Ga0207707_10043942
1378 Ga0207695_10004364
1379 Ga0207695_10114591
1380 Ga0207695_10145402
1381 Ga0207695_10367983
1382 Ga0207671_10000954
1383 Ga0207671_10009485
1384 Ga0207671_10050328
1385 Ga0207660_10011441
1386 Ga0207660_10028276
1387 Ga0207657_10050242
1388 Ga0207657_10050657
1389 Ga0207649_10008479
1390 Ga0207649_10027574
1391 Ga0207652_10013061
1392 Ga0207652_10045998
1393 Ga0207652_10142218
1394 Ga0207652_10143083
1395 Ga0207694_10017716
1396 Ga0207694_10123583
1397 Ga0207650_10003845
1398 Ga0207659_10034317
1399 Ga0207659_10047901
1400 Ga0207687_10030087
1401 Ga0207687_10058536
1402 Ga0207686_10077328
1403 Ga0207709_10178288
1404 Ga0207709_10194027
1405 Ga0207670_10332861
1406 Ga0207691_10030381
1407 Ga0207711_10020415
1408 Ga0207711_10079868
1409 Ga0207689_10045571
1410 Ga0207689_10161342
1411 Ga0207661_10046420
1412 Ga0207661_10058976
1413 Ga0207679_10016650
1414 Ga0207667_10005105
1415 Ga0207667_10014559
1416 Ga0207667_10045678
1417 Ga0207667_10056025
1418 Ga0207667_10097519
1419 Ga0207667_10132169
1420 Ga0207667_10133015
1421 Ga0207667_10168304
1422 Ga0207667_10293393
1423 Ga0207651_10073895
1424 Ga0207640_10002595
1425 Ga0207640_10015023
1426 Ga0207640_10194806
1427 Ga0207677_10082318
1428 Ga0207703_10100589
1429 Ga0207639_10009316
1430 Ga0207639_10048880
1431 Ga0207678_10009691
1432 Ga0207678_10016380
1433 Ga0207678_10054552
1434 Ga0207678_10055067
1435 Ga0207678_10149474
1436 Ga0207678_10257452
1437 Ga0207708_10075150
1438 Ga0207702_10009763
1439 Ga0207702_10010702
1440 Ga0207702_10070976
1441 Ga0207641_10150356
1442 Ga0207648_10224707
1443 Ga0207648_10367090
1444 Ga0207674_10023597
1445 Ga0207674_10033759
1446 Ga0207674_10104549
1447 Ga0207674_10127982
1448 Ga0207674_10222471
1449 Ga0207675_100227721
1450 Ga0207683_10257841
1451 Ga0207683_10381886
1452 Ga0207698_10025062
1453 Ga0207698_10027215
1454 Ga0207698_10035692
1455 Ga0207698_10036666
1456 Ga0207698_10108065
1457 Ga0207698_10404730
1458 Ga0207428_10019169
1459 Ga0268266_10000058
1460 Ga0268266_10000341
1461 Ga0268266_10069982
1462 Ga0268266_10100371
1463 Ga0268266_10102193
1464 Ga0268266_10351233
1465 Ga0268266_10538743
1466 Ga0307515_10003211
1467 Ga0307515_10271523
1468 Ga0265328_10000006
1469 Ga0265328_10000118
1470 Ga0265328_10007907
1471 Ga0265329_10003623
1472 Ga0265331_10000673
1473 Ga0265327_10002843
1474 Ga0265316_10000091
1475 Ga0265314_10066772
1476 Ga0307412_10253786
1477 Ga0307414_10102536
1478 Ga0316593_10060931
1479 Ga0373949_0027276
1480 Ga0373932_0004795
1481 Ga0373939_0068710
1482 Ga0373941_0017205
1483 Ga0373961_0004892
1484 Ga0373961_0014937
1485 Ga0373962_0017069
1486 Ga0316574_0006394
1487 Ga0316574_0092360
1488 Ga0373931_0001004
1489 Ga0373931_0001344
1490 Ga0373931_0033370
1491 Ga0373927_0000655
1492 Ga0373933_0112988
1493 Ga0373937_0041118
1494 Ga0373937_0067125
1495 Ga0316584_0200165
1496 Ga0373925_0121191
1497 Ga0373925_0178668
1498 Ga0395900_0029543
1499 Ga0395900_0037536
1500 Ga0395900_0038974
1501 Ga0395900_0266195
1502 Ga0395905_0012798
1503 Ga0395905_0034198
1504 Ga0395905_0379391
1505 Ga0395901_0049578
1506 Ga0395901_0139646
1507 Ga0395901_0174426
1508 Ga0395901_0305593
1509 Ga0400483_121163
1510 Ga0436365_0331535
1511 Ga0436365_0427085
1512 Ga0436365_0570842
1513 Ga0451851_1016416
1514 Ga0439458_0012238
1515 Ga0451577_0209910
1516 Ga0466966_0031658
1517 Ga0466961_0163786
1518 Ga0466968_0014091
1519 Ga0466957_0026795
1520 Ga0466960_0121422
1521 Ga0451576_0092705
1522 Ga0466967_0396673
1523 Ga0495638_0004237
1524 Ga0495638_0007074
1525 Ga0495651_0004728
1526 Ga0495653_0039248
1527 Ga0495580_0181961
1528 Ga0495584_0049250
1529 Ga0495585_0044733
1530 Ga0495596_0044690
1531 Ga0495583_0007688
1532 Ga0495606_0018719
1533 Ga0495606_0020615
1534 Ga0495610_0065394
1535 Ga0495630_0177876
1536 Ga0495631_0019052
1537 Ga0495632_0003180
1538 Ga0495637_0000031
1539 Ga0495643_0001093
1540 Ga0495643_0050024
1541 Ga0495642_0014178
1542 Ga0495652_0096772
1543 Ga0495654_0044876
1544 Ga0495645_0009300
1545 Ga0495667_0014739
1546 Ga0495625_0059224
1547 Ga0495625_0070660
1548 Ga0495625_0127831
1549 Ga0495588_0142613
1550 Ga0495599_0036140
1551 Ga0495623_0031813
1552 Ga0495646_0143242
1553 Ga0495649_0000683
1554 Ga0495604_0021224
1555 Ga0495604_0156254
1556 Ga0495681_0042682
1557 Ga0495684_0149182
1558 Ga0495686_0058680
1559 Ga0495626_0055112
1560 Ga0496101_0224978
1561 Ga0496102_0145969
1562 Ga0496102_0399331
1563 Ga0496104_0015271
1564 Ga0496105_0036616
1565 Ga0496106_0000401
1566 Ga0496106_0233272
1567 Ga0496108_0022536
1568 Ga0496108_0103592
1569 Ga0496109_0047565
1570 Ga0496109_0047873
1571 Ga0496110_0041946
1572 Ga0496110_0070044
1573 Ga0496112_0019439
1574 Ga0496112_0169741
1575 Ga0496114_0051537
1576 Ga0496115_0004185
1577 Ga0496115_0018349
1578 Ga0496116_0074862
1579 Ga0496116_0106400
1580 Ga0496117_0010266
1581 Ga0496118_0002144
1582 Ga0496118_0043074
1583 Ga0496119_0008989
1584 Ga0496119_0045119
1585 Ga0496120_0001004
1586 Ga0496120_0001561
1587 Ga0496121_0003845
1588 Ga0496121_0152626
1589 Ga0496122_0016018
1590 Ga0496122_0023231
1591 Ga0496123_0012214
1592 Ga0496123_0039515
1593 Ga0496123_0088876
1594 Ga0496124_0012766
1595 Ga0496124_0017382
1596 Ga0496124_0049375
1597 Ga0496124_0053093
1598 Ga0496125_0005411
1599 Ga0496125_0093585
1600 Ga0496126_0131020
1601 Ga0495678_003335
1602 Ga0501031_0052291
1603 Ga0501032_0010364
1604 Ga0501032_0257707
1605 Ga0501033_0000035
1606 Ga0501033_0001819
1607 Ga0501033_0035544
1608 Ga0501033_0052647
1609 Ga0501033_0056482
1610 Ga0501033_0090710
1611 Ga0501034_0002386
1612 Ga0501034_0076388
1613 Ga0501034_0098015
1614 Ga0501034_0141561
1615 Ga0501037_0000544
1616 Ga0501037_0116886
1617 Ga0501043_0000081
1618 Ga0501043_0047049
1619 Ga0501043_0052048
1620 Ga0501046_0125104
1621 Ga0501046_0338851
1622 Ga0501047_0010894
1623 Ga0501047_0028624
1624 Ga0501047_0057007
1625 Ga0501047_0057636
1626 Ga0501047_0082646
1627 Ga0501047_0203903
1628 Ga0501048_0253740
1629 Ga0501067_0111166
1630 Ga0501067_0160516
1631 Ga0501068_0002018
1632 Ga0501069_0000134
1633 Ga0501069_0007803
1634 Ga0501069_0091103
1635 Ga0501070_0000127
1636 Ga0501070_0002984
1637 Ga0501070_0003125
1638 Ga0501070_0019893
1639 Ga0501070_0046685
1640 Ga0501070_0149083
1641 Ga0501070_0239053
1642 Ga0501071_0003589
1643 Ga0501073_0000445
1644 Ga0501073_0076615
1645 Ga0501074_0000062
1646 Ga0501074_0000251
1647 Ga0501076_0089325
1648 Ga0501076_0090440
1649 Ga0501080_0003969
1650 Ga0501080_0009602
1651 Ga0501080_0029534
1652 Ga0501080_0179828
1653 Ga0501080_0343242
1654 Ga0501080_0496466
1655 Ga0501083_0000090
1656 Ga0501083_0003993
1657 Ga0501083_0007064
1658 Ga0501035_0000017
1659 Ga0501035_0004245
1660 Ga0501035_0004321
1661 Ga0501035_0013116
1662 Ga0501035_0034269
1663 Ga0501035_0085951
1664 Ga0501035_0201291
1665 Ga0501035_0215921
1666 Ga0501044_0000034
1667 Ga0501044_0003154
1668 Ga0501044_0022766
1669 Ga0501044_0053672
1670 Ga0501044_0058582
1671 Ga0501044_0072621
1672 Ga0501044_0095442
1673 Ga0501044_0118976
1674 Ga0501044_0194282
1675 nmdc:mga03n38_129080_c1
1676 nmdc:mga03n38_24034_c1
1677 nmdc:mga03n38_36100_c1
1678 nmdc:mga0yw44_11566_c1
1679 nmdc:mga0yw44_24937_c2
1680 nmdc:mga0yw44_26416_c1
1681 nmdc:mga0yw44_32066_c1
1682 nmdc:mga0yw44_471_c1
1683 nmdc:mga0yw44_48432_c1
1684 nmdc:mga0k408_211013_c1
1685 nmdc:mga07m45_175927_c1
1686 nmdc:mga05p37_145165_c1
1687 nmdc:mga05p37_171888_c1
1688 nmdc:mga05p37_39318_c1
1689 nmdc:mga05p37_39437_c1
1690 nmdc:mga05p37_545708_c1
1691 nmdc:mga05p37_719286_c1
1692 nmdc:mga09592_174944_c1
1693 nmdc:mga0qj67_154876_c1
1694 nmdc:mga0qj67_25049_c1
1695 nmdc:mga06r32_24241_c1
1696 nmdc:mga08y16_121585_c1
1697 nmdc:mga08y16_574_c1
1698 nmdc:mga08y16_63075_c1
1699 nmdc:mga0n895_2333_c1
1700 nmdc:mga0n895_272157_c1
1701 nmdc:mga0rr50_48130_c1
1702 nmdc:mga0rr50_54180_c1
1703 nmdc:mga08x19_29877_c1
1704 nmdc:mga08x19_98073_c1
1705 nmdc:mga0a205_152411_c1
1706 nmdc:mga0a205_222521_c1
1707 nmdc:mga0a205_233218_c1
1708 nmdc:mga0a205_351427_c1
1709 nmdc:mga0a205_4123_c1
1710 Ga0495601_0170919
1711 Ga0500610_0003042
1712 Ga0495595_0062344
1713 Ga0495619_0009128
1714 Ga0495619_0086549
1715 Ga0500651_0003441
1716 Ga0500555_003771
1717 Ga0500592_000996
1718 Ga0500595_000648
1719 Ga0500607_104104
1720 Ga0500608_056464
1721 Ga0500568_0000048
1722 Ga0500568_0001015
1723 Ga0500568_0105254
1724 Ga0500590_004310
1725 Ga0500604_0007188
1726 Ga0500616_0000102
1727 Ga0500616_0006999
1728 Ga0500616_0007353
1729 Ga0500616_0041254
1730 Ga0500622_0000533
1731 Ga0500622_0002086
1732 Ga0500627_0000005
1733 Ga0500634_0009499
1734 Ga0500636_0007347
1735 Ga0500611_022805
1736 Ga0500645_010428
1737 Ga0501084_0049799
1738 Ga0501082_0161870
1739 Ga0466962_0024458
1740 2503203072
1741 2509078232
1742 2509110166
1743 2509114793
1744 2509143388
1745 2509373752
1746 2509397537
1747 2510319390
1748 2510893961
1749 2510898986
1750 2511136423
1751 2511174477
1752 2511198317
1753 2511391073
1754 2512930117
1755 2512964804
1756 2513611810
1757 2514033099
1758 2514422467
1759 2515111621
1760 2515638230
1761 2520376276
1762 2558864543
1763 2585167982
1764 2585221746
1765 2585232021
1766 2585274790
1767 2585278554
1768 2585324587
1769 2585335455
1770 2585392382
1771 2585528948
1772 2585535405
1773 2585540081
1774 2585544084
1775 2585556792
1776 2585562156
1777 2585838279
1778 2585907902
1779 2585996318
1780 2586000926
1781 2587983322
1782 2588515733
1783 2597814804
1784 2599937373
1785 2616308072
1786 2643773523
1787 2643986633
1788 2644051071
1789 2644157568
1790 2644205551
1791 2644483975
1792 2644733394
1793 2644744770
1794 2692320028
1795 2694634003
1796 2694638626
1797 2719385179
1798 2719664942
1799 2720491362
1800 2720612722
1801 2720619562
1802 2721398899
1803 2723026380
1804 2723559923
1805 2723576730
1806 2724037712
1807 2724109644
1808 2725951617
1809 2730107316
1810 2739037796
1811 2739652009
1812 2740030483
1813 2756677845
1814 2765467222
1815 2774870922
1816 2776259481
1817 2776273026
1818 2776282131
1819 2792582460
1820 2792641497
1821 2792643492
1822 2792748911
1823 2793296966
1824 2793315460
1825 2793321430
1826 2793342618
1827 2793350231
1828 2793352071
1829 2793366161
1830 2805937970
1831 2806048557
1832 2806056195
1833 2806063203
1834 2806070451
1835 2806077792
1836 2819608111
1837 2819641001
1838 2819717468
1839 2835314510
1840 2838018508
1841 2838054077
1842 2838066580
1843 2838077535
1844 2838669766
1845 2838682861
1846 2838697493
1847 2838702138
1848 2838709329
1849 2839996441
1850 2840770379
1851 2841762918
1852 2841916962
1853 2841922583
1854 2842077439
1855 2842111211
1856 2842120052
1857 2842147317
1858 2842197253
1859 2842201347
1860 2842206642
1861 2842238740
1862 2842252383
1863 2842268672
1864 2842280099
1865 2842287823
1866 2842291101
1867 2842309889
1868 2842315109
1869 2842373490
1870 2842377497
1871 2842386563
1872 2842399753
1873 2842404649
1874 2842411232
1875 2842418319
1876 2842432805
1877 2842439110
1878 2842445739
1879 2842451411
1880 2842466909
1881 2842473724
1882 2842500535
1883 2842874203
1884 2844005986
1885 2844015197
1886 2844109212
1887 2847420547
1888 2847671163
1889 2847687303
1890 2848995419
1891 2851182206
1892 2851251319
1893 2852393341
1894 2852681383
1895 2855876430
1896 2856316677
1897 2856324607
1898 2856333183
1899 2856339158
1900 2856342212
1901 2856352541
1902 2856370975
1903 2857355277
1904 2857368934
1905 2869167913
1906 2869170215
1907 2869238658
1908 2869254762
1909 2869263169
1910 2869268934
1911 2869272395
1912 2869281397
1913 2869292132
1914 2871435339
1915 2871443811
1916 2871447453
1917 2871452725
1918 2871463841
1919 2871467229
1920 2871486635
1921 2871488812
1922 2871495981
1923 2874108611
1924 2874112445
1925 2874123309
1926 2874131139
1927 2874138933
1928 2874140937
1929 2874155040
1930 2874161359
1931 2874164627
1932 2876366319
1933 2876374068
1934 2876387024
1935 2876395515
1936 2876404036
1937 2876411609
1938 2876420496
1939 2876423310
1940 2878036887
1941 2878737476
1942 2878742716
1943 2878752474
1944 2878753575
1945 2878760214
1946 2878767174
1947 2878778184
1948 2881152293
1949 2881156690
1950 2881162109
1951 2881850188
1952 2881857250
1953 2881865420
1954 2882459134
1955 2882633485
1956 2882919617
1957 2883356487
1958 2884299732
1959 2885310951
1960 2885316594
1961 2885319356
1962 2885327687
1963 2885339152
1964 2885350450
1965 2885354126
1966 2888341111
1967 2888357286
1968 2889012240
1969 2889022867
1970 2894656915
1971 2896387620
1972 2903452578
1973 2903495471
1974 2903505353
1975 2903524187
1976 2903533630
1977 2903540776
1978 2904582573
1979 2904662146
1980 2906314868
1981 2906328040
1982 2906332688
1983 2906355396
1984 2906365461
1985 2906377782
1986 2906391394
1987 2906397838
1988 2906403961
1989 2906412025
1990 2906416814
1991 2913299927
1992 2917557210
1993 2917700979
1994 2919103288
1995 2919124053
1996 2919174585
1997 2922174975
1998 2922183797
1999 2922191956
2000 2924714593
2001 2924718818
2002 2924735178
2003 2924743015
2004 2924748408
2005 2924765729
2006 2924780516
2007 2924791987
2008 2928525057
2009 2933576382
2010 2933587237
2011 2935900372
2012 2937821266
2013 2937825677
2014 2937839450
2015 2937855249
2016 2937863024
2017 2937883042
2018 2937973792
2019 2937984577
2020 2937994631
2021 2938015510
2022 2954011330
2023 2958037359
2024 2958047071
2025 2958051800
2026 2958069605
2027 2958076672
2028 2958090168
2029 2958103438
2030 2958113281
2031 2958117716
2032 2958127573
2033 2958136532
2034 2958143729
2035 2958151648
2036 2958159999
2037 2958165109
2038 2958175883
2039 2958186026
2040 2961084507
2041 2961117300
2042 2961127892
2043 2961139626
2044 2961163569
2045 2961170765
2046 2961185476
2047 2963649115
2048 2965018372
2049 2965030455
2050 2965040065
2051 2965041506
2052 2965051231
2053 2965063083
2054 2965090473
2055 2965105396
2056 2965125139
2057 2968003344
2058 2968004111
2059 2968019800
2060 2968084359
2061 2968096730
2062 2968099932
2063 2968113208
2064 2968123628
2065 2968132896
2066 2968142484
2067 2968171972
2068 2970473121
2069 2970495274
2070 2970503355
2071 2970515729
2072 2970536712
2073 2970550514
2074 2970555065
2075 2970596001
2076 2970622303
2077 2970629280
2078 2977822792
2079 2977830967
2080 2977849533
2081 2977855899
2082 2977863063
2083 2977866401
2084 2977876196
2085 2977899544
2086 2977917472
2087 2977926932
2088 2977939354
2089 2977948823
2090 2977952856
2091 2977959237
2092 2977975098
2093 2977988275
2094 2979711538
2095 2979773615
2096 2979780368
2097 2979815584
2098 2987640410
2099 2987651869
2100 2987656216
2101 2987659577
2102 2987673054
2103 2996316700
2104 2996339196
2105 2996343344
2106 2996351755
2107 2996389574
2108 2996893979
2109 3000139024
2110 3002145428
2111 3004170686
2112 3004188620
2113 3004199264
2114 3004208608
2115 3004214857
2116 3004222552
2117 3004239161
2118 3004241024
2119 3004254482
2120 3004271728
2121 3004278455
2122 3004294137
2123 637079900
2124 649874409
2125 8002289878
2126 8004301786
2127 8004316072
2128 8004367386
2129 8004375148
2130 8004394888
2131 8004450541
2132 8004635339
2133 8004642838
2134 8004696330
2135 8004711599
2136 8004721129
2137 8004728083
2138 8005279951
2139 8005294558
2140 8005384792
2141 8005398242
2142 8005436339
2143 8005462271
2144 8005499673
2145 8005575180
2146 8005620852
2147 8005627355
2148 8005650310
2149 8005671093
2150 8005696405
2151 8018128353
2152 8018164761
2153 8018177742
2154 8024485517
2155 8024490308
2156 8046773660
2157 8049296028
2158 8054560415
2159 8055622483
2160 8056379851
2161 8056387778
2162 8057535072
2163 8057579403
2164 8057875795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18288

FAA_hydro_N_2

Fumarylacetoacetase N-terminal domain 2

49

124

0.98

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

127

381

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.968 1 330
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.9651 1 330
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.8569 82 330
6sbj-assembly1.cif.gz_B x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.8565 82 328
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.8552 82 328
ID Description Score Start End Superfamily
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9454 2 330 3.90.850.10
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9369 2 330 3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8714 80 325 3.90.850.10
af_O86346_1_303_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8698 1 329 3.90.850.10
af_O86346_1_303_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8671 1 329 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A849RCH2-F1-model_v4 2-keto-4-pentenoate hydratase 0.9935 165 329 GO:0003824
AF-A0A2G6J654-F1-model_v4 2-keto-4-pentenoate hydratase 0.99 1 330 GO:0003824
AF-A0A4Q9QKU4-F1-model_v4 2-keto-4-pentenoate hydratase 0.9896 1 329 GO:0003824
AF-A0A7J7B617-F1-model_v4 deleted 0.9892 1 330
AF-A0A1C3EC16-F1-model_v4 2-keto-4-pentenoate hydratase 0.989 1 330 GO:0003824

Map