F489698
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1082 | 463 | 2164 | 389 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0156729|Ga0395905_0156729_313_1587 |
| Length | 424 |
| Sequence | LRLERGRSESAPTPPRGQVRARPESNNERRSNAMHKRTLLQTAVAVALLGAGGAALAQDNVFKIGLILPMTGQQATTGRQIEAAARLWMAQNGDTVAGKKIQLIVRDDTSLPDQTRRLAQELVVNEKVNVLAGMGITPSALAVAPIATQSKTPLVVMAAATSSITEASPYVVRSSFTLPQVSVAMADWAPKNGIKNVVTLVTDYGPGLDAEKYFSERFVFNGGKVPEKLRVPLRNPDFAPFLQKVRDLKPDALFVFVPSGAGAAVMKQFGERGMDKAGIKLIGTGDVTDDDQLNDMGDVALGVVTSHHYSAYHQSAANKKFVSEFMKANKNLRPNFMAVGGYDGMRIIYEALKKTGGKGGGDALLGAMKGQIFESPRGPVFIDAQTRDIVQNVYLRKVEKKDGQLWNVEFDVIKDVKDPGKTKH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 104 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 140 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 230 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 231 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 232 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 233 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 234 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 242 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 252 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 272 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 273 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 274 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 275 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 276 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 277 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 278 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 279 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 280 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 281 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 282 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 283 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 284 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 285 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 286 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 287 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 290 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 291 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 292 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 293 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 351 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 352 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 353 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 354 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 355 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 356 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 385 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 386 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 387 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 394 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 395 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 397 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 398 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 399 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 400 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 404 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 405 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 406 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 407 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 408 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 409 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 410 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 411 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 412 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 413 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 414 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 415 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 416 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 417 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 418 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 419 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 420 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 421 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 422 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 423 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 424 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 425 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 426 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 427 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 428 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 429 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 430 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 431 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 432 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 433 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 434 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 435 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 436 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 437 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 438 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 439 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 440 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 441 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 442 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 443 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 444 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 445 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 446 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 447 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 448 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 449 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 450 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 451 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 452 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 453 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 454 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 455 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 456 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 457 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 458 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 459 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 460 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 461 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 462 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 463 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.61 |
| Metatranscriptomes | 0.09 |
| Isolates | 7.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.24 |
| Nodule | 0.46 |
| Rhizoplane | 3.14 |
| Rhizosphere | 67.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0156729 | 3300037471 | Bacteria | 2141 |
| 2 | SwRhRL2b_contig_1156090 | 2162886007 | Bacteria | 2597 |
| 3 | JGI24740J21852_10011219 | 3300001979 | Bacteria | 3418 |
| 4 | JGI24740J21852_10012167 | 3300001979 | Bacteria | 3250 |
| 5 | JGI25155J39150_1000092 | 3300002704 | Bacteria | 51808 |
| 6 | JGI25156J39149_1000067 | 3300002705 | Bacteria | 82796 |
| 7 | JGI25154J39366_1000089 | 3300002738 | Bacteria | 82796 |
| 8 | JGI25157J39369_1000084 | 3300002741 | Bacteria | 82796 |
| 9 | JGI25150J39212_1000694 | 3300002774 | Bacteria | 12176 |
| 10 | JGI25159J45721_1000228 | 3300002987 | Bacteria | 26393 |
| 11 | JGI25159J45721_1010332 | 3300002987 | Bacteria | 2386 |
| 12 | JGI25151J46595_10002022 | 3300003187 | Bacteria | 12680 |
| 13 | JGI25151J46595_10006434 | 3300003187 | Bacteria | 5908 |
| 14 | JGI25151J46595_10006514 | 3300003187 | Bacteria | 5855 |
| 15 | JGI25151J46595_10011382 | 3300003187 | Bacteria | 4089 |
| 16 | JGI25160J50197_1000076 | 3300003354 | Bacteria | 102318 |
| 17 | JGI25160J50197_1007974 | 3300003354 | Bacteria | 4077 |
| 18 | JGI25160J50197_1008069 | 3300003354 | Bacteria | 4046 |
| 19 | JGI25161J50226_1000058 | 3300003374 | Bacteria | 102318 |
| 20 | Ga0055535_1000084 | 3300003761 | Bacteria | 104652 |
| 21 | Ga0055535_1001221 | 3300003761 | Bacteria | 14499 |
| 22 | Ga0055542_1000033 | 3300003762 | Bacteria | 233997 |
| 23 | Ga0055542_1000381 | 3300003762 | Bacteria | 45199 |
| 24 | Ga0055526_1007589 | 3300003771 | Bacteria | 5599 |
| 25 | Ga0055537_1000304 | 3300003773 | Bacteria | 34030 |
| 26 | Ga0055537_1000389 | 3300003773 | Bacteria | 29486 |
| 27 | Ga0055537_1001544 | 3300003773 | Bacteria | 8811 |
| 28 | Ga0055524_1000678 | 3300003775 | Bacteria | 23860 |
| 29 | Ga0055524_1001685 | 3300003775 | Bacteria | 12301 |
| 30 | Ga0055524_1004503 | 3300003775 | Bacteria | 6418 |
| 31 | Ga0055536_1001854 | 3300003781 | Bacteria | 12355 |
| 32 | Ga0055534_1000260 | 3300003784 | Bacteria | 36676 |
| 33 | Ga0055534_1000289 | 3300003784 | Bacteria | 34030 |
| 34 | Ga0055534_1001915 | 3300003784 | Bacteria | 7673 |
| 35 | Ga0055534_1003287 | 3300003784 | Bacteria | 5137 |
| 36 | Ga0055534_1004043 | 3300003784 | Bacteria | 4393 |
| 37 | Ga0055528_1000468 | 3300003790 | Bacteria | 32324 |
| 38 | Ga0055528_1001139 | 3300003790 | Bacteria | 17326 |
| 39 | Ga0055528_1002348 | 3300003790 | Bacteria | 10236 |
| 40 | Ga0055528_1008822 | 3300003790 | Bacteria | 4273 |
| 41 | Ga0055528_1012104 | 3300003790 | Bacteria | 3374 |
| 42 | Ga0055528_1013553 | 3300003790 | Bacteria | 3080 |
| 43 | Ga0055530_10003506 | 3300003791 | Bacteria | 8878 |
| 44 | Ga0055530_10005277 | 3300003791 | Bacteria | 6210 |
| 45 | Ga0055540_1000088 | 3300003792 | Bacteria | 102236 |
| 46 | Ga0055540_1000890 | 3300003792 | Bacteria | 19699 |
| 47 | Ga0055540_1003373 | 3300003792 | Bacteria | 7744 |
| 48 | Ga0055540_1003974 | 3300003792 | Bacteria | 6889 |
| 49 | Ga0055531_10001335 | 3300003794 | Bacteria | 18427 |
| 50 | Ga0055531_10004099 | 3300003794 | Bacteria | 9013 |
| 51 | Ga0055531_10007816 | 3300003794 | Bacteria | 5759 |
| 52 | Ga0055543_1001562 | 3300004625 | Bacteria | 8867 |
| 53 | Ga0065165_1010395 | 3300005262 | Bacteria | 4030 |
| 54 | Ga0065704_10003035 | 3300005289 | Bacteria | 7930 |
| 55 | Ga0070658_10050911 | 3300005327 | Bacteria | 3357 |
| 56 | Ga0070658_10069444 | 3300005327 | Bacteria | 2882 |
| 57 | Ga0070658_10077442 | 3300005327 | Bacteria | 2728 |
| 58 | Ga0070676_10004686 | 3300005328 | Bacteria | 7228 |
| 59 | Ga0070676_10021675 | 3300005328 | Bacteria | 3598 |
| 60 | Ga0070676_10027980 | 3300005328 | Bacteria | 3201 |
| 61 | Ga0070676_10033636 | 3300005328 | Bacteria | 2941 |
| 62 | Ga0070676_10070078 | 3300005328 | Bacteria | 2102 |
| 63 | Ga0070683_100026059 | 3300005329 | Bacteria | 5259 |
| 64 | Ga0070690_100001202 | 3300005330 | Bacteria | 13364 |
| 65 | Ga0070690_100002924 | 3300005330 | Bacteria | 9227 |
| 66 | Ga0070690_100171412 | 3300005330 | Bacteria | 1494 |
| 67 | Ga0070670_100000527 | 3300005331 | Bacteria | 30691 |
| 68 | Ga0070670_100007034 | 3300005331 | Bacteria | 9534 |
| 69 | Ga0070670_100075632 | 3300005331 | Bacteria | 2893 |
| 70 | Ga0070670_100295398 | 3300005331 | Bacteria | 1416 |
| 71 | Ga0070677_10002614 | 3300005333 | Bacteria | 5766 |
| 72 | Ga0070677_10008730 | 3300005333 | Bacteria | 3419 |
| 73 | Ga0070677_10019143 | 3300005333 | Bacteria | 2475 |
| 74 | Ga0068869_100001043 | 3300005334 | Bacteria | 16128 |
| 75 | Ga0068869_100038691 | 3300005334 | Bacteria | 3402 |
| 76 | Ga0068869_100201196 | 3300005334 | Bacteria | 1571 |
| 77 | Ga0070666_10005740 | 3300005335 | Bacteria | 7621 |
| 78 | Ga0070666_10012986 | 3300005335 | Bacteria | 5273 |
| 79 | Ga0070666_10017401 | 3300005335 | Bacteria | 4607 |
| 80 | Ga0070666_10033037 | 3300005335 | Bacteria | 3421 |
| 81 | Ga0068868_100006495 | 3300005338 | Bacteria | 8279 |
| 82 | Ga0068868_100008142 | 3300005338 | Bacteria | 7500 |
| 83 | Ga0068868_100011759 | 3300005338 | Bacteria | 6379 |
| 84 | Ga0068868_100016559 | 3300005338 | Bacteria | 5479 |
| 85 | Ga0068868_100022882 | 3300005338 | Bacteria | 4724 |
| 86 | Ga0068868_100160542 | 3300005338 | Bacteria | 1856 |
| 87 | Ga0070660_100004674 | 3300005339 | Bacteria | 9481 |
| 88 | Ga0070660_100010895 | 3300005339 | Bacteria | 6436 |
| 89 | Ga0070660_100060830 | 3300005339 | Bacteria | 2932 |
| 90 | Ga0070689_100034325 | 3300005340 | Bacteria | 3870 |
| 91 | Ga0070687_100004173 | 3300005343 | Bacteria | 5724 |
| 92 | Ga0070661_100002145 | 3300005344 | Bacteria | 13596 |
| 93 | Ga0070661_100006191 | 3300005344 | Bacteria | 8251 |
| 94 | Ga0070661_100025859 | 3300005344 | Bacteria | 4219 |
| 95 | Ga0070661_100133026 | 3300005344 | Bacteria | 1869 |
| 96 | Ga0070668_100002160 | 3300005347 | Bacteria | 14394 |
| 97 | Ga0070668_100035155 | 3300005347 | Bacteria | 3820 |
| 98 | Ga0070668_100036588 | 3300005347 | Bacteria | 3747 |
| 99 | Ga0070669_100000975 | 3300005353 | Bacteria | 20894 |
| 100 | Ga0070669_100037434 | 3300005353 | Bacteria | 3519 |
| 101 | Ga0070675_100001244 | 3300005354 | Bacteria | 18566 |
| 102 | Ga0070675_100010772 | 3300005354 | Bacteria | 7152 |
| 103 | Ga0070675_100019421 | 3300005354 | Bacteria | 5416 |
| 104 | Ga0070675_100045372 | 3300005354 | Bacteria | 3596 |
| 105 | Ga0070675_100072505 | 3300005354 | Bacteria | 2859 |
| 106 | Ga0070675_100090277 | 3300005354 | Bacteria | 2566 |
| 107 | Ga0070675_100115299 | 3300005354 | Bacteria | 2277 |
| 108 | Ga0070671_100000803 | 3300005355 | Bacteria | 22698 |
| 109 | Ga0070671_100002319 | 3300005355 | Bacteria | 14699 |
| 110 | Ga0070671_100011447 | 3300005355 | Bacteria | 7131 |
| 111 | Ga0070671_100123092 | 3300005355 | Bacteria | 2183 |
| 112 | Ga0070671_100147884 | 3300005355 | Bacteria | 1983 |
| 113 | Ga0070671_100259914 | 3300005355 | Bacteria | 1475 |
| 114 | Ga0070671_100270747 | 3300005355 | Bacteria | 1444 |
| 115 | Ga0070674_100000274 | 3300005356 | Bacteria | 25095 |
| 116 | Ga0070674_100015585 | 3300005356 | Bacteria | 4749 |
| 117 | Ga0070674_100051434 | 3300005356 | Bacteria | 2839 |
| 118 | Ga0070674_100078640 | 3300005356 | Bacteria | 2351 |
| 119 | Ga0070673_100000502 | 3300005364 | Bacteria | 20926 |
| 120 | Ga0070673_100000830 | 3300005364 | Bacteria | 17287 |
| 121 | Ga0070673_100001613 | 3300005364 | Bacteria | 13330 |
| 122 | Ga0070688_100001343 | 3300005365 | Bacteria | 12214 |
| 123 | Ga0070659_100051896 | 3300005366 | Bacteria | 3225 |
| 124 | Ga0070667_100001764 | 3300005367 | Bacteria | 19262 |
| 125 | Ga0070667_100010428 | 3300005367 | Bacteria | 7671 |
| 126 | Ga0070667_100027156 | 3300005367 | Bacteria | 4764 |
| 127 | Ga0070667_100061358 | 3300005367 | Bacteria | 3183 |
| 128 | Ga0070667_100069343 | 3300005367 | Bacteria | 3000 |
| 129 | Ga0070667_100088093 | 3300005367 | Bacteria | 2665 |
| 130 | Ga0070667_100126214 | 3300005367 | Bacteria | 2230 |
| 131 | Ga0070709_10008071 | 3300005434 | Bacteria | 5776 |
| 132 | Ga0070709_10086488 | 3300005434 | Bacteria | 2058 |
| 133 | Ga0070714_100005399 | 3300005435 | Bacteria | 9753 |
| 134 | Ga0070713_100000260 | 3300005436 | Bacteria | 34743 |
| 135 | Ga0070713_100001983 | 3300005436 | Bacteria | 13210 |
| 136 | Ga0070713_100128437 | 3300005436 | Bacteria | 2232 |
| 137 | Ga0070713_100281540 | 3300005436 | Bacteria | 1526 |
| 138 | Ga0070711_100009608 | 3300005439 | Bacteria | 5960 |
| 139 | Ga0070711_100261814 | 3300005439 | Bacteria | 1361 |
| 140 | Ga0070700_100047209 | 3300005441 | Bacteria | 2664 |
| 141 | Ga0070708_100002558 | 3300005445 | Bacteria | 14069 |
| 142 | Ga0070663_100013800 | 3300005455 | Bacteria | 5168 |
| 143 | Ga0070663_100230053 | 3300005455 | Bacteria | 1459 |
| 144 | Ga0070678_100002201 | 3300005456 | Bacteria | 10602 |
| 145 | Ga0070678_100003193 | 3300005456 | Bacteria | 9096 |
| 146 | Ga0070678_100058594 | 3300005456 | Bacteria | 2827 |
| 147 | Ga0070678_100106868 | 3300005456 | Bacteria | 2181 |
| 148 | Ga0070678_100107996 | 3300005456 | Bacteria | 2171 |
| 149 | Ga0070678_100138332 | 3300005456 | Bacteria | 1945 |
| 150 | Ga0070678_100287374 | 3300005456 | Bacteria | 1393 |
| 151 | Ga0070662_100002003 | 3300005457 | Bacteria | 12491 |
| 152 | Ga0070662_100017339 | 3300005457 | Bacteria | 4855 |
| 153 | Ga0070662_100018662 | 3300005457 | Bacteria | 4696 |
| 154 | Ga0070681_10110400 | 3300005458 | Bacteria | 2690 |
| 155 | Ga0068867_100001459 | 3300005459 | Bacteria | 16391 |
| 156 | Ga0068867_100002610 | 3300005459 | Bacteria | 12706 |
| 157 | Ga0068867_100047178 | 3300005459 | Bacteria | 3166 |
| 158 | Ga0068867_100065386 | 3300005459 | Bacteria | 2706 |
| 159 | Ga0070685_10000750 | 3300005466 | Bacteria | 17640 |
| 160 | Ga0070679_100021986 | 3300005530 | Bacteria | 6231 |
| 161 | Ga0070679_100046845 | 3300005530 | Bacteria | 4310 |
| 162 | Ga0070684_100009859 | 3300005535 | Bacteria | 7546 |
| 163 | Ga0070684_100020569 | 3300005535 | Bacteria | 5474 |
| 164 | Ga0070684_100059867 | 3300005535 | Bacteria | 3330 |
| 165 | Ga0070684_100159330 | 3300005535 | Bacteria | 2047 |
| 166 | Ga0068853_100006479 | 3300005539 | Bacteria | 9310 |
| 167 | Ga0068853_100008837 | 3300005539 | Bacteria | 8104 |
| 168 | Ga0068853_100167693 | 3300005539 | Bacteria | 1985 |
| 169 | Ga0068853_100342775 | 3300005539 | Bacteria | 1389 |
| 170 | Ga0070672_100000202 | 3300005543 | Bacteria | 32978 |
| 171 | Ga0070672_100000616 | 3300005543 | Bacteria | 20862 |
| 172 | Ga0070672_100135704 | 3300005543 | Bacteria | 2026 |
| 173 | Ga0070672_100139403 | 3300005543 | Bacteria | 1999 |
| 174 | Ga0070672_100222122 | 3300005543 | Bacteria | 1585 |
| 175 | Ga0070686_100060217 | 3300005544 | Bacteria | 2449 |
| 176 | Ga0070693_100124387 | 3300005547 | Bacteria | 1603 |
| 177 | Ga0070665_100000982 | 3300005548 | Bacteria | 36142 |
| 178 | Ga0070665_100001071 | 3300005548 | Bacteria | 34085 |
| 179 | Ga0070665_100002968 | 3300005548 | Bacteria | 18325 |
| 180 | Ga0070665_100014568 | 3300005548 | Bacteria | 7889 |
| 181 | Ga0070665_100243138 | 3300005548 | Bacteria | 1800 |
| 182 | Ga0070704_100175022 | 3300005549 | Bacteria | 1711 |
| 183 | Ga0068855_100014542 | 3300005563 | Bacteria | 9478 |
| 184 | Ga0068855_100015933 | 3300005563 | Bacteria | 9042 |
| 185 | Ga0068855_100037558 | 3300005563 | Bacteria | 5759 |
| 186 | Ga0068855_100055098 | 3300005563 | Bacteria | 4671 |
| 187 | Ga0068855_100134917 | 3300005563 | Bacteria | 2816 |
| 188 | Ga0070664_100006995 | 3300005564 | Bacteria | 9097 |
| 189 | Ga0070664_100043072 | 3300005564 | Bacteria | 3808 |
| 190 | Ga0070664_100060159 | 3300005564 | Bacteria | 3234 |
| 191 | Ga0070664_100061589 | 3300005564 | Bacteria | 3198 |
| 192 | Ga0070664_100099020 | 3300005564 | Bacteria | 2533 |
| 193 | Ga0068857_100002632 | 3300005577 | Bacteria | 14734 |
| 194 | Ga0068857_100067392 | 3300005577 | Bacteria | 3186 |
| 195 | Ga0068857_100113025 | 3300005577 | Bacteria | 2441 |
| 196 | Ga0068857_100193748 | 3300005577 | Bacteria | 1851 |
| 197 | Ga0068854_100015673 | 3300005578 | Bacteria | 5031 |
| 198 | Ga0068854_100029294 | 3300005578 | Bacteria | 3811 |
| 199 | Ga0068856_100032839 | 3300005614 | Bacteria | 5082 |
| 200 | Ga0068856_100035047 | 3300005614 | Bacteria | 4917 |
| 201 | Ga0068856_100041356 | 3300005614 | Bacteria | 4529 |
| 202 | Ga0068856_100071382 | 3300005614 | Bacteria | 3437 |
| 203 | Ga0068852_100001296 | 3300005616 | Bacteria | 16715 |
| 204 | Ga0068852_100002427 | 3300005616 | Bacteria | 12829 |
| 205 | Ga0068852_100002469 | 3300005616 | Bacteria | 12727 |
| 206 | Ga0068852_100003642 | 3300005616 | Bacteria | 10791 |
| 207 | Ga0068852_100202190 | 3300005616 | Bacteria | 1880 |
| 208 | Ga0068859_100000299 | 3300005617 | Bacteria | 49331 |
| 209 | Ga0068864_100000973 | 3300005618 | Bacteria | 24018 |
| 210 | Ga0068864_100001865 | 3300005618 | Bacteria | 17299 |
| 211 | Ga0068864_100014639 | 3300005618 | Bacteria | 6516 |
| 212 | Ga0068864_100017389 | 3300005618 | Bacteria | 5996 |
| 213 | Ga0068864_100036399 | 3300005618 | Bacteria | 4195 |
| 214 | Ga0068864_100044498 | 3300005618 | Bacteria | 3806 |
| 215 | Ga0068866_10007175 | 3300005718 | Bacteria | 4661 |
| 216 | Ga0068861_100000405 | 3300005719 | Bacteria | 24937 |
| 217 | Ga0068861_100003338 | 3300005719 | Bacteria | 10628 |
| 218 | Ga0068861_100047283 | 3300005719 | Bacteria | 3247 |
| 219 | Ga0068861_100078425 | 3300005719 | Bacteria | 2579 |
| 220 | Ga0068851_10005924 | 3300005834 | Bacteria | 5563 |
| 221 | Ga0068851_10005937 | 3300005834 | Bacteria | 5557 |
| 222 | Ga0068851_10023969 | 3300005834 | Bacteria | 2985 |
| 223 | Ga0068851_10038082 | 3300005834 | Bacteria | 2412 |
| 224 | Ga0068851_10072028 | 3300005834 | Bacteria | 1789 |
| 225 | Ga0068870_10027062 | 3300005840 | Bacteria | 2865 |
| 226 | Ga0068863_100008043 | 3300005841 | Bacteria | 10298 |
| 227 | Ga0068863_100036282 | 3300005841 | Bacteria | 4697 |
| 228 | Ga0068863_100057950 | 3300005841 | Bacteria | 3666 |
| 229 | Ga0068863_100089185 | 3300005841 | Bacteria | 2924 |
| 230 | Ga0068863_100106122 | 3300005841 | Bacteria | 2672 |
| 231 | Ga0068863_100169078 | 3300005841 | Bacteria | 2096 |
| 232 | Ga0068863_100186824 | 3300005841 | Bacteria | 1991 |
| 233 | Ga0068858_100002362 | 3300005842 | Bacteria | 19076 |
| 234 | Ga0068858_100051954 | 3300005842 | Bacteria | 3792 |
| 235 | Ga0068860_100000216 | 3300005843 | Bacteria | 90423 |
| 236 | Ga0068860_100001383 | 3300005843 | Bacteria | 26323 |
| 237 | Ga0068860_100038831 | 3300005843 | Bacteria | 4555 |
| 238 | Ga0068860_100056478 | 3300005843 | Bacteria | 3732 |
| 239 | Ga0068860_100058929 | 3300005843 | Bacteria | 3651 |
| 240 | Ga0068860_100226510 | 3300005843 | Bacteria | 1816 |
| 241 | Ga0068862_100015000 | 3300005844 | Bacteria | 6435 |
| 242 | Ga0070717_10051736 | 3300006028 | Bacteria | 3382 |
| 243 | Ga0075365_10022743 | 3300006038 | Bacteria | 3932 |
| 244 | Ga0075365_10081033 | 3300006038 | Bacteria | 2198 |
| 245 | Ga0075365_10088354 | 3300006038 | Bacteria | 2108 |
| 246 | Ga0075368_10021210 | 3300006042 | Bacteria | 2466 |
| 247 | Ga0075363_100021432 | 3300006048 | Bacteria | 3255 |
| 248 | Ga0075363_100065389 | 3300006048 | Bacteria | 1966 |
| 249 | Ga0075363_100101348 | 3300006048 | Bacteria | 1594 |
| 250 | Ga0075364_10025483 | 3300006051 | Bacteria | 3764 |
| 251 | Ga0075364_10091324 | 3300006051 | Bacteria | 2020 |
| 252 | Ga0075364_10131519 | 3300006051 | Bacteria | 1679 |
| 253 | Ga0070715_10041445 | 3300006163 | Bacteria | 1930 |
| 254 | Ga0070716_100009928 | 3300006173 | Bacteria | 4761 |
| 255 | Ga0070712_100002075 | 3300006175 | Bacteria | 12294 |
| 256 | Ga0075362_10008038 | 3300006177 | Bacteria | 4019 |
| 257 | Ga0075362_10053803 | 3300006177 | Bacteria | 1808 |
| 258 | Ga0075362_10071687 | 3300006177 | Bacteria | 1583 |
| 259 | Ga0075367_10022602 | 3300006178 | Bacteria | 3529 |
| 260 | Ga0075369_10024533 | 3300006186 | Bacteria | 2500 |
| 261 | Ga0075369_10106548 | 3300006186 | Bacteria | 1261 |
| 262 | Ga0075366_10008556 | 3300006195 | Bacteria | 5693 |
| 263 | Ga0075366_10012284 | 3300006195 | Bacteria | 4855 |
| 264 | Ga0075366_10043910 | 3300006195 | Bacteria | 2648 |
| 265 | Ga0075366_10069834 | 3300006195 | Bacteria | 2091 |
| 266 | Ga0075366_10138889 | 3300006195 | Bacteria | 1468 |
| 267 | Ga0097621_100025467 | 3300006237 | Bacteria | 4630 |
| 268 | Ga0097621_100032630 | 3300006237 | Bacteria | 4141 |
| 269 | Ga0097621_100034930 | 3300006237 | Bacteria | 4013 |
| 270 | Ga0097621_100055054 | 3300006237 | Bacteria | 3247 |
| 271 | Ga0075370_10004900 | 3300006353 | Bacteria | 6572 |
| 272 | Ga0075370_10024685 | 3300006353 | Bacteria | 3322 |
| 273 | Ga0075370_10033431 | 3300006353 | Bacteria | 2880 |
| 274 | Ga0068871_100020380 | 3300006358 | Bacteria | 5078 |
| 275 | Ga0068871_100039339 | 3300006358 | Bacteria | 3783 |
| 276 | Ga0068871_100067809 | 3300006358 | Bacteria | 2928 |
| 277 | Ga0075434_100163224 | 3300006871 | Bacteria | 2248 |
| 278 | Ga0068865_100014828 | 3300006881 | Bacteria | 4959 |
| 279 | Ga0068865_100022953 | 3300006881 | Bacteria | 4078 |
| 280 | Ga0068865_100032381 | 3300006881 | Bacteria | 3491 |
| 281 | Ga0097620_100000299 | 3300006931 | Bacteria | 49331 |
| 282 | Ga0079104_1021813 | 3300006946 | Bacteria | 1737 |
| 283 | Ga0099826_10000044 | 3300006948 | Bacteria | 88060 |
| 284 | Ga0105244_10001156 | 3300009036 | Bacteria | 21857 |
| 285 | Ga0105244_10021526 | 3300009036 | Bacteria | 3565 |
| 286 | Ga0105240_10014739 | 3300009093 | Bacteria | 10662 |
| 287 | Ga0105240_10047143 | 3300009093 | Bacteria | 5455 |
| 288 | Ga0105240_10060157 | 3300009093 | Bacteria | 4736 |
| 289 | Ga0105240_10410890 | 3300009093 | Bacteria | 1522 |
| 290 | Ga0105245_10009237 | 3300009098 | Bacteria | 8596 |
| 291 | Ga0105245_10015868 | 3300009098 | Bacteria | 6563 |
| 292 | Ga0105245_10107469 | 3300009098 | Bacteria | 2590 |
| 293 | Ga0105245_10339106 | 3300009098 | Bacteria | 1486 |
| 294 | Ga0105245_10400144 | 3300009098 | Bacteria | 1372 |
| 295 | Ga0105247_10005757 | 3300009101 | Bacteria | 7760 |
| 296 | Ga0105243_10002240 | 3300009148 | Bacteria | 16253 |
| 297 | Ga0105243_10002379 | 3300009148 | Bacteria | 15749 |
| 298 | Ga0105243_10003283 | 3300009148 | Bacteria | 13145 |
| 299 | Ga0105243_10062928 | 3300009148 | Bacteria | 2972 |
| 300 | Ga0105241_10007933 | 3300009174 | Bacteria | 7806 |
| 301 | Ga0105241_10025815 | 3300009174 | Bacteria | 4367 |
| 302 | Ga0105241_10175159 | 3300009174 | Bacteria | 1775 |
| 303 | Ga0105242_10121367 | 3300009176 | Bacteria | 2243 |
| 304 | Ga0105248_10028897 | 3300009177 | Bacteria | 6181 |
| 305 | Ga0105248_10090531 | 3300009177 | Bacteria | 3445 |
| 306 | Ga0105248_10180854 | 3300009177 | Bacteria | 2376 |
| 307 | Ga0105237_10000933 | 3300009545 | Bacteria | 39346 |
| 308 | Ga0105237_10037996 | 3300009545 | Bacteria | 4864 |
| 309 | Ga0105237_10096912 | 3300009545 | Bacteria | 2940 |
| 310 | Ga0105238_10008227 | 3300009551 | Bacteria | 10433 |
| 311 | Ga0105238_10030064 | 3300009551 | Bacteria | 5528 |
| 312 | Ga0105238_10082419 | 3300009551 | Bacteria | 3206 |
| 313 | Ga0105238_10111427 | 3300009551 | Bacteria | 2717 |
| 314 | Ga0105249_10064275 | 3300009553 | Bacteria | 3373 |
| 315 | Ga0105249_10152469 | 3300009553 | Bacteria | 2226 |
| 316 | Ga0105239_10007368 | 3300010375 | Bacteria | 12638 |
| 317 | Ga0105239_10320371 | 3300010375 | Bacteria | 1748 |
| 318 | Ga0105246_10068407 | 3300011119 | Bacteria | 2491 |
| 319 | Ga0105246_10176241 | 3300011119 | Bacteria | 1642 |
| 320 | Ga0157373_10001556 | 3300013100 | Bacteria | 17499 |
| 321 | Ga0157373_10013744 | 3300013100 | Bacteria | 5935 |
| 322 | Ga0157371_10015422 | 3300013102 | Bacteria | 5733 |
| 323 | Ga0157371_10043853 | 3300013102 | Bacteria | 3185 |
| 324 | Ga0157371_10051612 | 3300013102 | Bacteria | 2922 |
| 325 | Ga0157371_10087976 | 3300013102 | Bacteria | 2199 |
| 326 | Ga0157370_10057280 | 3300013104 | Bacteria | 3706 |
| 327 | Ga0157370_10217311 | 3300013104 | Bacteria | 1771 |
| 328 | Ga0157369_10000456 | 3300013105 | Bacteria | 54115 |
| 329 | Ga0157369_10039411 | 3300013105 | Bacteria | 5163 |
| 330 | Ga0157369_10040205 | 3300013105 | Bacteria | 5106 |
| 331 | Ga0157369_10172220 | 3300013105 | Bacteria | 2280 |
| 332 | Ga0157374_10008825 | 3300013296 | Bacteria | 8629 |
| 333 | Ga0157374_10168342 | 3300013296 | Bacteria | 2137 |
| 334 | Ga0157378_10002940 | 3300013297 | Bacteria | 15150 |
| 335 | Ga0157378_10010946 | 3300013297 | Bacteria | 7934 |
| 336 | Ga0163162_10009038 | 3300013306 | Bacteria | 9685 |
| 337 | Ga0163162_10010013 | 3300013306 | Bacteria | 9217 |
| 338 | Ga0163162_10014511 | 3300013306 | Bacteria | 7699 |
| 339 | Ga0163162_10050004 | 3300013306 | Bacteria | 4191 |
| 340 | Ga0163162_10312657 | 3300013306 | Bacteria | 1703 |
| 341 | Ga0163162_10361502 | 3300013306 | Bacteria | 1585 |
| 342 | Ga0157372_10031835 | 3300013307 | Bacteria | 5779 |
| 343 | Ga0157372_10104164 | 3300013307 | Bacteria | 3243 |
| 344 | Ga0157372_10326825 | 3300013307 | Bacteria | 1786 |
| 345 | Ga0157375_10001479 | 3300013308 | Bacteria | 20180 |
| 346 | Ga0157375_10002234 | 3300013308 | Bacteria | 16754 |
| 347 | Ga0157375_10004157 | 3300013308 | Bacteria | 12560 |
| 348 | Ga0157375_10069870 | 3300013308 | Bacteria | 3519 |
| 349 | Ga0163163_10010522 | 3300014325 | Bacteria | 8323 |
| 350 | Ga0163163_10017385 | 3300014325 | Bacteria | 6706 |
| 351 | Ga0157380_10005798 | 3300014326 | Bacteria | 8645 |
| 352 | Ga0157380_10041751 | 3300014326 | Bacteria | 3582 |
| 353 | Ga0182008_10003337 | 3300014497 | Bacteria | 9751 |
| 354 | Ga0182008_10006370 | 3300014497 | Bacteria | 6609 |
| 355 | Ga0182008_10014906 | 3300014497 | Bacteria | 4066 |
| 356 | Ga0182008_10060982 | 3300014497 | Bacteria | 1859 |
| 357 | Ga0157377_10000246 | 3300014745 | Bacteria | 26794 |
| 358 | Ga0157377_10036460 | 3300014745 | Bacteria | 2705 |
| 359 | Ga0157379_10000911 | 3300014968 | Bacteria | 23851 |
| 360 | Ga0157379_10004260 | 3300014968 | Bacteria | 12214 |
| 361 | Ga0157379_10004346 | 3300014968 | Bacteria | 12120 |
| 362 | Ga0157379_10015058 | 3300014968 | Bacteria | 6784 |
| 363 | Ga0157379_10024195 | 3300014968 | Bacteria | 5390 |
| 364 | Ga0157379_10126688 | 3300014968 | Bacteria | 2298 |
| 365 | Ga0157376_10010329 | 3300014969 | Bacteria | 6822 |
| 366 | Ga0157376_10031559 | 3300014969 | Bacteria | 4245 |
| 367 | Ga0157376_10054119 | 3300014969 | Bacteria | 3344 |
| 368 | Ga0182006_1001535 | 3300015261 | Bacteria | 13801 |
| 369 | Ga0182006_1003085 | 3300015261 | Bacteria | 8734 |
| 370 | Ga0182006_1031627 | 3300015261 | Bacteria | 2130 |
| 371 | Ga0182007_10002970 | 3300015262 | Bacteria | 8217 |
| 372 | Ga0183362_10006 | 3300015683 | Bacteria | 287231 |
| 373 | Ga0163161_10000308 | 3300017792 | Bacteria | 42596 |
| 374 | Ga0163161_10057833 | 3300017792 | Bacteria | 2818 |
| 375 | Ga0163161_10161183 | 3300017792 | Bacteria | 1710 |
| 376 | Ga0206350_11076645 | 3300020080 | Bacteria | 1322 |
| 377 | Ga0213876_10016615 | 3300021384 | Bacteria | 3888 |
| 378 | Ga0213876_10038786 | 3300021384 | Bacteria | 2515 |
| 379 | Ga0213875_10001420 | 3300021388 | Bacteria | 15553 |
| 380 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 381 | Ga0209436_104850 | 3300025208 | Bacteria | 3225 |
| 382 | Ga0209672_100529 | 3300025228 | Bacteria | 20856 |
| 383 | Ga0209672_102290 | 3300025228 | Bacteria | 4895 |
| 384 | Ga0209147_100715 | 3300025229 | Bacteria | 16813 |
| 385 | Ga0209147_101310 | 3300025229 | Bacteria | 9576 |
| 386 | Ga0209258_100089 | 3300025242 | Bacteria | 234040 |
| 387 | Ga0209258_100454 | 3300025242 | Bacteria | 45089 |
| 388 | Ga0207425_1000355 | 3300025245 | Bacteria | 31804 |
| 389 | Ga0207425_1000483 | 3300025245 | Bacteria | 25107 |
| 390 | Ga0207425_1001782 | 3300025245 | Bacteria | 8362 |
| 391 | Ga0207425_1002298 | 3300025245 | Bacteria | 6860 |
| 392 | Ga0207425_1008002 | 3300025245 | Bacteria | 2741 |
| 393 | Ga0209646_1000029 | 3300025246 | Bacteria | 386414 |
| 394 | Ga0209026_1000016 | 3300025250 | Bacteria | 386457 |
| 395 | Ga0209148_1000097 | 3300025254 | Bacteria | 234049 |
| 396 | Ga0209148_1000449 | 3300025254 | Bacteria | 45110 |
| 397 | Ga0209759_1000016 | 3300025256 | Bacteria | 386414 |
| 398 | Ga0209129_1000033 | 3300025258 | Bacteria | 336894 |
| 399 | Ga0209129_1005867 | 3300025258 | Bacteria | 4173 |
| 400 | Ga0209565_1000019 | 3300025263 | Bacteria | 438920 |
| 401 | Ga0209565_1000047 | 3300025263 | Bacteria | 225745 |
| 402 | Ga0209565_1000120 | 3300025263 | Bacteria | 111458 |
| 403 | Ga0209565_1000586 | 3300025263 | Bacteria | 24589 |
| 404 | Ga0209565_1008452 | 3300025263 | Bacteria | 2690 |
| 405 | Ga0209673_1000079 | 3300025273 | Bacteria | 225746 |
| 406 | Ga0209673_1000099 | 3300025273 | Bacteria | 193248 |
| 407 | Ga0209673_1000185 | 3300025273 | Bacteria | 125742 |
| 408 | Ga0209673_1000492 | 3300025273 | Bacteria | 65573 |
| 409 | Ga0209673_1001345 | 3300025273 | Bacteria | 24589 |
| 410 | Ga0209673_1002128 | 3300025273 | Bacteria | 14787 |
| 411 | Ga0209673_1002340 | 3300025273 | Bacteria | 13407 |
| 412 | Ga0209673_1010691 | 3300025273 | Bacteria | 3847 |
| 413 | Ga0209130_1000011 | 3300025284 | Bacteria | 431723 |
| 414 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 415 | Ga0209130_1000272 | 3300025284 | Bacteria | 64696 |
| 416 | Ga0209130_1000736 | 3300025284 | Bacteria | 28751 |
| 417 | Ga0209130_1001586 | 3300025284 | Bacteria | 14275 |
| 418 | Ga0209130_1001885 | 3300025284 | Bacteria | 11906 |
| 419 | Ga0209130_1010381 | 3300025284 | Bacteria | 2568 |
| 420 | Ga0209675_1000046 | 3300025291 | Bacteria | 225746 |
| 421 | Ga0209675_1000054 | 3300025291 | Bacteria | 193248 |
| 422 | Ga0209675_1000073 | 3300025291 | Bacteria | 163009 |
| 423 | Ga0209675_1000296 | 3300025291 | Bacteria | 46253 |
| 424 | Ga0209675_1000539 | 3300025291 | Bacteria | 27695 |
| 425 | Ga0209675_1000622 | 3300025291 | Bacteria | 25332 |
| 426 | Ga0209675_1001599 | 3300025291 | Bacteria | 12794 |
| 427 | Ga0209675_1006949 | 3300025291 | Bacteria | 4439 |
| 428 | Ga0209675_1019145 | 3300025291 | Bacteria | 1892 |
| 429 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 430 | Ga0209676_1000153 | 3300025292 | Bacteria | 166393 |
| 431 | Ga0209676_1000179 | 3300025292 | Bacteria | 150096 |
| 432 | Ga0209676_1000896 | 3300025292 | Bacteria | 37733 |
| 433 | Ga0209676_1001185 | 3300025292 | Bacteria | 28045 |
| 434 | Ga0209676_1010360 | 3300025292 | Bacteria | 3898 |
| 435 | Ga0209676_1011930 | 3300025292 | Bacteria | 3459 |
| 436 | Ga0209676_1019621 | 3300025292 | Bacteria | 2321 |
| 437 | Ga0209025_1000714 | 3300025294 | Bacteria | 56537 |
| 438 | Ga0209025_1000743 | 3300025294 | Bacteria | 54915 |
| 439 | Ga0209025_1000973 | 3300025294 | Bacteria | 42929 |
| 440 | Ga0209025_1001001 | 3300025294 | Bacteria | 41900 |
| 441 | Ga0209025_1005221 | 3300025294 | Bacteria | 10713 |
| 442 | Ga0209025_1005695 | 3300025294 | Bacteria | 10034 |
| 443 | Ga0209025_1005712 | 3300025294 | Bacteria | 10001 |
| 444 | Ga0209025_1008443 | 3300025294 | Bacteria | 7411 |
| 445 | Ga0209025_1017032 | 3300025294 | Bacteria | 4230 |
| 446 | Ga0209025_1019327 | 3300025294 | Bacteria | 3792 |
| 447 | Ga0209025_1037003 | 3300025294 | Bacteria | 2173 |
| 448 | Ga0209564_1000040 | 3300025295 | Bacteria | 411388 |
| 449 | Ga0209564_1000151 | 3300025295 | Bacteria | 168783 |
| 450 | Ga0209564_1000246 | 3300025295 | Bacteria | 117096 |
| 451 | Ga0209564_1000725 | 3300025295 | Bacteria | 47333 |
| 452 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 453 | Ga0209758_1000037 | 3300025297 | Bacteria | 439101 |
| 454 | Ga0209758_1004818 | 3300025297 | Bacteria | 10892 |
| 455 | Ga0209758_1011129 | 3300025297 | Bacteria | 5256 |
| 456 | Ga0209758_1014773 | 3300025297 | Bacteria | 4118 |
| 457 | Ga0209758_1040496 | 3300025297 | Bacteria | 1756 |
| 458 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 459 | Ga0209050_1000172 | 3300025298 | Bacteria | 150096 |
| 460 | Ga0209050_1002148 | 3300025298 | Bacteria | 17949 |
| 461 | Ga0209050_1003172 | 3300025298 | Bacteria | 12496 |
| 462 | Ga0209050_1005822 | 3300025298 | Bacteria | 7560 |
| 463 | Ga0209050_1024418 | 3300025298 | Bacteria | 2092 |
| 464 | Ga0209050_1028869 | 3300025298 | Bacteria | 1789 |
| 465 | Ga0209256_1000023 | 3300025299 | Bacteria | 461150 |
| 466 | Ga0209256_1000039 | 3300025299 | Bacteria | 372337 |
| 467 | Ga0209256_1000069 | 3300025299 | Bacteria | 245640 |
| 468 | Ga0209256_1000161 | 3300025299 | Bacteria | 138270 |
| 469 | Ga0209256_1006705 | 3300025299 | Bacteria | 5974 |
| 470 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 471 | Ga0207426_1000029 | 3300025302 | Bacteria | 473835 |
| 472 | Ga0207426_1000115 | 3300025302 | Bacteria | 227423 |
| 473 | Ga0207426_1000174 | 3300025302 | Bacteria | 160877 |
| 474 | Ga0207426_1000411 | 3300025302 | Bacteria | 71437 |
| 475 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 476 | Ga0209051_1000046 | 3300025303 | Bacteria | 296424 |
| 477 | Ga0209051_1000055 | 3300025303 | Bacteria | 277194 |
| 478 | Ga0209051_1000128 | 3300025303 | Bacteria | 142159 |
| 479 | Ga0209051_1000483 | 3300025303 | Bacteria | 51423 |
| 480 | Ga0209051_1000762 | 3300025303 | Bacteria | 34275 |
| 481 | Ga0209051_1000841 | 3300025303 | Bacteria | 31619 |
| 482 | Ga0209051_1002685 | 3300025303 | Bacteria | 12424 |
| 483 | Ga0209051_1002686 | 3300025303 | Bacteria | 12422 |
| 484 | Ga0209051_1009810 | 3300025303 | Bacteria | 4902 |
| 485 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 486 | Ga0209257_1000101 | 3300025304 | Bacteria | 251553 |
| 487 | Ga0209257_1000281 | 3300025304 | Bacteria | 114413 |
| 488 | Ga0209257_1000377 | 3300025304 | Bacteria | 89033 |
| 489 | Ga0209257_1001061 | 3300025304 | Bacteria | 36348 |
| 490 | Ga0209257_1017705 | 3300025304 | Bacteria | 2790 |
| 491 | Ga0207697_10008475 | 3300025315 | Bacteria | 4494 |
| 492 | Ga0207697_10015952 | 3300025315 | Bacteria | 3098 |
| 493 | Ga0207656_10009598 | 3300025321 | Bacteria | 3596 |
| 494 | Ga0207656_10017111 | 3300025321 | Bacteria | 2835 |
| 495 | Ga0207655_1005421 | 3300025728 | Bacteria | 8674 |
| 496 | Ga0207682_10000930 | 3300025893 | Bacteria | 13586 |
| 497 | Ga0207682_10001271 | 3300025893 | Bacteria | 11579 |
| 498 | Ga0207682_10012418 | 3300025893 | Bacteria | 3325 |
| 499 | Ga0207682_10035668 | 3300025893 | Bacteria | 2010 |
| 500 | Ga0207692_10050644 | 3300025898 | Bacteria | 2102 |
| 501 | Ga0207642_10071197 | 3300025899 | Bacteria | 1655 |
| 502 | Ga0207710_10012742 | 3300025900 | Bacteria | 3540 |
| 503 | Ga0207688_10129459 | 3300025901 | Bacteria | 1478 |
| 504 | Ga0207680_10003123 | 3300025903 | Bacteria | 7780 |
| 505 | Ga0207680_10003924 | 3300025903 | Bacteria | 7018 |
| 506 | Ga0207680_10035243 | 3300025903 | Bacteria | 2871 |
| 507 | Ga0207699_10007585 | 3300025906 | Bacteria | 5311 |
| 508 | Ga0207645_10000242 | 3300025907 | Bacteria | 45222 |
| 509 | Ga0207645_10000481 | 3300025907 | Bacteria | 33007 |
| 510 | Ga0207645_10023328 | 3300025907 | Bacteria | 4022 |
| 511 | Ga0207645_10151049 | 3300025907 | Bacteria | 1516 |
| 512 | Ga0207643_10014273 | 3300025908 | Bacteria | 4314 |
| 513 | Ga0207643_10037378 | 3300025908 | Bacteria | 2725 |
| 514 | Ga0207654_10015755 | 3300025911 | Bacteria | 3928 |
| 515 | Ga0207654_10090825 | 3300025911 | Bacteria | 1861 |
| 516 | Ga0207707_10082168 | 3300025912 | Bacteria | 2813 |
| 517 | Ga0207695_10040965 | 3300025913 | Bacteria | 4961 |
| 518 | Ga0207695_10061561 | 3300025913 | Bacteria | 3878 |
| 519 | Ga0207695_10062000 | 3300025913 | Bacteria | 3863 |
| 520 | Ga0207695_10215361 | 3300025913 | Bacteria | 1830 |
| 521 | Ga0207671_10008055 | 3300025914 | Bacteria | 9007 |
| 522 | Ga0207693_10000405 | 3300025915 | Bacteria | 39292 |
| 523 | Ga0207663_10003087 | 3300025916 | Bacteria | 8076 |
| 524 | Ga0207663_10225900 | 3300025916 | Bacteria | 1365 |
| 525 | Ga0207662_10004572 | 3300025918 | Bacteria | 7294 |
| 526 | Ga0207662_10019814 | 3300025918 | Bacteria | 3834 |
| 527 | Ga0207657_10021044 | 3300025919 | Bacteria | 6149 |
| 528 | Ga0207657_10030031 | 3300025919 | Bacteria | 4938 |
| 529 | Ga0207657_10069103 | 3300025919 | Bacteria | 2999 |
| 530 | Ga0207657_10102655 | 3300025919 | Bacteria | 2371 |
| 531 | Ga0207657_10241732 | 3300025919 | Bacteria | 1441 |
| 532 | Ga0207652_10087621 | 3300025921 | Bacteria | 2730 |
| 533 | Ga0207681_10000162 | 3300025923 | Bacteria | 55291 |
| 534 | Ga0207681_10013644 | 3300025923 | Bacteria | 5031 |
| 535 | Ga0207681_10019030 | 3300025923 | Bacteria | 4334 |
| 536 | Ga0207681_10066479 | 3300025923 | Bacteria | 2496 |
| 537 | Ga0207694_10029379 | 3300025924 | Bacteria | 4194 |
| 538 | Ga0207694_10079787 | 3300025924 | Bacteria | 2567 |
| 539 | Ga0207694_10125408 | 3300025924 | Bacteria | 2054 |
| 540 | Ga0207650_10001039 | 3300025925 | Bacteria | 20830 |
| 541 | Ga0207650_10004268 | 3300025925 | Bacteria | 9753 |
| 542 | Ga0207650_10012479 | 3300025925 | Bacteria | 5865 |
| 543 | Ga0207650_10040447 | 3300025925 | Bacteria | 3412 |
| 544 | Ga0207650_10047698 | 3300025925 | Bacteria | 3157 |
| 545 | Ga0207650_10067893 | 3300025925 | Bacteria | 2676 |
| 546 | Ga0207650_10154738 | 3300025925 | Bacteria | 1812 |
| 547 | Ga0207650_10327360 | 3300025925 | Bacteria | 1256 |
| 548 | Ga0207659_10004029 | 3300025926 | Bacteria | 8865 |
| 549 | Ga0207659_10018283 | 3300025926 | Bacteria | 4593 |
| 550 | Ga0207659_10062930 | 3300025926 | Bacteria | 2680 |
| 551 | Ga0207659_10074965 | 3300025926 | Bacteria | 2481 |
| 552 | Ga0207659_10312004 | 3300025926 | Bacteria | 1295 |
| 553 | Ga0207687_10005515 | 3300025927 | Bacteria | 8371 |
| 554 | Ga0207687_10036680 | 3300025927 | Bacteria | 3340 |
| 555 | Ga0207700_10001855 | 3300025928 | Bacteria | 11973 |
| 556 | Ga0207664_10089203 | 3300025929 | Bacteria | 2524 |
| 557 | Ga0207644_10000236 | 3300025931 | Bacteria | 37953 |
| 558 | Ga0207644_10003418 | 3300025931 | Bacteria | 10251 |
| 559 | Ga0207644_10008705 | 3300025931 | Bacteria | 6643 |
| 560 | Ga0207644_10014552 | 3300025931 | Bacteria | 5265 |
| 561 | Ga0207644_10014708 | 3300025931 | Bacteria | 5244 |
| 562 | Ga0207644_10101692 | 3300025931 | Bacteria | 2160 |
| 563 | Ga0207644_10130324 | 3300025931 | Bacteria | 1924 |
| 564 | Ga0207690_10072446 | 3300025932 | Bacteria | 2379 |
| 565 | Ga0207690_10152698 | 3300025932 | Bacteria | 1713 |
| 566 | Ga0207706_10002936 | 3300025933 | Bacteria | 16479 |
| 567 | Ga0207706_10006657 | 3300025933 | Bacteria | 10682 |
| 568 | Ga0207686_10035034 | 3300025934 | Bacteria | 3010 |
| 569 | Ga0207686_10236463 | 3300025934 | Bacteria | 1327 |
| 570 | Ga0207709_10000319 | 3300025935 | Bacteria | 52470 |
| 571 | Ga0207709_10000868 | 3300025935 | Bacteria | 23068 |
| 572 | Ga0207709_10002362 | 3300025935 | Bacteria | 11916 |
| 573 | Ga0207670_10013702 | 3300025936 | Bacteria | 4790 |
| 574 | Ga0207669_10002721 | 3300025937 | Bacteria | 7570 |
| 575 | Ga0207669_10003694 | 3300025937 | Bacteria | 6654 |
| 576 | Ga0207669_10024902 | 3300025937 | Bacteria | 3224 |
| 577 | Ga0207669_10117174 | 3300025937 | Bacteria | 1799 |
| 578 | Ga0207704_10006650 | 3300025938 | Bacteria | 5411 |
| 579 | Ga0207691_10000084 | 3300025940 | Bacteria | 80075 |
| 580 | Ga0207691_10002250 | 3300025940 | Bacteria | 18932 |
| 581 | Ga0207691_10002324 | 3300025940 | Bacteria | 18618 |
| 582 | Ga0207691_10019132 | 3300025940 | Bacteria | 6482 |
| 583 | Ga0207691_10114013 | 3300025940 | Bacteria | 2402 |
| 584 | Ga0207691_10232243 | 3300025940 | Bacteria | 1597 |
| 585 | Ga0207711_10000320 | 3300025941 | Bacteria | 51464 |
| 586 | Ga0207711_10009403 | 3300025941 | Bacteria | 8163 |
| 587 | Ga0207711_10050769 | 3300025941 | Bacteria | 3551 |
| 588 | Ga0207689_10000725 | 3300025942 | Bacteria | 31641 |
| 589 | Ga0207689_10008373 | 3300025942 | Bacteria | 9006 |
| 590 | Ga0207689_10094751 | 3300025942 | Bacteria | 2452 |
| 591 | Ga0207689_10146300 | 3300025942 | Bacteria | 1947 |
| 592 | Ga0207661_10121699 | 3300025944 | Bacteria | 2222 |
| 593 | Ga0207679_10008059 | 3300025945 | Bacteria | 6698 |
| 594 | Ga0207679_10008384 | 3300025945 | Bacteria | 6581 |
| 595 | Ga0207679_10045774 | 3300025945 | Bacteria | 3167 |
| 596 | Ga0207679_10133938 | 3300025945 | Bacteria | 1992 |
| 597 | Ga0207667_10013088 | 3300025949 | Bacteria | 9522 |
| 598 | Ga0207667_10033228 | 3300025949 | Bacteria | 5550 |
| 599 | Ga0207667_10048599 | 3300025949 | Bacteria | 4485 |
| 600 | Ga0207667_10268640 | 3300025949 | Bacteria | 1744 |
| 601 | Ga0207651_10001535 | 3300025960 | Bacteria | 10540 |
| 602 | Ga0207651_10011801 | 3300025960 | Bacteria | 4906 |
| 603 | Ga0207712_10013041 | 3300025961 | Bacteria | 5324 |
| 604 | Ga0207712_10163635 | 3300025961 | Bacteria | 1732 |
| 605 | Ga0207668_10001266 | 3300025972 | Bacteria | 15063 |
| 606 | Ga0207668_10011750 | 3300025972 | Bacteria | 5335 |
| 607 | Ga0207668_10019585 | 3300025972 | Bacteria | 4280 |
| 608 | Ga0207668_10042208 | 3300025972 | Bacteria | 3088 |
| 609 | Ga0207668_10088267 | 3300025972 | Bacteria | 2270 |
| 610 | Ga0207668_10186334 | 3300025972 | Bacteria | 1641 |
| 611 | Ga0207640_10027346 | 3300025981 | Bacteria | 3474 |
| 612 | Ga0207640_10032378 | 3300025981 | Bacteria | 3241 |
| 613 | Ga0207640_10083221 | 3300025981 | Bacteria | 2193 |
| 614 | Ga0207640_10123093 | 3300025981 | Bacteria | 1862 |
| 615 | Ga0207658_10000181 | 3300025986 | Bacteria | 67700 |
| 616 | Ga0207658_10028994 | 3300025986 | Bacteria | 3903 |
| 617 | Ga0207658_10037345 | 3300025986 | Bacteria | 3489 |
| 618 | Ga0207658_10062420 | 3300025986 | Bacteria | 2788 |
| 619 | Ga0207658_10123511 | 3300025986 | Bacteria | 2068 |
| 620 | Ga0207658_10266012 | 3300025986 | Bacteria | 1463 |
| 621 | Ga0207677_10001129 | 3300026023 | Bacteria | 14557 |
| 622 | Ga0207677_10003051 | 3300026023 | Bacteria | 8854 |
| 623 | Ga0207677_10048120 | 3300026023 | Bacteria | 2869 |
| 624 | Ga0207677_10069671 | 3300026023 | Bacteria | 2474 |
| 625 | Ga0207677_10088010 | 3300026023 | Bacteria | 2250 |
| 626 | Ga0207703_10000377 | 3300026035 | Bacteria | 47621 |
| 627 | Ga0207703_10002749 | 3300026035 | Bacteria | 15066 |
| 628 | Ga0207703_10013218 | 3300026035 | Bacteria | 6430 |
| 629 | Ga0207703_10018081 | 3300026035 | Bacteria | 5505 |
| 630 | Ga0207703_10135870 | 3300026035 | Bacteria | 2129 |
| 631 | Ga0207703_10147716 | 3300026035 | Bacteria | 2046 |
| 632 | Ga0207639_10003425 | 3300026041 | Bacteria | 10668 |
| 633 | Ga0207639_10009290 | 3300026041 | Bacteria | 6780 |
| 634 | Ga0207639_10026001 | 3300026041 | Bacteria | 4250 |
| 635 | Ga0207639_10078064 | 3300026041 | Bacteria | 2612 |
| 636 | Ga0207678_10024411 | 3300026067 | Bacteria | 5279 |
| 637 | Ga0207678_10043678 | 3300026067 | Bacteria | 3878 |
| 638 | Ga0207678_10047219 | 3300026067 | Bacteria | 3724 |
| 639 | Ga0207708_10080307 | 3300026075 | Bacteria | 2506 |
| 640 | Ga0207702_10005209 | 3300026078 | Bacteria | 11415 |
| 641 | Ga0207702_10029549 | 3300026078 | Bacteria | 4561 |
| 642 | Ga0207702_10035879 | 3300026078 | Bacteria | 4146 |
| 643 | Ga0207702_10260513 | 3300026078 | Bacteria | 1633 |
| 644 | Ga0207641_10001807 | 3300026088 | Bacteria | 20576 |
| 645 | Ga0207641_10007514 | 3300026088 | Bacteria | 9070 |
| 646 | Ga0207641_10041170 | 3300026088 | Bacteria | 3871 |
| 647 | Ga0207641_10042857 | 3300026088 | Bacteria | 3798 |
| 648 | Ga0207641_10108018 | 3300026088 | Bacteria | 2462 |
| 649 | Ga0207641_10119563 | 3300026088 | Bacteria | 2349 |
| 650 | Ga0207641_10141317 | 3300026088 | Bacteria | 2172 |
| 651 | Ga0207648_10000799 | 3300026089 | Bacteria | 35474 |
| 652 | Ga0207648_10002006 | 3300026089 | Bacteria | 22204 |
| 653 | Ga0207648_10008220 | 3300026089 | Bacteria | 10130 |
| 654 | Ga0207648_10012486 | 3300026089 | Bacteria | 7953 |
| 655 | Ga0207648_10220242 | 3300026089 | Bacteria | 1686 |
| 656 | Ga0207676_10012888 | 3300026095 | Bacteria | 6003 |
| 657 | Ga0207676_10015861 | 3300026095 | Bacteria | 5447 |
| 658 | Ga0207676_10027124 | 3300026095 | Bacteria | 4263 |
| 659 | Ga0207676_10042038 | 3300026095 | Bacteria | 3513 |
| 660 | Ga0207676_10080947 | 3300026095 | Bacteria | 2637 |
| 661 | Ga0207676_10191354 | 3300026095 | Bacteria | 1800 |
| 662 | Ga0207674_10002241 | 3300026116 | Bacteria | 24492 |
| 663 | Ga0207674_10041068 | 3300026116 | Bacteria | 4786 |
| 664 | Ga0207674_10128118 | 3300026116 | Bacteria | 2502 |
| 665 | Ga0207674_10208960 | 3300026116 | Bacteria | 1901 |
| 666 | Ga0207675_100000273 | 3300026118 | Bacteria | 49026 |
| 667 | Ga0207675_100000770 | 3300026118 | Bacteria | 31956 |
| 668 | Ga0207675_100003220 | 3300026118 | Bacteria | 16019 |
| 669 | Ga0207675_100016216 | 3300026118 | Bacteria | 6955 |
| 670 | Ga0207683_10000003 | 3300026121 | Bacteria | 191866 |
| 671 | Ga0207683_10003562 | 3300026121 | Bacteria | 13579 |
| 672 | Ga0207683_10016614 | 3300026121 | Bacteria | 6264 |
| 673 | Ga0207683_10020310 | 3300026121 | Bacteria | 5680 |
| 674 | Ga0207683_10065538 | 3300026121 | Bacteria | 3203 |
| 675 | Ga0207683_10066195 | 3300026121 | Bacteria | 3186 |
| 676 | Ga0207683_10135533 | 3300026121 | Bacteria | 2216 |
| 677 | Ga0207698_10001703 | 3300026142 | Bacteria | 12820 |
| 678 | Ga0207698_10006587 | 3300026142 | Bacteria | 7261 |
| 679 | Ga0207698_10015574 | 3300026142 | Bacteria | 5096 |
| 680 | Ga0207698_10034839 | 3300026142 | Bacteria | 3675 |
| 681 | Ga0207698_10071400 | 3300026142 | Bacteria | 2755 |
| 682 | Ga0207698_10074270 | 3300026142 | Bacteria | 2712 |
| 683 | Ga0209282_1014520 | 3300027666 | Bacteria | 5014 |
| 684 | Ga0209974_10000572 | 3300027876 | Bacteria | 12285 |
| 685 | Ga0209974_10020721 | 3300027876 | Bacteria | 2179 |
| 686 | Ga0268266_10013197 | 3300028379 | Bacteria | 7124 |
| 687 | Ga0268266_10064760 | 3300028379 | Bacteria | 3158 |
| 688 | Ga0268266_10372303 | 3300028379 | Bacteria | 1345 |
| 689 | Ga0268264_10002625 | 3300028381 | Bacteria | 15693 |
| 690 | Ga0268264_10018448 | 3300028381 | Bacteria | 5706 |
| 691 | Ga0268264_10025144 | 3300028381 | Bacteria | 4864 |
| 692 | Ga0268264_10029519 | 3300028381 | Bacteria | 4492 |
| 693 | Ga0268264_10343893 | 3300028381 | Bacteria | 1418 |
| 694 | Ga0307515_10000257 | 3300028794 | Bacteria | 131732 |
| 695 | Ga0307515_10000737 | 3300028794 | Bacteria | 75687 |
| 696 | Ga0307515_10000911 | 3300028794 | Bacteria | 68106 |
| 697 | Ga0307515_10001517 | 3300028794 | Bacteria | 51954 |
| 698 | Ga0307515_10002263 | 3300028794 | Bacteria | 42131 |
| 699 | Ga0307515_10002980 | 3300028794 | Bacteria | 35948 |
| 700 | Ga0307515_10080406 | 3300028794 | Bacteria | 4252 |
| 701 | Ga0307511_10000086 | 3300030521 | Bacteria | 77931 |
| 702 | Ga0307512_10012428 | 3300030522 | Bacteria | 8035 |
| 703 | Ga0316180_1037273 | 3300030736 | Bacteria | 1470 |
| 704 | Ga0316183_1058424 | 3300030742 | Bacteria | 5149 |
| 705 | Ga0316182_1247809 | 3300030745 | Bacteria | 2626 |
| 706 | Ga0265330_10025219 | 3300031235 | Bacteria | 2696 |
| 707 | Ga0307513_10000037 | 3300031456 | Bacteria | 175364 |
| 708 | Ga0307513_10014317 | 3300031456 | Bacteria | 9691 |
| 709 | Ga0307513_10166806 | 3300031456 | Bacteria | 2085 |
| 710 | Ga0307509_10028187 | 3300031507 | Bacteria | 6246 |
| 711 | Ga0307408_100000117 | 3300031548 | Bacteria | 87442 |
| 712 | Ga0307408_100005526 | 3300031548 | Bacteria | 8445 |
| 713 | Ga0307408_100029623 | 3300031548 | Bacteria | 3794 |
| 714 | Ga0307408_100142692 | 3300031548 | Bacteria | 1881 |
| 715 | Ga0307508_10000101 | 3300031616 | Bacteria | 100858 |
| 716 | Ga0307514_10000408 | 3300031649 | Bacteria | 95961 |
| 717 | Ga0307514_10001925 | 3300031649 | Bacteria | 22740 |
| 718 | Ga0265314_10005849 | 3300031711 | Bacteria | 11012 |
| 719 | Ga0265314_10061543 | 3300031711 | Bacteria | 2555 |
| 720 | Ga0307516_10004632 | 3300031730 | Bacteria | 16868 |
| 721 | Ga0307516_10004894 | 3300031730 | Bacteria | 16300 |
| 722 | Ga0307405_10005204 | 3300031731 | Bacteria | 6246 |
| 723 | Ga0307405_10007347 | 3300031731 | Bacteria | 5500 |
| 724 | Ga0307405_10031026 | 3300031731 | Bacteria | 3141 |
| 725 | Ga0307405_10033033 | 3300031731 | Bacteria | 3065 |
| 726 | Ga0307413_10086242 | 3300031824 | Bacteria | 2029 |
| 727 | Ga0307406_10000717 | 3300031901 | Bacteria | 18697 |
| 728 | Ga0307406_10001362 | 3300031901 | Bacteria | 13677 |
| 729 | Ga0307406_10001703 | 3300031901 | Bacteria | 12091 |
| 730 | Ga0307406_10008835 | 3300031901 | Bacteria | 5631 |
| 731 | Ga0307412_10032584 | 3300031911 | Bacteria | 3304 |
| 732 | Ga0307412_10061904 | 3300031911 | Bacteria | 2517 |
| 733 | Ga0307412_10077918 | 3300031911 | Bacteria | 2281 |
| 734 | Ga0307409_100234697 | 3300031995 | Bacteria | 1665 |
| 735 | Ga0307416_100005940 | 3300032002 | Bacteria | 7585 |
| 736 | Ga0307411_10141963 | 3300032005 | Bacteria | 1772 |
| 737 | Ga0373934_0031443 | 3300035086 | Bacteria | 2078 |
| 738 | Ga0373944_0012434 | 3300035089 | Bacteria | 2345 |
| 739 | Ga0373952_0017932 | 3300035092 | Bacteria | 1459 |
| 740 | Ga0373923_0024304 | 3300035111 | Bacteria | 2391 |
| 741 | Ga0373954_0056826 | 3300035118 | Bacteria | 1842 |
| 742 | Ga0373956_0020838 | 3300035119 | Bacteria | 2794 |
| 743 | Ga0373956_0037296 | 3300035119 | Bacteria | 2148 |
| 744 | Ga0373957_0009807 | 3300035120 | Bacteria | 3143 |
| 745 | Ga0373943_0037724 | 3300035170 | Bacteria | 2320 |
| 746 | Ga0373943_0045843 | 3300035170 | Bacteria | 2132 |
| 747 | Ga0373924_0001355 | 3300035410 | Bacteria | 7900 |
| 748 | Ga0373924_0005008 | 3300035410 | Bacteria | 4662 |
| 749 | Ga0373935_0027565 | 3300035692 | Bacteria | 3512 |
| 750 | Ga0373935_0088661 | 3300035692 | Bacteria | 2021 |
| 751 | Ga0373927_0146437 | 3300035695 | Bacteria | 1546 |
| 752 | Ga0373933_0026327 | 3300035724 | Bacteria | 3339 |
| 753 | Ga0373933_0038139 | 3300035724 | Bacteria | 2823 |
| 754 | Ga0373947_0017539 | 3300035725 | Bacteria | 4118 |
| 755 | Ga0373947_0105003 | 3300035725 | Bacteria | 1779 |
| 756 | Ga0373937_0003621 | 3300036401 | Bacteria | 13032 |
| 757 | Ga0373937_0006249 | 3300036401 | Bacteria | 10274 |
| 758 | Ga0373937_0013535 | 3300036401 | Bacteria | 7184 |
| 759 | Ga0373937_0045827 | 3300036401 | Bacteria | 3997 |
| 760 | Ga0373937_0282586 | 3300036401 | Bacteria | 1567 |
| 761 | Ga0373925_0031507 | 3300037068 | Bacteria | 3897 |
| 762 | Ga0373925_0062778 | 3300037068 | Bacteria | 2794 |
| 763 | Ga0373925_0274969 | 3300037068 | Bacteria | 1355 |
| 764 | Ga0395899_0000729 | 3300037312 | Bacteria | 32868 |
| 765 | Ga0395899_0000953 | 3300037312 | Bacteria | 27077 |
| 766 | Ga0395899_0004365 | 3300037312 | Bacteria | 11030 |
| 767 | Ga0395899_0142355 | 3300037312 | Bacteria | 1705 |
| 768 | Ga0395900_0003921 | 3300037418 | Bacteria | 15886 |
| 769 | Ga0395900_0012212 | 3300037418 | Bacteria | 8780 |
| 770 | Ga0395900_0013023 | 3300037418 | Bacteria | 8498 |
| 771 | Ga0395900_0013168 | 3300037418 | Bacteria | 8453 |
| 772 | Ga0395900_0023654 | 3300037418 | Bacteria | 6285 |
| 773 | Ga0395900_0042298 | 3300037418 | Bacteria | 4694 |
| 774 | Ga0395900_0299272 | 3300037418 | Bacteria | 1595 |
| 775 | Ga0395898_0002404 | 3300037466 | Bacteria | 22217 |
| 776 | Ga0395898_0021652 | 3300037466 | Bacteria | 6516 |
| 777 | Ga0395898_0029788 | 3300037466 | Bacteria | 5463 |
| 778 | Ga0395905_0000773 | 3300037471 | Bacteria | 42104 |
| 779 | Ga0395905_0002341 | 3300037471 | Bacteria | 21134 |
| 780 | Ga0395905_0006414 | 3300037471 | Bacteria | 11843 |
| 781 | Ga0395905_0007480 | 3300037471 | Bacteria | 10866 |
| 782 | Ga0395905_0008399 | 3300037471 | Bacteria | 10183 |
| 783 | Ga0395905_0025327 | 3300037471 | Bacteria | 5594 |
| 784 | Ga0395905_0034441 | 3300037471 | Bacteria | 4755 |
| 785 | Ga0395905_0127970 | 3300037471 | Bacteria | 2388 |
| 786 | Ga0395905_0148231 | 3300037471 | Bacteria | 2208 |
| 787 | Ga0436364_0001604 | 3300037853 | Bacteria | 2885 |
| 788 | Ga0436364_0810222 | 3300037853 | Bacteria | 5386 |
| 789 | Ga0436364_1195167 | 3300037853 | Bacteria | 4748 |
| 790 | Ga0395901_0015521 | 3300038443 | Bacteria | 7756 |
| 791 | Ga0395901_0210306 | 3300038443 | Bacteria | 2036 |
| 792 | Ga0395901_0221072 | 3300038443 | Bacteria | 1979 |
| 793 | Ga0436365_0085001 | 3300039437 | Bacteria | 1220 |
| 794 | Ga0436365_0697045 | 3300039437 | Bacteria | 35162 |
| 795 | Ga0436361_0206236 | 3300039447 | Bacteria | 37288 |
| 796 | Ga0436363_0279939 | 3300039450 | Bacteria | 13836 |
| 797 | Ga0436363_1334668 | 3300039450 | Bacteria | 12831 |
| 798 | Ga0436362_0430762 | 3300039453 | Bacteria | 3666 |
| 799 | Ga0439436_0010842 | 3300041404 | Bacteria | 2776 |
| 800 | Ga0439447_014462 | 3300041407 | Bacteria | 2214 |
| 801 | Ga0439431_0013721 | 3300041997 | Bacteria | 1871 |
| 802 | Ga0439445_0019986 | 3300042004 | Bacteria | 1673 |
| 803 | Ga0439445_0030848 | 3300042004 | Bacteria | 1391 |
| 804 | Ga0439432_000428 | 3300042006 | Bacteria | 15693 |
| 805 | Ga0439449_0006422 | 3300042007 | Bacteria | 4496 |
| 806 | Ga0439449_0011558 | 3300042007 | Bacteria | 3320 |
| 807 | Ga0439462_0008801 | 3300042015 | Bacteria | 2551 |
| 808 | Ga0450911_000033 | 3300042115 | Bacteria | 65955 |
| 809 | Ga0450911_000416 | 3300042115 | Bacteria | 14088 |
| 810 | Ga0439434_0004056 | 3300042435 | Bacteria | 4275 |
| 811 | Ga0450918_002189 | 3300042531 | Bacteria | 3726 |
| 812 | Ga0451577_0002494 | 3300042876 | Bacteria | 21855 |
| 813 | Ga0466969_0007935 | 3300044656 | Bacteria | 5634 |
| 814 | Ga0453683_0007748 | 3300044673 | Bacteria | 7263 |
| 815 | Ga0466966_0015680 | 3300044684 | Bacteria | 5010 |
| 816 | Ga0466964_0012946 | 3300044706 | Bacteria | 3160 |
| 817 | Ga0453684_0006738 | 3300044712 | Bacteria | 21642 |
| 818 | Ga0453684_0015963 | 3300044712 | Bacteria | 11805 |
| 819 | Ga0453684_0075827 | 3300044712 | Bacteria | 4224 |
| 820 | Ga0466968_0013088 | 3300044735 | Bacteria | 3256 |
| 821 | Ga0466957_0041422 | 3300044842 | Bacteria | 2785 |
| 822 | Ga0466959_0053187 | 3300045049 | Bacteria | 2961 |
| 823 | Ga0451576_0004732 | 3300045051 | Bacteria | 17494 |
| 824 | Ga0451576_0042754 | 3300045051 | Bacteria | 4784 |
| 825 | Ga0451576_0079716 | 3300045051 | Bacteria | 3407 |
| 826 | Ga0466958_0022473 | 3300045836 | Bacteria | 3695 |
| 827 | Ga0495629_0000409 | 3300046459 | Bacteria | 35959 |
| 828 | Ga0495629_0014553 | 3300046459 | Bacteria | 5661 |
| 829 | Ga0495651_0001051 | 3300046462 | Bacteria | 21350 |
| 830 | Ga0495653_0019732 | 3300046463 | Bacteria | 5465 |
| 831 | Ga0495580_0109441 | 3300046472 | Bacteria | 1918 |
| 832 | Ga0495580_0174216 | 3300046472 | Bacteria | 1486 |
| 833 | Ga0495582_0103162 | 3300046473 | Bacteria | 1598 |
| 834 | Ga0495639_0010877 | 3300046475 | Bacteria | 3919 |
| 835 | Ga0495662_0016655 | 3300046476 | Bacteria | 3561 |
| 836 | Ga0495662_0094866 | 3300046476 | Bacteria | 1457 |
| 837 | Ga0495584_0121854 | 3300046491 | Bacteria | 1321 |
| 838 | Ga0495583_0000463 | 3300046506 | Bacteria | 59986 |
| 839 | Ga0495606_0004903 | 3300046507 | Bacteria | 13099 |
| 840 | Ga0495610_0025647 | 3300046512 | Bacteria | 3159 |
| 841 | Ga0495610_0044980 | 3300046512 | Bacteria | 2187 |
| 842 | Ga0495618_0002201 | 3300046514 | Bacteria | 12750 |
| 843 | Ga0495630_0011056 | 3300046517 | Bacteria | 6530 |
| 844 | Ga0495630_0135154 | 3300046517 | Bacteria | 1874 |
| 845 | Ga0495631_0000760 | 3300046518 | Bacteria | 20700 |
| 846 | Ga0495632_0004880 | 3300046519 | Bacteria | 8995 |
| 847 | Ga0495632_0043077 | 3300046519 | Bacteria | 2258 |
| 848 | Ga0495637_0009149 | 3300046520 | Bacteria | 4837 |
| 849 | Ga0495643_0000398 | 3300046522 | Bacteria | 57089 |
| 850 | Ga0495643_0000960 | 3300046522 | Bacteria | 29547 |
| 851 | Ga0495654_0002132 | 3300046530 | Bacteria | 12923 |
| 852 | Ga0495665_0016123 | 3300046531 | Bacteria | 4025 |
| 853 | Ga0495640_0017299 | 3300046533 | Bacteria | 5375 |
| 854 | Ga0495587_0005039 | 3300046536 | Bacteria | 8644 |
| 855 | Ga0495587_0150586 | 3300046536 | Bacteria | 1326 |
| 856 | Ga0495667_0007034 | 3300046559 | Bacteria | 7635 |
| 857 | Ga0495667_0154892 | 3300046559 | Bacteria | 1475 |
| 858 | Ga0495656_0000340 | 3300046615 | Bacteria | 15933 |
| 859 | Ga0495656_0022112 | 3300046615 | Bacteria | 2486 |
| 860 | Ga0495625_0002232 | 3300046660 | Bacteria | 21407 |
| 861 | Ga0495625_0005135 | 3300046660 | Bacteria | 12089 |
| 862 | Ga0495635_0028200 | 3300046663 | Bacteria | 3902 |
| 863 | Ga0495661_0013991 | 3300046665 | Bacteria | 5380 |
| 864 | Ga0495588_0070443 | 3300046674 | Bacteria | 1817 |
| 865 | Ga0495623_0036475 | 3300046679 | Bacteria | 3149 |
| 866 | Ga0495623_0083794 | 3300046679 | Bacteria | 1968 |
| 867 | Ga0495646_0006787 | 3300046680 | Bacteria | 7263 |
| 868 | Ga0495647_0005749 | 3300046681 | Bacteria | 4077 |
| 869 | Ga0495658_0060115 | 3300046683 | Bacteria | 2178 |
| 870 | Ga0495670_0064298 | 3300046691 | Bacteria | 1848 |
| 871 | Ga0495600_0003659 | 3300046809 | Bacteria | 9072 |
| 872 | Ga0495604_0001090 | 3300047317 | Bacteria | 22540 |
| 873 | Ga0495674_0003125 | 3300047319 | Bacteria | 16088 |
| 874 | Ga0495680_0000795 | 3300047322 | Bacteria | 35314 |
| 875 | Ga0495675_0016020 | 3300047444 | Bacteria | 4740 |
| 876 | Ga0495684_0005001 | 3300047471 | Bacteria | 10343 |
| 877 | Ga0495684_0039919 | 3300047471 | Bacteria | 3598 |
| 878 | Ga0495684_0084289 | 3300047471 | Bacteria | 2411 |
| 879 | Ga0495593_0009993 | 3300047673 | Bacteria | 5499 |
| 880 | Ga0495593_0046206 | 3300047673 | Bacteria | 2321 |
| 881 | Ga0495602_0010500 | 3300048088 | Bacteria | 9612 |
| 882 | Ga0495626_0000868 | 3300048091 | Bacteria | 26883 |
| 883 | Ga0495626_0008192 | 3300048091 | Bacteria | 5756 |
| 884 | Ga0495626_0010129 | 3300048091 | Bacteria | 5057 |
| 885 | Ga0495626_0058254 | 3300048091 | Bacteria | 1765 |
| 886 | Ga0496100_0037447 | 3300048903 | Bacteria | 3067 |
| 887 | Ga0496100_0243514 | 3300048903 | Bacteria | 1328 |
| 888 | Ga0496101_0002523 | 3300048904 | Bacteria | 11243 |
| 889 | Ga0496101_0007754 | 3300048904 | Bacteria | 6975 |
| 890 | Ga0496101_0259532 | 3300048904 | Bacteria | 1355 |
| 891 | Ga0496102_0006650 | 3300048905 | Bacteria | 9882 |
| 892 | Ga0496103_0093559 | 3300048906 | Bacteria | 1898 |
| 893 | Ga0496104_0003535 | 3300048907 | Bacteria | 13476 |
| 894 | Ga0496105_0005191 | 3300048908 | Bacteria | 9868 |
| 895 | Ga0496105_0058115 | 3300048908 | Bacteria | 3192 |
| 896 | Ga0496106_0057080 | 3300048909 | Bacteria | 2952 |
| 897 | Ga0496107_0013884 | 3300048910 | Bacteria | 5630 |
| 898 | Ga0496108_0138887 | 3300048911 | Bacteria | 2093 |
| 899 | Ga0496109_0005079 | 3300048912 | Bacteria | 10995 |
| 900 | Ga0496109_0027699 | 3300048912 | Bacteria | 5064 |
| 901 | Ga0496110_0025566 | 3300048913 | Bacteria | 5046 |
| 902 | Ga0496110_0162028 | 3300048913 | Bacteria | 2028 |
| 903 | Ga0496110_0206482 | 3300048913 | Bacteria | 1785 |
| 904 | Ga0496112_0003897 | 3300048915 | Bacteria | 12482 |
| 905 | Ga0496112_0004675 | 3300048915 | Bacteria | 11641 |
| 906 | Ga0496112_0015232 | 3300048915 | Bacteria | 7168 |
| 907 | Ga0496112_0049858 | 3300048915 | Bacteria | 4104 |
| 908 | Ga0496113_0037995 | 3300048916 | Bacteria | 3537 |
| 909 | Ga0496113_0089139 | 3300048916 | Bacteria | 2374 |
| 910 | Ga0496114_0071643 | 3300048917 | Bacteria | 2913 |
| 911 | Ga0496114_0108143 | 3300048917 | Bacteria | 2380 |
| 912 | Ga0496115_0024747 | 3300048918 | Bacteria | 4669 |
| 913 | Ga0496115_0059915 | 3300048918 | Bacteria | 3066 |
| 914 | Ga0496117_0000965 | 3300048920 | Bacteria | 44061 |
| 915 | Ga0496117_0026287 | 3300048920 | Bacteria | 4557 |
| 916 | Ga0496118_0001301 | 3300048921 | Bacteria | 38037 |
| 917 | Ga0496118_0023891 | 3300048921 | Bacteria | 5293 |
| 918 | Ga0496118_0102815 | 3300048921 | Bacteria | 1924 |
| 919 | Ga0496121_0029040 | 3300048924 | Bacteria | 5128 |
| 920 | Ga0496121_0034728 | 3300048924 | Bacteria | 4534 |
| 921 | Ga0496122_0000199 | 3300048925 | Bacteria | 133898 |
| 922 | Ga0496122_0000310 | 3300048925 | Bacteria | 107506 |
| 923 | Ga0496123_0000102 | 3300048926 | Bacteria | 169327 |
| 924 | Ga0496123_0000312 | 3300048926 | Bacteria | 93478 |
| 925 | Ga0496124_0007963 | 3300048927 | Bacteria | 11153 |
| 926 | Ga0496124_0013624 | 3300048927 | Bacteria | 7927 |
| 927 | Ga0496125_0000361 | 3300048928 | Bacteria | 85699 |
| 928 | Ga0496125_0001359 | 3300048928 | Bacteria | 36008 |
| 929 | Ga0496125_0002445 | 3300048928 | Bacteria | 24130 |
| 930 | Ga0496125_0011871 | 3300048928 | Bacteria | 8678 |
| 931 | Ga0496125_0026569 | 3300048928 | Bacteria | 5270 |
| 932 | Ga0496125_0185624 | 3300048928 | Bacteria | 1380 |
| 933 | Ga0496126_0076353 | 3300048929 | Bacteria | 2972 |
| 934 | Ga0501033_0147141 | 3300049570 | Bacteria | 1701 |
| 935 | Ga0501037_0044434 | 3300049573 | Bacteria | 3263 |
| 936 | Ga0501037_0048122 | 3300049573 | Bacteria | 3125 |
| 937 | Ga0501038_0050943 | 3300049574 | Bacteria | 3576 |
| 938 | Ga0501039_0004592 | 3300049575 | Bacteria | 10444 |
| 939 | Ga0501041_0001425 | 3300049577 | Bacteria | 13218 |
| 940 | Ga0501043_0041705 | 3300049579 | Bacteria | 3606 |
| 941 | Ga0501047_0055347 | 3300049581 | Bacteria | 3837 |
| 942 | Ga0501071_0020912 | 3300049587 | Bacteria | 4553 |
| 943 | Ga0501072_0096621 | 3300049588 | Bacteria | 2347 |
| 944 | Ga0501076_0002101 | 3300049592 | Bacteria | 13659 |
| 945 | Ga0501079_0000442 | 3300049741 | Bacteria | 26958 |
| 946 | Ga0501080_0005112 | 3300049742 | Bacteria | 11689 |
| 947 | Ga0501081_0001609 | 3300049743 | Bacteria | 13933 |
| 948 | Ga0501083_0022417 | 3300049744 | Bacteria | 4384 |
| 949 | Ga0501262_000023 | 3300049759 | Bacteria | 21585 |
| 950 | Ga0501262_000311 | 3300049759 | Bacteria | 5938 |
| 951 | Ga0501045_0016595 | 3300049824 | Bacteria | 5232 |
| 952 | nmdc:mga03683_16298_c1 | 3300050489 | Bacteria | 2789 |
| 953 | nmdc:mga03683_49284_c1 | 3300050489 | Bacteria | 1753 |
| 954 | nmdc:mga00v17_16695_c1 | 3300050491 | Bacteria | 4141 |
| 955 | nmdc:mga0k408_100441_c1 | 3300050493 | Bacteria | 1706 |
| 956 | nmdc:mga0k408_109991_c1 | 3300050493 | Bacteria | 1629 |
| 957 | nmdc:mga0k408_17256_c1 | 3300050493 | Bacteria | 4019 |
| 958 | nmdc:mga0k408_29173_c1 | 3300050493 | Bacteria | 3140 |
| 959 | nmdc:mga0k408_3909_c1 | 3300050493 | Bacteria | 7898 |
| 960 | nmdc:mga0k408_44496_c1 | 3300050493 | Bacteria | 2560 |
| 961 | nmdc:mga0k408_47553_c1 | 3300050493 | Bacteria | 2480 |
| 962 | nmdc:mga06z11_157283_c1 | 3300050494 | Bacteria | 1297 |
| 963 | nmdc:mga07m45_20766_c1 | 3300050496 | Bacteria | 3569 |
| 964 | nmdc:mga07m45_357_c1 | 3300050496 | Bacteria | 18685 |
| 965 | nmdc:mga07m45_4231_c1 | 3300050496 | Bacteria | 7024 |
| 966 | nmdc:mga07m45_6994_c1 | 3300050496 | Bacteria | 5739 |
| 967 | nmdc:mga07m45_94235_c1 | 3300050496 | Bacteria | 1717 |
| 968 | nmdc:mga0n895_325932_c1 | 3300050512 | Bacteria | 1556 |
| 969 | nmdc:mga0sz30_5942_c1 | 3300050516 | Bacteria | 4503 |
| 970 | nmdc:mga0sz30_96834_c1 | 3300050516 | Bacteria | 1287 |
| 971 | Ga0495601_0059253 | 3300053077 | Bacteria | 2428 |
| 972 | Ga0495595_0001232 | 3300053084 | Bacteria | 9952 |
| 973 | Ga0495619_0001190 | 3300053085 | Bacteria | 17140 |
| 974 | Ga0495619_0011643 | 3300053085 | Bacteria | 5541 |
| 975 | Ga0495619_0032340 | 3300053085 | Bacteria | 3394 |
| 976 | Ga0500583_0037911 | 3300053092 | Bacteria | 2167 |
| 977 | Ga0500651_0000165 | 3300053093 | Bacteria | 42850 |
| 978 | Ga0500651_0124697 | 3300053093 | Bacteria | 1561 |
| 979 | Ga0500641_0025876 | 3300053096 | Bacteria | 2274 |
| 980 | Ga0500562_005454 | 3300053108 | Bacteria | 3194 |
| 981 | Ga0500571_000235 | 3300053110 | Bacteria | 20748 |
| 982 | Ga0500618_013591 | 3300053125 | Bacteria | 2098 |
| 983 | Ga0500658_0000102 | 3300053134 | Bacteria | 39059 |
| 984 | Ga0500658_0000693 | 3300053134 | Bacteria | 13911 |
| 985 | Ga0500559_0007382 | 3300053136 | Bacteria | 4876 |
| 986 | Ga0500559_0009091 | 3300053136 | Bacteria | 4317 |
| 987 | Ga0500568_0000375 | 3300053139 | Bacteria | 34271 |
| 988 | Ga0500568_0008065 | 3300053139 | Bacteria | 5111 |
| 989 | Ga0500586_029290 | 3300053145 | Bacteria | 1804 |
| 990 | Ga0500590_022668 | 3300053148 | Bacteria | 3264 |
| 991 | Ga0500616_0029700 | 3300053153 | Bacteria | 3007 |
| 992 | Ga0500616_0046223 | 3300053153 | Bacteria | 2315 |
| 993 | Ga0500616_0095962 | 3300053153 | Bacteria | 1458 |
| 994 | Ga0500622_0011106 | 3300053156 | Bacteria | 4917 |
| 995 | Ga0500634_0038674 | 3300053161 | Bacteria | 2593 |
| 996 | Ga0500638_055171 | 3300053162 | Bacteria | 1915 |
| 997 | Ga0500570_037731 | 3300053724 | Bacteria | 2554 |
| 998 | Ga0500645_000250 | 3300053730 | Bacteria | 40018 |
| 999 | Ga0501084_0034987 | 3300054114 | Bacteria | 4200 |
| 1000 | Ga0501082_0016744 | 3300060353 | Bacteria | 6312 |
| 1001 | Ga0466962_0015127 | 3300061719 | Bacteria | 3720 |
| 1002 | Ga0466962_0105467 | 3300061719 | Bacteria | 1355 |
| 1003 | Ga0530510_0083125 | 3300061734 | Bacteria | 2332 |
| 1004 | 2511243313 | 2511231002 | Bacteria | 5042903 |
| 1005 | 2513227893 | 2513020051 | Bacteria | 6053213 |
| 1006 | 2548500330 | 2547132374 | Bacteria | 5530232 |
| 1007 | 2587757075 | 2585428062 | Bacteria | 6842168 |
| 1008 | 2599624234 | 2599185214 | Bacteria | 8209958 |
| 1009 | 2599627740 | 2599185214 | Bacteria | 8209958 |
| 1010 | 2599672246 | 2599185226 | Bacteria | 8233575 |
| 1011 | 2599677339 | 2599185226 | Bacteria | 8233575 |
| 1012 | 2599681670 | 2599185227 | Bacteria | 8246414 |
| 1013 | 2599685403 | 2599185227 | Bacteria | 8246414 |
| 1014 | 2599693684 | 2599185229 | Bacteria | 8216126 |
| 1015 | 2599697183 | 2599185229 | Bacteria | 8216126 |
| 1016 | 2643864634 | 2643221570 | Bacteria | 5103772 |
| 1017 | 2643992751 | 2643221596 | Bacteria | 5006805 |
| 1018 | 2644058335 | 2643221609 | Bacteria | 6756331 |
| 1019 | 2644073387 | 2643221611 | Bacteria | 6820941 |
| 1020 | 2644162707 | 2643221628 | Bacteria | 5745828 |
| 1021 | 2644296430 | 2643221652 | Bacteria | 5140275 |
| 1022 | 2644328902 | 2643221658 | Bacteria | 6064537 |
| 1023 | 2644397732 | 2643221672 | Bacteria | 6322190 |
| 1024 | 2644469044 | 2643221683 | Bacteria | 5749203 |
| 1025 | 2644647121 | 2643221717 | Bacteria | 5676132 |
| 1026 | 2738719825 | 2738541277 | Bacteria | 7458140 |
| 1027 | 2738879766 | 2738541307 | Bacteria | 8606193 |
| 1028 | 2738885326 | 2738541307 | Bacteria | 8606193 |
| 1029 | 2739244323 | 2738543012 | Bacteria | 7115078 |
| 1030 | 2739252254 | 2738543013 | Bacteria | 5618633 |
| 1031 | 2739279024 | 2738543019 | Bacteria | 7459457 |
| 1032 | 2808982702 | 2808606386 | Bacteria | 4471946 |
| 1033 | 2809130203 | 2808606415 | Bacteria | 4576710 |
| 1034 | 2809150320 | 2808606419 | Bacteria | 4576925 |
| 1035 | 2816469754 | 2816332133 | Bacteria | 7249298 |
| 1036 | 2819596601 | 2818991446 | Bacteria | 7757362 |
| 1037 | 2819598482 | 2818991446 | Bacteria | 7757362 |
| 1038 | 2821450559 | 2821443989 | Bacteria | 7658172 |
| 1039 | 2831267929 | 2831265667 | Bacteria | 7184833 |
| 1040 | 2838060129 | 2838054893 | Bacteria | 7451788 |
| 1041 | 2838061396 | 2838054893 | Bacteria | 7451788 |
| 1042 | 2842677904 | 2842677519 | Bacteria | 5615038 |
| 1043 | 2842735629 | 2842733646 | Bacteria | 5716726 |
| 1044 | 2842748630 | 2842747753 | Bacteria | 5578255 |
| 1045 | 2852621457 | 2852618963 | Bacteria | 4577824 |
| 1046 | 2885199318 | 2885198086 | Bacteria | 7212419 |
| 1047 | 2885212969 | 2885211737 | Bacteria | 7212420 |
| 1048 | 2895517930 | 2895511927 | Bacteria | 6802080 |
| 1049 | 2899926268 | 2899924645 | Bacteria | 7487985 |
| 1050 | 2899931319 | 2899924645 | Bacteria | 7487985 |
| 1051 | 2904450179 | 2904449895 | Bacteria | 6927402 |
| 1052 | 2904453810 | 2904449895 | Bacteria | 6927402 |
| 1053 | 2904456998 | 2904456579 | Bacteria | 6819253 |
| 1054 | 2904462285 | 2904456579 | Bacteria | 6819253 |
| 1055 | 2904483368 | 2904479285 | Bacteria | 5073931 |
| 1056 | 2904544035 | 2904541872 | Bacteria | 8915136 |
| 1057 | 2904550030 | 2904541872 | Bacteria | 8915136 |
| 1058 | 2904606175 | 2904601388 | Bacteria | 5884906 |
| 1059 | 2919464808 | 2919462493 | Bacteria | 5817112 |
| 1060 | 2928037908 | 2928037797 | Bacteria | 7273642 |
| 1061 | 2928044200 | 2928037797 | Bacteria | 7273642 |
| 1062 | 2928046486 | 2928044640 | Bacteria | 7271509 |
| 1063 | 2928051039 | 2928044640 | Bacteria | 7271509 |
| 1064 | 2928054181 | 2928051484 | Bacteria | 7773759 |
| 1065 | 2928057125 | 2928051484 | Bacteria | 7773759 |
| 1066 | 2928065934 | 2928064002 | Bacteria | 7419480 |
| 1067 | 2928069358 | 2928064002 | Bacteria | 7419480 |
| 1068 | 2928076841 | 2928070936 | Bacteria | 8062541 |
| 1069 | 2928077109 | 2928070936 | Bacteria | 8062541 |
| 1070 | 2928087853 | 2928084124 | Bacteria | 7159212 |
| 1071 | 2928089902 | 2928084124 | Bacteria | 7159212 |
| 1072 | 2928117845 | 2928115317 | Bacteria | 6477646 |
| 1073 | 2928118709 | 2928115317 | Bacteria | 6477646 |
| 1074 | 2929162406 | 2929160207 | Bacteria | 9075316 |
| 1075 | 2929166524 | 2929160207 | Bacteria | 9075316 |
| 1076 | 2929525514 | 2929520902 | Bacteria | 6765052 |
| 1077 | 2945948839 | 2945945610 | Bacteria | 5951079 |
| 1078 | 2945972959 | 2945972063 | Bacteria | 6086495 |
| 1079 | 2945984502 | 2945984333 | Bacteria | 7358892 |
| 1080 | 2954767889 | 2954767861 | Bacteria | 5535784 |
| 1081 | 2954772974 | 2954767861 | Bacteria | 5535784 |
| 1082 | 2990715216 | 2990710928 | Bacteria | 5002431 |
| 1083 | Ga0395905_0156729 | |||
| 1084 | SwRhRL2b_contig_1156090 | |||
| 1085 | JGI24740J21852_10011219 | |||
| 1086 | JGI24740J21852_10012167 | |||
| 1087 | JGI25155J39150_1000092 | |||
| 1088 | JGI25156J39149_1000067 | |||
| 1089 | JGI25154J39366_1000089 | |||
| 1090 | JGI25157J39369_1000084 | |||
| 1091 | JGI25150J39212_1000694 | |||
| 1092 | JGI25159J45721_1000228 | |||
| 1093 | JGI25159J45721_1010332 | |||
| 1094 | JGI25151J46595_10002022 | |||
| 1095 | JGI25151J46595_10006434 | |||
| 1096 | JGI25151J46595_10006514 | |||
| 1097 | JGI25151J46595_10011382 | |||
| 1098 | JGI25160J50197_1000076 | |||
| 1099 | JGI25160J50197_1007974 | |||
| 1100 | JGI25160J50197_1008069 | |||
| 1101 | JGI25161J50226_1000058 | |||
| 1102 | Ga0055535_1000084 | |||
| 1103 | Ga0055535_1001221 | |||
| 1104 | Ga0055542_1000033 | |||
| 1105 | Ga0055542_1000381 | |||
| 1106 | Ga0055526_1007589 | |||
| 1107 | Ga0055537_1000304 | |||
| 1108 | Ga0055537_1000389 | |||
| 1109 | Ga0055537_1001544 | |||
| 1110 | Ga0055524_1000678 | |||
| 1111 | Ga0055524_1001685 | |||
| 1112 | Ga0055524_1004503 | |||
| 1113 | Ga0055536_1001854 | |||
| 1114 | Ga0055534_1000260 | |||
| 1115 | Ga0055534_1000289 | |||
| 1116 | Ga0055534_1001915 | |||
| 1117 | Ga0055534_1003287 | |||
| 1118 | Ga0055534_1004043 | |||
| 1119 | Ga0055528_1000468 | |||
| 1120 | Ga0055528_1001139 | |||
| 1121 | Ga0055528_1002348 | |||
| 1122 | Ga0055528_1008822 | |||
| 1123 | Ga0055528_1012104 | |||
| 1124 | Ga0055528_1013553 | |||
| 1125 | Ga0055530_10003506 | |||
| 1126 | Ga0055530_10005277 | |||
| 1127 | Ga0055540_1000088 | |||
| 1128 | Ga0055540_1000890 | |||
| 1129 | Ga0055540_1003373 | |||
| 1130 | Ga0055540_1003974 | |||
| 1131 | Ga0055531_10001335 | |||
| 1132 | Ga0055531_10004099 | |||
| 1133 | Ga0055531_10007816 | |||
| 1134 | Ga0055543_1001562 | |||
| 1135 | Ga0065165_1010395 | |||
| 1136 | Ga0065704_10003035 | |||
| 1137 | Ga0070658_10050911 | |||
| 1138 | Ga0070658_10069444 | |||
| 1139 | Ga0070658_10077442 | |||
| 1140 | Ga0070676_10004686 | |||
| 1141 | Ga0070676_10021675 | |||
| 1142 | Ga0070676_10027980 | |||
| 1143 | Ga0070676_10033636 | |||
| 1144 | Ga0070676_10070078 | |||
| 1145 | Ga0070683_100026059 | |||
| 1146 | Ga0070690_100001202 | |||
| 1147 | Ga0070690_100002924 | |||
| 1148 | Ga0070690_100171412 | |||
| 1149 | Ga0070670_100000527 | |||
| 1150 | Ga0070670_100007034 | |||
| 1151 | Ga0070670_100075632 | |||
| 1152 | Ga0070670_100295398 | |||
| 1153 | Ga0070677_10002614 | |||
| 1154 | Ga0070677_10008730 | |||
| 1155 | Ga0070677_10019143 | |||
| 1156 | Ga0068869_100001043 | |||
| 1157 | Ga0068869_100038691 | |||
| 1158 | Ga0068869_100201196 | |||
| 1159 | Ga0070666_10005740 | |||
| 1160 | Ga0070666_10012986 | |||
| 1161 | Ga0070666_10017401 | |||
| 1162 | Ga0070666_10033037 | |||
| 1163 | Ga0068868_100006495 | |||
| 1164 | Ga0068868_100008142 | |||
| 1165 | Ga0068868_100011759 | |||
| 1166 | Ga0068868_100016559 | |||
| 1167 | Ga0068868_100022882 | |||
| 1168 | Ga0068868_100160542 | |||
| 1169 | Ga0070660_100004674 | |||
| 1170 | Ga0070660_100010895 | |||
| 1171 | Ga0070660_100060830 | |||
| 1172 | Ga0070689_100034325 | |||
| 1173 | Ga0070687_100004173 | |||
| 1174 | Ga0070661_100002145 | |||
| 1175 | Ga0070661_100006191 | |||
| 1176 | Ga0070661_100025859 | |||
| 1177 | Ga0070661_100133026 | |||
| 1178 | Ga0070668_100002160 | |||
| 1179 | Ga0070668_100035155 | |||
| 1180 | Ga0070668_100036588 | |||
| 1181 | Ga0070669_100000975 | |||
| 1182 | Ga0070669_100037434 | |||
| 1183 | Ga0070675_100001244 | |||
| 1184 | Ga0070675_100010772 | |||
| 1185 | Ga0070675_100019421 | |||
| 1186 | Ga0070675_100045372 | |||
| 1187 | Ga0070675_100072505 | |||
| 1188 | Ga0070675_100090277 | |||
| 1189 | Ga0070675_100115299 | |||
| 1190 | Ga0070671_100000803 | |||
| 1191 | Ga0070671_100002319 | |||
| 1192 | Ga0070671_100011447 | |||
| 1193 | Ga0070671_100123092 | |||
| 1194 | Ga0070671_100147884 | |||
| 1195 | Ga0070671_100259914 | |||
| 1196 | Ga0070671_100270747 | |||
| 1197 | Ga0070674_100000274 | |||
| 1198 | Ga0070674_100015585 | |||
| 1199 | Ga0070674_100051434 | |||
| 1200 | Ga0070674_100078640 | |||
| 1201 | Ga0070673_100000502 | |||
| 1202 | Ga0070673_100000830 | |||
| 1203 | Ga0070673_100001613 | |||
| 1204 | Ga0070688_100001343 | |||
| 1205 | Ga0070659_100051896 | |||
| 1206 | Ga0070667_100001764 | |||
| 1207 | Ga0070667_100010428 | |||
| 1208 | Ga0070667_100027156 | |||
| 1209 | Ga0070667_100061358 | |||
| 1210 | Ga0070667_100069343 | |||
| 1211 | Ga0070667_100088093 | |||
| 1212 | Ga0070667_100126214 | |||
| 1213 | Ga0070709_10008071 | |||
| 1214 | Ga0070709_10086488 | |||
| 1215 | Ga0070714_100005399 | |||
| 1216 | Ga0070713_100000260 | |||
| 1217 | Ga0070713_100001983 | |||
| 1218 | Ga0070713_100128437 | |||
| 1219 | Ga0070713_100281540 | |||
| 1220 | Ga0070711_100009608 | |||
| 1221 | Ga0070711_100261814 | |||
| 1222 | Ga0070700_100047209 | |||
| 1223 | Ga0070708_100002558 | |||
| 1224 | Ga0070663_100013800 | |||
| 1225 | Ga0070663_100230053 | |||
| 1226 | Ga0070678_100002201 | |||
| 1227 | Ga0070678_100003193 | |||
| 1228 | Ga0070678_100058594 | |||
| 1229 | Ga0070678_100106868 | |||
| 1230 | Ga0070678_100107996 | |||
| 1231 | Ga0070678_100138332 | |||
| 1232 | Ga0070678_100287374 | |||
| 1233 | Ga0070662_100002003 | |||
| 1234 | Ga0070662_100017339 | |||
| 1235 | Ga0070662_100018662 | |||
| 1236 | Ga0070681_10110400 | |||
| 1237 | Ga0068867_100001459 | |||
| 1238 | Ga0068867_100002610 | |||
| 1239 | Ga0068867_100047178 | |||
| 1240 | Ga0068867_100065386 | |||
| 1241 | Ga0070685_10000750 | |||
| 1242 | Ga0070679_100021986 | |||
| 1243 | Ga0070679_100046845 | |||
| 1244 | Ga0070684_100009859 | |||
| 1245 | Ga0070684_100020569 | |||
| 1246 | Ga0070684_100059867 | |||
| 1247 | Ga0070684_100159330 | |||
| 1248 | Ga0068853_100006479 | |||
| 1249 | Ga0068853_100008837 | |||
| 1250 | Ga0068853_100167693 | |||
| 1251 | Ga0068853_100342775 | |||
| 1252 | Ga0070672_100000202 | |||
| 1253 | Ga0070672_100000616 | |||
| 1254 | Ga0070672_100135704 | |||
| 1255 | Ga0070672_100139403 | |||
| 1256 | Ga0070672_100222122 | |||
| 1257 | Ga0070686_100060217 | |||
| 1258 | Ga0070693_100124387 | |||
| 1259 | Ga0070665_100000982 | |||
| 1260 | Ga0070665_100001071 | |||
| 1261 | Ga0070665_100002968 | |||
| 1262 | Ga0070665_100014568 | |||
| 1263 | Ga0070665_100243138 | |||
| 1264 | Ga0070704_100175022 | |||
| 1265 | Ga0068855_100014542 | |||
| 1266 | Ga0068855_100015933 | |||
| 1267 | Ga0068855_100037558 | |||
| 1268 | Ga0068855_100055098 | |||
| 1269 | Ga0068855_100134917 | |||
| 1270 | Ga0070664_100006995 | |||
| 1271 | Ga0070664_100043072 | |||
| 1272 | Ga0070664_100060159 | |||
| 1273 | Ga0070664_100061589 | |||
| 1274 | Ga0070664_100099020 | |||
| 1275 | Ga0068857_100002632 | |||
| 1276 | Ga0068857_100067392 | |||
| 1277 | Ga0068857_100113025 | |||
| 1278 | Ga0068857_100193748 | |||
| 1279 | Ga0068854_100015673 | |||
| 1280 | Ga0068854_100029294 | |||
| 1281 | Ga0068856_100032839 | |||
| 1282 | Ga0068856_100035047 | |||
| 1283 | Ga0068856_100041356 | |||
| 1284 | Ga0068856_100071382 | |||
| 1285 | Ga0068852_100001296 | |||
| 1286 | Ga0068852_100002427 | |||
| 1287 | Ga0068852_100002469 | |||
| 1288 | Ga0068852_100003642 | |||
| 1289 | Ga0068852_100202190 | |||
| 1290 | Ga0068859_100000299 | |||
| 1291 | Ga0068864_100000973 | |||
| 1292 | Ga0068864_100001865 | |||
| 1293 | Ga0068864_100014639 | |||
| 1294 | Ga0068864_100017389 | |||
| 1295 | Ga0068864_100036399 | |||
| 1296 | Ga0068864_100044498 | |||
| 1297 | Ga0068866_10007175 | |||
| 1298 | Ga0068861_100000405 | |||
| 1299 | Ga0068861_100003338 | |||
| 1300 | Ga0068861_100047283 | |||
| 1301 | Ga0068861_100078425 | |||
| 1302 | Ga0068851_10005924 | |||
| 1303 | Ga0068851_10005937 | |||
| 1304 | Ga0068851_10023969 | |||
| 1305 | Ga0068851_10038082 | |||
| 1306 | Ga0068851_10072028 | |||
| 1307 | Ga0068870_10027062 | |||
| 1308 | Ga0068863_100008043 | |||
| 1309 | Ga0068863_100036282 | |||
| 1310 | Ga0068863_100057950 | |||
| 1311 | Ga0068863_100089185 | |||
| 1312 | Ga0068863_100106122 | |||
| 1313 | Ga0068863_100169078 | |||
| 1314 | Ga0068863_100186824 | |||
| 1315 | Ga0068858_100002362 | |||
| 1316 | Ga0068858_100051954 | |||
| 1317 | Ga0068860_100000216 | |||
| 1318 | Ga0068860_100001383 | |||
| 1319 | Ga0068860_100038831 | |||
| 1320 | Ga0068860_100056478 | |||
| 1321 | Ga0068860_100058929 | |||
| 1322 | Ga0068860_100226510 | |||
| 1323 | Ga0068862_100015000 | |||
| 1324 | Ga0070717_10051736 | |||
| 1325 | Ga0075365_10022743 | |||
| 1326 | Ga0075365_10081033 | |||
| 1327 | Ga0075365_10088354 | |||
| 1328 | Ga0075368_10021210 | |||
| 1329 | Ga0075363_100021432 | |||
| 1330 | Ga0075363_100065389 | |||
| 1331 | Ga0075363_100101348 | |||
| 1332 | Ga0075364_10025483 | |||
| 1333 | Ga0075364_10091324 | |||
| 1334 | Ga0075364_10131519 | |||
| 1335 | Ga0070715_10041445 | |||
| 1336 | Ga0070716_100009928 | |||
| 1337 | Ga0070712_100002075 | |||
| 1338 | Ga0075362_10008038 | |||
| 1339 | Ga0075362_10053803 | |||
| 1340 | Ga0075362_10071687 | |||
| 1341 | Ga0075367_10022602 | |||
| 1342 | Ga0075369_10024533 | |||
| 1343 | Ga0075369_10106548 | |||
| 1344 | Ga0075366_10008556 | |||
| 1345 | Ga0075366_10012284 | |||
| 1346 | Ga0075366_10043910 | |||
| 1347 | Ga0075366_10069834 | |||
| 1348 | Ga0075366_10138889 | |||
| 1349 | Ga0097621_100025467 | |||
| 1350 | Ga0097621_100032630 | |||
| 1351 | Ga0097621_100034930 | |||
| 1352 | Ga0097621_100055054 | |||
| 1353 | Ga0075370_10004900 | |||
| 1354 | Ga0075370_10024685 | |||
| 1355 | Ga0075370_10033431 | |||
| 1356 | Ga0068871_100020380 | |||
| 1357 | Ga0068871_100039339 | |||
| 1358 | Ga0068871_100067809 | |||
| 1359 | Ga0075434_100163224 | |||
| 1360 | Ga0068865_100014828 | |||
| 1361 | Ga0068865_100022953 | |||
| 1362 | Ga0068865_100032381 | |||
| 1363 | Ga0097620_100000299 | |||
| 1364 | Ga0079104_1021813 | |||
| 1365 | Ga0099826_10000044 | |||
| 1366 | Ga0105244_10001156 | |||
| 1367 | Ga0105244_10021526 | |||
| 1368 | Ga0105240_10014739 | |||
| 1369 | Ga0105240_10047143 | |||
| 1370 | Ga0105240_10060157 | |||
| 1371 | Ga0105240_10410890 | |||
| 1372 | Ga0105245_10009237 | |||
| 1373 | Ga0105245_10015868 | |||
| 1374 | Ga0105245_10107469 | |||
| 1375 | Ga0105245_10339106 | |||
| 1376 | Ga0105245_10400144 | |||
| 1377 | Ga0105247_10005757 | |||
| 1378 | Ga0105243_10002240 | |||
| 1379 | Ga0105243_10002379 | |||
| 1380 | Ga0105243_10003283 | |||
| 1381 | Ga0105243_10062928 | |||
| 1382 | Ga0105241_10007933 | |||
| 1383 | Ga0105241_10025815 | |||
| 1384 | Ga0105241_10175159 | |||
| 1385 | Ga0105242_10121367 | |||
| 1386 | Ga0105248_10028897 | |||
| 1387 | Ga0105248_10090531 | |||
| 1388 | Ga0105248_10180854 | |||
| 1389 | Ga0105237_10000933 | |||
| 1390 | Ga0105237_10037996 | |||
| 1391 | Ga0105237_10096912 | |||
| 1392 | Ga0105238_10008227 | |||
| 1393 | Ga0105238_10030064 | |||
| 1394 | Ga0105238_10082419 | |||
| 1395 | Ga0105238_10111427 | |||
| 1396 | Ga0105249_10064275 | |||
| 1397 | Ga0105249_10152469 | |||
| 1398 | Ga0105239_10007368 | |||
| 1399 | Ga0105239_10320371 | |||
| 1400 | Ga0105246_10068407 | |||
| 1401 | Ga0105246_10176241 | |||
| 1402 | Ga0157373_10001556 | |||
| 1403 | Ga0157373_10013744 | |||
| 1404 | Ga0157371_10015422 | |||
| 1405 | Ga0157371_10043853 | |||
| 1406 | Ga0157371_10051612 | |||
| 1407 | Ga0157371_10087976 | |||
| 1408 | Ga0157370_10057280 | |||
| 1409 | Ga0157370_10217311 | |||
| 1410 | Ga0157369_10000456 | |||
| 1411 | Ga0157369_10039411 | |||
| 1412 | Ga0157369_10040205 | |||
| 1413 | Ga0157369_10172220 | |||
| 1414 | Ga0157374_10008825 | |||
| 1415 | Ga0157374_10168342 | |||
| 1416 | Ga0157378_10002940 | |||
| 1417 | Ga0157378_10010946 | |||
| 1418 | Ga0163162_10009038 | |||
| 1419 | Ga0163162_10010013 | |||
| 1420 | Ga0163162_10014511 | |||
| 1421 | Ga0163162_10050004 | |||
| 1422 | Ga0163162_10312657 | |||
| 1423 | Ga0163162_10361502 | |||
| 1424 | Ga0157372_10031835 | |||
| 1425 | Ga0157372_10104164 | |||
| 1426 | Ga0157372_10326825 | |||
| 1427 | Ga0157375_10001479 | |||
| 1428 | Ga0157375_10002234 | |||
| 1429 | Ga0157375_10004157 | |||
| 1430 | Ga0157375_10069870 | |||
| 1431 | Ga0163163_10010522 | |||
| 1432 | Ga0163163_10017385 | |||
| 1433 | Ga0157380_10005798 | |||
| 1434 | Ga0157380_10041751 | |||
| 1435 | Ga0182008_10003337 | |||
| 1436 | Ga0182008_10006370 | |||
| 1437 | Ga0182008_10014906 | |||
| 1438 | Ga0182008_10060982 | |||
| 1439 | Ga0157377_10000246 | |||
| 1440 | Ga0157377_10036460 | |||
| 1441 | Ga0157379_10000911 | |||
| 1442 | Ga0157379_10004260 | |||
| 1443 | Ga0157379_10004346 | |||
| 1444 | Ga0157379_10015058 | |||
| 1445 | Ga0157379_10024195 | |||
| 1446 | Ga0157379_10126688 | |||
| 1447 | Ga0157376_10010329 | |||
| 1448 | Ga0157376_10031559 | |||
| 1449 | Ga0157376_10054119 | |||
| 1450 | Ga0182006_1001535 | |||
| 1451 | Ga0182006_1003085 | |||
| 1452 | Ga0182006_1031627 | |||
| 1453 | Ga0182007_10002970 | |||
| 1454 | Ga0183362_10006 | |||
| 1455 | Ga0163161_10000308 | |||
| 1456 | Ga0163161_10057833 | |||
| 1457 | Ga0163161_10161183 | |||
| 1458 | Ga0206350_11076645 | |||
| 1459 | Ga0213876_10016615 | |||
| 1460 | Ga0213876_10038786 | |||
| 1461 | Ga0213875_10001420 | |||
| 1462 | Ga0209435_100008 | |||
| 1463 | Ga0209436_104850 | |||
| 1464 | Ga0209672_100529 | |||
| 1465 | Ga0209672_102290 | |||
| 1466 | Ga0209147_100715 | |||
| 1467 | Ga0209147_101310 | |||
| 1468 | Ga0209258_100089 | |||
| 1469 | Ga0209258_100454 | |||
| 1470 | Ga0207425_1000355 | |||
| 1471 | Ga0207425_1000483 | |||
| 1472 | Ga0207425_1001782 | |||
| 1473 | Ga0207425_1002298 | |||
| 1474 | Ga0207425_1008002 | |||
| 1475 | Ga0209646_1000029 | |||
| 1476 | Ga0209026_1000016 | |||
| 1477 | Ga0209148_1000097 | |||
| 1478 | Ga0209148_1000449 | |||
| 1479 | Ga0209759_1000016 | |||
| 1480 | Ga0209129_1000033 | |||
| 1481 | Ga0209129_1005867 | |||
| 1482 | Ga0209565_1000019 | |||
| 1483 | Ga0209565_1000047 | |||
| 1484 | Ga0209565_1000120 | |||
| 1485 | Ga0209565_1000586 | |||
| 1486 | Ga0209565_1008452 | |||
| 1487 | Ga0209673_1000079 | |||
| 1488 | Ga0209673_1000099 | |||
| 1489 | Ga0209673_1000185 | |||
| 1490 | Ga0209673_1000492 | |||
| 1491 | Ga0209673_1001345 | |||
| 1492 | Ga0209673_1002128 | |||
| 1493 | Ga0209673_1002340 | |||
| 1494 | Ga0209673_1010691 | |||
| 1495 | Ga0209130_1000011 | |||
| 1496 | Ga0209130_1000014 | |||
| 1497 | Ga0209130_1000272 | |||
| 1498 | Ga0209130_1000736 | |||
| 1499 | Ga0209130_1001586 | |||
| 1500 | Ga0209130_1001885 | |||
| 1501 | Ga0209130_1010381 | |||
| 1502 | Ga0209675_1000046 | |||
| 1503 | Ga0209675_1000054 | |||
| 1504 | Ga0209675_1000073 | |||
| 1505 | Ga0209675_1000296 | |||
| 1506 | Ga0209675_1000539 | |||
| 1507 | Ga0209675_1000622 | |||
| 1508 | Ga0209675_1001599 | |||
| 1509 | Ga0209675_1006949 | |||
| 1510 | Ga0209675_1019145 | |||
| 1511 | Ga0209676_1000013 | |||
| 1512 | Ga0209676_1000153 | |||
| 1513 | Ga0209676_1000179 | |||
| 1514 | Ga0209676_1000896 | |||
| 1515 | Ga0209676_1001185 | |||
| 1516 | Ga0209676_1010360 | |||
| 1517 | Ga0209676_1011930 | |||
| 1518 | Ga0209676_1019621 | |||
| 1519 | Ga0209025_1000714 | |||
| 1520 | Ga0209025_1000743 | |||
| 1521 | Ga0209025_1000973 | |||
| 1522 | Ga0209025_1001001 | |||
| 1523 | Ga0209025_1005221 | |||
| 1524 | Ga0209025_1005695 | |||
| 1525 | Ga0209025_1005712 | |||
| 1526 | Ga0209025_1008443 | |||
| 1527 | Ga0209025_1017032 | |||
| 1528 | Ga0209025_1019327 | |||
| 1529 | Ga0209025_1037003 | |||
| 1530 | Ga0209564_1000040 | |||
| 1531 | Ga0209564_1000151 | |||
| 1532 | Ga0209564_1000246 | |||
| 1533 | Ga0209564_1000725 | |||
| 1534 | Ga0209758_1000027 | |||
| 1535 | Ga0209758_1000037 | |||
| 1536 | Ga0209758_1004818 | |||
| 1537 | Ga0209758_1011129 | |||
| 1538 | Ga0209758_1014773 | |||
| 1539 | Ga0209758_1040496 | |||
| 1540 | Ga0209050_1000008 | |||
| 1541 | Ga0209050_1000172 | |||
| 1542 | Ga0209050_1002148 | |||
| 1543 | Ga0209050_1003172 | |||
| 1544 | Ga0209050_1005822 | |||
| 1545 | Ga0209050_1024418 | |||
| 1546 | Ga0209050_1028869 | |||
| 1547 | Ga0209256_1000023 | |||
| 1548 | Ga0209256_1000039 | |||
| 1549 | Ga0209256_1000069 | |||
| 1550 | Ga0209256_1000161 | |||
| 1551 | Ga0209256_1006705 | |||
| 1552 | Ga0207426_1000027 | |||
| 1553 | Ga0207426_1000029 | |||
| 1554 | Ga0207426_1000115 | |||
| 1555 | Ga0207426_1000174 | |||
| 1556 | Ga0207426_1000411 | |||
| 1557 | Ga0209051_1000005 | |||
| 1558 | Ga0209051_1000046 | |||
| 1559 | Ga0209051_1000055 | |||
| 1560 | Ga0209051_1000128 | |||
| 1561 | Ga0209051_1000483 | |||
| 1562 | Ga0209051_1000762 | |||
| 1563 | Ga0209051_1000841 | |||
| 1564 | Ga0209051_1002685 | |||
| 1565 | Ga0209051_1002686 | |||
| 1566 | Ga0209051_1009810 | |||
| 1567 | Ga0209257_1000031 | |||
| 1568 | Ga0209257_1000101 | |||
| 1569 | Ga0209257_1000281 | |||
| 1570 | Ga0209257_1000377 | |||
| 1571 | Ga0209257_1001061 | |||
| 1572 | Ga0209257_1017705 | |||
| 1573 | Ga0207697_10008475 | |||
| 1574 | Ga0207697_10015952 | |||
| 1575 | Ga0207656_10009598 | |||
| 1576 | Ga0207656_10017111 | |||
| 1577 | Ga0207655_1005421 | |||
| 1578 | Ga0207682_10000930 | |||
| 1579 | Ga0207682_10001271 | |||
| 1580 | Ga0207682_10012418 | |||
| 1581 | Ga0207682_10035668 | |||
| 1582 | Ga0207692_10050644 | |||
| 1583 | Ga0207642_10071197 | |||
| 1584 | Ga0207710_10012742 | |||
| 1585 | Ga0207688_10129459 | |||
| 1586 | Ga0207680_10003123 | |||
| 1587 | Ga0207680_10003924 | |||
| 1588 | Ga0207680_10035243 | |||
| 1589 | Ga0207699_10007585 | |||
| 1590 | Ga0207645_10000242 | |||
| 1591 | Ga0207645_10000481 | |||
| 1592 | Ga0207645_10023328 | |||
| 1593 | Ga0207645_10151049 | |||
| 1594 | Ga0207643_10014273 | |||
| 1595 | Ga0207643_10037378 | |||
| 1596 | Ga0207654_10015755 | |||
| 1597 | Ga0207654_10090825 | |||
| 1598 | Ga0207707_10082168 | |||
| 1599 | Ga0207695_10040965 | |||
| 1600 | Ga0207695_10061561 | |||
| 1601 | Ga0207695_10062000 | |||
| 1602 | Ga0207695_10215361 | |||
| 1603 | Ga0207671_10008055 | |||
| 1604 | Ga0207693_10000405 | |||
| 1605 | Ga0207663_10003087 | |||
| 1606 | Ga0207663_10225900 | |||
| 1607 | Ga0207662_10004572 | |||
| 1608 | Ga0207662_10019814 | |||
| 1609 | Ga0207657_10021044 | |||
| 1610 | Ga0207657_10030031 | |||
| 1611 | Ga0207657_10069103 | |||
| 1612 | Ga0207657_10102655 | |||
| 1613 | Ga0207657_10241732 | |||
| 1614 | Ga0207652_10087621 | |||
| 1615 | Ga0207681_10000162 | |||
| 1616 | Ga0207681_10013644 | |||
| 1617 | Ga0207681_10019030 | |||
| 1618 | Ga0207681_10066479 | |||
| 1619 | Ga0207694_10029379 | |||
| 1620 | Ga0207694_10079787 | |||
| 1621 | Ga0207694_10125408 | |||
| 1622 | Ga0207650_10001039 | |||
| 1623 | Ga0207650_10004268 | |||
| 1624 | Ga0207650_10012479 | |||
| 1625 | Ga0207650_10040447 | |||
| 1626 | Ga0207650_10047698 | |||
| 1627 | Ga0207650_10067893 | |||
| 1628 | Ga0207650_10154738 | |||
| 1629 | Ga0207650_10327360 | |||
| 1630 | Ga0207659_10004029 | |||
| 1631 | Ga0207659_10018283 | |||
| 1632 | Ga0207659_10062930 | |||
| 1633 | Ga0207659_10074965 | |||
| 1634 | Ga0207659_10312004 | |||
| 1635 | Ga0207687_10005515 | |||
| 1636 | Ga0207687_10036680 | |||
| 1637 | Ga0207700_10001855 | |||
| 1638 | Ga0207664_10089203 | |||
| 1639 | Ga0207644_10000236 | |||
| 1640 | Ga0207644_10003418 | |||
| 1641 | Ga0207644_10008705 | |||
| 1642 | Ga0207644_10014552 | |||
| 1643 | Ga0207644_10014708 | |||
| 1644 | Ga0207644_10101692 | |||
| 1645 | Ga0207644_10130324 | |||
| 1646 | Ga0207690_10072446 | |||
| 1647 | Ga0207690_10152698 | |||
| 1648 | Ga0207706_10002936 | |||
| 1649 | Ga0207706_10006657 | |||
| 1650 | Ga0207686_10035034 | |||
| 1651 | Ga0207686_10236463 | |||
| 1652 | Ga0207709_10000319 | |||
| 1653 | Ga0207709_10000868 | |||
| 1654 | Ga0207709_10002362 | |||
| 1655 | Ga0207670_10013702 | |||
| 1656 | Ga0207669_10002721 | |||
| 1657 | Ga0207669_10003694 | |||
| 1658 | Ga0207669_10024902 | |||
| 1659 | Ga0207669_10117174 | |||
| 1660 | Ga0207704_10006650 | |||
| 1661 | Ga0207691_10000084 | |||
| 1662 | Ga0207691_10002250 | |||
| 1663 | Ga0207691_10002324 | |||
| 1664 | Ga0207691_10019132 | |||
| 1665 | Ga0207691_10114013 | |||
| 1666 | Ga0207691_10232243 | |||
| 1667 | Ga0207711_10000320 | |||
| 1668 | Ga0207711_10009403 | |||
| 1669 | Ga0207711_10050769 | |||
| 1670 | Ga0207689_10000725 | |||
| 1671 | Ga0207689_10008373 | |||
| 1672 | Ga0207689_10094751 | |||
| 1673 | Ga0207689_10146300 | |||
| 1674 | Ga0207661_10121699 | |||
| 1675 | Ga0207679_10008059 | |||
| 1676 | Ga0207679_10008384 | |||
| 1677 | Ga0207679_10045774 | |||
| 1678 | Ga0207679_10133938 | |||
| 1679 | Ga0207667_10013088 | |||
| 1680 | Ga0207667_10033228 | |||
| 1681 | Ga0207667_10048599 | |||
| 1682 | Ga0207667_10268640 | |||
| 1683 | Ga0207651_10001535 | |||
| 1684 | Ga0207651_10011801 | |||
| 1685 | Ga0207712_10013041 | |||
| 1686 | Ga0207712_10163635 | |||
| 1687 | Ga0207668_10001266 | |||
| 1688 | Ga0207668_10011750 | |||
| 1689 | Ga0207668_10019585 | |||
| 1690 | Ga0207668_10042208 | |||
| 1691 | Ga0207668_10088267 | |||
| 1692 | Ga0207668_10186334 | |||
| 1693 | Ga0207640_10027346 | |||
| 1694 | Ga0207640_10032378 | |||
| 1695 | Ga0207640_10083221 | |||
| 1696 | Ga0207640_10123093 | |||
| 1697 | Ga0207658_10000181 | |||
| 1698 | Ga0207658_10028994 | |||
| 1699 | Ga0207658_10037345 | |||
| 1700 | Ga0207658_10062420 | |||
| 1701 | Ga0207658_10123511 | |||
| 1702 | Ga0207658_10266012 | |||
| 1703 | Ga0207677_10001129 | |||
| 1704 | Ga0207677_10003051 | |||
| 1705 | Ga0207677_10048120 | |||
| 1706 | Ga0207677_10069671 | |||
| 1707 | Ga0207677_10088010 | |||
| 1708 | Ga0207703_10000377 | |||
| 1709 | Ga0207703_10002749 | |||
| 1710 | Ga0207703_10013218 | |||
| 1711 | Ga0207703_10018081 | |||
| 1712 | Ga0207703_10135870 | |||
| 1713 | Ga0207703_10147716 | |||
| 1714 | Ga0207639_10003425 | |||
| 1715 | Ga0207639_10009290 | |||
| 1716 | Ga0207639_10026001 | |||
| 1717 | Ga0207639_10078064 | |||
| 1718 | Ga0207678_10024411 | |||
| 1719 | Ga0207678_10043678 | |||
| 1720 | Ga0207678_10047219 | |||
| 1721 | Ga0207708_10080307 | |||
| 1722 | Ga0207702_10005209 | |||
| 1723 | Ga0207702_10029549 | |||
| 1724 | Ga0207702_10035879 | |||
| 1725 | Ga0207702_10260513 | |||
| 1726 | Ga0207641_10001807 | |||
| 1727 | Ga0207641_10007514 | |||
| 1728 | Ga0207641_10041170 | |||
| 1729 | Ga0207641_10042857 | |||
| 1730 | Ga0207641_10108018 | |||
| 1731 | Ga0207641_10119563 | |||
| 1732 | Ga0207641_10141317 | |||
| 1733 | Ga0207648_10000799 | |||
| 1734 | Ga0207648_10002006 | |||
| 1735 | Ga0207648_10008220 | |||
| 1736 | Ga0207648_10012486 | |||
| 1737 | Ga0207648_10220242 | |||
| 1738 | Ga0207676_10012888 | |||
| 1739 | Ga0207676_10015861 | |||
| 1740 | Ga0207676_10027124 | |||
| 1741 | Ga0207676_10042038 | |||
| 1742 | Ga0207676_10080947 | |||
| 1743 | Ga0207676_10191354 | |||
| 1744 | Ga0207674_10002241 | |||
| 1745 | Ga0207674_10041068 | |||
| 1746 | Ga0207674_10128118 | |||
| 1747 | Ga0207674_10208960 | |||
| 1748 | Ga0207675_100000273 | |||
| 1749 | Ga0207675_100000770 | |||
| 1750 | Ga0207675_100003220 | |||
| 1751 | Ga0207675_100016216 | |||
| 1752 | Ga0207683_10000003 | |||
| 1753 | Ga0207683_10003562 | |||
| 1754 | Ga0207683_10016614 | |||
| 1755 | Ga0207683_10020310 | |||
| 1756 | Ga0207683_10065538 | |||
| 1757 | Ga0207683_10066195 | |||
| 1758 | Ga0207683_10135533 | |||
| 1759 | Ga0207698_10001703 | |||
| 1760 | Ga0207698_10006587 | |||
| 1761 | Ga0207698_10015574 | |||
| 1762 | Ga0207698_10034839 | |||
| 1763 | Ga0207698_10071400 | |||
| 1764 | Ga0207698_10074270 | |||
| 1765 | Ga0209282_1014520 | |||
| 1766 | Ga0209974_10000572 | |||
| 1767 | Ga0209974_10020721 | |||
| 1768 | Ga0268266_10013197 | |||
| 1769 | Ga0268266_10064760 | |||
| 1770 | Ga0268266_10372303 | |||
| 1771 | Ga0268264_10002625 | |||
| 1772 | Ga0268264_10018448 | |||
| 1773 | Ga0268264_10025144 | |||
| 1774 | Ga0268264_10029519 | |||
| 1775 | Ga0268264_10343893 | |||
| 1776 | Ga0307515_10000257 | |||
| 1777 | Ga0307515_10000737 | |||
| 1778 | Ga0307515_10000911 | |||
| 1779 | Ga0307515_10001517 | |||
| 1780 | Ga0307515_10002263 | |||
| 1781 | Ga0307515_10002980 | |||
| 1782 | Ga0307515_10080406 | |||
| 1783 | Ga0307511_10000086 | |||
| 1784 | Ga0307512_10012428 | |||
| 1785 | Ga0316180_1037273 | |||
| 1786 | Ga0316183_1058424 | |||
| 1787 | Ga0316182_1247809 | |||
| 1788 | Ga0265330_10025219 | |||
| 1789 | Ga0307513_10000037 | |||
| 1790 | Ga0307513_10014317 | |||
| 1791 | Ga0307513_10166806 | |||
| 1792 | Ga0307509_10028187 | |||
| 1793 | Ga0307408_100000117 | |||
| 1794 | Ga0307408_100005526 | |||
| 1795 | Ga0307408_100029623 | |||
| 1796 | Ga0307408_100142692 | |||
| 1797 | Ga0307508_10000101 | |||
| 1798 | Ga0307514_10000408 | |||
| 1799 | Ga0307514_10001925 | |||
| 1800 | Ga0265314_10005849 | |||
| 1801 | Ga0265314_10061543 | |||
| 1802 | Ga0307516_10004632 | |||
| 1803 | Ga0307516_10004894 | |||
| 1804 | Ga0307405_10005204 | |||
| 1805 | Ga0307405_10007347 | |||
| 1806 | Ga0307405_10031026 | |||
| 1807 | Ga0307405_10033033 | |||
| 1808 | Ga0307413_10086242 | |||
| 1809 | Ga0307406_10000717 | |||
| 1810 | Ga0307406_10001362 | |||
| 1811 | Ga0307406_10001703 | |||
| 1812 | Ga0307406_10008835 | |||
| 1813 | Ga0307412_10032584 | |||
| 1814 | Ga0307412_10061904 | |||
| 1815 | Ga0307412_10077918 | |||
| 1816 | Ga0307409_100234697 | |||
| 1817 | Ga0307416_100005940 | |||
| 1818 | Ga0307411_10141963 | |||
| 1819 | Ga0373934_0031443 | |||
| 1820 | Ga0373944_0012434 | |||
| 1821 | Ga0373952_0017932 | |||
| 1822 | Ga0373923_0024304 | |||
| 1823 | Ga0373954_0056826 | |||
| 1824 | Ga0373956_0020838 | |||
| 1825 | Ga0373956_0037296 | |||
| 1826 | Ga0373957_0009807 | |||
| 1827 | Ga0373943_0037724 | |||
| 1828 | Ga0373943_0045843 | |||
| 1829 | Ga0373924_0001355 | |||
| 1830 | Ga0373924_0005008 | |||
| 1831 | Ga0373935_0027565 | |||
| 1832 | Ga0373935_0088661 | |||
| 1833 | Ga0373927_0146437 | |||
| 1834 | Ga0373933_0026327 | |||
| 1835 | Ga0373933_0038139 | |||
| 1836 | Ga0373947_0017539 | |||
| 1837 | Ga0373947_0105003 | |||
| 1838 | Ga0373937_0003621 | |||
| 1839 | Ga0373937_0006249 | |||
| 1840 | Ga0373937_0013535 | |||
| 1841 | Ga0373937_0045827 | |||
| 1842 | Ga0373937_0282586 | |||
| 1843 | Ga0373925_0031507 | |||
| 1844 | Ga0373925_0062778 | |||
| 1845 | Ga0373925_0274969 | |||
| 1846 | Ga0395899_0000729 | |||
| 1847 | Ga0395899_0000953 | |||
| 1848 | Ga0395899_0004365 | |||
| 1849 | Ga0395899_0142355 | |||
| 1850 | Ga0395900_0003921 | |||
| 1851 | Ga0395900_0012212 | |||
| 1852 | Ga0395900_0013023 | |||
| 1853 | Ga0395900_0013168 | |||
| 1854 | Ga0395900_0023654 | |||
| 1855 | Ga0395900_0042298 | |||
| 1856 | Ga0395900_0299272 | |||
| 1857 | Ga0395898_0002404 | |||
| 1858 | Ga0395898_0021652 | |||
| 1859 | Ga0395898_0029788 | |||
| 1860 | Ga0395905_0000773 | |||
| 1861 | Ga0395905_0002341 | |||
| 1862 | Ga0395905_0006414 | |||
| 1863 | Ga0395905_0007480 | |||
| 1864 | Ga0395905_0008399 | |||
| 1865 | Ga0395905_0025327 | |||
| 1866 | Ga0395905_0034441 | |||
| 1867 | Ga0395905_0127970 | |||
| 1868 | Ga0395905_0148231 | |||
| 1869 | Ga0436364_0001604 | |||
| 1870 | Ga0436364_0810222 | |||
| 1871 | Ga0436364_1195167 | |||
| 1872 | Ga0395901_0015521 | |||
| 1873 | Ga0395901_0210306 | |||
| 1874 | Ga0395901_0221072 | |||
| 1875 | Ga0436365_0085001 | |||
| 1876 | Ga0436365_0697045 | |||
| 1877 | Ga0436361_0206236 | |||
| 1878 | Ga0436363_0279939 | |||
| 1879 | Ga0436363_1334668 | |||
| 1880 | Ga0436362_0430762 | |||
| 1881 | Ga0439436_0010842 | |||
| 1882 | Ga0439447_014462 | |||
| 1883 | Ga0439431_0013721 | |||
| 1884 | Ga0439445_0019986 | |||
| 1885 | Ga0439445_0030848 | |||
| 1886 | Ga0439432_000428 | |||
| 1887 | Ga0439449_0006422 | |||
| 1888 | Ga0439449_0011558 | |||
| 1889 | Ga0439462_0008801 | |||
| 1890 | Ga0450911_000033 | |||
| 1891 | Ga0450911_000416 | |||
| 1892 | Ga0439434_0004056 | |||
| 1893 | Ga0450918_002189 | |||
| 1894 | Ga0451577_0002494 | |||
| 1895 | Ga0466969_0007935 | |||
| 1896 | Ga0453683_0007748 | |||
| 1897 | Ga0466966_0015680 | |||
| 1898 | Ga0466964_0012946 | |||
| 1899 | Ga0453684_0006738 | |||
| 1900 | Ga0453684_0015963 | |||
| 1901 | Ga0453684_0075827 | |||
| 1902 | Ga0466968_0013088 | |||
| 1903 | Ga0466957_0041422 | |||
| 1904 | Ga0466959_0053187 | |||
| 1905 | Ga0451576_0004732 | |||
| 1906 | Ga0451576_0042754 | |||
| 1907 | Ga0451576_0079716 | |||
| 1908 | Ga0466958_0022473 | |||
| 1909 | Ga0495629_0000409 | |||
| 1910 | Ga0495629_0014553 | |||
| 1911 | Ga0495651_0001051 | |||
| 1912 | Ga0495653_0019732 | |||
| 1913 | Ga0495580_0109441 | |||
| 1914 | Ga0495580_0174216 | |||
| 1915 | Ga0495582_0103162 | |||
| 1916 | Ga0495639_0010877 | |||
| 1917 | Ga0495662_0016655 | |||
| 1918 | Ga0495662_0094866 | |||
| 1919 | Ga0495584_0121854 | |||
| 1920 | Ga0495583_0000463 | |||
| 1921 | Ga0495606_0004903 | |||
| 1922 | Ga0495610_0025647 | |||
| 1923 | Ga0495610_0044980 | |||
| 1924 | Ga0495618_0002201 | |||
| 1925 | Ga0495630_0011056 | |||
| 1926 | Ga0495630_0135154 | |||
| 1927 | Ga0495631_0000760 | |||
| 1928 | Ga0495632_0004880 | |||
| 1929 | Ga0495632_0043077 | |||
| 1930 | Ga0495637_0009149 | |||
| 1931 | Ga0495643_0000398 | |||
| 1932 | Ga0495643_0000960 | |||
| 1933 | Ga0495654_0002132 | |||
| 1934 | Ga0495665_0016123 | |||
| 1935 | Ga0495640_0017299 | |||
| 1936 | Ga0495587_0005039 | |||
| 1937 | Ga0495587_0150586 | |||
| 1938 | Ga0495667_0007034 | |||
| 1939 | Ga0495667_0154892 | |||
| 1940 | Ga0495656_0000340 | |||
| 1941 | Ga0495656_0022112 | |||
| 1942 | Ga0495625_0002232 | |||
| 1943 | Ga0495625_0005135 | |||
| 1944 | Ga0495635_0028200 | |||
| 1945 | Ga0495661_0013991 | |||
| 1946 | Ga0495588_0070443 | |||
| 1947 | Ga0495623_0036475 | |||
| 1948 | Ga0495623_0083794 | |||
| 1949 | Ga0495646_0006787 | |||
| 1950 | Ga0495647_0005749 | |||
| 1951 | Ga0495658_0060115 | |||
| 1952 | Ga0495670_0064298 | |||
| 1953 | Ga0495600_0003659 | |||
| 1954 | Ga0495604_0001090 | |||
| 1955 | Ga0495674_0003125 | |||
| 1956 | Ga0495680_0000795 | |||
| 1957 | Ga0495675_0016020 | |||
| 1958 | Ga0495684_0005001 | |||
| 1959 | Ga0495684_0039919 | |||
| 1960 | Ga0495684_0084289 | |||
| 1961 | Ga0495593_0009993 | |||
| 1962 | Ga0495593_0046206 | |||
| 1963 | Ga0495602_0010500 | |||
| 1964 | Ga0495626_0000868 | |||
| 1965 | Ga0495626_0008192 | |||
| 1966 | Ga0495626_0010129 | |||
| 1967 | Ga0495626_0058254 | |||
| 1968 | Ga0496100_0037447 | |||
| 1969 | Ga0496100_0243514 | |||
| 1970 | Ga0496101_0002523 | |||
| 1971 | Ga0496101_0007754 | |||
| 1972 | Ga0496101_0259532 | |||
| 1973 | Ga0496102_0006650 | |||
| 1974 | Ga0496103_0093559 | |||
| 1975 | Ga0496104_0003535 | |||
| 1976 | Ga0496105_0005191 | |||
| 1977 | Ga0496105_0058115 | |||
| 1978 | Ga0496106_0057080 | |||
| 1979 | Ga0496107_0013884 | |||
| 1980 | Ga0496108_0138887 | |||
| 1981 | Ga0496109_0005079 | |||
| 1982 | Ga0496109_0027699 | |||
| 1983 | Ga0496110_0025566 | |||
| 1984 | Ga0496110_0162028 | |||
| 1985 | Ga0496110_0206482 | |||
| 1986 | Ga0496112_0003897 | |||
| 1987 | Ga0496112_0004675 | |||
| 1988 | Ga0496112_0015232 | |||
| 1989 | Ga0496112_0049858 | |||
| 1990 | Ga0496113_0037995 | |||
| 1991 | Ga0496113_0089139 | |||
| 1992 | Ga0496114_0071643 | |||
| 1993 | Ga0496114_0108143 | |||
| 1994 | Ga0496115_0024747 | |||
| 1995 | Ga0496115_0059915 | |||
| 1996 | Ga0496117_0000965 | |||
| 1997 | Ga0496117_0026287 | |||
| 1998 | Ga0496118_0001301 | |||
| 1999 | Ga0496118_0023891 | |||
| 2000 | Ga0496118_0102815 | |||
| 2001 | Ga0496121_0029040 | |||
| 2002 | Ga0496121_0034728 | |||
| 2003 | Ga0496122_0000199 | |||
| 2004 | Ga0496122_0000310 | |||
| 2005 | Ga0496123_0000102 | |||
| 2006 | Ga0496123_0000312 | |||
| 2007 | Ga0496124_0007963 | |||
| 2008 | Ga0496124_0013624 | |||
| 2009 | Ga0496125_0000361 | |||
| 2010 | Ga0496125_0001359 | |||
| 2011 | Ga0496125_0002445 | |||
| 2012 | Ga0496125_0011871 | |||
| 2013 | Ga0496125_0026569 | |||
| 2014 | Ga0496125_0185624 | |||
| 2015 | Ga0496126_0076353 | |||
| 2016 | Ga0501033_0147141 | |||
| 2017 | Ga0501037_0044434 | |||
| 2018 | Ga0501037_0048122 | |||
| 2019 | Ga0501038_0050943 | |||
| 2020 | Ga0501039_0004592 | |||
| 2021 | Ga0501041_0001425 | |||
| 2022 | Ga0501043_0041705 | |||
| 2023 | Ga0501047_0055347 | |||
| 2024 | Ga0501071_0020912 | |||
| 2025 | Ga0501072_0096621 | |||
| 2026 | Ga0501076_0002101 | |||
| 2027 | Ga0501079_0000442 | |||
| 2028 | Ga0501080_0005112 | |||
| 2029 | Ga0501081_0001609 | |||
| 2030 | Ga0501083_0022417 | |||
| 2031 | Ga0501262_000023 | |||
| 2032 | Ga0501262_000311 | |||
| 2033 | Ga0501045_0016595 | |||
| 2034 | nmdc:mga03683_16298_c1 | |||
| 2035 | nmdc:mga03683_49284_c1 | |||
| 2036 | nmdc:mga00v17_16695_c1 | |||
| 2037 | nmdc:mga0k408_100441_c1 | |||
| 2038 | nmdc:mga0k408_109991_c1 | |||
| 2039 | nmdc:mga0k408_17256_c1 | |||
| 2040 | nmdc:mga0k408_29173_c1 | |||
| 2041 | nmdc:mga0k408_3909_c1 | |||
| 2042 | nmdc:mga0k408_44496_c1 | |||
| 2043 | nmdc:mga0k408_47553_c1 | |||
| 2044 | nmdc:mga06z11_157283_c1 | |||
| 2045 | nmdc:mga07m45_20766_c1 | |||
| 2046 | nmdc:mga07m45_357_c1 | |||
| 2047 | nmdc:mga07m45_4231_c1 | |||
| 2048 | nmdc:mga07m45_6994_c1 | |||
| 2049 | nmdc:mga07m45_94235_c1 | |||
| 2050 | nmdc:mga0n895_325932_c1 | |||
| 2051 | nmdc:mga0sz30_5942_c1 | |||
| 2052 | nmdc:mga0sz30_96834_c1 | |||
| 2053 | Ga0495601_0059253 | |||
| 2054 | Ga0495595_0001232 | |||
| 2055 | Ga0495619_0001190 | |||
| 2056 | Ga0495619_0011643 | |||
| 2057 | Ga0495619_0032340 | |||
| 2058 | Ga0500583_0037911 | |||
| 2059 | Ga0500651_0000165 | |||
| 2060 | Ga0500651_0124697 | |||
| 2061 | Ga0500641_0025876 | |||
| 2062 | Ga0500562_005454 | |||
| 2063 | Ga0500571_000235 | |||
| 2064 | Ga0500618_013591 | |||
| 2065 | Ga0500658_0000102 | |||
| 2066 | Ga0500658_0000693 | |||
| 2067 | Ga0500559_0007382 | |||
| 2068 | Ga0500559_0009091 | |||
| 2069 | Ga0500568_0000375 | |||
| 2070 | Ga0500568_0008065 | |||
| 2071 | Ga0500586_029290 | |||
| 2072 | Ga0500590_022668 | |||
| 2073 | Ga0500616_0029700 | |||
| 2074 | Ga0500616_0046223 | |||
| 2075 | Ga0500616_0095962 | |||
| 2076 | Ga0500622_0011106 | |||
| 2077 | Ga0500634_0038674 | |||
| 2078 | Ga0500638_055171 | |||
| 2079 | Ga0500570_037731 | |||
| 2080 | Ga0500645_000250 | |||
| 2081 | Ga0501084_0034987 | |||
| 2082 | Ga0501082_0016744 | |||
| 2083 | Ga0466962_0015127 | |||
| 2084 | Ga0466962_0105467 | |||
| 2085 | Ga0530510_0083125 | |||
| 2086 | 2511243313 | |||
| 2087 | 2513227893 | |||
| 2088 | 2548500330 | |||
| 2089 | 2587757075 | |||
| 2090 | 2599624234 | |||
| 2091 | 2599627740 | |||
| 2092 | 2599672246 | |||
| 2093 | 2599677339 | |||
| 2094 | 2599681670 | |||
| 2095 | 2599685403 | |||
| 2096 | 2599693684 | |||
| 2097 | 2599697183 | |||
| 2098 | 2643864634 | |||
| 2099 | 2643992751 | |||
| 2100 | 2644058335 | |||
| 2101 | 2644073387 | |||
| 2102 | 2644162707 | |||
| 2103 | 2644296430 | |||
| 2104 | 2644328902 | |||
| 2105 | 2644397732 | |||
| 2106 | 2644469044 | |||
| 2107 | 2644647121 | |||
| 2108 | 2738719825 | |||
| 2109 | 2738879766 | |||
| 2110 | 2738885326 | |||
| 2111 | 2739244323 | |||
| 2112 | 2739252254 | |||
| 2113 | 2739279024 | |||
| 2114 | 2808982702 | |||
| 2115 | 2809130203 | |||
| 2116 | 2809150320 | |||
| 2117 | 2816469754 | |||
| 2118 | 2819596601 | |||
| 2119 | 2819598482 | |||
| 2120 | 2821450559 | |||
| 2121 | 2831267929 | |||
| 2122 | 2838060129 | |||
| 2123 | 2838061396 | |||
| 2124 | 2842677904 | |||
| 2125 | 2842735629 | |||
| 2126 | 2842748630 | |||
| 2127 | 2852621457 | |||
| 2128 | 2885199318 | |||
| 2129 | 2885212969 | |||
| 2130 | 2895517930 | |||
| 2131 | 2899926268 | |||
| 2132 | 2899931319 | |||
| 2133 | 2904450179 | |||
| 2134 | 2904453810 | |||
| 2135 | 2904456998 | |||
| 2136 | 2904462285 | |||
| 2137 | 2904483368 | |||
| 2138 | 2904544035 | |||
| 2139 | 2904550030 | |||
| 2140 | 2904606175 | |||
| 2141 | 2919464808 | |||
| 2142 | 2928037908 | |||
| 2143 | 2928044200 | |||
| 2144 | 2928046486 | |||
| 2145 | 2928051039 | |||
| 2146 | 2928054181 | |||
| 2147 | 2928057125 | |||
| 2148 | 2928065934 | |||
| 2149 | 2928069358 | |||
| 2150 | 2928076841 | |||
| 2151 | 2928077109 | |||
| 2152 | 2928087853 | |||
| 2153 | 2928089902 | |||
| 2154 | 2928117845 | |||
| 2155 | 2928118709 | |||
| 2156 | 2929162406 | |||
| 2157 | 2929166524 | |||
| 2158 | 2929525514 | |||
| 2159 | 2945948839 | |||
| 2160 | 2945972959 | |||
| 2161 | 2945984502 | |||
| 2162 | 2954767889 | |||
| 2163 | 2954772974 | |||
| 2164 | 2990715216 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f06-assembly1.cif.gz_A | crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid | 0.963 | 23 | 385 |
| 4evs-assembly1.cif.gz_A | crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate | 0.96 | 23 | 385 |
| 4f06-assembly1.cif.gz_A | crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid | 0.9476 | 23 | 385 |
| 4evs-assembly1.cif.gz_A | crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate | 0.9448 | 23 | 385 |
| 4eyk-assembly1.cif.gz_A | crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with 3,4-dihydroxy benzoic acid | 0.9417 | 23 | 387 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4f06A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.961 | 143 | 385 | 3.40.50.2300 |
| 4evqB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9318 | 141 | 271 | 3.40.50.2300 |
| 4f06A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9272 | 143 | 385 | 3.40.50.2300 |
| 4ey3A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9168 | 141 | 387 | 3.40.50.2300 |
| 4ey3A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9115 | 141 | 387 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0K8Z4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9579 | 136 | 383 |
|
| AF-A0A537X4X2-F1-model_v4 | ABC transporter substrate-binding protein | 0.946 | 24 | 389 |
GO:0006865
|
| AF-A0A537X4X2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9361 | 24 | 389 |
GO:0006865
|
| AF-A0A5C9CTM2-F1-model_v4 | Branched-chain amino acid transport system substrate-binding protein | 0.9332 | 232 | 388 |
|
| AF-A0A536XNG0-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.9322 | 7 | 347 |
|