F489698

General Info

Members Datasets Scaffolds Average Seq Length
1082 463 2164 389

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0156729|Ga0395905_0156729_313_1587
Length 424
Sequence LRLERGRSESAPTPPRGQVRARPESNNERRSNAMHKRTLLQTAVAVALLGAGGAALAQDNVFKIGLILPMTGQQATTGRQIEAAARLWMAQNGDTVAGKKIQLIVRDDTSLPDQTRRLAQELVVNEKVNVLAGMGITPSALAVAPIATQSKTPLVVMAAATSSITEASPYVVRSSFTLPQVSVAMADWAPKNGIKNVVTLVTDYGPGLDAEKYFSERFVFNGGKVPEKLRVPLRNPDFAPFLQKVRDLKPDALFVFVPSGAGAAVMKQFGERGMDKAGIKLIGTGDVTDDDQLNDMGDVALGVVTSHHYSAYHQSAANKKFVSEFMKANKNLRPNFMAVGGYDGMRIIYEALKKTGGKGGGDALLGAMKGQIFESPRGPVFIDAQTRDIVQNVYLRKVEKKDGQLWNVEFDVIKDVKDPGKTKH

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
104 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
135 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
140 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
141 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
146 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
147 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
148 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
230 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
231 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
232 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
233 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
234 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
272 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
273 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
274 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
275 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
276 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
277 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
278 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
279 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
280 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
286 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
287 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
302 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
312 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
351 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
352 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
353 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
354 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
355 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
366 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
385 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
386 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
387 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
388 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
389 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
390 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
394 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
395 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
396 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
397 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
398 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
399 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
400 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
403 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
404 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
405 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
406 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
407 2547132374 Acidovorax radicis N35 Isolate Unclassified
408 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
409 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
410 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
411 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
412 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
413 2643221570 Acidovorax sp. Root568 Isolate Unclassified
414 2643221596 Acidovorax sp. Root70 Isolate Unclassified
415 2643221609 Acidovorax sp. Root217 Isolate Unclassified
416 2643221611 Acidovorax sp. Root219 Isolate Unclassified
417 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
418 2643221652 Acidovorax sp. Root402 Isolate Unclassified
419 2643221658 Variovorax sp. Root411 Isolate Unclassified
420 2643221672 Variovorax sp. Root434 Isolate Unclassified
421 2643221683 Variovorax sp. Root473 Isolate Unclassified
422 2643221717 Acidovorax sp. Root267 Isolate Unclassified
423 2738541277 Variovorax sp. GV051 Isolate Unclassified
424 2738541307 Variovorax sp. GV008 Isolate Unclassified
425 2738543012 Acidovorax sp. CF301 Isolate Unclassified
426 2738543013 Variovorax sp. BT01 Isolate Unclassified
427 2738543019 Variovorax sp. GV040 Isolate Unclassified
428 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
429 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
430 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
431 2816332133 Acidovorax radicis 2721A Isolate Unclassified
432 2818991446 Variovorax sp. 1180 Isolate Unclassified
433 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
434 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
435 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
436 2842677519 Variovorax sp. R-72495 Isolate Unclassified
437 2842733646 Variovorax sp. R-72446 Isolate Unclassified
438 2842747753 Variovorax sp. R-72060 Isolate Unclassified
439 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
440 2885198086 Variovorax sp. 679 Isolate Unclassified
441 2885211737 Variovorax sp. 553 Isolate Unclassified
442 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
443 2899924645 Variovorax sp. 369 Isolate Unclassified
444 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
445 2904456579 Variovorax sp. 2002 Isolate Unclassified
446 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
447 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
448 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
449 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
450 2928037797 Variovorax sp. 1126 Isolate Unclassified
451 2928044640 Variovorax sp. 1128 Isolate Unclassified
452 2928051484 Variovorax sp. 1133 Isolate Unclassified
453 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
454 2928070936 Variovorax gossypii 1167 Isolate Unclassified
455 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
456 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
457 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
458 2929520902 Variovorax beijingensis 502 Isolate Unclassified
459 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
460 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
461 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
462 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
463 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0.09
Isolates 7.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.24
Nodule 0.46
Rhizoplane 3.14
Rhizosphere 67.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0156729 3300037471 Bacteria 2141
2 SwRhRL2b_contig_1156090 2162886007 Bacteria 2597
3 JGI24740J21852_10011219 3300001979 Bacteria 3418
4 JGI24740J21852_10012167 3300001979 Bacteria 3250
5 JGI25155J39150_1000092 3300002704 Bacteria 51808
6 JGI25156J39149_1000067 3300002705 Bacteria 82796
7 JGI25154J39366_1000089 3300002738 Bacteria 82796
8 JGI25157J39369_1000084 3300002741 Bacteria 82796
9 JGI25150J39212_1000694 3300002774 Bacteria 12176
10 JGI25159J45721_1000228 3300002987 Bacteria 26393
11 JGI25159J45721_1010332 3300002987 Bacteria 2386
12 JGI25151J46595_10002022 3300003187 Bacteria 12680
13 JGI25151J46595_10006434 3300003187 Bacteria 5908
14 JGI25151J46595_10006514 3300003187 Bacteria 5855
15 JGI25151J46595_10011382 3300003187 Bacteria 4089
16 JGI25160J50197_1000076 3300003354 Bacteria 102318
17 JGI25160J50197_1007974 3300003354 Bacteria 4077
18 JGI25160J50197_1008069 3300003354 Bacteria 4046
19 JGI25161J50226_1000058 3300003374 Bacteria 102318
20 Ga0055535_1000084 3300003761 Bacteria 104652
21 Ga0055535_1001221 3300003761 Bacteria 14499
22 Ga0055542_1000033 3300003762 Bacteria 233997
23 Ga0055542_1000381 3300003762 Bacteria 45199
24 Ga0055526_1007589 3300003771 Bacteria 5599
25 Ga0055537_1000304 3300003773 Bacteria 34030
26 Ga0055537_1000389 3300003773 Bacteria 29486
27 Ga0055537_1001544 3300003773 Bacteria 8811
28 Ga0055524_1000678 3300003775 Bacteria 23860
29 Ga0055524_1001685 3300003775 Bacteria 12301
30 Ga0055524_1004503 3300003775 Bacteria 6418
31 Ga0055536_1001854 3300003781 Bacteria 12355
32 Ga0055534_1000260 3300003784 Bacteria 36676
33 Ga0055534_1000289 3300003784 Bacteria 34030
34 Ga0055534_1001915 3300003784 Bacteria 7673
35 Ga0055534_1003287 3300003784 Bacteria 5137
36 Ga0055534_1004043 3300003784 Bacteria 4393
37 Ga0055528_1000468 3300003790 Bacteria 32324
38 Ga0055528_1001139 3300003790 Bacteria 17326
39 Ga0055528_1002348 3300003790 Bacteria 10236
40 Ga0055528_1008822 3300003790 Bacteria 4273
41 Ga0055528_1012104 3300003790 Bacteria 3374
42 Ga0055528_1013553 3300003790 Bacteria 3080
43 Ga0055530_10003506 3300003791 Bacteria 8878
44 Ga0055530_10005277 3300003791 Bacteria 6210
45 Ga0055540_1000088 3300003792 Bacteria 102236
46 Ga0055540_1000890 3300003792 Bacteria 19699
47 Ga0055540_1003373 3300003792 Bacteria 7744
48 Ga0055540_1003974 3300003792 Bacteria 6889
49 Ga0055531_10001335 3300003794 Bacteria 18427
50 Ga0055531_10004099 3300003794 Bacteria 9013
51 Ga0055531_10007816 3300003794 Bacteria 5759
52 Ga0055543_1001562 3300004625 Bacteria 8867
53 Ga0065165_1010395 3300005262 Bacteria 4030
54 Ga0065704_10003035 3300005289 Bacteria 7930
55 Ga0070658_10050911 3300005327 Bacteria 3357
56 Ga0070658_10069444 3300005327 Bacteria 2882
57 Ga0070658_10077442 3300005327 Bacteria 2728
58 Ga0070676_10004686 3300005328 Bacteria 7228
59 Ga0070676_10021675 3300005328 Bacteria 3598
60 Ga0070676_10027980 3300005328 Bacteria 3201
61 Ga0070676_10033636 3300005328 Bacteria 2941
62 Ga0070676_10070078 3300005328 Bacteria 2102
63 Ga0070683_100026059 3300005329 Bacteria 5259
64 Ga0070690_100001202 3300005330 Bacteria 13364
65 Ga0070690_100002924 3300005330 Bacteria 9227
66 Ga0070690_100171412 3300005330 Bacteria 1494
67 Ga0070670_100000527 3300005331 Bacteria 30691
68 Ga0070670_100007034 3300005331 Bacteria 9534
69 Ga0070670_100075632 3300005331 Bacteria 2893
70 Ga0070670_100295398 3300005331 Bacteria 1416
71 Ga0070677_10002614 3300005333 Bacteria 5766
72 Ga0070677_10008730 3300005333 Bacteria 3419
73 Ga0070677_10019143 3300005333 Bacteria 2475
74 Ga0068869_100001043 3300005334 Bacteria 16128
75 Ga0068869_100038691 3300005334 Bacteria 3402
76 Ga0068869_100201196 3300005334 Bacteria 1571
77 Ga0070666_10005740 3300005335 Bacteria 7621
78 Ga0070666_10012986 3300005335 Bacteria 5273
79 Ga0070666_10017401 3300005335 Bacteria 4607
80 Ga0070666_10033037 3300005335 Bacteria 3421
81 Ga0068868_100006495 3300005338 Bacteria 8279
82 Ga0068868_100008142 3300005338 Bacteria 7500
83 Ga0068868_100011759 3300005338 Bacteria 6379
84 Ga0068868_100016559 3300005338 Bacteria 5479
85 Ga0068868_100022882 3300005338 Bacteria 4724
86 Ga0068868_100160542 3300005338 Bacteria 1856
87 Ga0070660_100004674 3300005339 Bacteria 9481
88 Ga0070660_100010895 3300005339 Bacteria 6436
89 Ga0070660_100060830 3300005339 Bacteria 2932
90 Ga0070689_100034325 3300005340 Bacteria 3870
91 Ga0070687_100004173 3300005343 Bacteria 5724
92 Ga0070661_100002145 3300005344 Bacteria 13596
93 Ga0070661_100006191 3300005344 Bacteria 8251
94 Ga0070661_100025859 3300005344 Bacteria 4219
95 Ga0070661_100133026 3300005344 Bacteria 1869
96 Ga0070668_100002160 3300005347 Bacteria 14394
97 Ga0070668_100035155 3300005347 Bacteria 3820
98 Ga0070668_100036588 3300005347 Bacteria 3747
99 Ga0070669_100000975 3300005353 Bacteria 20894
100 Ga0070669_100037434 3300005353 Bacteria 3519
101 Ga0070675_100001244 3300005354 Bacteria 18566
102 Ga0070675_100010772 3300005354 Bacteria 7152
103 Ga0070675_100019421 3300005354 Bacteria 5416
104 Ga0070675_100045372 3300005354 Bacteria 3596
105 Ga0070675_100072505 3300005354 Bacteria 2859
106 Ga0070675_100090277 3300005354 Bacteria 2566
107 Ga0070675_100115299 3300005354 Bacteria 2277
108 Ga0070671_100000803 3300005355 Bacteria 22698
109 Ga0070671_100002319 3300005355 Bacteria 14699
110 Ga0070671_100011447 3300005355 Bacteria 7131
111 Ga0070671_100123092 3300005355 Bacteria 2183
112 Ga0070671_100147884 3300005355 Bacteria 1983
113 Ga0070671_100259914 3300005355 Bacteria 1475
114 Ga0070671_100270747 3300005355 Bacteria 1444
115 Ga0070674_100000274 3300005356 Bacteria 25095
116 Ga0070674_100015585 3300005356 Bacteria 4749
117 Ga0070674_100051434 3300005356 Bacteria 2839
118 Ga0070674_100078640 3300005356 Bacteria 2351
119 Ga0070673_100000502 3300005364 Bacteria 20926
120 Ga0070673_100000830 3300005364 Bacteria 17287
121 Ga0070673_100001613 3300005364 Bacteria 13330
122 Ga0070688_100001343 3300005365 Bacteria 12214
123 Ga0070659_100051896 3300005366 Bacteria 3225
124 Ga0070667_100001764 3300005367 Bacteria 19262
125 Ga0070667_100010428 3300005367 Bacteria 7671
126 Ga0070667_100027156 3300005367 Bacteria 4764
127 Ga0070667_100061358 3300005367 Bacteria 3183
128 Ga0070667_100069343 3300005367 Bacteria 3000
129 Ga0070667_100088093 3300005367 Bacteria 2665
130 Ga0070667_100126214 3300005367 Bacteria 2230
131 Ga0070709_10008071 3300005434 Bacteria 5776
132 Ga0070709_10086488 3300005434 Bacteria 2058
133 Ga0070714_100005399 3300005435 Bacteria 9753
134 Ga0070713_100000260 3300005436 Bacteria 34743
135 Ga0070713_100001983 3300005436 Bacteria 13210
136 Ga0070713_100128437 3300005436 Bacteria 2232
137 Ga0070713_100281540 3300005436 Bacteria 1526
138 Ga0070711_100009608 3300005439 Bacteria 5960
139 Ga0070711_100261814 3300005439 Bacteria 1361
140 Ga0070700_100047209 3300005441 Bacteria 2664
141 Ga0070708_100002558 3300005445 Bacteria 14069
142 Ga0070663_100013800 3300005455 Bacteria 5168
143 Ga0070663_100230053 3300005455 Bacteria 1459
144 Ga0070678_100002201 3300005456 Bacteria 10602
145 Ga0070678_100003193 3300005456 Bacteria 9096
146 Ga0070678_100058594 3300005456 Bacteria 2827
147 Ga0070678_100106868 3300005456 Bacteria 2181
148 Ga0070678_100107996 3300005456 Bacteria 2171
149 Ga0070678_100138332 3300005456 Bacteria 1945
150 Ga0070678_100287374 3300005456 Bacteria 1393
151 Ga0070662_100002003 3300005457 Bacteria 12491
152 Ga0070662_100017339 3300005457 Bacteria 4855
153 Ga0070662_100018662 3300005457 Bacteria 4696
154 Ga0070681_10110400 3300005458 Bacteria 2690
155 Ga0068867_100001459 3300005459 Bacteria 16391
156 Ga0068867_100002610 3300005459 Bacteria 12706
157 Ga0068867_100047178 3300005459 Bacteria 3166
158 Ga0068867_100065386 3300005459 Bacteria 2706
159 Ga0070685_10000750 3300005466 Bacteria 17640
160 Ga0070679_100021986 3300005530 Bacteria 6231
161 Ga0070679_100046845 3300005530 Bacteria 4310
162 Ga0070684_100009859 3300005535 Bacteria 7546
163 Ga0070684_100020569 3300005535 Bacteria 5474
164 Ga0070684_100059867 3300005535 Bacteria 3330
165 Ga0070684_100159330 3300005535 Bacteria 2047
166 Ga0068853_100006479 3300005539 Bacteria 9310
167 Ga0068853_100008837 3300005539 Bacteria 8104
168 Ga0068853_100167693 3300005539 Bacteria 1985
169 Ga0068853_100342775 3300005539 Bacteria 1389
170 Ga0070672_100000202 3300005543 Bacteria 32978
171 Ga0070672_100000616 3300005543 Bacteria 20862
172 Ga0070672_100135704 3300005543 Bacteria 2026
173 Ga0070672_100139403 3300005543 Bacteria 1999
174 Ga0070672_100222122 3300005543 Bacteria 1585
175 Ga0070686_100060217 3300005544 Bacteria 2449
176 Ga0070693_100124387 3300005547 Bacteria 1603
177 Ga0070665_100000982 3300005548 Bacteria 36142
178 Ga0070665_100001071 3300005548 Bacteria 34085
179 Ga0070665_100002968 3300005548 Bacteria 18325
180 Ga0070665_100014568 3300005548 Bacteria 7889
181 Ga0070665_100243138 3300005548 Bacteria 1800
182 Ga0070704_100175022 3300005549 Bacteria 1711
183 Ga0068855_100014542 3300005563 Bacteria 9478
184 Ga0068855_100015933 3300005563 Bacteria 9042
185 Ga0068855_100037558 3300005563 Bacteria 5759
186 Ga0068855_100055098 3300005563 Bacteria 4671
187 Ga0068855_100134917 3300005563 Bacteria 2816
188 Ga0070664_100006995 3300005564 Bacteria 9097
189 Ga0070664_100043072 3300005564 Bacteria 3808
190 Ga0070664_100060159 3300005564 Bacteria 3234
191 Ga0070664_100061589 3300005564 Bacteria 3198
192 Ga0070664_100099020 3300005564 Bacteria 2533
193 Ga0068857_100002632 3300005577 Bacteria 14734
194 Ga0068857_100067392 3300005577 Bacteria 3186
195 Ga0068857_100113025 3300005577 Bacteria 2441
196 Ga0068857_100193748 3300005577 Bacteria 1851
197 Ga0068854_100015673 3300005578 Bacteria 5031
198 Ga0068854_100029294 3300005578 Bacteria 3811
199 Ga0068856_100032839 3300005614 Bacteria 5082
200 Ga0068856_100035047 3300005614 Bacteria 4917
201 Ga0068856_100041356 3300005614 Bacteria 4529
202 Ga0068856_100071382 3300005614 Bacteria 3437
203 Ga0068852_100001296 3300005616 Bacteria 16715
204 Ga0068852_100002427 3300005616 Bacteria 12829
205 Ga0068852_100002469 3300005616 Bacteria 12727
206 Ga0068852_100003642 3300005616 Bacteria 10791
207 Ga0068852_100202190 3300005616 Bacteria 1880
208 Ga0068859_100000299 3300005617 Bacteria 49331
209 Ga0068864_100000973 3300005618 Bacteria 24018
210 Ga0068864_100001865 3300005618 Bacteria 17299
211 Ga0068864_100014639 3300005618 Bacteria 6516
212 Ga0068864_100017389 3300005618 Bacteria 5996
213 Ga0068864_100036399 3300005618 Bacteria 4195
214 Ga0068864_100044498 3300005618 Bacteria 3806
215 Ga0068866_10007175 3300005718 Bacteria 4661
216 Ga0068861_100000405 3300005719 Bacteria 24937
217 Ga0068861_100003338 3300005719 Bacteria 10628
218 Ga0068861_100047283 3300005719 Bacteria 3247
219 Ga0068861_100078425 3300005719 Bacteria 2579
220 Ga0068851_10005924 3300005834 Bacteria 5563
221 Ga0068851_10005937 3300005834 Bacteria 5557
222 Ga0068851_10023969 3300005834 Bacteria 2985
223 Ga0068851_10038082 3300005834 Bacteria 2412
224 Ga0068851_10072028 3300005834 Bacteria 1789
225 Ga0068870_10027062 3300005840 Bacteria 2865
226 Ga0068863_100008043 3300005841 Bacteria 10298
227 Ga0068863_100036282 3300005841 Bacteria 4697
228 Ga0068863_100057950 3300005841 Bacteria 3666
229 Ga0068863_100089185 3300005841 Bacteria 2924
230 Ga0068863_100106122 3300005841 Bacteria 2672
231 Ga0068863_100169078 3300005841 Bacteria 2096
232 Ga0068863_100186824 3300005841 Bacteria 1991
233 Ga0068858_100002362 3300005842 Bacteria 19076
234 Ga0068858_100051954 3300005842 Bacteria 3792
235 Ga0068860_100000216 3300005843 Bacteria 90423
236 Ga0068860_100001383 3300005843 Bacteria 26323
237 Ga0068860_100038831 3300005843 Bacteria 4555
238 Ga0068860_100056478 3300005843 Bacteria 3732
239 Ga0068860_100058929 3300005843 Bacteria 3651
240 Ga0068860_100226510 3300005843 Bacteria 1816
241 Ga0068862_100015000 3300005844 Bacteria 6435
242 Ga0070717_10051736 3300006028 Bacteria 3382
243 Ga0075365_10022743 3300006038 Bacteria 3932
244 Ga0075365_10081033 3300006038 Bacteria 2198
245 Ga0075365_10088354 3300006038 Bacteria 2108
246 Ga0075368_10021210 3300006042 Bacteria 2466
247 Ga0075363_100021432 3300006048 Bacteria 3255
248 Ga0075363_100065389 3300006048 Bacteria 1966
249 Ga0075363_100101348 3300006048 Bacteria 1594
250 Ga0075364_10025483 3300006051 Bacteria 3764
251 Ga0075364_10091324 3300006051 Bacteria 2020
252 Ga0075364_10131519 3300006051 Bacteria 1679
253 Ga0070715_10041445 3300006163 Bacteria 1930
254 Ga0070716_100009928 3300006173 Bacteria 4761
255 Ga0070712_100002075 3300006175 Bacteria 12294
256 Ga0075362_10008038 3300006177 Bacteria 4019
257 Ga0075362_10053803 3300006177 Bacteria 1808
258 Ga0075362_10071687 3300006177 Bacteria 1583
259 Ga0075367_10022602 3300006178 Bacteria 3529
260 Ga0075369_10024533 3300006186 Bacteria 2500
261 Ga0075369_10106548 3300006186 Bacteria 1261
262 Ga0075366_10008556 3300006195 Bacteria 5693
263 Ga0075366_10012284 3300006195 Bacteria 4855
264 Ga0075366_10043910 3300006195 Bacteria 2648
265 Ga0075366_10069834 3300006195 Bacteria 2091
266 Ga0075366_10138889 3300006195 Bacteria 1468
267 Ga0097621_100025467 3300006237 Bacteria 4630
268 Ga0097621_100032630 3300006237 Bacteria 4141
269 Ga0097621_100034930 3300006237 Bacteria 4013
270 Ga0097621_100055054 3300006237 Bacteria 3247
271 Ga0075370_10004900 3300006353 Bacteria 6572
272 Ga0075370_10024685 3300006353 Bacteria 3322
273 Ga0075370_10033431 3300006353 Bacteria 2880
274 Ga0068871_100020380 3300006358 Bacteria 5078
275 Ga0068871_100039339 3300006358 Bacteria 3783
276 Ga0068871_100067809 3300006358 Bacteria 2928
277 Ga0075434_100163224 3300006871 Bacteria 2248
278 Ga0068865_100014828 3300006881 Bacteria 4959
279 Ga0068865_100022953 3300006881 Bacteria 4078
280 Ga0068865_100032381 3300006881 Bacteria 3491
281 Ga0097620_100000299 3300006931 Bacteria 49331
282 Ga0079104_1021813 3300006946 Bacteria 1737
283 Ga0099826_10000044 3300006948 Bacteria 88060
284 Ga0105244_10001156 3300009036 Bacteria 21857
285 Ga0105244_10021526 3300009036 Bacteria 3565
286 Ga0105240_10014739 3300009093 Bacteria 10662
287 Ga0105240_10047143 3300009093 Bacteria 5455
288 Ga0105240_10060157 3300009093 Bacteria 4736
289 Ga0105240_10410890 3300009093 Bacteria 1522
290 Ga0105245_10009237 3300009098 Bacteria 8596
291 Ga0105245_10015868 3300009098 Bacteria 6563
292 Ga0105245_10107469 3300009098 Bacteria 2590
293 Ga0105245_10339106 3300009098 Bacteria 1486
294 Ga0105245_10400144 3300009098 Bacteria 1372
295 Ga0105247_10005757 3300009101 Bacteria 7760
296 Ga0105243_10002240 3300009148 Bacteria 16253
297 Ga0105243_10002379 3300009148 Bacteria 15749
298 Ga0105243_10003283 3300009148 Bacteria 13145
299 Ga0105243_10062928 3300009148 Bacteria 2972
300 Ga0105241_10007933 3300009174 Bacteria 7806
301 Ga0105241_10025815 3300009174 Bacteria 4367
302 Ga0105241_10175159 3300009174 Bacteria 1775
303 Ga0105242_10121367 3300009176 Bacteria 2243
304 Ga0105248_10028897 3300009177 Bacteria 6181
305 Ga0105248_10090531 3300009177 Bacteria 3445
306 Ga0105248_10180854 3300009177 Bacteria 2376
307 Ga0105237_10000933 3300009545 Bacteria 39346
308 Ga0105237_10037996 3300009545 Bacteria 4864
309 Ga0105237_10096912 3300009545 Bacteria 2940
310 Ga0105238_10008227 3300009551 Bacteria 10433
311 Ga0105238_10030064 3300009551 Bacteria 5528
312 Ga0105238_10082419 3300009551 Bacteria 3206
313 Ga0105238_10111427 3300009551 Bacteria 2717
314 Ga0105249_10064275 3300009553 Bacteria 3373
315 Ga0105249_10152469 3300009553 Bacteria 2226
316 Ga0105239_10007368 3300010375 Bacteria 12638
317 Ga0105239_10320371 3300010375 Bacteria 1748
318 Ga0105246_10068407 3300011119 Bacteria 2491
319 Ga0105246_10176241 3300011119 Bacteria 1642
320 Ga0157373_10001556 3300013100 Bacteria 17499
321 Ga0157373_10013744 3300013100 Bacteria 5935
322 Ga0157371_10015422 3300013102 Bacteria 5733
323 Ga0157371_10043853 3300013102 Bacteria 3185
324 Ga0157371_10051612 3300013102 Bacteria 2922
325 Ga0157371_10087976 3300013102 Bacteria 2199
326 Ga0157370_10057280 3300013104 Bacteria 3706
327 Ga0157370_10217311 3300013104 Bacteria 1771
328 Ga0157369_10000456 3300013105 Bacteria 54115
329 Ga0157369_10039411 3300013105 Bacteria 5163
330 Ga0157369_10040205 3300013105 Bacteria 5106
331 Ga0157369_10172220 3300013105 Bacteria 2280
332 Ga0157374_10008825 3300013296 Bacteria 8629
333 Ga0157374_10168342 3300013296 Bacteria 2137
334 Ga0157378_10002940 3300013297 Bacteria 15150
335 Ga0157378_10010946 3300013297 Bacteria 7934
336 Ga0163162_10009038 3300013306 Bacteria 9685
337 Ga0163162_10010013 3300013306 Bacteria 9217
338 Ga0163162_10014511 3300013306 Bacteria 7699
339 Ga0163162_10050004 3300013306 Bacteria 4191
340 Ga0163162_10312657 3300013306 Bacteria 1703
341 Ga0163162_10361502 3300013306 Bacteria 1585
342 Ga0157372_10031835 3300013307 Bacteria 5779
343 Ga0157372_10104164 3300013307 Bacteria 3243
344 Ga0157372_10326825 3300013307 Bacteria 1786
345 Ga0157375_10001479 3300013308 Bacteria 20180
346 Ga0157375_10002234 3300013308 Bacteria 16754
347 Ga0157375_10004157 3300013308 Bacteria 12560
348 Ga0157375_10069870 3300013308 Bacteria 3519
349 Ga0163163_10010522 3300014325 Bacteria 8323
350 Ga0163163_10017385 3300014325 Bacteria 6706
351 Ga0157380_10005798 3300014326 Bacteria 8645
352 Ga0157380_10041751 3300014326 Bacteria 3582
353 Ga0182008_10003337 3300014497 Bacteria 9751
354 Ga0182008_10006370 3300014497 Bacteria 6609
355 Ga0182008_10014906 3300014497 Bacteria 4066
356 Ga0182008_10060982 3300014497 Bacteria 1859
357 Ga0157377_10000246 3300014745 Bacteria 26794
358 Ga0157377_10036460 3300014745 Bacteria 2705
359 Ga0157379_10000911 3300014968 Bacteria 23851
360 Ga0157379_10004260 3300014968 Bacteria 12214
361 Ga0157379_10004346 3300014968 Bacteria 12120
362 Ga0157379_10015058 3300014968 Bacteria 6784
363 Ga0157379_10024195 3300014968 Bacteria 5390
364 Ga0157379_10126688 3300014968 Bacteria 2298
365 Ga0157376_10010329 3300014969 Bacteria 6822
366 Ga0157376_10031559 3300014969 Bacteria 4245
367 Ga0157376_10054119 3300014969 Bacteria 3344
368 Ga0182006_1001535 3300015261 Bacteria 13801
369 Ga0182006_1003085 3300015261 Bacteria 8734
370 Ga0182006_1031627 3300015261 Bacteria 2130
371 Ga0182007_10002970 3300015262 Bacteria 8217
372 Ga0183362_10006 3300015683 Bacteria 287231
373 Ga0163161_10000308 3300017792 Bacteria 42596
374 Ga0163161_10057833 3300017792 Bacteria 2818
375 Ga0163161_10161183 3300017792 Bacteria 1710
376 Ga0206350_11076645 3300020080 Bacteria 1322
377 Ga0213876_10016615 3300021384 Bacteria 3888
378 Ga0213876_10038786 3300021384 Bacteria 2515
379 Ga0213875_10001420 3300021388 Bacteria 15553
380 Ga0209435_100008 3300025206 Bacteria 503644
381 Ga0209436_104850 3300025208 Bacteria 3225
382 Ga0209672_100529 3300025228 Bacteria 20856
383 Ga0209672_102290 3300025228 Bacteria 4895
384 Ga0209147_100715 3300025229 Bacteria 16813
385 Ga0209147_101310 3300025229 Bacteria 9576
386 Ga0209258_100089 3300025242 Bacteria 234040
387 Ga0209258_100454 3300025242 Bacteria 45089
388 Ga0207425_1000355 3300025245 Bacteria 31804
389 Ga0207425_1000483 3300025245 Bacteria 25107
390 Ga0207425_1001782 3300025245 Bacteria 8362
391 Ga0207425_1002298 3300025245 Bacteria 6860
392 Ga0207425_1008002 3300025245 Bacteria 2741
393 Ga0209646_1000029 3300025246 Bacteria 386414
394 Ga0209026_1000016 3300025250 Bacteria 386457
395 Ga0209148_1000097 3300025254 Bacteria 234049
396 Ga0209148_1000449 3300025254 Bacteria 45110
397 Ga0209759_1000016 3300025256 Bacteria 386414
398 Ga0209129_1000033 3300025258 Bacteria 336894
399 Ga0209129_1005867 3300025258 Bacteria 4173
400 Ga0209565_1000019 3300025263 Bacteria 438920
401 Ga0209565_1000047 3300025263 Bacteria 225745
402 Ga0209565_1000120 3300025263 Bacteria 111458
403 Ga0209565_1000586 3300025263 Bacteria 24589
404 Ga0209565_1008452 3300025263 Bacteria 2690
405 Ga0209673_1000079 3300025273 Bacteria 225746
406 Ga0209673_1000099 3300025273 Bacteria 193248
407 Ga0209673_1000185 3300025273 Bacteria 125742
408 Ga0209673_1000492 3300025273 Bacteria 65573
409 Ga0209673_1001345 3300025273 Bacteria 24589
410 Ga0209673_1002128 3300025273 Bacteria 14787
411 Ga0209673_1002340 3300025273 Bacteria 13407
412 Ga0209673_1010691 3300025273 Bacteria 3847
413 Ga0209130_1000011 3300025284 Bacteria 431723
414 Ga0209130_1000014 3300025284 Bacteria 412039
415 Ga0209130_1000272 3300025284 Bacteria 64696
416 Ga0209130_1000736 3300025284 Bacteria 28751
417 Ga0209130_1001586 3300025284 Bacteria 14275
418 Ga0209130_1001885 3300025284 Bacteria 11906
419 Ga0209130_1010381 3300025284 Bacteria 2568
420 Ga0209675_1000046 3300025291 Bacteria 225746
421 Ga0209675_1000054 3300025291 Bacteria 193248
422 Ga0209675_1000073 3300025291 Bacteria 163009
423 Ga0209675_1000296 3300025291 Bacteria 46253
424 Ga0209675_1000539 3300025291 Bacteria 27695
425 Ga0209675_1000622 3300025291 Bacteria 25332
426 Ga0209675_1001599 3300025291 Bacteria 12794
427 Ga0209675_1006949 3300025291 Bacteria 4439
428 Ga0209675_1019145 3300025291 Bacteria 1892
429 Ga0209676_1000013 3300025292 Bacteria 816080
430 Ga0209676_1000153 3300025292 Bacteria 166393
431 Ga0209676_1000179 3300025292 Bacteria 150096
432 Ga0209676_1000896 3300025292 Bacteria 37733
433 Ga0209676_1001185 3300025292 Bacteria 28045
434 Ga0209676_1010360 3300025292 Bacteria 3898
435 Ga0209676_1011930 3300025292 Bacteria 3459
436 Ga0209676_1019621 3300025292 Bacteria 2321
437 Ga0209025_1000714 3300025294 Bacteria 56537
438 Ga0209025_1000743 3300025294 Bacteria 54915
439 Ga0209025_1000973 3300025294 Bacteria 42929
440 Ga0209025_1001001 3300025294 Bacteria 41900
441 Ga0209025_1005221 3300025294 Bacteria 10713
442 Ga0209025_1005695 3300025294 Bacteria 10034
443 Ga0209025_1005712 3300025294 Bacteria 10001
444 Ga0209025_1008443 3300025294 Bacteria 7411
445 Ga0209025_1017032 3300025294 Bacteria 4230
446 Ga0209025_1019327 3300025294 Bacteria 3792
447 Ga0209025_1037003 3300025294 Bacteria 2173
448 Ga0209564_1000040 3300025295 Bacteria 411388
449 Ga0209564_1000151 3300025295 Bacteria 168783
450 Ga0209564_1000246 3300025295 Bacteria 117096
451 Ga0209564_1000725 3300025295 Bacteria 47333
452 Ga0209758_1000027 3300025297 Bacteria 549650
453 Ga0209758_1000037 3300025297 Bacteria 439101
454 Ga0209758_1004818 3300025297 Bacteria 10892
455 Ga0209758_1011129 3300025297 Bacteria 5256
456 Ga0209758_1014773 3300025297 Bacteria 4118
457 Ga0209758_1040496 3300025297 Bacteria 1756
458 Ga0209050_1000008 3300025298 Bacteria 1144179
459 Ga0209050_1000172 3300025298 Bacteria 150096
460 Ga0209050_1002148 3300025298 Bacteria 17949
461 Ga0209050_1003172 3300025298 Bacteria 12496
462 Ga0209050_1005822 3300025298 Bacteria 7560
463 Ga0209050_1024418 3300025298 Bacteria 2092
464 Ga0209050_1028869 3300025298 Bacteria 1789
465 Ga0209256_1000023 3300025299 Bacteria 461150
466 Ga0209256_1000039 3300025299 Bacteria 372337
467 Ga0209256_1000069 3300025299 Bacteria 245640
468 Ga0209256_1000161 3300025299 Bacteria 138270
469 Ga0209256_1006705 3300025299 Bacteria 5974
470 Ga0207426_1000027 3300025302 Bacteria 513176
471 Ga0207426_1000029 3300025302 Bacteria 473835
472 Ga0207426_1000115 3300025302 Bacteria 227423
473 Ga0207426_1000174 3300025302 Bacteria 160877
474 Ga0207426_1000411 3300025302 Bacteria 71437
475 Ga0209051_1000005 3300025303 Bacteria 1142353
476 Ga0209051_1000046 3300025303 Bacteria 296424
477 Ga0209051_1000055 3300025303 Bacteria 277194
478 Ga0209051_1000128 3300025303 Bacteria 142159
479 Ga0209051_1000483 3300025303 Bacteria 51423
480 Ga0209051_1000762 3300025303 Bacteria 34275
481 Ga0209051_1000841 3300025303 Bacteria 31619
482 Ga0209051_1002685 3300025303 Bacteria 12424
483 Ga0209051_1002686 3300025303 Bacteria 12422
484 Ga0209051_1009810 3300025303 Bacteria 4902
485 Ga0209257_1000031 3300025304 Bacteria 688770
486 Ga0209257_1000101 3300025304 Bacteria 251553
487 Ga0209257_1000281 3300025304 Bacteria 114413
488 Ga0209257_1000377 3300025304 Bacteria 89033
489 Ga0209257_1001061 3300025304 Bacteria 36348
490 Ga0209257_1017705 3300025304 Bacteria 2790
491 Ga0207697_10008475 3300025315 Bacteria 4494
492 Ga0207697_10015952 3300025315 Bacteria 3098
493 Ga0207656_10009598 3300025321 Bacteria 3596
494 Ga0207656_10017111 3300025321 Bacteria 2835
495 Ga0207655_1005421 3300025728 Bacteria 8674
496 Ga0207682_10000930 3300025893 Bacteria 13586
497 Ga0207682_10001271 3300025893 Bacteria 11579
498 Ga0207682_10012418 3300025893 Bacteria 3325
499 Ga0207682_10035668 3300025893 Bacteria 2010
500 Ga0207692_10050644 3300025898 Bacteria 2102
501 Ga0207642_10071197 3300025899 Bacteria 1655
502 Ga0207710_10012742 3300025900 Bacteria 3540
503 Ga0207688_10129459 3300025901 Bacteria 1478
504 Ga0207680_10003123 3300025903 Bacteria 7780
505 Ga0207680_10003924 3300025903 Bacteria 7018
506 Ga0207680_10035243 3300025903 Bacteria 2871
507 Ga0207699_10007585 3300025906 Bacteria 5311
508 Ga0207645_10000242 3300025907 Bacteria 45222
509 Ga0207645_10000481 3300025907 Bacteria 33007
510 Ga0207645_10023328 3300025907 Bacteria 4022
511 Ga0207645_10151049 3300025907 Bacteria 1516
512 Ga0207643_10014273 3300025908 Bacteria 4314
513 Ga0207643_10037378 3300025908 Bacteria 2725
514 Ga0207654_10015755 3300025911 Bacteria 3928
515 Ga0207654_10090825 3300025911 Bacteria 1861
516 Ga0207707_10082168 3300025912 Bacteria 2813
517 Ga0207695_10040965 3300025913 Bacteria 4961
518 Ga0207695_10061561 3300025913 Bacteria 3878
519 Ga0207695_10062000 3300025913 Bacteria 3863
520 Ga0207695_10215361 3300025913 Bacteria 1830
521 Ga0207671_10008055 3300025914 Bacteria 9007
522 Ga0207693_10000405 3300025915 Bacteria 39292
523 Ga0207663_10003087 3300025916 Bacteria 8076
524 Ga0207663_10225900 3300025916 Bacteria 1365
525 Ga0207662_10004572 3300025918 Bacteria 7294
526 Ga0207662_10019814 3300025918 Bacteria 3834
527 Ga0207657_10021044 3300025919 Bacteria 6149
528 Ga0207657_10030031 3300025919 Bacteria 4938
529 Ga0207657_10069103 3300025919 Bacteria 2999
530 Ga0207657_10102655 3300025919 Bacteria 2371
531 Ga0207657_10241732 3300025919 Bacteria 1441
532 Ga0207652_10087621 3300025921 Bacteria 2730
533 Ga0207681_10000162 3300025923 Bacteria 55291
534 Ga0207681_10013644 3300025923 Bacteria 5031
535 Ga0207681_10019030 3300025923 Bacteria 4334
536 Ga0207681_10066479 3300025923 Bacteria 2496
537 Ga0207694_10029379 3300025924 Bacteria 4194
538 Ga0207694_10079787 3300025924 Bacteria 2567
539 Ga0207694_10125408 3300025924 Bacteria 2054
540 Ga0207650_10001039 3300025925 Bacteria 20830
541 Ga0207650_10004268 3300025925 Bacteria 9753
542 Ga0207650_10012479 3300025925 Bacteria 5865
543 Ga0207650_10040447 3300025925 Bacteria 3412
544 Ga0207650_10047698 3300025925 Bacteria 3157
545 Ga0207650_10067893 3300025925 Bacteria 2676
546 Ga0207650_10154738 3300025925 Bacteria 1812
547 Ga0207650_10327360 3300025925 Bacteria 1256
548 Ga0207659_10004029 3300025926 Bacteria 8865
549 Ga0207659_10018283 3300025926 Bacteria 4593
550 Ga0207659_10062930 3300025926 Bacteria 2680
551 Ga0207659_10074965 3300025926 Bacteria 2481
552 Ga0207659_10312004 3300025926 Bacteria 1295
553 Ga0207687_10005515 3300025927 Bacteria 8371
554 Ga0207687_10036680 3300025927 Bacteria 3340
555 Ga0207700_10001855 3300025928 Bacteria 11973
556 Ga0207664_10089203 3300025929 Bacteria 2524
557 Ga0207644_10000236 3300025931 Bacteria 37953
558 Ga0207644_10003418 3300025931 Bacteria 10251
559 Ga0207644_10008705 3300025931 Bacteria 6643
560 Ga0207644_10014552 3300025931 Bacteria 5265
561 Ga0207644_10014708 3300025931 Bacteria 5244
562 Ga0207644_10101692 3300025931 Bacteria 2160
563 Ga0207644_10130324 3300025931 Bacteria 1924
564 Ga0207690_10072446 3300025932 Bacteria 2379
565 Ga0207690_10152698 3300025932 Bacteria 1713
566 Ga0207706_10002936 3300025933 Bacteria 16479
567 Ga0207706_10006657 3300025933 Bacteria 10682
568 Ga0207686_10035034 3300025934 Bacteria 3010
569 Ga0207686_10236463 3300025934 Bacteria 1327
570 Ga0207709_10000319 3300025935 Bacteria 52470
571 Ga0207709_10000868 3300025935 Bacteria 23068
572 Ga0207709_10002362 3300025935 Bacteria 11916
573 Ga0207670_10013702 3300025936 Bacteria 4790
574 Ga0207669_10002721 3300025937 Bacteria 7570
575 Ga0207669_10003694 3300025937 Bacteria 6654
576 Ga0207669_10024902 3300025937 Bacteria 3224
577 Ga0207669_10117174 3300025937 Bacteria 1799
578 Ga0207704_10006650 3300025938 Bacteria 5411
579 Ga0207691_10000084 3300025940 Bacteria 80075
580 Ga0207691_10002250 3300025940 Bacteria 18932
581 Ga0207691_10002324 3300025940 Bacteria 18618
582 Ga0207691_10019132 3300025940 Bacteria 6482
583 Ga0207691_10114013 3300025940 Bacteria 2402
584 Ga0207691_10232243 3300025940 Bacteria 1597
585 Ga0207711_10000320 3300025941 Bacteria 51464
586 Ga0207711_10009403 3300025941 Bacteria 8163
587 Ga0207711_10050769 3300025941 Bacteria 3551
588 Ga0207689_10000725 3300025942 Bacteria 31641
589 Ga0207689_10008373 3300025942 Bacteria 9006
590 Ga0207689_10094751 3300025942 Bacteria 2452
591 Ga0207689_10146300 3300025942 Bacteria 1947
592 Ga0207661_10121699 3300025944 Bacteria 2222
593 Ga0207679_10008059 3300025945 Bacteria 6698
594 Ga0207679_10008384 3300025945 Bacteria 6581
595 Ga0207679_10045774 3300025945 Bacteria 3167
596 Ga0207679_10133938 3300025945 Bacteria 1992
597 Ga0207667_10013088 3300025949 Bacteria 9522
598 Ga0207667_10033228 3300025949 Bacteria 5550
599 Ga0207667_10048599 3300025949 Bacteria 4485
600 Ga0207667_10268640 3300025949 Bacteria 1744
601 Ga0207651_10001535 3300025960 Bacteria 10540
602 Ga0207651_10011801 3300025960 Bacteria 4906
603 Ga0207712_10013041 3300025961 Bacteria 5324
604 Ga0207712_10163635 3300025961 Bacteria 1732
605 Ga0207668_10001266 3300025972 Bacteria 15063
606 Ga0207668_10011750 3300025972 Bacteria 5335
607 Ga0207668_10019585 3300025972 Bacteria 4280
608 Ga0207668_10042208 3300025972 Bacteria 3088
609 Ga0207668_10088267 3300025972 Bacteria 2270
610 Ga0207668_10186334 3300025972 Bacteria 1641
611 Ga0207640_10027346 3300025981 Bacteria 3474
612 Ga0207640_10032378 3300025981 Bacteria 3241
613 Ga0207640_10083221 3300025981 Bacteria 2193
614 Ga0207640_10123093 3300025981 Bacteria 1862
615 Ga0207658_10000181 3300025986 Bacteria 67700
616 Ga0207658_10028994 3300025986 Bacteria 3903
617 Ga0207658_10037345 3300025986 Bacteria 3489
618 Ga0207658_10062420 3300025986 Bacteria 2788
619 Ga0207658_10123511 3300025986 Bacteria 2068
620 Ga0207658_10266012 3300025986 Bacteria 1463
621 Ga0207677_10001129 3300026023 Bacteria 14557
622 Ga0207677_10003051 3300026023 Bacteria 8854
623 Ga0207677_10048120 3300026023 Bacteria 2869
624 Ga0207677_10069671 3300026023 Bacteria 2474
625 Ga0207677_10088010 3300026023 Bacteria 2250
626 Ga0207703_10000377 3300026035 Bacteria 47621
627 Ga0207703_10002749 3300026035 Bacteria 15066
628 Ga0207703_10013218 3300026035 Bacteria 6430
629 Ga0207703_10018081 3300026035 Bacteria 5505
630 Ga0207703_10135870 3300026035 Bacteria 2129
631 Ga0207703_10147716 3300026035 Bacteria 2046
632 Ga0207639_10003425 3300026041 Bacteria 10668
633 Ga0207639_10009290 3300026041 Bacteria 6780
634 Ga0207639_10026001 3300026041 Bacteria 4250
635 Ga0207639_10078064 3300026041 Bacteria 2612
636 Ga0207678_10024411 3300026067 Bacteria 5279
637 Ga0207678_10043678 3300026067 Bacteria 3878
638 Ga0207678_10047219 3300026067 Bacteria 3724
639 Ga0207708_10080307 3300026075 Bacteria 2506
640 Ga0207702_10005209 3300026078 Bacteria 11415
641 Ga0207702_10029549 3300026078 Bacteria 4561
642 Ga0207702_10035879 3300026078 Bacteria 4146
643 Ga0207702_10260513 3300026078 Bacteria 1633
644 Ga0207641_10001807 3300026088 Bacteria 20576
645 Ga0207641_10007514 3300026088 Bacteria 9070
646 Ga0207641_10041170 3300026088 Bacteria 3871
647 Ga0207641_10042857 3300026088 Bacteria 3798
648 Ga0207641_10108018 3300026088 Bacteria 2462
649 Ga0207641_10119563 3300026088 Bacteria 2349
650 Ga0207641_10141317 3300026088 Bacteria 2172
651 Ga0207648_10000799 3300026089 Bacteria 35474
652 Ga0207648_10002006 3300026089 Bacteria 22204
653 Ga0207648_10008220 3300026089 Bacteria 10130
654 Ga0207648_10012486 3300026089 Bacteria 7953
655 Ga0207648_10220242 3300026089 Bacteria 1686
656 Ga0207676_10012888 3300026095 Bacteria 6003
657 Ga0207676_10015861 3300026095 Bacteria 5447
658 Ga0207676_10027124 3300026095 Bacteria 4263
659 Ga0207676_10042038 3300026095 Bacteria 3513
660 Ga0207676_10080947 3300026095 Bacteria 2637
661 Ga0207676_10191354 3300026095 Bacteria 1800
662 Ga0207674_10002241 3300026116 Bacteria 24492
663 Ga0207674_10041068 3300026116 Bacteria 4786
664 Ga0207674_10128118 3300026116 Bacteria 2502
665 Ga0207674_10208960 3300026116 Bacteria 1901
666 Ga0207675_100000273 3300026118 Bacteria 49026
667 Ga0207675_100000770 3300026118 Bacteria 31956
668 Ga0207675_100003220 3300026118 Bacteria 16019
669 Ga0207675_100016216 3300026118 Bacteria 6955
670 Ga0207683_10000003 3300026121 Bacteria 191866
671 Ga0207683_10003562 3300026121 Bacteria 13579
672 Ga0207683_10016614 3300026121 Bacteria 6264
673 Ga0207683_10020310 3300026121 Bacteria 5680
674 Ga0207683_10065538 3300026121 Bacteria 3203
675 Ga0207683_10066195 3300026121 Bacteria 3186
676 Ga0207683_10135533 3300026121 Bacteria 2216
677 Ga0207698_10001703 3300026142 Bacteria 12820
678 Ga0207698_10006587 3300026142 Bacteria 7261
679 Ga0207698_10015574 3300026142 Bacteria 5096
680 Ga0207698_10034839 3300026142 Bacteria 3675
681 Ga0207698_10071400 3300026142 Bacteria 2755
682 Ga0207698_10074270 3300026142 Bacteria 2712
683 Ga0209282_1014520 3300027666 Bacteria 5014
684 Ga0209974_10000572 3300027876 Bacteria 12285
685 Ga0209974_10020721 3300027876 Bacteria 2179
686 Ga0268266_10013197 3300028379 Bacteria 7124
687 Ga0268266_10064760 3300028379 Bacteria 3158
688 Ga0268266_10372303 3300028379 Bacteria 1345
689 Ga0268264_10002625 3300028381 Bacteria 15693
690 Ga0268264_10018448 3300028381 Bacteria 5706
691 Ga0268264_10025144 3300028381 Bacteria 4864
692 Ga0268264_10029519 3300028381 Bacteria 4492
693 Ga0268264_10343893 3300028381 Bacteria 1418
694 Ga0307515_10000257 3300028794 Bacteria 131732
695 Ga0307515_10000737 3300028794 Bacteria 75687
696 Ga0307515_10000911 3300028794 Bacteria 68106
697 Ga0307515_10001517 3300028794 Bacteria 51954
698 Ga0307515_10002263 3300028794 Bacteria 42131
699 Ga0307515_10002980 3300028794 Bacteria 35948
700 Ga0307515_10080406 3300028794 Bacteria 4252
701 Ga0307511_10000086 3300030521 Bacteria 77931
702 Ga0307512_10012428 3300030522 Bacteria 8035
703 Ga0316180_1037273 3300030736 Bacteria 1470
704 Ga0316183_1058424 3300030742 Bacteria 5149
705 Ga0316182_1247809 3300030745 Bacteria 2626
706 Ga0265330_10025219 3300031235 Bacteria 2696
707 Ga0307513_10000037 3300031456 Bacteria 175364
708 Ga0307513_10014317 3300031456 Bacteria 9691
709 Ga0307513_10166806 3300031456 Bacteria 2085
710 Ga0307509_10028187 3300031507 Bacteria 6246
711 Ga0307408_100000117 3300031548 Bacteria 87442
712 Ga0307408_100005526 3300031548 Bacteria 8445
713 Ga0307408_100029623 3300031548 Bacteria 3794
714 Ga0307408_100142692 3300031548 Bacteria 1881
715 Ga0307508_10000101 3300031616 Bacteria 100858
716 Ga0307514_10000408 3300031649 Bacteria 95961
717 Ga0307514_10001925 3300031649 Bacteria 22740
718 Ga0265314_10005849 3300031711 Bacteria 11012
719 Ga0265314_10061543 3300031711 Bacteria 2555
720 Ga0307516_10004632 3300031730 Bacteria 16868
721 Ga0307516_10004894 3300031730 Bacteria 16300
722 Ga0307405_10005204 3300031731 Bacteria 6246
723 Ga0307405_10007347 3300031731 Bacteria 5500
724 Ga0307405_10031026 3300031731 Bacteria 3141
725 Ga0307405_10033033 3300031731 Bacteria 3065
726 Ga0307413_10086242 3300031824 Bacteria 2029
727 Ga0307406_10000717 3300031901 Bacteria 18697
728 Ga0307406_10001362 3300031901 Bacteria 13677
729 Ga0307406_10001703 3300031901 Bacteria 12091
730 Ga0307406_10008835 3300031901 Bacteria 5631
731 Ga0307412_10032584 3300031911 Bacteria 3304
732 Ga0307412_10061904 3300031911 Bacteria 2517
733 Ga0307412_10077918 3300031911 Bacteria 2281
734 Ga0307409_100234697 3300031995 Bacteria 1665
735 Ga0307416_100005940 3300032002 Bacteria 7585
736 Ga0307411_10141963 3300032005 Bacteria 1772
737 Ga0373934_0031443 3300035086 Bacteria 2078
738 Ga0373944_0012434 3300035089 Bacteria 2345
739 Ga0373952_0017932 3300035092 Bacteria 1459
740 Ga0373923_0024304 3300035111 Bacteria 2391
741 Ga0373954_0056826 3300035118 Bacteria 1842
742 Ga0373956_0020838 3300035119 Bacteria 2794
743 Ga0373956_0037296 3300035119 Bacteria 2148
744 Ga0373957_0009807 3300035120 Bacteria 3143
745 Ga0373943_0037724 3300035170 Bacteria 2320
746 Ga0373943_0045843 3300035170 Bacteria 2132
747 Ga0373924_0001355 3300035410 Bacteria 7900
748 Ga0373924_0005008 3300035410 Bacteria 4662
749 Ga0373935_0027565 3300035692 Bacteria 3512
750 Ga0373935_0088661 3300035692 Bacteria 2021
751 Ga0373927_0146437 3300035695 Bacteria 1546
752 Ga0373933_0026327 3300035724 Bacteria 3339
753 Ga0373933_0038139 3300035724 Bacteria 2823
754 Ga0373947_0017539 3300035725 Bacteria 4118
755 Ga0373947_0105003 3300035725 Bacteria 1779
756 Ga0373937_0003621 3300036401 Bacteria 13032
757 Ga0373937_0006249 3300036401 Bacteria 10274
758 Ga0373937_0013535 3300036401 Bacteria 7184
759 Ga0373937_0045827 3300036401 Bacteria 3997
760 Ga0373937_0282586 3300036401 Bacteria 1567
761 Ga0373925_0031507 3300037068 Bacteria 3897
762 Ga0373925_0062778 3300037068 Bacteria 2794
763 Ga0373925_0274969 3300037068 Bacteria 1355
764 Ga0395899_0000729 3300037312 Bacteria 32868
765 Ga0395899_0000953 3300037312 Bacteria 27077
766 Ga0395899_0004365 3300037312 Bacteria 11030
767 Ga0395899_0142355 3300037312 Bacteria 1705
768 Ga0395900_0003921 3300037418 Bacteria 15886
769 Ga0395900_0012212 3300037418 Bacteria 8780
770 Ga0395900_0013023 3300037418 Bacteria 8498
771 Ga0395900_0013168 3300037418 Bacteria 8453
772 Ga0395900_0023654 3300037418 Bacteria 6285
773 Ga0395900_0042298 3300037418 Bacteria 4694
774 Ga0395900_0299272 3300037418 Bacteria 1595
775 Ga0395898_0002404 3300037466 Bacteria 22217
776 Ga0395898_0021652 3300037466 Bacteria 6516
777 Ga0395898_0029788 3300037466 Bacteria 5463
778 Ga0395905_0000773 3300037471 Bacteria 42104
779 Ga0395905_0002341 3300037471 Bacteria 21134
780 Ga0395905_0006414 3300037471 Bacteria 11843
781 Ga0395905_0007480 3300037471 Bacteria 10866
782 Ga0395905_0008399 3300037471 Bacteria 10183
783 Ga0395905_0025327 3300037471 Bacteria 5594
784 Ga0395905_0034441 3300037471 Bacteria 4755
785 Ga0395905_0127970 3300037471 Bacteria 2388
786 Ga0395905_0148231 3300037471 Bacteria 2208
787 Ga0436364_0001604 3300037853 Bacteria 2885
788 Ga0436364_0810222 3300037853 Bacteria 5386
789 Ga0436364_1195167 3300037853 Bacteria 4748
790 Ga0395901_0015521 3300038443 Bacteria 7756
791 Ga0395901_0210306 3300038443 Bacteria 2036
792 Ga0395901_0221072 3300038443 Bacteria 1979
793 Ga0436365_0085001 3300039437 Bacteria 1220
794 Ga0436365_0697045 3300039437 Bacteria 35162
795 Ga0436361_0206236 3300039447 Bacteria 37288
796 Ga0436363_0279939 3300039450 Bacteria 13836
797 Ga0436363_1334668 3300039450 Bacteria 12831
798 Ga0436362_0430762 3300039453 Bacteria 3666
799 Ga0439436_0010842 3300041404 Bacteria 2776
800 Ga0439447_014462 3300041407 Bacteria 2214
801 Ga0439431_0013721 3300041997 Bacteria 1871
802 Ga0439445_0019986 3300042004 Bacteria 1673
803 Ga0439445_0030848 3300042004 Bacteria 1391
804 Ga0439432_000428 3300042006 Bacteria 15693
805 Ga0439449_0006422 3300042007 Bacteria 4496
806 Ga0439449_0011558 3300042007 Bacteria 3320
807 Ga0439462_0008801 3300042015 Bacteria 2551
808 Ga0450911_000033 3300042115 Bacteria 65955
809 Ga0450911_000416 3300042115 Bacteria 14088
810 Ga0439434_0004056 3300042435 Bacteria 4275
811 Ga0450918_002189 3300042531 Bacteria 3726
812 Ga0451577_0002494 3300042876 Bacteria 21855
813 Ga0466969_0007935 3300044656 Bacteria 5634
814 Ga0453683_0007748 3300044673 Bacteria 7263
815 Ga0466966_0015680 3300044684 Bacteria 5010
816 Ga0466964_0012946 3300044706 Bacteria 3160
817 Ga0453684_0006738 3300044712 Bacteria 21642
818 Ga0453684_0015963 3300044712 Bacteria 11805
819 Ga0453684_0075827 3300044712 Bacteria 4224
820 Ga0466968_0013088 3300044735 Bacteria 3256
821 Ga0466957_0041422 3300044842 Bacteria 2785
822 Ga0466959_0053187 3300045049 Bacteria 2961
823 Ga0451576_0004732 3300045051 Bacteria 17494
824 Ga0451576_0042754 3300045051 Bacteria 4784
825 Ga0451576_0079716 3300045051 Bacteria 3407
826 Ga0466958_0022473 3300045836 Bacteria 3695
827 Ga0495629_0000409 3300046459 Bacteria 35959
828 Ga0495629_0014553 3300046459 Bacteria 5661
829 Ga0495651_0001051 3300046462 Bacteria 21350
830 Ga0495653_0019732 3300046463 Bacteria 5465
831 Ga0495580_0109441 3300046472 Bacteria 1918
832 Ga0495580_0174216 3300046472 Bacteria 1486
833 Ga0495582_0103162 3300046473 Bacteria 1598
834 Ga0495639_0010877 3300046475 Bacteria 3919
835 Ga0495662_0016655 3300046476 Bacteria 3561
836 Ga0495662_0094866 3300046476 Bacteria 1457
837 Ga0495584_0121854 3300046491 Bacteria 1321
838 Ga0495583_0000463 3300046506 Bacteria 59986
839 Ga0495606_0004903 3300046507 Bacteria 13099
840 Ga0495610_0025647 3300046512 Bacteria 3159
841 Ga0495610_0044980 3300046512 Bacteria 2187
842 Ga0495618_0002201 3300046514 Bacteria 12750
843 Ga0495630_0011056 3300046517 Bacteria 6530
844 Ga0495630_0135154 3300046517 Bacteria 1874
845 Ga0495631_0000760 3300046518 Bacteria 20700
846 Ga0495632_0004880 3300046519 Bacteria 8995
847 Ga0495632_0043077 3300046519 Bacteria 2258
848 Ga0495637_0009149 3300046520 Bacteria 4837
849 Ga0495643_0000398 3300046522 Bacteria 57089
850 Ga0495643_0000960 3300046522 Bacteria 29547
851 Ga0495654_0002132 3300046530 Bacteria 12923
852 Ga0495665_0016123 3300046531 Bacteria 4025
853 Ga0495640_0017299 3300046533 Bacteria 5375
854 Ga0495587_0005039 3300046536 Bacteria 8644
855 Ga0495587_0150586 3300046536 Bacteria 1326
856 Ga0495667_0007034 3300046559 Bacteria 7635
857 Ga0495667_0154892 3300046559 Bacteria 1475
858 Ga0495656_0000340 3300046615 Bacteria 15933
859 Ga0495656_0022112 3300046615 Bacteria 2486
860 Ga0495625_0002232 3300046660 Bacteria 21407
861 Ga0495625_0005135 3300046660 Bacteria 12089
862 Ga0495635_0028200 3300046663 Bacteria 3902
863 Ga0495661_0013991 3300046665 Bacteria 5380
864 Ga0495588_0070443 3300046674 Bacteria 1817
865 Ga0495623_0036475 3300046679 Bacteria 3149
866 Ga0495623_0083794 3300046679 Bacteria 1968
867 Ga0495646_0006787 3300046680 Bacteria 7263
868 Ga0495647_0005749 3300046681 Bacteria 4077
869 Ga0495658_0060115 3300046683 Bacteria 2178
870 Ga0495670_0064298 3300046691 Bacteria 1848
871 Ga0495600_0003659 3300046809 Bacteria 9072
872 Ga0495604_0001090 3300047317 Bacteria 22540
873 Ga0495674_0003125 3300047319 Bacteria 16088
874 Ga0495680_0000795 3300047322 Bacteria 35314
875 Ga0495675_0016020 3300047444 Bacteria 4740
876 Ga0495684_0005001 3300047471 Bacteria 10343
877 Ga0495684_0039919 3300047471 Bacteria 3598
878 Ga0495684_0084289 3300047471 Bacteria 2411
879 Ga0495593_0009993 3300047673 Bacteria 5499
880 Ga0495593_0046206 3300047673 Bacteria 2321
881 Ga0495602_0010500 3300048088 Bacteria 9612
882 Ga0495626_0000868 3300048091 Bacteria 26883
883 Ga0495626_0008192 3300048091 Bacteria 5756
884 Ga0495626_0010129 3300048091 Bacteria 5057
885 Ga0495626_0058254 3300048091 Bacteria 1765
886 Ga0496100_0037447 3300048903 Bacteria 3067
887 Ga0496100_0243514 3300048903 Bacteria 1328
888 Ga0496101_0002523 3300048904 Bacteria 11243
889 Ga0496101_0007754 3300048904 Bacteria 6975
890 Ga0496101_0259532 3300048904 Bacteria 1355
891 Ga0496102_0006650 3300048905 Bacteria 9882
892 Ga0496103_0093559 3300048906 Bacteria 1898
893 Ga0496104_0003535 3300048907 Bacteria 13476
894 Ga0496105_0005191 3300048908 Bacteria 9868
895 Ga0496105_0058115 3300048908 Bacteria 3192
896 Ga0496106_0057080 3300048909 Bacteria 2952
897 Ga0496107_0013884 3300048910 Bacteria 5630
898 Ga0496108_0138887 3300048911 Bacteria 2093
899 Ga0496109_0005079 3300048912 Bacteria 10995
900 Ga0496109_0027699 3300048912 Bacteria 5064
901 Ga0496110_0025566 3300048913 Bacteria 5046
902 Ga0496110_0162028 3300048913 Bacteria 2028
903 Ga0496110_0206482 3300048913 Bacteria 1785
904 Ga0496112_0003897 3300048915 Bacteria 12482
905 Ga0496112_0004675 3300048915 Bacteria 11641
906 Ga0496112_0015232 3300048915 Bacteria 7168
907 Ga0496112_0049858 3300048915 Bacteria 4104
908 Ga0496113_0037995 3300048916 Bacteria 3537
909 Ga0496113_0089139 3300048916 Bacteria 2374
910 Ga0496114_0071643 3300048917 Bacteria 2913
911 Ga0496114_0108143 3300048917 Bacteria 2380
912 Ga0496115_0024747 3300048918 Bacteria 4669
913 Ga0496115_0059915 3300048918 Bacteria 3066
914 Ga0496117_0000965 3300048920 Bacteria 44061
915 Ga0496117_0026287 3300048920 Bacteria 4557
916 Ga0496118_0001301 3300048921 Bacteria 38037
917 Ga0496118_0023891 3300048921 Bacteria 5293
918 Ga0496118_0102815 3300048921 Bacteria 1924
919 Ga0496121_0029040 3300048924 Bacteria 5128
920 Ga0496121_0034728 3300048924 Bacteria 4534
921 Ga0496122_0000199 3300048925 Bacteria 133898
922 Ga0496122_0000310 3300048925 Bacteria 107506
923 Ga0496123_0000102 3300048926 Bacteria 169327
924 Ga0496123_0000312 3300048926 Bacteria 93478
925 Ga0496124_0007963 3300048927 Bacteria 11153
926 Ga0496124_0013624 3300048927 Bacteria 7927
927 Ga0496125_0000361 3300048928 Bacteria 85699
928 Ga0496125_0001359 3300048928 Bacteria 36008
929 Ga0496125_0002445 3300048928 Bacteria 24130
930 Ga0496125_0011871 3300048928 Bacteria 8678
931 Ga0496125_0026569 3300048928 Bacteria 5270
932 Ga0496125_0185624 3300048928 Bacteria 1380
933 Ga0496126_0076353 3300048929 Bacteria 2972
934 Ga0501033_0147141 3300049570 Bacteria 1701
935 Ga0501037_0044434 3300049573 Bacteria 3263
936 Ga0501037_0048122 3300049573 Bacteria 3125
937 Ga0501038_0050943 3300049574 Bacteria 3576
938 Ga0501039_0004592 3300049575 Bacteria 10444
939 Ga0501041_0001425 3300049577 Bacteria 13218
940 Ga0501043_0041705 3300049579 Bacteria 3606
941 Ga0501047_0055347 3300049581 Bacteria 3837
942 Ga0501071_0020912 3300049587 Bacteria 4553
943 Ga0501072_0096621 3300049588 Bacteria 2347
944 Ga0501076_0002101 3300049592 Bacteria 13659
945 Ga0501079_0000442 3300049741 Bacteria 26958
946 Ga0501080_0005112 3300049742 Bacteria 11689
947 Ga0501081_0001609 3300049743 Bacteria 13933
948 Ga0501083_0022417 3300049744 Bacteria 4384
949 Ga0501262_000023 3300049759 Bacteria 21585
950 Ga0501262_000311 3300049759 Bacteria 5938
951 Ga0501045_0016595 3300049824 Bacteria 5232
952 nmdc:mga03683_16298_c1 3300050489 Bacteria 2789
953 nmdc:mga03683_49284_c1 3300050489 Bacteria 1753
954 nmdc:mga00v17_16695_c1 3300050491 Bacteria 4141
955 nmdc:mga0k408_100441_c1 3300050493 Bacteria 1706
956 nmdc:mga0k408_109991_c1 3300050493 Bacteria 1629
957 nmdc:mga0k408_17256_c1 3300050493 Bacteria 4019
958 nmdc:mga0k408_29173_c1 3300050493 Bacteria 3140
959 nmdc:mga0k408_3909_c1 3300050493 Bacteria 7898
960 nmdc:mga0k408_44496_c1 3300050493 Bacteria 2560
961 nmdc:mga0k408_47553_c1 3300050493 Bacteria 2480
962 nmdc:mga06z11_157283_c1 3300050494 Bacteria 1297
963 nmdc:mga07m45_20766_c1 3300050496 Bacteria 3569
964 nmdc:mga07m45_357_c1 3300050496 Bacteria 18685
965 nmdc:mga07m45_4231_c1 3300050496 Bacteria 7024
966 nmdc:mga07m45_6994_c1 3300050496 Bacteria 5739
967 nmdc:mga07m45_94235_c1 3300050496 Bacteria 1717
968 nmdc:mga0n895_325932_c1 3300050512 Bacteria 1556
969 nmdc:mga0sz30_5942_c1 3300050516 Bacteria 4503
970 nmdc:mga0sz30_96834_c1 3300050516 Bacteria 1287
971 Ga0495601_0059253 3300053077 Bacteria 2428
972 Ga0495595_0001232 3300053084 Bacteria 9952
973 Ga0495619_0001190 3300053085 Bacteria 17140
974 Ga0495619_0011643 3300053085 Bacteria 5541
975 Ga0495619_0032340 3300053085 Bacteria 3394
976 Ga0500583_0037911 3300053092 Bacteria 2167
977 Ga0500651_0000165 3300053093 Bacteria 42850
978 Ga0500651_0124697 3300053093 Bacteria 1561
979 Ga0500641_0025876 3300053096 Bacteria 2274
980 Ga0500562_005454 3300053108 Bacteria 3194
981 Ga0500571_000235 3300053110 Bacteria 20748
982 Ga0500618_013591 3300053125 Bacteria 2098
983 Ga0500658_0000102 3300053134 Bacteria 39059
984 Ga0500658_0000693 3300053134 Bacteria 13911
985 Ga0500559_0007382 3300053136 Bacteria 4876
986 Ga0500559_0009091 3300053136 Bacteria 4317
987 Ga0500568_0000375 3300053139 Bacteria 34271
988 Ga0500568_0008065 3300053139 Bacteria 5111
989 Ga0500586_029290 3300053145 Bacteria 1804
990 Ga0500590_022668 3300053148 Bacteria 3264
991 Ga0500616_0029700 3300053153 Bacteria 3007
992 Ga0500616_0046223 3300053153 Bacteria 2315
993 Ga0500616_0095962 3300053153 Bacteria 1458
994 Ga0500622_0011106 3300053156 Bacteria 4917
995 Ga0500634_0038674 3300053161 Bacteria 2593
996 Ga0500638_055171 3300053162 Bacteria 1915
997 Ga0500570_037731 3300053724 Bacteria 2554
998 Ga0500645_000250 3300053730 Bacteria 40018
999 Ga0501084_0034987 3300054114 Bacteria 4200
1000 Ga0501082_0016744 3300060353 Bacteria 6312
1001 Ga0466962_0015127 3300061719 Bacteria 3720
1002 Ga0466962_0105467 3300061719 Bacteria 1355
1003 Ga0530510_0083125 3300061734 Bacteria 2332
1004 2511243313 2511231002 Bacteria 5042903
1005 2513227893 2513020051 Bacteria 6053213
1006 2548500330 2547132374 Bacteria 5530232
1007 2587757075 2585428062 Bacteria 6842168
1008 2599624234 2599185214 Bacteria 8209958
1009 2599627740 2599185214 Bacteria 8209958
1010 2599672246 2599185226 Bacteria 8233575
1011 2599677339 2599185226 Bacteria 8233575
1012 2599681670 2599185227 Bacteria 8246414
1013 2599685403 2599185227 Bacteria 8246414
1014 2599693684 2599185229 Bacteria 8216126
1015 2599697183 2599185229 Bacteria 8216126
1016 2643864634 2643221570 Bacteria 5103772
1017 2643992751 2643221596 Bacteria 5006805
1018 2644058335 2643221609 Bacteria 6756331
1019 2644073387 2643221611 Bacteria 6820941
1020 2644162707 2643221628 Bacteria 5745828
1021 2644296430 2643221652 Bacteria 5140275
1022 2644328902 2643221658 Bacteria 6064537
1023 2644397732 2643221672 Bacteria 6322190
1024 2644469044 2643221683 Bacteria 5749203
1025 2644647121 2643221717 Bacteria 5676132
1026 2738719825 2738541277 Bacteria 7458140
1027 2738879766 2738541307 Bacteria 8606193
1028 2738885326 2738541307 Bacteria 8606193
1029 2739244323 2738543012 Bacteria 7115078
1030 2739252254 2738543013 Bacteria 5618633
1031 2739279024 2738543019 Bacteria 7459457
1032 2808982702 2808606386 Bacteria 4471946
1033 2809130203 2808606415 Bacteria 4576710
1034 2809150320 2808606419 Bacteria 4576925
1035 2816469754 2816332133 Bacteria 7249298
1036 2819596601 2818991446 Bacteria 7757362
1037 2819598482 2818991446 Bacteria 7757362
1038 2821450559 2821443989 Bacteria 7658172
1039 2831267929 2831265667 Bacteria 7184833
1040 2838060129 2838054893 Bacteria 7451788
1041 2838061396 2838054893 Bacteria 7451788
1042 2842677904 2842677519 Bacteria 5615038
1043 2842735629 2842733646 Bacteria 5716726
1044 2842748630 2842747753 Bacteria 5578255
1045 2852621457 2852618963 Bacteria 4577824
1046 2885199318 2885198086 Bacteria 7212419
1047 2885212969 2885211737 Bacteria 7212420
1048 2895517930 2895511927 Bacteria 6802080
1049 2899926268 2899924645 Bacteria 7487985
1050 2899931319 2899924645 Bacteria 7487985
1051 2904450179 2904449895 Bacteria 6927402
1052 2904453810 2904449895 Bacteria 6927402
1053 2904456998 2904456579 Bacteria 6819253
1054 2904462285 2904456579 Bacteria 6819253
1055 2904483368 2904479285 Bacteria 5073931
1056 2904544035 2904541872 Bacteria 8915136
1057 2904550030 2904541872 Bacteria 8915136
1058 2904606175 2904601388 Bacteria 5884906
1059 2919464808 2919462493 Bacteria 5817112
1060 2928037908 2928037797 Bacteria 7273642
1061 2928044200 2928037797 Bacteria 7273642
1062 2928046486 2928044640 Bacteria 7271509
1063 2928051039 2928044640 Bacteria 7271509
1064 2928054181 2928051484 Bacteria 7773759
1065 2928057125 2928051484 Bacteria 7773759
1066 2928065934 2928064002 Bacteria 7419480
1067 2928069358 2928064002 Bacteria 7419480
1068 2928076841 2928070936 Bacteria 8062541
1069 2928077109 2928070936 Bacteria 8062541
1070 2928087853 2928084124 Bacteria 7159212
1071 2928089902 2928084124 Bacteria 7159212
1072 2928117845 2928115317 Bacteria 6477646
1073 2928118709 2928115317 Bacteria 6477646
1074 2929162406 2929160207 Bacteria 9075316
1075 2929166524 2929160207 Bacteria 9075316
1076 2929525514 2929520902 Bacteria 6765052
1077 2945948839 2945945610 Bacteria 5951079
1078 2945972959 2945972063 Bacteria 6086495
1079 2945984502 2945984333 Bacteria 7358892
1080 2954767889 2954767861 Bacteria 5535784
1081 2954772974 2954767861 Bacteria 5535784
1082 2990715216 2990710928 Bacteria 5002431
1083 Ga0395905_0156729
1084 SwRhRL2b_contig_1156090
1085 JGI24740J21852_10011219
1086 JGI24740J21852_10012167
1087 JGI25155J39150_1000092
1088 JGI25156J39149_1000067
1089 JGI25154J39366_1000089
1090 JGI25157J39369_1000084
1091 JGI25150J39212_1000694
1092 JGI25159J45721_1000228
1093 JGI25159J45721_1010332
1094 JGI25151J46595_10002022
1095 JGI25151J46595_10006434
1096 JGI25151J46595_10006514
1097 JGI25151J46595_10011382
1098 JGI25160J50197_1000076
1099 JGI25160J50197_1007974
1100 JGI25160J50197_1008069
1101 JGI25161J50226_1000058
1102 Ga0055535_1000084
1103 Ga0055535_1001221
1104 Ga0055542_1000033
1105 Ga0055542_1000381
1106 Ga0055526_1007589
1107 Ga0055537_1000304
1108 Ga0055537_1000389
1109 Ga0055537_1001544
1110 Ga0055524_1000678
1111 Ga0055524_1001685
1112 Ga0055524_1004503
1113 Ga0055536_1001854
1114 Ga0055534_1000260
1115 Ga0055534_1000289
1116 Ga0055534_1001915
1117 Ga0055534_1003287
1118 Ga0055534_1004043
1119 Ga0055528_1000468
1120 Ga0055528_1001139
1121 Ga0055528_1002348
1122 Ga0055528_1008822
1123 Ga0055528_1012104
1124 Ga0055528_1013553
1125 Ga0055530_10003506
1126 Ga0055530_10005277
1127 Ga0055540_1000088
1128 Ga0055540_1000890
1129 Ga0055540_1003373
1130 Ga0055540_1003974
1131 Ga0055531_10001335
1132 Ga0055531_10004099
1133 Ga0055531_10007816
1134 Ga0055543_1001562
1135 Ga0065165_1010395
1136 Ga0065704_10003035
1137 Ga0070658_10050911
1138 Ga0070658_10069444
1139 Ga0070658_10077442
1140 Ga0070676_10004686
1141 Ga0070676_10021675
1142 Ga0070676_10027980
1143 Ga0070676_10033636
1144 Ga0070676_10070078
1145 Ga0070683_100026059
1146 Ga0070690_100001202
1147 Ga0070690_100002924
1148 Ga0070690_100171412
1149 Ga0070670_100000527
1150 Ga0070670_100007034
1151 Ga0070670_100075632
1152 Ga0070670_100295398
1153 Ga0070677_10002614
1154 Ga0070677_10008730
1155 Ga0070677_10019143
1156 Ga0068869_100001043
1157 Ga0068869_100038691
1158 Ga0068869_100201196
1159 Ga0070666_10005740
1160 Ga0070666_10012986
1161 Ga0070666_10017401
1162 Ga0070666_10033037
1163 Ga0068868_100006495
1164 Ga0068868_100008142
1165 Ga0068868_100011759
1166 Ga0068868_100016559
1167 Ga0068868_100022882
1168 Ga0068868_100160542
1169 Ga0070660_100004674
1170 Ga0070660_100010895
1171 Ga0070660_100060830
1172 Ga0070689_100034325
1173 Ga0070687_100004173
1174 Ga0070661_100002145
1175 Ga0070661_100006191
1176 Ga0070661_100025859
1177 Ga0070661_100133026
1178 Ga0070668_100002160
1179 Ga0070668_100035155
1180 Ga0070668_100036588
1181 Ga0070669_100000975
1182 Ga0070669_100037434
1183 Ga0070675_100001244
1184 Ga0070675_100010772
1185 Ga0070675_100019421
1186 Ga0070675_100045372
1187 Ga0070675_100072505
1188 Ga0070675_100090277
1189 Ga0070675_100115299
1190 Ga0070671_100000803
1191 Ga0070671_100002319
1192 Ga0070671_100011447
1193 Ga0070671_100123092
1194 Ga0070671_100147884
1195 Ga0070671_100259914
1196 Ga0070671_100270747
1197 Ga0070674_100000274
1198 Ga0070674_100015585
1199 Ga0070674_100051434
1200 Ga0070674_100078640
1201 Ga0070673_100000502
1202 Ga0070673_100000830
1203 Ga0070673_100001613
1204 Ga0070688_100001343
1205 Ga0070659_100051896
1206 Ga0070667_100001764
1207 Ga0070667_100010428
1208 Ga0070667_100027156
1209 Ga0070667_100061358
1210 Ga0070667_100069343
1211 Ga0070667_100088093
1212 Ga0070667_100126214
1213 Ga0070709_10008071
1214 Ga0070709_10086488
1215 Ga0070714_100005399
1216 Ga0070713_100000260
1217 Ga0070713_100001983
1218 Ga0070713_100128437
1219 Ga0070713_100281540
1220 Ga0070711_100009608
1221 Ga0070711_100261814
1222 Ga0070700_100047209
1223 Ga0070708_100002558
1224 Ga0070663_100013800
1225 Ga0070663_100230053
1226 Ga0070678_100002201
1227 Ga0070678_100003193
1228 Ga0070678_100058594
1229 Ga0070678_100106868
1230 Ga0070678_100107996
1231 Ga0070678_100138332
1232 Ga0070678_100287374
1233 Ga0070662_100002003
1234 Ga0070662_100017339
1235 Ga0070662_100018662
1236 Ga0070681_10110400
1237 Ga0068867_100001459
1238 Ga0068867_100002610
1239 Ga0068867_100047178
1240 Ga0068867_100065386
1241 Ga0070685_10000750
1242 Ga0070679_100021986
1243 Ga0070679_100046845
1244 Ga0070684_100009859
1245 Ga0070684_100020569
1246 Ga0070684_100059867
1247 Ga0070684_100159330
1248 Ga0068853_100006479
1249 Ga0068853_100008837
1250 Ga0068853_100167693
1251 Ga0068853_100342775
1252 Ga0070672_100000202
1253 Ga0070672_100000616
1254 Ga0070672_100135704
1255 Ga0070672_100139403
1256 Ga0070672_100222122
1257 Ga0070686_100060217
1258 Ga0070693_100124387
1259 Ga0070665_100000982
1260 Ga0070665_100001071
1261 Ga0070665_100002968
1262 Ga0070665_100014568
1263 Ga0070665_100243138
1264 Ga0070704_100175022
1265 Ga0068855_100014542
1266 Ga0068855_100015933
1267 Ga0068855_100037558
1268 Ga0068855_100055098
1269 Ga0068855_100134917
1270 Ga0070664_100006995
1271 Ga0070664_100043072
1272 Ga0070664_100060159
1273 Ga0070664_100061589
1274 Ga0070664_100099020
1275 Ga0068857_100002632
1276 Ga0068857_100067392
1277 Ga0068857_100113025
1278 Ga0068857_100193748
1279 Ga0068854_100015673
1280 Ga0068854_100029294
1281 Ga0068856_100032839
1282 Ga0068856_100035047
1283 Ga0068856_100041356
1284 Ga0068856_100071382
1285 Ga0068852_100001296
1286 Ga0068852_100002427
1287 Ga0068852_100002469
1288 Ga0068852_100003642
1289 Ga0068852_100202190
1290 Ga0068859_100000299
1291 Ga0068864_100000973
1292 Ga0068864_100001865
1293 Ga0068864_100014639
1294 Ga0068864_100017389
1295 Ga0068864_100036399
1296 Ga0068864_100044498
1297 Ga0068866_10007175
1298 Ga0068861_100000405
1299 Ga0068861_100003338
1300 Ga0068861_100047283
1301 Ga0068861_100078425
1302 Ga0068851_10005924
1303 Ga0068851_10005937
1304 Ga0068851_10023969
1305 Ga0068851_10038082
1306 Ga0068851_10072028
1307 Ga0068870_10027062
1308 Ga0068863_100008043
1309 Ga0068863_100036282
1310 Ga0068863_100057950
1311 Ga0068863_100089185
1312 Ga0068863_100106122
1313 Ga0068863_100169078
1314 Ga0068863_100186824
1315 Ga0068858_100002362
1316 Ga0068858_100051954
1317 Ga0068860_100000216
1318 Ga0068860_100001383
1319 Ga0068860_100038831
1320 Ga0068860_100056478
1321 Ga0068860_100058929
1322 Ga0068860_100226510
1323 Ga0068862_100015000
1324 Ga0070717_10051736
1325 Ga0075365_10022743
1326 Ga0075365_10081033
1327 Ga0075365_10088354
1328 Ga0075368_10021210
1329 Ga0075363_100021432
1330 Ga0075363_100065389
1331 Ga0075363_100101348
1332 Ga0075364_10025483
1333 Ga0075364_10091324
1334 Ga0075364_10131519
1335 Ga0070715_10041445
1336 Ga0070716_100009928
1337 Ga0070712_100002075
1338 Ga0075362_10008038
1339 Ga0075362_10053803
1340 Ga0075362_10071687
1341 Ga0075367_10022602
1342 Ga0075369_10024533
1343 Ga0075369_10106548
1344 Ga0075366_10008556
1345 Ga0075366_10012284
1346 Ga0075366_10043910
1347 Ga0075366_10069834
1348 Ga0075366_10138889
1349 Ga0097621_100025467
1350 Ga0097621_100032630
1351 Ga0097621_100034930
1352 Ga0097621_100055054
1353 Ga0075370_10004900
1354 Ga0075370_10024685
1355 Ga0075370_10033431
1356 Ga0068871_100020380
1357 Ga0068871_100039339
1358 Ga0068871_100067809
1359 Ga0075434_100163224
1360 Ga0068865_100014828
1361 Ga0068865_100022953
1362 Ga0068865_100032381
1363 Ga0097620_100000299
1364 Ga0079104_1021813
1365 Ga0099826_10000044
1366 Ga0105244_10001156
1367 Ga0105244_10021526
1368 Ga0105240_10014739
1369 Ga0105240_10047143
1370 Ga0105240_10060157
1371 Ga0105240_10410890
1372 Ga0105245_10009237
1373 Ga0105245_10015868
1374 Ga0105245_10107469
1375 Ga0105245_10339106
1376 Ga0105245_10400144
1377 Ga0105247_10005757
1378 Ga0105243_10002240
1379 Ga0105243_10002379
1380 Ga0105243_10003283
1381 Ga0105243_10062928
1382 Ga0105241_10007933
1383 Ga0105241_10025815
1384 Ga0105241_10175159
1385 Ga0105242_10121367
1386 Ga0105248_10028897
1387 Ga0105248_10090531
1388 Ga0105248_10180854
1389 Ga0105237_10000933
1390 Ga0105237_10037996
1391 Ga0105237_10096912
1392 Ga0105238_10008227
1393 Ga0105238_10030064
1394 Ga0105238_10082419
1395 Ga0105238_10111427
1396 Ga0105249_10064275
1397 Ga0105249_10152469
1398 Ga0105239_10007368
1399 Ga0105239_10320371
1400 Ga0105246_10068407
1401 Ga0105246_10176241
1402 Ga0157373_10001556
1403 Ga0157373_10013744
1404 Ga0157371_10015422
1405 Ga0157371_10043853
1406 Ga0157371_10051612
1407 Ga0157371_10087976
1408 Ga0157370_10057280
1409 Ga0157370_10217311
1410 Ga0157369_10000456
1411 Ga0157369_10039411
1412 Ga0157369_10040205
1413 Ga0157369_10172220
1414 Ga0157374_10008825
1415 Ga0157374_10168342
1416 Ga0157378_10002940
1417 Ga0157378_10010946
1418 Ga0163162_10009038
1419 Ga0163162_10010013
1420 Ga0163162_10014511
1421 Ga0163162_10050004
1422 Ga0163162_10312657
1423 Ga0163162_10361502
1424 Ga0157372_10031835
1425 Ga0157372_10104164
1426 Ga0157372_10326825
1427 Ga0157375_10001479
1428 Ga0157375_10002234
1429 Ga0157375_10004157
1430 Ga0157375_10069870
1431 Ga0163163_10010522
1432 Ga0163163_10017385
1433 Ga0157380_10005798
1434 Ga0157380_10041751
1435 Ga0182008_10003337
1436 Ga0182008_10006370
1437 Ga0182008_10014906
1438 Ga0182008_10060982
1439 Ga0157377_10000246
1440 Ga0157377_10036460
1441 Ga0157379_10000911
1442 Ga0157379_10004260
1443 Ga0157379_10004346
1444 Ga0157379_10015058
1445 Ga0157379_10024195
1446 Ga0157379_10126688
1447 Ga0157376_10010329
1448 Ga0157376_10031559
1449 Ga0157376_10054119
1450 Ga0182006_1001535
1451 Ga0182006_1003085
1452 Ga0182006_1031627
1453 Ga0182007_10002970
1454 Ga0183362_10006
1455 Ga0163161_10000308
1456 Ga0163161_10057833
1457 Ga0163161_10161183
1458 Ga0206350_11076645
1459 Ga0213876_10016615
1460 Ga0213876_10038786
1461 Ga0213875_10001420
1462 Ga0209435_100008
1463 Ga0209436_104850
1464 Ga0209672_100529
1465 Ga0209672_102290
1466 Ga0209147_100715
1467 Ga0209147_101310
1468 Ga0209258_100089
1469 Ga0209258_100454
1470 Ga0207425_1000355
1471 Ga0207425_1000483
1472 Ga0207425_1001782
1473 Ga0207425_1002298
1474 Ga0207425_1008002
1475 Ga0209646_1000029
1476 Ga0209026_1000016
1477 Ga0209148_1000097
1478 Ga0209148_1000449
1479 Ga0209759_1000016
1480 Ga0209129_1000033
1481 Ga0209129_1005867
1482 Ga0209565_1000019
1483 Ga0209565_1000047
1484 Ga0209565_1000120
1485 Ga0209565_1000586
1486 Ga0209565_1008452
1487 Ga0209673_1000079
1488 Ga0209673_1000099
1489 Ga0209673_1000185
1490 Ga0209673_1000492
1491 Ga0209673_1001345
1492 Ga0209673_1002128
1493 Ga0209673_1002340
1494 Ga0209673_1010691
1495 Ga0209130_1000011
1496 Ga0209130_1000014
1497 Ga0209130_1000272
1498 Ga0209130_1000736
1499 Ga0209130_1001586
1500 Ga0209130_1001885
1501 Ga0209130_1010381
1502 Ga0209675_1000046
1503 Ga0209675_1000054
1504 Ga0209675_1000073
1505 Ga0209675_1000296
1506 Ga0209675_1000539
1507 Ga0209675_1000622
1508 Ga0209675_1001599
1509 Ga0209675_1006949
1510 Ga0209675_1019145
1511 Ga0209676_1000013
1512 Ga0209676_1000153
1513 Ga0209676_1000179
1514 Ga0209676_1000896
1515 Ga0209676_1001185
1516 Ga0209676_1010360
1517 Ga0209676_1011930
1518 Ga0209676_1019621
1519 Ga0209025_1000714
1520 Ga0209025_1000743
1521 Ga0209025_1000973
1522 Ga0209025_1001001
1523 Ga0209025_1005221
1524 Ga0209025_1005695
1525 Ga0209025_1005712
1526 Ga0209025_1008443
1527 Ga0209025_1017032
1528 Ga0209025_1019327
1529 Ga0209025_1037003
1530 Ga0209564_1000040
1531 Ga0209564_1000151
1532 Ga0209564_1000246
1533 Ga0209564_1000725
1534 Ga0209758_1000027
1535 Ga0209758_1000037
1536 Ga0209758_1004818
1537 Ga0209758_1011129
1538 Ga0209758_1014773
1539 Ga0209758_1040496
1540 Ga0209050_1000008
1541 Ga0209050_1000172
1542 Ga0209050_1002148
1543 Ga0209050_1003172
1544 Ga0209050_1005822
1545 Ga0209050_1024418
1546 Ga0209050_1028869
1547 Ga0209256_1000023
1548 Ga0209256_1000039
1549 Ga0209256_1000069
1550 Ga0209256_1000161
1551 Ga0209256_1006705
1552 Ga0207426_1000027
1553 Ga0207426_1000029
1554 Ga0207426_1000115
1555 Ga0207426_1000174
1556 Ga0207426_1000411
1557 Ga0209051_1000005
1558 Ga0209051_1000046
1559 Ga0209051_1000055
1560 Ga0209051_1000128
1561 Ga0209051_1000483
1562 Ga0209051_1000762
1563 Ga0209051_1000841
1564 Ga0209051_1002685
1565 Ga0209051_1002686
1566 Ga0209051_1009810
1567 Ga0209257_1000031
1568 Ga0209257_1000101
1569 Ga0209257_1000281
1570 Ga0209257_1000377
1571 Ga0209257_1001061
1572 Ga0209257_1017705
1573 Ga0207697_10008475
1574 Ga0207697_10015952
1575 Ga0207656_10009598
1576 Ga0207656_10017111
1577 Ga0207655_1005421
1578 Ga0207682_10000930
1579 Ga0207682_10001271
1580 Ga0207682_10012418
1581 Ga0207682_10035668
1582 Ga0207692_10050644
1583 Ga0207642_10071197
1584 Ga0207710_10012742
1585 Ga0207688_10129459
1586 Ga0207680_10003123
1587 Ga0207680_10003924
1588 Ga0207680_10035243
1589 Ga0207699_10007585
1590 Ga0207645_10000242
1591 Ga0207645_10000481
1592 Ga0207645_10023328
1593 Ga0207645_10151049
1594 Ga0207643_10014273
1595 Ga0207643_10037378
1596 Ga0207654_10015755
1597 Ga0207654_10090825
1598 Ga0207707_10082168
1599 Ga0207695_10040965
1600 Ga0207695_10061561
1601 Ga0207695_10062000
1602 Ga0207695_10215361
1603 Ga0207671_10008055
1604 Ga0207693_10000405
1605 Ga0207663_10003087
1606 Ga0207663_10225900
1607 Ga0207662_10004572
1608 Ga0207662_10019814
1609 Ga0207657_10021044
1610 Ga0207657_10030031
1611 Ga0207657_10069103
1612 Ga0207657_10102655
1613 Ga0207657_10241732
1614 Ga0207652_10087621
1615 Ga0207681_10000162
1616 Ga0207681_10013644
1617 Ga0207681_10019030
1618 Ga0207681_10066479
1619 Ga0207694_10029379
1620 Ga0207694_10079787
1621 Ga0207694_10125408
1622 Ga0207650_10001039
1623 Ga0207650_10004268
1624 Ga0207650_10012479
1625 Ga0207650_10040447
1626 Ga0207650_10047698
1627 Ga0207650_10067893
1628 Ga0207650_10154738
1629 Ga0207650_10327360
1630 Ga0207659_10004029
1631 Ga0207659_10018283
1632 Ga0207659_10062930
1633 Ga0207659_10074965
1634 Ga0207659_10312004
1635 Ga0207687_10005515
1636 Ga0207687_10036680
1637 Ga0207700_10001855
1638 Ga0207664_10089203
1639 Ga0207644_10000236
1640 Ga0207644_10003418
1641 Ga0207644_10008705
1642 Ga0207644_10014552
1643 Ga0207644_10014708
1644 Ga0207644_10101692
1645 Ga0207644_10130324
1646 Ga0207690_10072446
1647 Ga0207690_10152698
1648 Ga0207706_10002936
1649 Ga0207706_10006657
1650 Ga0207686_10035034
1651 Ga0207686_10236463
1652 Ga0207709_10000319
1653 Ga0207709_10000868
1654 Ga0207709_10002362
1655 Ga0207670_10013702
1656 Ga0207669_10002721
1657 Ga0207669_10003694
1658 Ga0207669_10024902
1659 Ga0207669_10117174
1660 Ga0207704_10006650
1661 Ga0207691_10000084
1662 Ga0207691_10002250
1663 Ga0207691_10002324
1664 Ga0207691_10019132
1665 Ga0207691_10114013
1666 Ga0207691_10232243
1667 Ga0207711_10000320
1668 Ga0207711_10009403
1669 Ga0207711_10050769
1670 Ga0207689_10000725
1671 Ga0207689_10008373
1672 Ga0207689_10094751
1673 Ga0207689_10146300
1674 Ga0207661_10121699
1675 Ga0207679_10008059
1676 Ga0207679_10008384
1677 Ga0207679_10045774
1678 Ga0207679_10133938
1679 Ga0207667_10013088
1680 Ga0207667_10033228
1681 Ga0207667_10048599
1682 Ga0207667_10268640
1683 Ga0207651_10001535
1684 Ga0207651_10011801
1685 Ga0207712_10013041
1686 Ga0207712_10163635
1687 Ga0207668_10001266
1688 Ga0207668_10011750
1689 Ga0207668_10019585
1690 Ga0207668_10042208
1691 Ga0207668_10088267
1692 Ga0207668_10186334
1693 Ga0207640_10027346
1694 Ga0207640_10032378
1695 Ga0207640_10083221
1696 Ga0207640_10123093
1697 Ga0207658_10000181
1698 Ga0207658_10028994
1699 Ga0207658_10037345
1700 Ga0207658_10062420
1701 Ga0207658_10123511
1702 Ga0207658_10266012
1703 Ga0207677_10001129
1704 Ga0207677_10003051
1705 Ga0207677_10048120
1706 Ga0207677_10069671
1707 Ga0207677_10088010
1708 Ga0207703_10000377
1709 Ga0207703_10002749
1710 Ga0207703_10013218
1711 Ga0207703_10018081
1712 Ga0207703_10135870
1713 Ga0207703_10147716
1714 Ga0207639_10003425
1715 Ga0207639_10009290
1716 Ga0207639_10026001
1717 Ga0207639_10078064
1718 Ga0207678_10024411
1719 Ga0207678_10043678
1720 Ga0207678_10047219
1721 Ga0207708_10080307
1722 Ga0207702_10005209
1723 Ga0207702_10029549
1724 Ga0207702_10035879
1725 Ga0207702_10260513
1726 Ga0207641_10001807
1727 Ga0207641_10007514
1728 Ga0207641_10041170
1729 Ga0207641_10042857
1730 Ga0207641_10108018
1731 Ga0207641_10119563
1732 Ga0207641_10141317
1733 Ga0207648_10000799
1734 Ga0207648_10002006
1735 Ga0207648_10008220
1736 Ga0207648_10012486
1737 Ga0207648_10220242
1738 Ga0207676_10012888
1739 Ga0207676_10015861
1740 Ga0207676_10027124
1741 Ga0207676_10042038
1742 Ga0207676_10080947
1743 Ga0207676_10191354
1744 Ga0207674_10002241
1745 Ga0207674_10041068
1746 Ga0207674_10128118
1747 Ga0207674_10208960
1748 Ga0207675_100000273
1749 Ga0207675_100000770
1750 Ga0207675_100003220
1751 Ga0207675_100016216
1752 Ga0207683_10000003
1753 Ga0207683_10003562
1754 Ga0207683_10016614
1755 Ga0207683_10020310
1756 Ga0207683_10065538
1757 Ga0207683_10066195
1758 Ga0207683_10135533
1759 Ga0207698_10001703
1760 Ga0207698_10006587
1761 Ga0207698_10015574
1762 Ga0207698_10034839
1763 Ga0207698_10071400
1764 Ga0207698_10074270
1765 Ga0209282_1014520
1766 Ga0209974_10000572
1767 Ga0209974_10020721
1768 Ga0268266_10013197
1769 Ga0268266_10064760
1770 Ga0268266_10372303
1771 Ga0268264_10002625
1772 Ga0268264_10018448
1773 Ga0268264_10025144
1774 Ga0268264_10029519
1775 Ga0268264_10343893
1776 Ga0307515_10000257
1777 Ga0307515_10000737
1778 Ga0307515_10000911
1779 Ga0307515_10001517
1780 Ga0307515_10002263
1781 Ga0307515_10002980
1782 Ga0307515_10080406
1783 Ga0307511_10000086
1784 Ga0307512_10012428
1785 Ga0316180_1037273
1786 Ga0316183_1058424
1787 Ga0316182_1247809
1788 Ga0265330_10025219
1789 Ga0307513_10000037
1790 Ga0307513_10014317
1791 Ga0307513_10166806
1792 Ga0307509_10028187
1793 Ga0307408_100000117
1794 Ga0307408_100005526
1795 Ga0307408_100029623
1796 Ga0307408_100142692
1797 Ga0307508_10000101
1798 Ga0307514_10000408
1799 Ga0307514_10001925
1800 Ga0265314_10005849
1801 Ga0265314_10061543
1802 Ga0307516_10004632
1803 Ga0307516_10004894
1804 Ga0307405_10005204
1805 Ga0307405_10007347
1806 Ga0307405_10031026
1807 Ga0307405_10033033
1808 Ga0307413_10086242
1809 Ga0307406_10000717
1810 Ga0307406_10001362
1811 Ga0307406_10001703
1812 Ga0307406_10008835
1813 Ga0307412_10032584
1814 Ga0307412_10061904
1815 Ga0307412_10077918
1816 Ga0307409_100234697
1817 Ga0307416_100005940
1818 Ga0307411_10141963
1819 Ga0373934_0031443
1820 Ga0373944_0012434
1821 Ga0373952_0017932
1822 Ga0373923_0024304
1823 Ga0373954_0056826
1824 Ga0373956_0020838
1825 Ga0373956_0037296
1826 Ga0373957_0009807
1827 Ga0373943_0037724
1828 Ga0373943_0045843
1829 Ga0373924_0001355
1830 Ga0373924_0005008
1831 Ga0373935_0027565
1832 Ga0373935_0088661
1833 Ga0373927_0146437
1834 Ga0373933_0026327
1835 Ga0373933_0038139
1836 Ga0373947_0017539
1837 Ga0373947_0105003
1838 Ga0373937_0003621
1839 Ga0373937_0006249
1840 Ga0373937_0013535
1841 Ga0373937_0045827
1842 Ga0373937_0282586
1843 Ga0373925_0031507
1844 Ga0373925_0062778
1845 Ga0373925_0274969
1846 Ga0395899_0000729
1847 Ga0395899_0000953
1848 Ga0395899_0004365
1849 Ga0395899_0142355
1850 Ga0395900_0003921
1851 Ga0395900_0012212
1852 Ga0395900_0013023
1853 Ga0395900_0013168
1854 Ga0395900_0023654
1855 Ga0395900_0042298
1856 Ga0395900_0299272
1857 Ga0395898_0002404
1858 Ga0395898_0021652
1859 Ga0395898_0029788
1860 Ga0395905_0000773
1861 Ga0395905_0002341
1862 Ga0395905_0006414
1863 Ga0395905_0007480
1864 Ga0395905_0008399
1865 Ga0395905_0025327
1866 Ga0395905_0034441
1867 Ga0395905_0127970
1868 Ga0395905_0148231
1869 Ga0436364_0001604
1870 Ga0436364_0810222
1871 Ga0436364_1195167
1872 Ga0395901_0015521
1873 Ga0395901_0210306
1874 Ga0395901_0221072
1875 Ga0436365_0085001
1876 Ga0436365_0697045
1877 Ga0436361_0206236
1878 Ga0436363_0279939
1879 Ga0436363_1334668
1880 Ga0436362_0430762
1881 Ga0439436_0010842
1882 Ga0439447_014462
1883 Ga0439431_0013721
1884 Ga0439445_0019986
1885 Ga0439445_0030848
1886 Ga0439432_000428
1887 Ga0439449_0006422
1888 Ga0439449_0011558
1889 Ga0439462_0008801
1890 Ga0450911_000033
1891 Ga0450911_000416
1892 Ga0439434_0004056
1893 Ga0450918_002189
1894 Ga0451577_0002494
1895 Ga0466969_0007935
1896 Ga0453683_0007748
1897 Ga0466966_0015680
1898 Ga0466964_0012946
1899 Ga0453684_0006738
1900 Ga0453684_0015963
1901 Ga0453684_0075827
1902 Ga0466968_0013088
1903 Ga0466957_0041422
1904 Ga0466959_0053187
1905 Ga0451576_0004732
1906 Ga0451576_0042754
1907 Ga0451576_0079716
1908 Ga0466958_0022473
1909 Ga0495629_0000409
1910 Ga0495629_0014553
1911 Ga0495651_0001051
1912 Ga0495653_0019732
1913 Ga0495580_0109441
1914 Ga0495580_0174216
1915 Ga0495582_0103162
1916 Ga0495639_0010877
1917 Ga0495662_0016655
1918 Ga0495662_0094866
1919 Ga0495584_0121854
1920 Ga0495583_0000463
1921 Ga0495606_0004903
1922 Ga0495610_0025647
1923 Ga0495610_0044980
1924 Ga0495618_0002201
1925 Ga0495630_0011056
1926 Ga0495630_0135154
1927 Ga0495631_0000760
1928 Ga0495632_0004880
1929 Ga0495632_0043077
1930 Ga0495637_0009149
1931 Ga0495643_0000398
1932 Ga0495643_0000960
1933 Ga0495654_0002132
1934 Ga0495665_0016123
1935 Ga0495640_0017299
1936 Ga0495587_0005039
1937 Ga0495587_0150586
1938 Ga0495667_0007034
1939 Ga0495667_0154892
1940 Ga0495656_0000340
1941 Ga0495656_0022112
1942 Ga0495625_0002232
1943 Ga0495625_0005135
1944 Ga0495635_0028200
1945 Ga0495661_0013991
1946 Ga0495588_0070443
1947 Ga0495623_0036475
1948 Ga0495623_0083794
1949 Ga0495646_0006787
1950 Ga0495647_0005749
1951 Ga0495658_0060115
1952 Ga0495670_0064298
1953 Ga0495600_0003659
1954 Ga0495604_0001090
1955 Ga0495674_0003125
1956 Ga0495680_0000795
1957 Ga0495675_0016020
1958 Ga0495684_0005001
1959 Ga0495684_0039919
1960 Ga0495684_0084289
1961 Ga0495593_0009993
1962 Ga0495593_0046206
1963 Ga0495602_0010500
1964 Ga0495626_0000868
1965 Ga0495626_0008192
1966 Ga0495626_0010129
1967 Ga0495626_0058254
1968 Ga0496100_0037447
1969 Ga0496100_0243514
1970 Ga0496101_0002523
1971 Ga0496101_0007754
1972 Ga0496101_0259532
1973 Ga0496102_0006650
1974 Ga0496103_0093559
1975 Ga0496104_0003535
1976 Ga0496105_0005191
1977 Ga0496105_0058115
1978 Ga0496106_0057080
1979 Ga0496107_0013884
1980 Ga0496108_0138887
1981 Ga0496109_0005079
1982 Ga0496109_0027699
1983 Ga0496110_0025566
1984 Ga0496110_0162028
1985 Ga0496110_0206482
1986 Ga0496112_0003897
1987 Ga0496112_0004675
1988 Ga0496112_0015232
1989 Ga0496112_0049858
1990 Ga0496113_0037995
1991 Ga0496113_0089139
1992 Ga0496114_0071643
1993 Ga0496114_0108143
1994 Ga0496115_0024747
1995 Ga0496115_0059915
1996 Ga0496117_0000965
1997 Ga0496117_0026287
1998 Ga0496118_0001301
1999 Ga0496118_0023891
2000 Ga0496118_0102815
2001 Ga0496121_0029040
2002 Ga0496121_0034728
2003 Ga0496122_0000199
2004 Ga0496122_0000310
2005 Ga0496123_0000102
2006 Ga0496123_0000312
2007 Ga0496124_0007963
2008 Ga0496124_0013624
2009 Ga0496125_0000361
2010 Ga0496125_0001359
2011 Ga0496125_0002445
2012 Ga0496125_0011871
2013 Ga0496125_0026569
2014 Ga0496125_0185624
2015 Ga0496126_0076353
2016 Ga0501033_0147141
2017 Ga0501037_0044434
2018 Ga0501037_0048122
2019 Ga0501038_0050943
2020 Ga0501039_0004592
2021 Ga0501041_0001425
2022 Ga0501043_0041705
2023 Ga0501047_0055347
2024 Ga0501071_0020912
2025 Ga0501072_0096621
2026 Ga0501076_0002101
2027 Ga0501079_0000442
2028 Ga0501080_0005112
2029 Ga0501081_0001609
2030 Ga0501083_0022417
2031 Ga0501262_000023
2032 Ga0501262_000311
2033 Ga0501045_0016595
2034 nmdc:mga03683_16298_c1
2035 nmdc:mga03683_49284_c1
2036 nmdc:mga00v17_16695_c1
2037 nmdc:mga0k408_100441_c1
2038 nmdc:mga0k408_109991_c1
2039 nmdc:mga0k408_17256_c1
2040 nmdc:mga0k408_29173_c1
2041 nmdc:mga0k408_3909_c1
2042 nmdc:mga0k408_44496_c1
2043 nmdc:mga0k408_47553_c1
2044 nmdc:mga06z11_157283_c1
2045 nmdc:mga07m45_20766_c1
2046 nmdc:mga07m45_357_c1
2047 nmdc:mga07m45_4231_c1
2048 nmdc:mga07m45_6994_c1
2049 nmdc:mga07m45_94235_c1
2050 nmdc:mga0n895_325932_c1
2051 nmdc:mga0sz30_5942_c1
2052 nmdc:mga0sz30_96834_c1
2053 Ga0495601_0059253
2054 Ga0495595_0001232
2055 Ga0495619_0001190
2056 Ga0495619_0011643
2057 Ga0495619_0032340
2058 Ga0500583_0037911
2059 Ga0500651_0000165
2060 Ga0500651_0124697
2061 Ga0500641_0025876
2062 Ga0500562_005454
2063 Ga0500571_000235
2064 Ga0500618_013591
2065 Ga0500658_0000102
2066 Ga0500658_0000693
2067 Ga0500559_0007382
2068 Ga0500559_0009091
2069 Ga0500568_0000375
2070 Ga0500568_0008065
2071 Ga0500586_029290
2072 Ga0500590_022668
2073 Ga0500616_0029700
2074 Ga0500616_0046223
2075 Ga0500616_0095962
2076 Ga0500622_0011106
2077 Ga0500634_0038674
2078 Ga0500638_055171
2079 Ga0500570_037731
2080 Ga0500645_000250
2081 Ga0501084_0034987
2082 Ga0501082_0016744
2083 Ga0466962_0015127
2084 Ga0466962_0105467
2085 Ga0530510_0083125
2086 2511243313
2087 2513227893
2088 2548500330
2089 2587757075
2090 2599624234
2091 2599627740
2092 2599672246
2093 2599677339
2094 2599681670
2095 2599685403
2096 2599693684
2097 2599697183
2098 2643864634
2099 2643992751
2100 2644058335
2101 2644073387
2102 2644162707
2103 2644296430
2104 2644328902
2105 2644397732
2106 2644469044
2107 2644647121
2108 2738719825
2109 2738879766
2110 2738885326
2111 2739244323
2112 2739252254
2113 2739279024
2114 2808982702
2115 2809130203
2116 2809150320
2117 2816469754
2118 2819596601
2119 2819598482
2120 2821450559
2121 2831267929
2122 2838060129
2123 2838061396
2124 2842677904
2125 2842735629
2126 2842748630
2127 2852621457
2128 2885199318
2129 2885212969
2130 2895517930
2131 2899926268
2132 2899931319
2133 2904450179
2134 2904453810
2135 2904456998
2136 2904462285
2137 2904483368
2138 2904544035
2139 2904550030
2140 2904606175
2141 2919464808
2142 2928037908
2143 2928044200
2144 2928046486
2145 2928051039
2146 2928054181
2147 2928057125
2148 2928065934
2149 2928069358
2150 2928076841
2151 2928077109
2152 2928087853
2153 2928089902
2154 2928117845
2155 2928118709
2156 2929162406
2157 2929166524
2158 2929525514
2159 2945948839
2160 2945972959
2161 2945984502
2162 2954767889
2163 2954772974
2164 2990715216

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

61

404

0.95

PF13433

Peripla_BP_5

Periplasmic binding protein domain

62

421

0.9

PF01094

ANF_receptor

Receptor family ligand binding region

89

393

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f06-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid 0.963 23 385
4evs-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate 0.96 23 385
4f06-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid 0.9476 23 385
4evs-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate 0.9448 23 385
4eyk-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with 3,4-dihydroxy benzoic acid 0.9417 23 387
ID Description Score Start End Superfamily
4f06A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.961 143 385 3.40.50.2300
4evqB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9318 141 271 3.40.50.2300
4f06A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9272 143 385 3.40.50.2300
4ey3A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9168 141 387 3.40.50.2300
4ey3A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9115 141 387 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3C0K8Z4-F1-model_v4 ABC transporter substrate-binding protein 0.9579 136 383
AF-A0A537X4X2-F1-model_v4 ABC transporter substrate-binding protein 0.946 24 389 GO:0006865
AF-A0A537X4X2-F1-model_v4 ABC transporter substrate-binding protein 0.9361 24 389 GO:0006865
AF-A0A5C9CTM2-F1-model_v4 Branched-chain amino acid transport system substrate-binding protein 0.9332 232 388
AF-A0A536XNG0-F1-model_v4 Leucine-binding protein domain-containing protein 0.9322 7 347

Map