F489701

General Info

Members Datasets Scaffolds Average Seq Length
1082 308 2164 107

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0092382|Ga0495656_0092382_274_651
Length 125
Sequence MKAPGCTWCAGKRFRSDPSLAEACVRPSKPSGILTPRPPHASSADAWAAYDKAVLASCTKASGLANAKPVGNAAQFDDRVGYTALLLQGQYPQKHMKGQQGTELCLYNKKSKTAYVTEWDSIRPN

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
58 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
59 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
60 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
61 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
72 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
73 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
74 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
75 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
78 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
79 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
80 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
81 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
82 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
83 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
84 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
87 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
88 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
89 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
90 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
91 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
92 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
93 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
94 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
95 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
96 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
97 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
98 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
99 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
100 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
103 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
107 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
108 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
204 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
211 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 2511231004 Pseudomonas sp. GM102 Isolate Nodule
214 2511231006 Pseudomonas sp. GM17 Isolate Nodule
215 2511231007 Pseudomonas sp. GM18 Isolate Nodule
216 2511231008 Pseudomonas sp. GM21 Isolate Nodule
217 2511231012 Pseudomonas sp. GM33 Isolate Nodule
218 2511231014 Pseudomonas sp. GM48 Isolate Nodule
219 2511231015 Pseudomonas sp. GM49 Isolate Nodule
220 2511231016 Pseudomonas sp. GM50 Isolate Nodule
221 2511231017 Pseudomonas sp. GM55 Isolate Nodule
222 2511231019 Pseudomonas sp. GM67 Isolate Nodule
223 2511231020 Pseudomonas sp. GM74 Isolate Nodule
224 2511231021 Pseudomonas sp. GM78 Isolate Nodule
225 2511231022 Pseudomonas sp. GM79 Isolate Nodule
226 2511231031 Pseudomonas sp. GM16 Isolate Nodule
227 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
228 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
229 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
230 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
231 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
232 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
233 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
234 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
235 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
236 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
237 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
238 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
239 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
240 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
241 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
242 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
243 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
244 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
245 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
246 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
247 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
248 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
249 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
250 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
251 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
252 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
253 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
254 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
255 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
256 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
257 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
258 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
259 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
260 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
261 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
262 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
263 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
264 2773857670 Pseudomonas sp. 478 Isolate Unclassified
265 2784132072 Pseudomonas sp. 460 Isolate Unclassified
266 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
267 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
268 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
269 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
270 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
271 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
272 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
273 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
274 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
275 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
276 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
277 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
278 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
279 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
280 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
281 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
282 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
283 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
284 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
285 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
286 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
287 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
288 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
289 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
290 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
291 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
292 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
293 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
294 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
295 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
296 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
297 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
298 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
299 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
300 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
301 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
302 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
303 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
304 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
305 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
306 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
307 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
308 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.13
Metatranscriptomes 0
Isolates 8.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 1.48
Rhizoplane 3.51
Rhizosphere 84.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0092382 3300046615 Bacteria 1386
2 MRS2a_Contig_303 2124908027 Bacteria 4064
3 MRS2a_Contig_63 2124908027 Bacteria 63450
4 SwRhRL2b_contig_3024960 2162886007 Bacteria 3724
5 rootH1_10209168 3300003323 Bacteria 2461
6 Ga0055536_1000707 3300003781 Bacteria 22391
7 Ga0055536_1002231 3300003781 Bacteria 11030
8 Ga0055530_10000626 3300003791 Bacteria 30520
9 Ga0055530_10004127 3300003791 Bacteria 7708
10 Ga0055530_10005829 3300003791 Bacteria 5713
11 Ga0055530_10008561 3300003791 Bacteria 4073
12 Ga0055540_1000484 3300003792 Bacteria 30520
13 Ga0055540_1003397 3300003792 Bacteria 7715
14 Ga0055540_1005052 3300003792 Bacteria 5713
15 Ga0055531_10001834 3300003794 Bacteria 14992
16 Ga0065714_10000425 3300005288 Bacteria 5489
17 Ga0065714_10002388 3300005288 Bacteria 25021
18 Ga0065714_10009202 3300005288 Bacteria 2635
19 Ga0065714_10009497 3300005288 Bacteria 2848
20 Ga0065714_10023738 3300005288 Bacteria 1530
21 Ga0065714_10068967 3300005288 Bacteria 4442
22 Ga0065714_10072503 3300005288 Bacteria 3353
23 Ga0065714_10116087 3300005288 Bacteria 1407
24 Ga0065714_10154326 3300005288 Bacteria 1087
25 Ga0065714_10516147 3300005288 Bacteria 515
26 Ga0065714_10540772 3300005288 Bacteria 503
27 Ga0065704_10072495 3300005289 Bacteria 8421
28 Ga0065704_10524027 3300005289 Bacteria 651
29 Ga0065712_10000524 3300005290 Bacteria 15878
30 Ga0065712_10067964 3300005290 Bacteria 18936
31 Ga0065715_10517598 3300005293 Bacteria 732
32 Ga0070670_101025094 3300005331 Bacteria 751
33 Ga0070669_100008019 3300005353 Bacteria 7539
34 Ga0070665_102093111 3300005548 Bacteria 570
35 Ga0075363_100109048 3300006048 Bacteria 1538
36 Ga0075364_10056329 3300006051 Bacteria 2574
37 Ga0075364_10101628 3300006051 Bacteria 1914
38 Ga0075364_10172220 3300006051 Bacteria 1463
39 Ga0075364_10597108 3300006051 Bacteria 754
40 Ga0075432_10001387 3300006058 Bacteria 7881
41 Ga0075432_10003850 3300006058 Bacteria 5115
42 Ga0075432_10014170 3300006058 Bacteria 2714
43 Ga0075432_10029853 3300006058 Bacteria 1883
44 Ga0075432_10035170 3300006058 Bacteria 1740
45 Ga0075432_10103438 3300006058 Bacteria 1054
46 Ga0075432_10134618 3300006058 Bacteria 938
47 Ga0075432_10191238 3300006058 Bacteria 805
48 Ga0075432_10227422 3300006058 Bacteria 748
49 Ga0075362_10008988 3300006177 Bacteria 3843
50 Ga0075362_10328507 3300006177 Bacteria 763
51 Ga0075362_10432941 3300006177 Bacteria 666
52 Ga0075369_10031602 3300006186 Bacteria 2236
53 Ga0075436_100010379 3300006914 Bacteria 6381
54 Ga0075436_100410930 3300006914 Bacteria 982
55 Ga0099826_10019217 3300006948 Bacteria 5141
56 Ga0105251_10000933 3300009011 Bacteria 26175
57 Ga0105251_10002815 3300009011 Bacteria 13171
58 Ga0105251_10019561 3300009011 Bacteria 3573
59 Ga0105251_10137383 3300009011 Bacteria 1106
60 Ga0105251_10149967 3300009011 Bacteria 1053
61 Ga0105244_10006302 3300009036 Bacteria 7718
62 Ga0105244_10011329 3300009036 Bacteria 5358
63 Ga0105244_10012728 3300009036 Bacteria 4960
64 Ga0105244_10015739 3300009036 Bacteria 4330
65 Ga0105244_10017558 3300009036 Bacteria 4040
66 Ga0105244_10018381 3300009036 Bacteria 3923
67 Ga0105244_10058532 3300009036 Bacteria 1944
68 Ga0105244_10100084 3300009036 Bacteria 1419
69 Ga0105250_10002431 3300009092 Bacteria 9358
70 Ga0105250_10014143 3300009092 Bacteria 3283
71 Ga0105250_10032831 3300009092 Bacteria 2084
72 Ga0105250_10164614 3300009092 Bacteria 927
73 Ga0105243_10006057 3300009148 Bacteria 9355
74 Ga0105243_10075703 3300009148 Bacteria 2732
75 Ga0105243_10086367 3300009148 Bacteria 2573
76 Ga0105243_10105018 3300009148 Bacteria 2352
77 Ga0105242_10193376 3300009176 Bacteria 1803
78 Ga0105249_11785469 3300009553 Bacteria 688
79 Ga0105246_10001228 3300011119 Bacteria 15012
80 Ga0105246_10009116 3300011119 Bacteria 6110
81 Ga0157345_1008032 3300012498 Bacteria 874
82 Ga0157373_10006102 3300013100 Bacteria 9009
83 Ga0157373_10008434 3300013100 Bacteria 7651
84 Ga0157373_10158360 3300013100 Bacteria 1593
85 Ga0157371_10006251 3300013102 Bacteria 9867
86 Ga0157371_10428354 3300013102 Bacteria 971
87 Ga0157370_10007745 3300013104 Bacteria 11643
88 Ga0157370_10013518 3300013104 Bacteria 8404
89 Ga0157370_10051906 3300013104 Bacteria 3915
90 Ga0157370_10070660 3300013104 Bacteria 3295
91 Ga0157370_10399641 3300013104 Bacteria 1265
92 Ga0157370_10418690 3300013104 Bacteria 1232
93 Ga0157370_11335662 3300013104 Bacteria 646
94 Ga0157370_11975111 3300013104 Bacteria 523
95 Ga0163162_10007642 3300013306 Bacteria 10528
96 Ga0163162_10010234 3300013306 Bacteria 9111
97 Ga0163162_10717482 3300013306 Bacteria 1121
98 Ga0163162_11255270 3300013306 Bacteria 841
99 Ga0157372_10222233 3300013307 Bacteria 2189
100 Ga0157375_10106385 3300013308 Bacteria 2897
101 Ga0157375_10875676 3300013308 Bacteria 1043
102 Ga0157375_12569392 3300013308 Bacteria 608
103 Ga0182008_10007313 3300014497 Bacteria 6107
104 Ga0182008_10010129 3300014497 Bacteria 5055
105 Ga0182008_10012363 3300014497 Bacteria 4506
106 Ga0182008_10018115 3300014497 Bacteria 3647
107 Ga0182008_10029943 3300014497 Bacteria 2747
108 Ga0182008_10042892 3300014497 Bacteria 2253
109 Ga0182008_10487410 3300014497 Bacteria 676
110 Ga0182006_1002541 3300015261 Bacteria 9902
111 Ga0182006_1006967 3300015261 Bacteria 5202
112 Ga0182006_1014293 3300015261 Bacteria 3424
113 Ga0182006_1029298 3300015261 Bacteria 2231
114 Ga0182006_1029834 3300015261 Bacteria 2208
115 Ga0182006_1030609 3300015261 Bacteria 2174
116 Ga0182006_1047251 3300015261 Bacteria 1670
117 Ga0182006_1110432 3300015261 Bacteria 965
118 Ga0182007_10001933 3300015262 Bacteria 10721
119 Ga0182007_10018404 3300015262 Bacteria 2530
120 Ga0182007_10088994 3300015262 Bacteria 1016
121 Ga0182007_10153959 3300015262 Bacteria 783
122 Ga0182005_1001184 3300015265 Bacteria 10779
123 Ga0182005_1011301 3300015265 Bacteria 2550
124 Ga0182005_1015288 3300015265 Bacteria 2142
125 Ga0182005_1015930 3300015265 Bacteria 2094
126 Ga0182005_1018188 3300015265 Bacteria 1942
127 Ga0182005_1041544 3300015265 Bacteria 1250
128 Ga0182005_1042950 3300015265 Bacteria 1229
129 Ga0163161_10004450 3300017792 Bacteria 9770
130 Ga0163161_10011719 3300017792 Bacteria 6083
131 Ga0163161_10013269 3300017792 Bacteria 5728
132 Ga0163161_10021641 3300017792 Bacteria 4519
133 Ga0163161_10061986 3300017792 Bacteria 2724
134 Ga0163161_10076195 3300017792 Bacteria 2462
135 Ga0163161_10472297 3300017792 Bacteria 1017
136 Ga0209563_100384 3300025230 Bacteria 15984
137 Ga0209675_1004486 3300025291 Bacteria 6184
138 Ga0209676_1000006 3300025292 Bacteria 1039588
139 Ga0209676_1000010 3300025292 Bacteria 954025
140 Ga0209676_1002175 3300025292 Bacteria 14736
141 Ga0209676_1021021 3300025292 Bacteria 2200
142 Ga0209050_1000019 3300025298 Bacteria 608757
143 Ga0209050_1000027 3300025298 Bacteria 483261
144 Ga0209050_1000065 3300025298 Bacteria 313668
145 Ga0209050_1000560 3300025298 Bacteria 60894
146 Ga0209051_1000102 3300025303 Bacteria 162911
147 Ga0209051_1000504 3300025303 Bacteria 49506
148 Ga0209051_1000800 3300025303 Bacteria 33041
149 Ga0209051_1018015 3300025303 Bacteria 3140
150 Ga0209257_1000119 3300025304 Bacteria 225893
151 Ga0209257_1013653 3300025304 Bacteria 3583
152 Ga0209257_1126206 3300025304 Bacteria 592
153 Ga0207696_1002258 3300025711 Bacteria 9587
154 Ga0207696_1002426 3300025711 Bacteria 9150
155 Ga0207696_1007512 3300025711 Bacteria 4257
156 Ga0207696_1032913 3300025711 Bacteria 1557
157 Ga0207655_1000005 3300025728 Bacteria 917277
158 Ga0207655_1000015 3300025728 Bacteria 600662
159 Ga0207655_1001102 3300025728 Bacteria 26443
160 Ga0207655_1002625 3300025728 Bacteria 14255
161 Ga0207655_1003264 3300025728 Bacteria 12168
162 Ga0207655_1003556 3300025728 Bacteria 11541
163 Ga0207655_1017549 3300025728 Bacteria 3853
164 Ga0207655_1019623 3300025728 Bacteria 3521
165 Ga0207655_1020439 3300025728 Bacteria 3402
166 Ga0207655_1022170 3300025728 Bacteria 3194
167 Ga0207655_1052889 3300025728 Bacteria 1630
168 Ga0207655_1055076 3300025728 Bacteria 1577
169 Ga0207655_1083785 3300025728 Bacteria 1142
170 Ga0207655_1139318 3300025728 Bacteria 780
171 Ga0207713_1000604 3300025735 Bacteria 35350
172 Ga0207713_1001944 3300025735 Bacteria 15624
173 Ga0207713_1002068 3300025735 Bacteria 14999
174 Ga0207713_1003039 3300025735 Bacteria 11697
175 Ga0207713_1006203 3300025735 Bacteria 7327
176 Ga0207713_1030601 3300025735 Bacteria 2394
177 Ga0207713_1036998 3300025735 Bacteria 2087
178 Ga0207713_1116562 3300025735 Bacteria 901
179 Ga0207681_10001097 3300025923 Bacteria 17539
180 Ga0207686_10132310 3300025934 Bacteria 1712
181 Ga0207709_10000224 3300025935 Bacteria 71687
182 Ga0207709_10007744 3300025935 Bacteria 5955
183 Ga0209281_1000015 3300027111 Bacteria 590084
184 Ga0207428_10005994 3300027907 Bacteria 11255
185 Ga0207428_10024832 3300027907 Bacteria 5028
186 Ga0207428_10069052 3300027907 Bacteria 2778
187 Ga0207428_10095357 3300027907 Bacteria 2305
188 Ga0207428_10098513 3300027907 Bacteria 2262
189 Ga0207428_10121466 3300027907 Bacteria 2003
190 Ga0207428_10180379 3300027907 Bacteria 1596
191 Ga0207428_10185543 3300027907 Bacteria 1570
192 Ga0207428_10480464 3300027907 Bacteria 904
193 Ga0268266_11072794 3300028379 Bacteria 779
194 Ga0307517_10117151 3300028786 Bacteria 1990
195 Ga0307511_10088683 3300030521 Bacteria 2114
196 Ga0307511_10344825 3300030521 Bacteria 644
197 Ga0316177_1130498 3300030731 Bacteria 2415
198 Ga0316181_1184042 3300030744 Bacteria 1917
199 Ga0316182_1161176 3300030745 Bacteria 1228
200 Ga0307408_100012772 3300031548 Bacteria 5568
201 Ga0307408_100111561 3300031548 Bacteria 2101
202 Ga0307405_10070302 3300031731 Bacteria 2247
203 Ga0307405_11047345 3300031731 Bacteria 698
204 Ga0307406_10417920 3300031901 Bacteria 1067
205 Ga0307407_10946384 3300031903 Bacteria 663
206 Ga0307412_10035190 3300031911 Bacteria 3197
207 Ga0307412_10036528 3300031911 Bacteria 3148
208 Ga0307416_100210264 3300032002 Bacteria 1855
209 Ga0307414_10009074 3300032004 Bacteria 5692
210 Ga0307414_11126309 3300032004 Bacteria 725
211 Ga0307411_10089973 3300032005 Bacteria 2139
212 Ga0307510_10009889 3300033180 Bacteria 11347
213 Ga0307510_10454825 3300033180 Bacteria 721
214 Ga0237819_00235 3300038705 Bacteria 20293
215 Ga0439436_0080596 3300041404 Bacteria 906
216 Ga0439438_000458 3300041405 Bacteria 18423
217 Ga0439438_001105 3300041405 Bacteria 12044
218 Ga0439438_001822 3300041405 Bacteria 9346
219 Ga0439438_001985 3300041405 Bacteria 8943
220 Ga0439438_003641 3300041405 Bacteria 6166
221 Ga0439438_005641 3300041405 Bacteria 4566
222 Ga0439438_007686 3300041405 Bacteria 3654
223 Ga0439438_009827 3300041405 Bacteria 3072
224 Ga0439438_026619 3300041405 Bacteria 1567
225 Ga0439438_034888 3300041405 Bacteria 1323
226 Ga0439438_102742 3300041405 Bacteria 692
227 Ga0439447_001586 3300041407 Bacteria 8321
228 Ga0439447_002464 3300041407 Bacteria 6734
229 Ga0439447_003589 3300041407 Bacteria 5494
230 Ga0439447_003775 3300041407 Bacteria 5320
231 Ga0439447_007135 3300041407 Bacteria 3570
232 Ga0439447_010612 3300041407 Bacteria 2725
233 Ga0439447_011093 3300041407 Bacteria 2646
234 Ga0439447_019163 3300041407 Bacteria 1827
235 Ga0439447_025930 3300041407 Bacteria 1506
236 Ga0439447_028158 3300041407 Bacteria 1429
237 Ga0439447_029299 3300041407 Bacteria 1394
238 Ga0439447_041794 3300041407 Bacteria 1115
239 Ga0439447_052182 3300041407 Bacteria 974
240 Ga0439447_074711 3300041407 Bacteria 785
241 Ga0439461_0052174 3300041410 Bacteria 910
242 Ga0439466_0000449 3300041411 Bacteria 15679
243 Ga0439466_0000907 3300041411 Bacteria 11278
244 Ga0439466_0000971 3300041411 Bacteria 11031
245 Ga0439466_0001301 3300041411 Bacteria 9722
246 Ga0439466_0004087 3300041411 Bacteria 5637
247 Ga0439466_0013878 3300041411 Bacteria 2943
248 Ga0439466_0014525 3300041411 Bacteria 2866
249 Ga0439466_0020206 3300041411 Bacteria 2376
250 Ga0439466_0027191 3300041411 Bacteria 1982
251 Ga0439466_0040754 3300041411 Bacteria 1552
252 Ga0439466_0056582 3300041411 Bacteria 1272
253 Ga0439466_0091755 3300041411 Bacteria 951
254 Ga0439466_0101711 3300041411 Bacteria 895
255 Ga0439465_0036220 3300041413 Bacteria 1584
256 Ga0439465_0079079 3300041413 Bacteria 1112
257 Ga0439465_0126008 3300041413 Bacteria 901
258 Ga0439431_0000561 3300041997 Bacteria 7882
259 Ga0439445_0005783 3300042004 Bacteria 2826
260 Ga0439448_0071571 3300042005 Bacteria 1155
261 Ga0439432_006676 3300042006 Bacteria 4109
262 Ga0439432_008963 3300042006 Bacteria 3497
263 Ga0439432_015150 3300042006 Bacteria 2604
264 Ga0439432_015163 3300042006 Bacteria 2603
265 Ga0439432_016007 3300042006 Bacteria 2526
266 Ga0439432_019189 3300042006 Bacteria 2279
267 Ga0439432_191990 3300042006 Bacteria 593
268 Ga0439451_005258 3300042009 Bacteria 2636
269 Ga0439451_007496 3300042009 Bacteria 2223
270 Ga0439451_008367 3300042009 Bacteria 2098
271 Ga0439451_011210 3300042009 Bacteria 1808
272 Ga0439451_013958 3300042009 Bacteria 1620
273 Ga0439451_020379 3300042009 Bacteria 1336
274 Ga0439451_072131 3300042009 Bacteria 691
275 Ga0439451_091956 3300042009 Bacteria 611
276 Ga0439452_000425 3300042010 Bacteria 24410
277 Ga0439452_000450 3300042010 Bacteria 23166
278 Ga0439452_002394 3300042010 Bacteria 6951
279 Ga0439452_004462 3300042010 Bacteria 4688
280 Ga0439452_004827 3300042010 Bacteria 4436
281 Ga0439452_007948 3300042010 Bacteria 3213
282 Ga0439452_017782 3300042010 Bacteria 1903
283 Ga0439452_030300 3300042010 Bacteria 1335
284 Ga0439456_006901 3300042013 Bacteria 2324
285 Ga0439456_010571 3300042013 Bacteria 1906
286 Ga0439456_011577 3300042013 Bacteria 1826
287 Ga0439456_012407 3300042013 Bacteria 1766
288 Ga0439456_012446 3300042013 Bacteria 1763
289 Ga0439456_022838 3300042013 Bacteria 1325
290 Ga0439456_026646 3300042013 Bacteria 1229
291 Ga0439456_035796 3300042013 Bacteria 1070
292 Ga0439456_059345 3300042013 Bacteria 840
293 Ga0439456_065406 3300042013 Bacteria 802
294 Ga0439456_149732 3300042013 Bacteria 543
295 Ga0439463_001422 3300042016 Bacteria 6354
296 Ga0439463_014229 3300042016 Bacteria 1960
297 Ga0439463_016759 3300042016 Bacteria 1813
298 Ga0439463_021207 3300042016 Bacteria 1622
299 Ga0439463_023726 3300042016 Bacteria 1536
300 Ga0439463_024652 3300042016 Bacteria 1508
301 Ga0439463_047410 3300042016 Bacteria 1094
302 Ga0439463_068403 3300042016 Bacteria 909
303 Ga0450911_003180 3300042115 Bacteria 2962
304 Ga0450911_004302 3300042115 Bacteria 2351
305 Ga0450911_006067 3300042115 Bacteria 1821
306 Ga0450911_013095 3300042115 Bacteria 1113
307 Ga0450919_001490 3300042121 Bacteria 3057
308 Ga0450920_003528 3300042122 Bacteria 2715
309 Ga0450922_000214 3300042124 Bacteria 6148
310 Ga0450922_002068 3300042124 Bacteria 1909
311 Ga0450922_002573 3300042124 Bacteria 1698
312 Ga0450923_003544 3300042125 Bacteria 2370
313 Ga0450923_040313 3300042125 Bacteria 979
314 Ga0450890_000379 3300042127 Bacteria 6487
315 Ga0450892_002198 3300042130 Bacteria 1698
316 Ga0450902_000988 3300042137 Bacteria 3735
317 Ga0450902_003548 3300042137 Bacteria 2287
318 Ga0450902_004464 3300042137 Bacteria 2084
319 Ga0450902_017383 3300042137 Bacteria 1175
320 Ga0450902_036703 3300042137 Bacteria 830
321 Ga0450902_039547 3300042137 Bacteria 801
322 Ga0450903_000730 3300042138 Bacteria 6497
323 Ga0450903_000921 3300042138 Bacteria 5645
324 Ga0450903_010413 3300042138 Bacteria 1505
325 Ga0450903_011204 3300042138 Bacteria 1446
326 Ga0450903_013217 3300042138 Bacteria 1314
327 Ga0450903_038115 3300042138 Bacteria 714
328 Ga0450904_008898 3300042139 Bacteria 991
329 Ga0450904_026878 3300042139 Bacteria 595
330 Ga0450905_005316 3300042142 Bacteria 1728
331 Ga0450889_003519 3300042144 Bacteria 1547
332 Ga0450906_003503 3300042145 Bacteria 3371
333 Ga0450906_010553 3300042145 Bacteria 1745
334 Ga0450906_025420 3300042145 Bacteria 1052
335 Ga0450906_035819 3300042145 Bacteria 876
336 Ga0450907_000153 3300042146 Bacteria 25822
337 Ga0450907_002327 3300042146 Bacteria 3672
338 Ga0450907_007049 3300042146 Bacteria 1874
339 Ga0450907_032870 3300042146 Bacteria 883
340 Ga0450910_000417 3300042147 Bacteria 5021
341 Ga0450910_000673 3300042147 Bacteria 4085
342 Ga0450910_003292 3300042147 Bacteria 2144
343 Ga0450910_013086 3300042147 Bacteria 1205
344 Ga0439446_0156179 3300042156 Bacteria 752
345 Ga0450908_001121 3300042184 Bacteria 5206
346 Ga0450908_013702 3300042184 Bacteria 1464
347 Ga0450908_027630 3300042184 Bacteria 988
348 Ga0450909_000558 3300042185 Bacteria 4916
349 Ga0450909_003241 3300042185 Bacteria 2316
350 Ga0450909_013996 3300042185 Bacteria 1181
351 Ga0439434_0001096 3300042435 Bacteria 7842
352 Ga0439434_0372949 3300042435 Bacteria 500
353 Ga0439460_0000125 3300042461 Bacteria 13439
354 Ga0439460_0002258 3300042461 Bacteria 4633
355 Ga0439460_0016544 3300042461 Bacteria 1965
356 Ga0439460_0019019 3300042461 Bacteria 1855
357 Ga0450918_004915 3300042531 Bacteria 2414
358 Ga0450918_009433 3300042531 Bacteria 1711
359 Ga0450893_0009040 3300042532 Bacteria 1627
360 Ga0450893_0049292 3300042532 Bacteria 786
361 Ga0439440_0000511 3300042993 Bacteria 6515
362 Ga0439440_0001054 3300042993 Bacteria 4902
363 Ga0439440_0005229 3300042993 Bacteria 2572
364 Ga0439440_0073112 3300042993 Bacteria 895
365 Ga0495617_000724 3300046452 Bacteria 16317
366 Ga0495617_001081 3300046452 Bacteria 12414
367 Ga0495617_002113 3300046452 Bacteria 8202
368 Ga0495617_005624 3300046452 Bacteria 4433
369 Ga0495617_005959 3300046452 Bacteria 4300
370 Ga0495617_009141 3300046452 Bacteria 3409
371 Ga0495617_010383 3300046452 Bacteria 3190
372 Ga0495617_018536 3300046452 Bacteria 2353
373 Ga0495617_054809 3300046452 Bacteria 1323
374 Ga0495617_061971 3300046452 Bacteria 1236
375 Ga0495627_002113 3300046453 Bacteria 10044
376 Ga0495627_003934 3300046453 Bacteria 6353
377 Ga0495627_012594 3300046453 Bacteria 2996
378 Ga0495627_014962 3300046453 Bacteria 2690
379 Ga0495603_0008313 3300046455 Bacteria 6273
380 Ga0495603_0023331 3300046455 Bacteria 3745
381 Ga0495603_0522978 3300046455 Bacteria 679
382 Ga0495603_0708235 3300046455 Bacteria 576
383 Ga0495590_0000664 3300046457 Bacteria 15913
384 Ga0495590_0001952 3300046457 Bacteria 8721
385 Ga0495590_0007655 3300046457 Bacteria 4148
386 Ga0495590_0022165 3300046457 Bacteria 2247
387 Ga0495590_0046900 3300046457 Bacteria 1507
388 Ga0495590_0055249 3300046457 Bacteria 1387
389 Ga0495590_0289620 3300046457 Bacteria 614
390 Ga0495591_001774 3300046458 Bacteria 12795
391 Ga0495591_002124 3300046458 Bacteria 11400
392 Ga0495591_005352 3300046458 Bacteria 5966
393 Ga0495591_009372 3300046458 Bacteria 3900
394 Ga0495591_013853 3300046458 Bacteria 2927
395 Ga0495591_022822 3300046458 Bacteria 2016
396 Ga0495591_026377 3300046458 Bacteria 1806
397 Ga0495591_044690 3300046458 Bacteria 1239
398 Ga0495591_068213 3300046458 Bacteria 929
399 Ga0495591_170562 3300046458 Bacteria 519
400 Ga0495638_0000675 3300046460 Bacteria 37081
401 Ga0495638_0003108 3300046460 Bacteria 13156
402 Ga0495638_0004385 3300046460 Bacteria 10684
403 Ga0495638_0008486 3300046460 Bacteria 7281
404 Ga0495638_0019265 3300046460 Bacteria 4515
405 Ga0495638_0022180 3300046460 Bacteria 4170
406 Ga0495638_0030335 3300046460 Bacteria 3481
407 Ga0495638_0030573 3300046460 Bacteria 3465
408 Ga0495638_0041071 3300046460 Bacteria 2928
409 Ga0495638_0051386 3300046460 Bacteria 2570
410 Ga0495638_0068853 3300046460 Bacteria 2169
411 Ga0495638_0114918 3300046460 Bacteria 1595
412 Ga0495638_0118200 3300046460 Bacteria 1568
413 Ga0495638_0260486 3300046460 Bacteria 951
414 Ga0495638_0298629 3300046460 Bacteria 868
415 Ga0495653_0031034 3300046463 Bacteria 4250
416 Ga0495650_0009261 3300046471 Bacteria 5624
417 Ga0495650_0012679 3300046471 Bacteria 4516
418 Ga0495650_0012690 3300046471 Bacteria 4514
419 Ga0495650_0018020 3300046471 Bacteria 3521
420 Ga0495650_0021842 3300046471 Bacteria 3079
421 Ga0495650_0034867 3300046471 Bacteria 2220
422 Ga0495650_0039601 3300046471 Bacteria 2032
423 Ga0495650_0041047 3300046471 Bacteria 1982
424 Ga0495605_0000353 3300046474 Bacteria 44329
425 Ga0495605_0018259 3300046474 Bacteria 3762
426 Ga0495605_0019089 3300046474 Bacteria 3668
427 Ga0495605_0029161 3300046474 Bacteria 2843
428 Ga0495605_0029701 3300046474 Bacteria 2809
429 Ga0495605_0036456 3300046474 Bacteria 2480
430 Ga0495605_0049965 3300046474 Bacteria 2041
431 Ga0495605_0054802 3300046474 Bacteria 1929
432 Ga0495605_0095597 3300046474 Bacteria 1371
433 Ga0495639_0000338 3300046475 Bacteria 22658
434 Ga0495639_0027448 3300046475 Bacteria 2520
435 Ga0495584_0000726 3300046491 Bacteria 21744
436 Ga0495584_0001156 3300046491 Bacteria 16265
437 Ga0495584_0002464 3300046491 Bacteria 10487
438 Ga0495584_0004354 3300046491 Bacteria 7622
439 Ga0495584_0005797 3300046491 Bacteria 6512
440 Ga0495584_0007707 3300046491 Bacteria 5606
441 Ga0495584_0011657 3300046491 Bacteria 4500
442 Ga0495584_0012986 3300046491 Bacteria 4252
443 Ga0495584_0017434 3300046491 Bacteria 3656
444 Ga0495584_0020571 3300046491 Bacteria 3350
445 Ga0495584_0029975 3300046491 Bacteria 2757
446 Ga0495584_0038955 3300046491 Bacteria 2402
447 Ga0495585_0002507 3300046492 Bacteria 13063
448 Ga0495585_0010109 3300046492 Bacteria 5636
449 Ga0495585_0015869 3300046492 Bacteria 4372
450 Ga0495585_0025748 3300046492 Bacteria 3366
451 Ga0495585_0028726 3300046492 Bacteria 3170
452 Ga0495585_0029790 3300046492 Bacteria 3105
453 Ga0495585_0043036 3300046492 Bacteria 2527
454 Ga0495585_0055264 3300046492 Bacteria 2194
455 Ga0495585_0094072 3300046492 Bacteria 1611
456 Ga0495585_0118873 3300046492 Bacteria 1399
457 Ga0495585_0215726 3300046492 Bacteria 970
458 Ga0495585_0243669 3300046492 Bacteria 899
459 Ga0495585_0435708 3300046492 Bacteria 628
460 Ga0495594_0004302 3300046499 Bacteria 7315
461 Ga0495594_0010838 3300046499 Bacteria 4734
462 Ga0495594_0030502 3300046499 Bacteria 2918
463 Ga0495596_0004590 3300046500 Bacteria 6697
464 Ga0495596_0010701 3300046500 Bacteria 3985
465 Ga0495607_0001439 3300046501 Bacteria 21207
466 Ga0495607_0002741 3300046501 Bacteria 14046
467 Ga0495607_0007786 3300046501 Bacteria 7374
468 Ga0495607_0011464 3300046501 Bacteria 5897
469 Ga0495607_0012872 3300046501 Bacteria 5503
470 Ga0495607_0015443 3300046501 Bacteria 4950
471 Ga0495607_0015890 3300046501 Bacteria 4868
472 Ga0495607_0020017 3300046501 Bacteria 4237
473 Ga0495607_0034336 3300046501 Bacteria 3077
474 Ga0495607_0037772 3300046501 Bacteria 2898
475 Ga0495607_0047068 3300046501 Bacteria 2528
476 Ga0495607_0047237 3300046501 Bacteria 2523
477 Ga0495607_0050612 3300046501 Bacteria 2417
478 Ga0495607_0069152 3300046501 Bacteria 1977
479 Ga0495607_0072061 3300046501 Bacteria 1924
480 Ga0495607_0217510 3300046501 Bacteria 936
481 Ga0495607_0323657 3300046501 Bacteria 718
482 Ga0495607_0403920 3300046501 Bacteria 621
483 Ga0495583_0003432 3300046506 Bacteria 12061
484 Ga0495583_0018739 3300046506 Bacteria 3635
485 Ga0495583_0029403 3300046506 Bacteria 2688
486 Ga0495583_0038821 3300046506 Bacteria 2247
487 Ga0495583_0040330 3300046506 Bacteria 2194
488 Ga0495583_0156743 3300046506 Bacteria 941
489 Ga0495583_0196987 3300046506 Bacteria 819
490 Ga0495583_0400100 3300046506 Bacteria 539
491 Ga0495606_0003734 3300046507 Bacteria 15862
492 Ga0495606_0004433 3300046507 Bacteria 14037
493 Ga0495606_0080290 3300046507 Bacteria 2030
494 Ga0495606_0215695 3300046507 Bacteria 1084
495 Ga0495606_0302294 3300046507 Bacteria 866
496 Ga0495610_0002132 3300046512 Bacteria 16835
497 Ga0495610_0008268 3300046512 Bacteria 6762
498 Ga0495610_0013992 3300046512 Bacteria 4741
499 Ga0495610_0018154 3300046512 Bacteria 3981
500 Ga0495610_0022281 3300046512 Bacteria 3468
501 Ga0495610_0029274 3300046512 Bacteria 2902
502 Ga0495610_0045193 3300046512 Bacteria 2180
503 Ga0495610_0053014 3300046512 Bacteria 1967
504 Ga0495610_0065661 3300046512 Bacteria 1711
505 Ga0495610_0074758 3300046512 Bacteria 1571
506 Ga0495616_0001333 3300046513 Bacteria 17253
507 Ga0495616_0005088 3300046513 Bacteria 8175
508 Ga0495616_0010916 3300046513 Bacteria 5230
509 Ga0495616_0013091 3300046513 Bacteria 4690
510 Ga0495616_0013281 3300046513 Bacteria 4651
511 Ga0495616_0014716 3300046513 Bacteria 4370
512 Ga0495616_0032548 3300046513 Bacteria 2723
513 Ga0495616_0034364 3300046513 Bacteria 2633
514 Ga0495616_0055738 3300046513 Bacteria 1955
515 Ga0495616_0080349 3300046513 Bacteria 1561
516 Ga0495616_0113062 3300046513 Bacteria 1259
517 Ga0495616_0131063 3300046513 Bacteria 1149
518 Ga0495616_0132843 3300046513 Bacteria 1139
519 Ga0495616_0139438 3300046513 Bacteria 1105
520 Ga0495616_0264394 3300046513 Bacteria 735
521 Ga0495620_0002523 3300046515 Bacteria 10602
522 Ga0495620_0008973 3300046515 Bacteria 5342
523 Ga0495620_0011736 3300046515 Bacteria 4557
524 Ga0495620_0016239 3300046515 Bacteria 3742
525 Ga0495620_0027622 3300046515 Bacteria 2652
526 Ga0495620_0030340 3300046515 Bacteria 2490
527 Ga0495620_0051056 3300046515 Bacteria 1761
528 Ga0495628_0207807 3300046516 Bacteria 1473
529 Ga0495630_0025909 3300046517 Bacteria 4339
530 Ga0495630_0113205 3300046517 Bacteria 2055
531 Ga0495631_0001079 3300046518 Bacteria 16944
532 Ga0495631_0013760 3300046518 Bacteria 3921
533 Ga0495631_0034439 3300046518 Bacteria 2270
534 Ga0495631_0047940 3300046518 Bacteria 1874
535 Ga0495631_0104681 3300046518 Bacteria 1217
536 Ga0495631_0118510 3300046518 Bacteria 1138
537 Ga0495632_0002027 3300046519 Bacteria 15948
538 Ga0495632_0002163 3300046519 Bacteria 15171
539 Ga0495632_0007242 3300046519 Bacteria 7002
540 Ga0495632_0013786 3300046519 Bacteria 4596
541 Ga0495632_0028229 3300046519 Bacteria 2929
542 Ga0495632_0032257 3300046519 Bacteria 2700
543 Ga0495632_0034845 3300046519 Bacteria 2573
544 Ga0495632_0038971 3300046519 Bacteria 2402
545 Ga0495632_0086708 3300046519 Bacteria 1488
546 Ga0495632_0128265 3300046519 Bacteria 1181
547 Ga0495632_0132455 3300046519 Bacteria 1159
548 Ga0495632_0139911 3300046519 Bacteria 1123
549 Ga0495632_0472377 3300046519 Bacteria 542
550 Ga0495637_0001125 3300046520 Bacteria 16370
551 Ga0495637_0001320 3300046520 Bacteria 14878
552 Ga0495637_0002591 3300046520 Bacteria 9931
553 Ga0495637_0002950 3300046520 Bacteria 9163
554 Ga0495637_0004612 3300046520 Bacteria 7116
555 Ga0495637_0007686 3300046520 Bacteria 5332
556 Ga0495637_0009669 3300046520 Bacteria 4695
557 Ga0495637_0011363 3300046520 Bacteria 4281
558 Ga0495637_0012886 3300046520 Bacteria 3985
559 Ga0495637_0039957 3300046520 Bacteria 2021
560 Ga0495637_0048975 3300046520 Bacteria 1777
561 Ga0495637_0050492 3300046520 Bacteria 1744
562 Ga0495637_0055046 3300046520 Bacteria 1651
563 Ga0495637_0094737 3300046520 Bacteria 1173
564 Ga0495637_0206186 3300046520 Bacteria 720
565 Ga0495643_0024717 3300046522 Bacteria 3405
566 Ga0495643_0025659 3300046522 Bacteria 3332
567 Ga0495643_0037694 3300046522 Bacteria 2649
568 Ga0495643_0043312 3300046522 Bacteria 2450
569 Ga0495643_0047259 3300046522 Bacteria 2331
570 Ga0495643_0052477 3300046522 Bacteria 2189
571 Ga0495643_0087530 3300046522 Bacteria 1612
572 Ga0495643_0138571 3300046522 Bacteria 1215
573 Ga0495643_0253329 3300046522 Bacteria 821
574 Ga0495643_0290531 3300046522 Bacteria 749
575 Ga0495644_0002956 3300046523 Bacteria 6753
576 Ga0495644_0004115 3300046523 Bacteria 5715
577 Ga0495644_0004612 3300046523 Bacteria 5414
578 Ga0495644_0091919 3300046523 Bacteria 1146
579 Ga0495644_0185511 3300046523 Bacteria 800
580 Ga0495644_0206808 3300046523 Bacteria 757
581 Ga0495648_0003822 3300046524 Bacteria 13077
582 Ga0495648_0010556 3300046524 Bacteria 7022
583 Ga0495648_0018696 3300046524 Bacteria 4894
584 Ga0495648_0019644 3300046524 Bacteria 4740
585 Ga0495648_0020044 3300046524 Bacteria 4677
586 Ga0495648_0032546 3300046524 Bacteria 3419
587 Ga0495648_0036954 3300046524 Bacteria 3143
588 Ga0495648_0041251 3300046524 Bacteria 2917
589 Ga0495648_0042558 3300046524 Bacteria 2856
590 Ga0495648_0047178 3300046524 Bacteria 2664
591 Ga0495648_0055385 3300046524 Bacteria 2391
592 Ga0495648_0075516 3300046524 Bacteria 1938
593 Ga0495648_0098098 3300046524 Bacteria 1623
594 Ga0495648_0134149 3300046524 Bacteria 1312
595 Ga0495648_0165665 3300046524 Bacteria 1138
596 Ga0495648_0213244 3300046524 Bacteria 957
597 Ga0495648_0321805 3300046524 Bacteria 716
598 Ga0495666_0007568 3300046526 Bacteria 5434
599 Ga0495666_0014599 3300046526 Bacteria 3911
600 Ga0495666_0018440 3300046526 Bacteria 3472
601 Ga0495666_0043929 3300046526 Bacteria 2158
602 Ga0495666_0058631 3300046526 Bacteria 1841
603 Ga0495642_0000194 3300046528 Bacteria 35869
604 Ga0495642_0002058 3300046528 Bacteria 8362
605 Ga0495642_0005920 3300046528 Bacteria 4691
606 Ga0495654_0003039 3300046530 Bacteria 10448
607 Ga0495654_0004633 3300046530 Bacteria 8114
608 Ga0495654_0005151 3300046530 Bacteria 7629
609 Ga0495654_0013202 3300046530 Bacteria 4423
610 Ga0495654_0016257 3300046530 Bacteria 3938
611 Ga0495654_0016356 3300046530 Bacteria 3925
612 Ga0495654_0019823 3300046530 Bacteria 3512
613 Ga0495654_0028949 3300046530 Bacteria 2828
614 Ga0495654_0032869 3300046530 Bacteria 2628
615 Ga0495654_0034511 3300046530 Bacteria 2551
616 Ga0495654_0035117 3300046530 Bacteria 2526
617 Ga0495654_0042619 3300046530 Bacteria 2251
618 Ga0495654_0043745 3300046530 Bacteria 2218
619 Ga0495654_0057435 3300046530 Bacteria 1879
620 Ga0495654_0066241 3300046530 Bacteria 1722
621 Ga0495654_0068326 3300046530 Bacteria 1689
622 Ga0495654_0080643 3300046530 Bacteria 1526
623 Ga0495654_0095161 3300046530 Bacteria 1377
624 Ga0495654_0108112 3300046530 Bacteria 1271
625 Ga0495654_0169812 3300046530 Bacteria 951
626 Ga0495587_0017806 3300046536 Bacteria 4406
627 Ga0495609_0001443 3300046538 Bacteria 15799
628 Ga0495609_0002477 3300046538 Bacteria 11343
629 Ga0495609_0006410 3300046538 Bacteria 6006
630 Ga0495609_0007833 3300046538 Bacteria 5284
631 Ga0495609_0017388 3300046538 Bacteria 3338
632 Ga0495609_0023339 3300046538 Bacteria 2843
633 Ga0495609_0026648 3300046538 Bacteria 2646
634 Ga0495609_0050070 3300046538 Bacteria 1863
635 Ga0495597_0002877 3300046542 Bacteria 10510
636 Ga0495597_0033767 3300046542 Bacteria 2314
637 Ga0495597_0038114 3300046542 Bacteria 2155
638 Ga0495597_0045016 3300046542 Bacteria 1960
639 Ga0495597_0063404 3300046542 Bacteria 1606
640 Ga0495597_0066232 3300046542 Bacteria 1565
641 Ga0495597_0100588 3300046542 Bacteria 1219
642 Ga0495597_0101605 3300046542 Bacteria 1212
643 Ga0495597_0101758 3300046542 Bacteria 1211
644 Ga0495597_0106023 3300046542 Bacteria 1181
645 Ga0495597_0377985 3300046542 Bacteria 540
646 Ga0495622_0000881 3300046557 Bacteria 16384
647 Ga0495622_0000886 3300046557 Bacteria 16327
648 Ga0495622_0009258 3300046557 Bacteria 4558
649 Ga0495622_0012465 3300046557 Bacteria 3936
650 Ga0495622_0017327 3300046557 Bacteria 3353
651 Ga0495622_0024315 3300046557 Bacteria 2828
652 Ga0495622_0239057 3300046557 Bacteria 801
653 Ga0495622_0347452 3300046557 Bacteria 642
654 Ga0495633_0004434 3300046558 Bacteria 8932
655 Ga0495633_0012019 3300046558 Bacteria 4626
656 Ga0495633_0053141 3300046558 Bacteria 1907
657 Ga0495633_0058201 3300046558 Bacteria 1814
658 Ga0495633_0061059 3300046558 Bacteria 1765
659 Ga0495633_0111835 3300046558 Bacteria 1266
660 Ga0495633_0332935 3300046558 Bacteria 688
661 Ga0495656_0001745 3300046615 Bacteria 7123
662 Ga0495656_0065979 3300046615 Bacteria 1593
663 Ga0495656_0129419 3300046615 Bacteria 1200
664 Ga0495668_0009763 3300046616 Bacteria 5860
665 Ga0495668_0010985 3300046616 Bacteria 5449
666 Ga0495668_0103848 3300046616 Bacteria 1555
667 Ga0495668_0170013 3300046616 Bacteria 1194
668 Ga0495668_0220851 3300046616 Bacteria 1037
669 Ga0495634_0013161 3300046642 Bacteria 5977
670 Ga0495611_0000552 3300046648 Bacteria 21884
671 Ga0495611_0018239 3300046648 Bacteria 3008
672 Ga0495611_0018849 3300046648 Bacteria 2961
673 Ga0495611_0021690 3300046648 Bacteria 2775
674 Ga0495611_0050499 3300046648 Bacteria 1873
675 Ga0495611_0457433 3300046648 Bacteria 581
676 Ga0495625_0005100 3300046660 Bacteria 12153
677 Ga0495625_0005658 3300046660 Bacteria 11318
678 Ga0495625_0021767 3300046660 Bacteria 4927
679 Ga0495625_0026415 3300046660 Bacteria 4387
680 Ga0495625_0034884 3300046660 Bacteria 3710
681 Ga0495625_0119926 3300046660 Bacteria 1791
682 Ga0495625_0187608 3300046660 Bacteria 1371
683 Ga0495625_0196027 3300046660 Bacteria 1335
684 Ga0495625_0216865 3300046660 Bacteria 1255
685 Ga0495625_0281177 3300046660 Bacteria 1070
686 Ga0495625_0328256 3300046660 Bacteria 972
687 Ga0495625_0458230 3300046660 Bacteria 786
688 Ga0495625_0553012 3300046660 Bacteria 697
689 Ga0495625_0643622 3300046660 Bacteria 632
690 Ga0495635_0024515 3300046663 Bacteria 4203
691 Ga0495659_0002195 3300046664 Bacteria 6366
692 Ga0495659_0009040 3300046664 Bacteria 3175
693 Ga0495659_0045969 3300046664 Bacteria 1575
694 Ga0495659_0047655 3300046664 Bacteria 1550
695 Ga0495659_0066190 3300046664 Bacteria 1345
696 Ga0495661_0021821 3300046665 Bacteria 4168
697 Ga0495661_0032366 3300046665 Bacteria 3305
698 Ga0495661_0043799 3300046665 Bacteria 2748
699 Ga0495661_0051273 3300046665 Bacteria 2492
700 Ga0495661_0057856 3300046665 Bacteria 2312
701 Ga0495661_0064299 3300046665 Bacteria 2165
702 Ga0495661_0073725 3300046665 Bacteria 1988
703 Ga0495661_0078726 3300046665 Bacteria 1906
704 Ga0495661_0081106 3300046665 Bacteria 1870
705 Ga0495661_0133764 3300046665 Bacteria 1356
706 Ga0495661_0193882 3300046665 Bacteria 1068
707 Ga0495661_0249785 3300046665 Bacteria 906
708 Ga0495661_0418377 3300046665 Bacteria 649
709 Ga0495661_0628533 3300046665 Bacteria 503
710 Ga0495588_0018387 3300046674 Bacteria 3407
711 Ga0495588_0025831 3300046674 Bacteria 2929
712 Ga0495588_0118027 3300046674 Bacteria 1398
713 Ga0495657_0368500 3300046675 Bacteria 848
714 Ga0495623_0008028 3300046679 Bacteria 6860
715 Ga0495623_0013999 3300046679 Bacteria 5197
716 Ga0495646_0011163 3300046680 Bacteria 5705
717 Ga0495646_0108855 3300046680 Bacteria 1579
718 Ga0495669_0015646 3300046684 Bacteria 3249
719 Ga0495669_0180378 3300046684 Bacteria 1006
720 Ga0495613_0116239 3300046689 Bacteria 1924
721 Ga0495670_0001941 3300046691 Bacteria 10192
722 Ga0495670_0004255 3300046691 Bacteria 7012
723 Ga0495670_0004830 3300046691 Bacteria 6620
724 Ga0495670_0006899 3300046691 Bacteria 5592
725 Ga0495670_0016945 3300046691 Bacteria 3581
726 Ga0495670_0024202 3300046691 Bacteria 3000
727 Ga0495670_0030970 3300046691 Bacteria 2657
728 Ga0495670_0040860 3300046691 Bacteria 2313
729 Ga0495670_0109323 3300046691 Bacteria 1429
730 Ga0495670_0124175 3300046691 Bacteria 1342
731 Ga0495670_0196867 3300046691 Bacteria 1066
732 Ga0495671_0001748 3300046692 Bacteria 14082
733 Ga0495671_0012398 3300046692 Bacteria 4658
734 Ga0495671_0020510 3300046692 Bacteria 3481
735 Ga0495671_0039860 3300046692 Bacteria 2369
736 Ga0495671_0042849 3300046692 Bacteria 2273
737 Ga0495671_0053361 3300046692 Bacteria 2006
738 Ga0495671_0082704 3300046692 Bacteria 1573
739 Ga0495671_0086822 3300046692 Bacteria 1532
740 Ga0495671_0095014 3300046692 Bacteria 1458
741 Ga0495671_0095391 3300046692 Bacteria 1455
742 Ga0495671_0143045 3300046692 Bacteria 1165
743 Ga0495671_0148422 3300046692 Bacteria 1141
744 Ga0495671_0541690 3300046692 Bacteria 554
745 Ga0495649_0000624 3300046694 Bacteria 29168
746 Ga0495649_0003989 3300046694 Bacteria 9733
747 Ga0495649_0009449 3300046694 Bacteria 5795
748 Ga0495649_0015911 3300046694 Bacteria 4272
749 Ga0495649_0028634 3300046694 Bacteria 3087
750 Ga0495649_0045315 3300046694 Bacteria 2398
751 Ga0495649_0051540 3300046694 Bacteria 2231
752 Ga0495649_0092065 3300046694 Bacteria 1615
753 Ga0495649_0092818 3300046694 Bacteria 1607
754 Ga0495649_0111812 3300046694 Bacteria 1448
755 Ga0495649_0131123 3300046694 Bacteria 1322
756 Ga0495649_0215284 3300046694 Bacteria 994
757 Ga0495649_0477423 3300046694 Bacteria 621
758 Ga0495649_0556680 3300046694 Bacteria 567
759 Ga0495589_0000179 3300046794 Bacteria 56070
760 Ga0495589_0003706 3300046794 Bacteria 8241
761 Ga0495589_0008366 3300046794 Bacteria 5406
762 Ga0495589_0010280 3300046794 Bacteria 4863
763 Ga0495589_0021806 3300046794 Bacteria 3272
764 Ga0495589_0045684 3300046794 Bacteria 2175
765 Ga0495589_0061305 3300046794 Bacteria 1846
766 Ga0495589_0078265 3300046794 Bacteria 1610
767 Ga0495589_0149311 3300046794 Bacteria 1116
768 Ga0495589_0358299 3300046794 Bacteria 671
769 Ga0495600_0052953 3300046809 Bacteria 2650
770 Ga0495660_0008576 3300046810 Bacteria 5982
771 Ga0495660_0008627 3300046810 Bacteria 5963
772 Ga0495660_0011667 3300046810 Bacteria 5097
773 Ga0495660_0012498 3300046810 Bacteria 4929
774 Ga0495660_0014397 3300046810 Bacteria 4577
775 Ga0495660_0028401 3300046810 Bacteria 3160
776 Ga0495660_0047486 3300046810 Bacteria 2350
777 Ga0495660_0057714 3300046810 Bacteria 2093
778 Ga0495660_0059987 3300046810 Bacteria 2045
779 Ga0495660_0072558 3300046810 Bacteria 1823
780 Ga0495660_0083832 3300046810 Bacteria 1667
781 Ga0495660_0094151 3300046810 Bacteria 1551
782 Ga0495660_0118750 3300046810 Bacteria 1340
783 Ga0495660_0118766 3300046810 Bacteria 1340
784 Ga0495660_0120323 3300046810 Bacteria 1329
785 Ga0495660_0144608 3300046810 Bacteria 1179
786 Ga0495660_0174205 3300046810 Bacteria 1045
787 Ga0495581_0018822 3300047315 Bacteria 4008
788 Ga0495604_0023158 3300047317 Bacteria 4957
789 Ga0495604_0110925 3300047317 Bacteria 2000
790 Ga0495636_0643894 3300047318 Bacteria 520
791 Ga0495674_0051563 3300047319 Bacteria 3627
792 Ga0495672_0002638 3300047320 Bacteria 16190
793 Ga0495672_0003679 3300047320 Bacteria 12955
794 Ga0495672_0009355 3300047320 Bacteria 7109
795 Ga0495672_0011410 3300047320 Bacteria 6274
796 Ga0495672_0020821 3300047320 Bacteria 4289
797 Ga0495672_0026753 3300047320 Bacteria 3675
798 Ga0495672_0034737 3300047320 Bacteria 3111
799 Ga0495672_0035253 3300047320 Bacteria 3082
800 Ga0495672_0035687 3300047320 Bacteria 3060
801 Ga0495672_0041085 3300047320 Bacteria 2799
802 Ga0495672_0051165 3300047320 Bacteria 2434
803 Ga0495672_0051955 3300047320 Bacteria 2410
804 Ga0495672_0080805 3300047320 Bacteria 1812
805 Ga0495672_0085343 3300047320 Bacteria 1749
806 Ga0495672_0105646 3300047320 Bacteria 1519
807 Ga0495672_0439239 3300047320 Bacteria 590
808 Ga0495680_0031628 3300047322 Bacteria 4303
809 Ga0495680_0065453 3300047322 Bacteria 2783
810 Ga0495680_0147772 3300047322 Bacteria 1715
811 Ga0495680_0276112 3300047322 Bacteria 1185
812 Ga0495683_0001305 3300047323 Bacteria 16741
813 Ga0495683_0012545 3300047323 Bacteria 4448
814 Ga0495683_0012723 3300047323 Bacteria 4415
815 Ga0495683_0014353 3300047323 Bacteria 4126
816 Ga0495683_0023987 3300047323 Bacteria 3132
817 Ga0495683_0031913 3300047323 Bacteria 2683
818 Ga0495683_0036771 3300047323 Bacteria 2484
819 Ga0495683_0037852 3300047323 Bacteria 2443
820 Ga0495683_0040482 3300047323 Bacteria 2354
821 Ga0495683_0040623 3300047323 Bacteria 2350
822 Ga0495683_0041211 3300047323 Bacteria 2331
823 Ga0495683_0082731 3300047323 Bacteria 1563
824 Ga0495683_0098112 3300047323 Bacteria 1412
825 Ga0495687_001795 3300047443 Bacteria 18949
826 Ga0495687_001904 3300047443 Bacteria 17924
827 Ga0495687_007827 3300047443 Bacteria 6221
828 Ga0495687_012255 3300047443 Bacteria 4543
829 Ga0495687_070304 3300047443 Bacteria 1406
830 Ga0495675_0160741 3300047444 Bacteria 1383
831 Ga0495677_0005485 3300047445 Bacteria 4810
832 Ga0495677_0295802 3300047445 Bacteria 636
833 Ga0495679_013219 3300047446 Bacteria 3108
834 Ga0495679_016431 3300047446 Bacteria 2678
835 Ga0495679_022051 3300047446 Bacteria 2186
836 Ga0495685_116856 3300047447 Bacteria 876
837 Ga0495673_0001119 3300047469 Bacteria 23023
838 Ga0495673_0002216 3300047469 Bacteria 13985
839 Ga0495673_0003127 3300047469 Bacteria 11081
840 Ga0495673_0003780 3300047469 Bacteria 9810
841 Ga0495673_0005243 3300047469 Bacteria 7875
842 Ga0495673_0009263 3300047469 Bacteria 5461
843 Ga0495673_0015211 3300047469 Bacteria 3971
844 Ga0495673_0016463 3300047469 Bacteria 3779
845 Ga0495673_0019682 3300047469 Bacteria 3378
846 Ga0495673_0022011 3300047469 Bacteria 3132
847 Ga0495673_0026486 3300047469 Bacteria 2771
848 Ga0495673_0030610 3300047469 Bacteria 2526
849 Ga0495673_0036686 3300047469 Bacteria 2245
850 Ga0495673_0076669 3300047469 Bacteria 1393
851 Ga0495673_0161287 3300047469 Bacteria 860
852 Ga0495673_0209148 3300047469 Bacteria 726
853 Ga0495681_0000894 3300047470 Bacteria 23021
854 Ga0495681_0002117 3300047470 Bacteria 14435
855 Ga0495681_0003240 3300047470 Bacteria 11355
856 Ga0495681_0003535 3300047470 Bacteria 10868
857 Ga0495681_0004183 3300047470 Bacteria 9907
858 Ga0495681_0005394 3300047470 Bacteria 8570
859 Ga0495681_0007949 3300047470 Bacteria 6697
860 Ga0495681_0009632 3300047470 Bacteria 5931
861 Ga0495681_0011180 3300047470 Bacteria 5368
862 Ga0495681_0015723 3300047470 Bacteria 4272
863 Ga0495681_0016894 3300047470 Bacteria 4070
864 Ga0495681_0024210 3300047470 Bacteria 3205
865 Ga0495681_0130621 3300047470 Bacteria 1069
866 Ga0495684_0070134 3300047471 Bacteria 2664
867 Ga0495686_0008517 3300047472 Bacteria 7517
868 Ga0495686_0037597 3300047472 Bacteria 3100
869 Ga0495686_0043947 3300047472 Bacteria 2829
870 Ga0495686_0053595 3300047472 Bacteria 2527
871 Ga0495686_0127427 3300047472 Bacteria 1512
872 Ga0495686_0180421 3300047472 Bacteria 1223
873 Ga0495686_0735782 3300047472 Bacteria 501
874 Ga0495593_0004837 3300047673 Bacteria 7988
875 Ga0495593_0018133 3300047673 Bacteria 3957
876 Ga0495593_0037129 3300047673 Bacteria 2637
877 Ga0495593_0050868 3300047673 Bacteria 2193
878 Ga0495593_0083058 3300047673 Bacteria 1655
879 Ga0495593_0243424 3300047673 Bacteria 901
880 Ga0495593_0323490 3300047673 Bacteria 771
881 Ga0495614_0106417 3300048089 Bacteria 1229
882 Ga0495614_0317800 3300048089 Bacteria 722
883 Ga0495626_0000983 3300048091 Bacteria 24536
884 Ga0495626_0001235 3300048091 Bacteria 21011
885 Ga0495626_0001815 3300048091 Bacteria 16091
886 Ga0495626_0003151 3300048091 Bacteria 10775
887 Ga0495626_0004148 3300048091 Bacteria 8997
888 Ga0495626_0005033 3300048091 Bacteria 7890
889 Ga0495626_0014966 3300048091 Bacteria 3979
890 Ga0495626_0050804 3300048091 Bacteria 1914
891 Ga0495626_0086929 3300048091 Bacteria 1380
892 Ga0495626_0159215 3300048091 Bacteria 947
893 Ga0495626_0184380 3300048091 Bacteria 863
894 Ga0495626_0193844 3300048091 Bacteria 836
895 Ga0495626_0213853 3300048091 Bacteria 785
896 Ga0496102_0003520 3300048905 Bacteria 13269
897 Ga0496102_0332504 3300048905 Bacteria 1431
898 Ga0496102_0812361 3300048905 Bacteria 857
899 Ga0496103_0067125 3300048906 Bacteria 2239
900 Ga0496103_0589824 3300048906 Bacteria 708
901 Ga0496104_1822267 3300048907 Bacteria 510
902 Ga0496105_0216672 3300048908 Bacteria 1559
903 Ga0496106_0355714 3300048909 Bacteria 1176
904 Ga0496110_0070779 3300048913 Bacteria 3091
905 Ga0496110_0249530 3300048913 Bacteria 1615
906 Ga0496110_1300313 3300048913 Bacteria 636
907 Ga0496111_0328254 3300048914 Bacteria 1133
908 Ga0496111_0864316 3300048914 Bacteria 652
909 Ga0496113_0323489 3300048916 Bacteria 1236
910 Ga0496114_0758562 3300048917 Bacteria 848
911 Ga0496116_0002114 3300048919 Bacteria 21174
912 Ga0496116_0024314 3300048919 Bacteria 4484
913 Ga0496116_0030939 3300048919 Bacteria 3839
914 Ga0496116_0182443 3300048919 Bacteria 1122
915 Ga0496117_0012224 3300048920 Bacteria 7591
916 Ga0496117_0035963 3300048920 Bacteria 3711
917 Ga0496117_0059011 3300048920 Bacteria 2654
918 Ga0496117_0245486 3300048920 Bacteria 980
919 Ga0496118_0016753 3300048921 Bacteria 6703
920 Ga0496118_0026103 3300048921 Bacteria 4986
921 Ga0496118_0027448 3300048921 Bacteria 4817
922 Ga0496118_0040175 3300048921 Bacteria 3722
923 Ga0496121_0043999 3300048924 Bacteria 3859
924 Ga0496121_0270272 3300048924 Bacteria 1169
925 Ga0496121_0329570 3300048924 Bacteria 1024
926 Ga0496121_0566653 3300048924 Bacteria 707
927 Ga0496122_0008052 3300048925 Bacteria 11502
928 Ga0496122_0081927 3300048925 Bacteria 2243
929 Ga0496123_0032511 3300048926 Bacteria 3775
930 Ga0496124_0006359 3300048927 Bacteria 12891
931 Ga0496124_0041439 3300048927 Bacteria 3973
932 Ga0496124_0131531 3300048927 Bacteria 1987
933 Ga0496124_0139997 3300048927 Bacteria 1910
934 Ga0496124_0176879 3300048927 Bacteria 1646
935 Ga0496124_0198623 3300048927 Bacteria 1527
936 Ga0496124_0362692 3300048927 Bacteria 1020
937 Ga0496125_0037301 3300048928 Bacteria 4227
938 Ga0496125_0073666 3300048928 Bacteria 2653
939 Ga0496125_0093999 3300048928 Bacteria 2236
940 Ga0496125_0698873 3300048928 Bacteria 538
941 Ga0496126_0171275 3300048929 Bacteria 1849
942 Ga0496126_0666105 3300048929 Bacteria 812
943 Ga0495678_001895 3300049459 Bacteria 15195
944 Ga0495678_010895 3300049459 Bacteria 4383
945 Ga0495678_012438 3300049459 Bacteria 4034
946 Ga0495678_012896 3300049459 Bacteria 3941
947 Ga0495678_020263 3300049459 Bacteria 2950
948 Ga0495678_021070 3300049459 Bacteria 2875
949 Ga0495678_021732 3300049459 Bacteria 2819
950 Ga0495678_022585 3300049459 Bacteria 2748
951 Ga0495678_054369 3300049459 Bacteria 1533
952 Ga0495678_065565 3300049459 Bacteria 1347
953 Ga0495678_068712 3300049459 Bacteria 1305
954 Ga0495678_102481 3300049459 Bacteria 989
955 Ga0495678_219930 3300049459 Bacteria 576
956 Ga0495678_219943 3300049459 Bacteria 576
957 Ga0495678_266710 3300049459 Bacteria 504
958 Ga0495682_0007042 3300049460 Bacteria 4501
959 Ga0495682_0007072 3300049460 Bacteria 4490
960 Ga0495682_0008752 3300049460 Bacteria 3981
961 Ga0495682_0018254 3300049460 Bacteria 2643
962 Ga0495682_0047060 3300049460 Bacteria 1574
963 Ga0495682_0069596 3300049460 Bacteria 1266
964 Ga0495682_0085743 3300049460 Bacteria 1131
965 Ga0495682_0090591 3300049460 Bacteria 1098
966 Ga0495682_0118604 3300049460 Bacteria 947
967 Ga0495682_0252049 3300049460 Bacteria 624
968 Ga0495682_0286531 3300049460 Bacteria 581
969 Ga0495682_0330517 3300049460 Bacteria 537
970 Ga0501269_012096 3300049766 Bacteria 1053
971 Ga0501226_002292 3300049853 Bacteria 2347
972 nmdc:mga03683_249101_c1 3300050489 Bacteria 825
973 nmdc:mga03683_278130_c1 3300050489 Bacteria 782
974 nmdc:mga03n38_356531_c1 3300050490 Bacteria 797
975 nmdc:mga00v17_113950_c1 3300050491 Bacteria 1717
976 nmdc:mga00v17_132980_c1 3300050491 Bacteria 1591
977 nmdc:mga00v17_156632_c1 3300050491 Bacteria 1465
978 nmdc:mga00v17_51637_c1 3300050491 Bacteria 582
979 nmdc:mga08x19_122368_c1 3300050514 Bacteria 1745
980 nmdc:mga08x19_178486_c1 3300050514 Bacteria 1449
981 nmdc:mga08x19_518800_c1 3300050514 Bacteria 842
982 nmdc:mga0sz30_2376_c1 3300050516 Bacteria 6714
983 nmdc:mga0sz30_521086_c1 3300050516 Bacteria 535
984 Ga0500647_0285291 3300053091 Bacteria 712
985 Ga0500572_002635 3300053111 Bacteria 4254
986 Ga0500568_0164643 3300053139 Bacteria 817
987 2511257365 2511231004 Bacteria 6669789
988 2511263716 2511231006 Bacteria 6794709
989 2511274436 2511231007 Bacteria 6306603
990 2511275934 2511231008 Bacteria 6624100
991 2511299263 2511231012 Bacteria 6738011
992 2511313952 2511231014 Bacteria 6462302
993 2511321456 2511231015 Bacteria 6598026
994 2511329091 2511231016 Bacteria 6704427
995 2511334468 2511231017 Bacteria 6503007
996 2511342614 2511231019 Bacteria 6520662
997 2511348497 2511231020 Bacteria 6115223
998 2511355604 2511231021 Bacteria 7302637
999 2511363177 2511231022 Bacteria 6719296
1000 2511414908 2511231031 Bacteria 6558529
1001 2511826834 2511231156 Bacteria 6845832
1002 2512324353 2512047018 Bacteria 6663241
1003 2583794459 2582580891 Bacteria 6800976
1004 2597860044 2597489887 Bacteria 6666321
1005 2599502809 2599185188 Bacteria 6164180
1006 2599614098 2599185212 Bacteria 6765997
1007 2599771357 2599185248 Bacteria 6696816
1008 2599888702 2599185289 Bacteria 6778765
1009 2599900711 2599185291 Bacteria 6775623
1010 2599930163 2599185300 Bacteria 6062622
1011 2599960955 2599185305 Bacteria 6748700
1012 2599966590 2599185306 Bacteria 6637356
1013 2599977845 2599185308 Bacteria 6621546
1014 2599996348 2599185311 Bacteria 6354990
1015 2600005751 2599185313 Bacteria 6658188
1016 2600011896 2599185314 Bacteria 6621749
1017 2600020605 2599185315 Bacteria 6771107
1018 2600024285 2599185316 Bacteria 6320029
1019 2600027908 2599185317 Bacteria 6435722
1020 2600033393 2599185318 Bacteria 6961590
1021 2600055204 2599185321 Bacteria 6764560
1022 2600060831 2599185322 Bacteria 6763055
1023 2600071129 2599185324 Bacteria 6590677
1024 2600078745 2599185325 Bacteria 6324919
1025 2600357075 2600254930 Bacteria 6431253
1026 2624490313 2623620446 Bacteria 6500345
1027 2643844137 2643221565 Bacteria 6216018
1028 2644188291 2643221633 Bacteria 6733554
1029 2644285846 2643221650 Bacteria 7029547
1030 2652543762 2651869719 Bacteria 6047974
1031 2671092994 2667528170 Bacteria 6786960
1032 2671125688 2667528176 Bacteria 6724917
1033 2678265208 2675903515 Bacteria 6580491
1034 2739200351 2738543004 Bacteria 6381073
1035 2739258223 2738543015 Bacteria 6750701
1036 2743739578 2740892503 Bacteria 6855563
1037 2745005665 2744054620 Bacteria 6551379
1038 2774122123 2773857670 Bacteria 6407454
1039 2784314368 2784132072 Bacteria 6596533
1040 2808853987 2808606361 Bacteria 6136259
1041 2808923280 2808606376 Bacteria 6248667
1042 2808930285 2808606377 Bacteria 6646337
1043 2808934019 2808606378 Bacteria 6177535
1044 2808945445 2808606380 Bacteria 6248705
1045 2808952407 2808606381 Bacteria 6646461
1046 2808959713 2808606382 Bacteria 6841132
1047 2808962580 2808606383 Bacteria 6138645
1048 2808997379 2808606389 Bacteria 6138126
1049 2825655899 2825651385 Bacteria 6715909
1050 2826584051 2826581358 Bacteria 5963467
1051 2842819529 2842815866 Bacteria 5947510
1052 2842849770 2842849001 Bacteria 5924277
1053 2842856300 2842854478 Bacteria 6143501
1054 2860344492 2860339153 Bacteria 6846989
1055 2904521571 2904518522 Bacteria 6068986
1056 2904550986 2904550169 Bacteria 6221258
1057 2913037808 2913036834 Bacteria 6704877
1058 2919459607 2919456309 Bacteria 6586567
1059 2919482686 2919481497 Bacteria 6907839
1060 2919703965 2919697872 Bacteria 6553725
1061 2923158664 2923153595 Bacteria 6870622
1062 2923590459 2923586266 Bacteria 6565975
1063 2929149132 2929144301 Bacteria 6622272
1064 2931373457 2931369376 Bacteria 6847892
1065 2931397261 2931396565 Bacteria 7251677
1066 2939638233 2939636861 Bacteria 6297853
1067 2969309347 2969304461 Bacteria 6601805
1068 2988732767 2988728565 Bacteria 6124362
1069 3007398294 3007395558 Bacteria 6755444
1070 3007420592 3007419365 Bacteria 7026924
1071 3007516376 3007511990 Bacteria 6481491
1072 3007622736 3007619802 Bacteria 6411688
1073 3007867521 3007866637 Bacteria 5899198
1074 8015692750 8015687852 Bacteria 6613826
1075 8019782248 8019775933 Bacteria 6858656
1076 8055775984 8055770955 Bacteria 6827675
1077 8056126964 8056125926 Bacteria 6228218
1078 8056144250 8056143049 Bacteria 6307666
1079 8056155634 8056155041 Bacteria 6486948
1080 8056180692 8056177738 Bacteria 6748268
1081 8056574448 8056569372 Bacteria 5997322
1082 8057804867 8057798959 Bacteria 6713499
1083 Ga0495656_0092382
1084 MRS2a_Contig_303
1085 MRS2a_Contig_63
1086 SwRhRL2b_contig_3024960
1087 rootH1_10209168
1088 Ga0055536_1000707
1089 Ga0055536_1002231
1090 Ga0055530_10000626
1091 Ga0055530_10004127
1092 Ga0055530_10005829
1093 Ga0055530_10008561
1094 Ga0055540_1000484
1095 Ga0055540_1003397
1096 Ga0055540_1005052
1097 Ga0055531_10001834
1098 Ga0065714_10000425
1099 Ga0065714_10002388
1100 Ga0065714_10009202
1101 Ga0065714_10009497
1102 Ga0065714_10023738
1103 Ga0065714_10068967
1104 Ga0065714_10072503
1105 Ga0065714_10116087
1106 Ga0065714_10154326
1107 Ga0065714_10516147
1108 Ga0065714_10540772
1109 Ga0065704_10072495
1110 Ga0065704_10524027
1111 Ga0065712_10000524
1112 Ga0065712_10067964
1113 Ga0065715_10517598
1114 Ga0070670_101025094
1115 Ga0070669_100008019
1116 Ga0070665_102093111
1117 Ga0075363_100109048
1118 Ga0075364_10056329
1119 Ga0075364_10101628
1120 Ga0075364_10172220
1121 Ga0075364_10597108
1122 Ga0075432_10001387
1123 Ga0075432_10003850
1124 Ga0075432_10014170
1125 Ga0075432_10029853
1126 Ga0075432_10035170
1127 Ga0075432_10103438
1128 Ga0075432_10134618
1129 Ga0075432_10191238
1130 Ga0075432_10227422
1131 Ga0075362_10008988
1132 Ga0075362_10328507
1133 Ga0075362_10432941
1134 Ga0075369_10031602
1135 Ga0075436_100010379
1136 Ga0075436_100410930
1137 Ga0099826_10019217
1138 Ga0105251_10000933
1139 Ga0105251_10002815
1140 Ga0105251_10019561
1141 Ga0105251_10137383
1142 Ga0105251_10149967
1143 Ga0105244_10006302
1144 Ga0105244_10011329
1145 Ga0105244_10012728
1146 Ga0105244_10015739
1147 Ga0105244_10017558
1148 Ga0105244_10018381
1149 Ga0105244_10058532
1150 Ga0105244_10100084
1151 Ga0105250_10002431
1152 Ga0105250_10014143
1153 Ga0105250_10032831
1154 Ga0105250_10164614
1155 Ga0105243_10006057
1156 Ga0105243_10075703
1157 Ga0105243_10086367
1158 Ga0105243_10105018
1159 Ga0105242_10193376
1160 Ga0105249_11785469
1161 Ga0105246_10001228
1162 Ga0105246_10009116
1163 Ga0157345_1008032
1164 Ga0157373_10006102
1165 Ga0157373_10008434
1166 Ga0157373_10158360
1167 Ga0157371_10006251
1168 Ga0157371_10428354
1169 Ga0157370_10007745
1170 Ga0157370_10013518
1171 Ga0157370_10051906
1172 Ga0157370_10070660
1173 Ga0157370_10399641
1174 Ga0157370_10418690
1175 Ga0157370_11335662
1176 Ga0157370_11975111
1177 Ga0163162_10007642
1178 Ga0163162_10010234
1179 Ga0163162_10717482
1180 Ga0163162_11255270
1181 Ga0157372_10222233
1182 Ga0157375_10106385
1183 Ga0157375_10875676
1184 Ga0157375_12569392
1185 Ga0182008_10007313
1186 Ga0182008_10010129
1187 Ga0182008_10012363
1188 Ga0182008_10018115
1189 Ga0182008_10029943
1190 Ga0182008_10042892
1191 Ga0182008_10487410
1192 Ga0182006_1002541
1193 Ga0182006_1006967
1194 Ga0182006_1014293
1195 Ga0182006_1029298
1196 Ga0182006_1029834
1197 Ga0182006_1030609
1198 Ga0182006_1047251
1199 Ga0182006_1110432
1200 Ga0182007_10001933
1201 Ga0182007_10018404
1202 Ga0182007_10088994
1203 Ga0182007_10153959
1204 Ga0182005_1001184
1205 Ga0182005_1011301
1206 Ga0182005_1015288
1207 Ga0182005_1015930
1208 Ga0182005_1018188
1209 Ga0182005_1041544
1210 Ga0182005_1042950
1211 Ga0163161_10004450
1212 Ga0163161_10011719
1213 Ga0163161_10013269
1214 Ga0163161_10021641
1215 Ga0163161_10061986
1216 Ga0163161_10076195
1217 Ga0163161_10472297
1218 Ga0209563_100384
1219 Ga0209675_1004486
1220 Ga0209676_1000006
1221 Ga0209676_1000010
1222 Ga0209676_1002175
1223 Ga0209676_1021021
1224 Ga0209050_1000019
1225 Ga0209050_1000027
1226 Ga0209050_1000065
1227 Ga0209050_1000560
1228 Ga0209051_1000102
1229 Ga0209051_1000504
1230 Ga0209051_1000800
1231 Ga0209051_1018015
1232 Ga0209257_1000119
1233 Ga0209257_1013653
1234 Ga0209257_1126206
1235 Ga0207696_1002258
1236 Ga0207696_1002426
1237 Ga0207696_1007512
1238 Ga0207696_1032913
1239 Ga0207655_1000005
1240 Ga0207655_1000015
1241 Ga0207655_1001102
1242 Ga0207655_1002625
1243 Ga0207655_1003264
1244 Ga0207655_1003556
1245 Ga0207655_1017549
1246 Ga0207655_1019623
1247 Ga0207655_1020439
1248 Ga0207655_1022170
1249 Ga0207655_1052889
1250 Ga0207655_1055076
1251 Ga0207655_1083785
1252 Ga0207655_1139318
1253 Ga0207713_1000604
1254 Ga0207713_1001944
1255 Ga0207713_1002068
1256 Ga0207713_1003039
1257 Ga0207713_1006203
1258 Ga0207713_1030601
1259 Ga0207713_1036998
1260 Ga0207713_1116562
1261 Ga0207681_10001097
1262 Ga0207686_10132310
1263 Ga0207709_10000224
1264 Ga0207709_10007744
1265 Ga0209281_1000015
1266 Ga0207428_10005994
1267 Ga0207428_10024832
1268 Ga0207428_10069052
1269 Ga0207428_10095357
1270 Ga0207428_10098513
1271 Ga0207428_10121466
1272 Ga0207428_10180379
1273 Ga0207428_10185543
1274 Ga0207428_10480464
1275 Ga0268266_11072794
1276 Ga0307517_10117151
1277 Ga0307511_10088683
1278 Ga0307511_10344825
1279 Ga0316177_1130498
1280 Ga0316181_1184042
1281 Ga0316182_1161176
1282 Ga0307408_100012772
1283 Ga0307408_100111561
1284 Ga0307405_10070302
1285 Ga0307405_11047345
1286 Ga0307406_10417920
1287 Ga0307407_10946384
1288 Ga0307412_10035190
1289 Ga0307412_10036528
1290 Ga0307416_100210264
1291 Ga0307414_10009074
1292 Ga0307414_11126309
1293 Ga0307411_10089973
1294 Ga0307510_10009889
1295 Ga0307510_10454825
1296 Ga0237819_00235
1297 Ga0439436_0080596
1298 Ga0439438_000458
1299 Ga0439438_001105
1300 Ga0439438_001822
1301 Ga0439438_001985
1302 Ga0439438_003641
1303 Ga0439438_005641
1304 Ga0439438_007686
1305 Ga0439438_009827
1306 Ga0439438_026619
1307 Ga0439438_034888
1308 Ga0439438_102742
1309 Ga0439447_001586
1310 Ga0439447_002464
1311 Ga0439447_003589
1312 Ga0439447_003775
1313 Ga0439447_007135
1314 Ga0439447_010612
1315 Ga0439447_011093
1316 Ga0439447_019163
1317 Ga0439447_025930
1318 Ga0439447_028158
1319 Ga0439447_029299
1320 Ga0439447_041794
1321 Ga0439447_052182
1322 Ga0439447_074711
1323 Ga0439461_0052174
1324 Ga0439466_0000449
1325 Ga0439466_0000907
1326 Ga0439466_0000971
1327 Ga0439466_0001301
1328 Ga0439466_0004087
1329 Ga0439466_0013878
1330 Ga0439466_0014525
1331 Ga0439466_0020206
1332 Ga0439466_0027191
1333 Ga0439466_0040754
1334 Ga0439466_0056582
1335 Ga0439466_0091755
1336 Ga0439466_0101711
1337 Ga0439465_0036220
1338 Ga0439465_0079079
1339 Ga0439465_0126008
1340 Ga0439431_0000561
1341 Ga0439445_0005783
1342 Ga0439448_0071571
1343 Ga0439432_006676
1344 Ga0439432_008963
1345 Ga0439432_015150
1346 Ga0439432_015163
1347 Ga0439432_016007
1348 Ga0439432_019189
1349 Ga0439432_191990
1350 Ga0439451_005258
1351 Ga0439451_007496
1352 Ga0439451_008367
1353 Ga0439451_011210
1354 Ga0439451_013958
1355 Ga0439451_020379
1356 Ga0439451_072131
1357 Ga0439451_091956
1358 Ga0439452_000425
1359 Ga0439452_000450
1360 Ga0439452_002394
1361 Ga0439452_004462
1362 Ga0439452_004827
1363 Ga0439452_007948
1364 Ga0439452_017782
1365 Ga0439452_030300
1366 Ga0439456_006901
1367 Ga0439456_010571
1368 Ga0439456_011577
1369 Ga0439456_012407
1370 Ga0439456_012446
1371 Ga0439456_022838
1372 Ga0439456_026646
1373 Ga0439456_035796
1374 Ga0439456_059345
1375 Ga0439456_065406
1376 Ga0439456_149732
1377 Ga0439463_001422
1378 Ga0439463_014229
1379 Ga0439463_016759
1380 Ga0439463_021207
1381 Ga0439463_023726
1382 Ga0439463_024652
1383 Ga0439463_047410
1384 Ga0439463_068403
1385 Ga0450911_003180
1386 Ga0450911_004302
1387 Ga0450911_006067
1388 Ga0450911_013095
1389 Ga0450919_001490
1390 Ga0450920_003528
1391 Ga0450922_000214
1392 Ga0450922_002068
1393 Ga0450922_002573
1394 Ga0450923_003544
1395 Ga0450923_040313
1396 Ga0450890_000379
1397 Ga0450892_002198
1398 Ga0450902_000988
1399 Ga0450902_003548
1400 Ga0450902_004464
1401 Ga0450902_017383
1402 Ga0450902_036703
1403 Ga0450902_039547
1404 Ga0450903_000730
1405 Ga0450903_000921
1406 Ga0450903_010413
1407 Ga0450903_011204
1408 Ga0450903_013217
1409 Ga0450903_038115
1410 Ga0450904_008898
1411 Ga0450904_026878
1412 Ga0450905_005316
1413 Ga0450889_003519
1414 Ga0450906_003503
1415 Ga0450906_010553
1416 Ga0450906_025420
1417 Ga0450906_035819
1418 Ga0450907_000153
1419 Ga0450907_002327
1420 Ga0450907_007049
1421 Ga0450907_032870
1422 Ga0450910_000417
1423 Ga0450910_000673
1424 Ga0450910_003292
1425 Ga0450910_013086
1426 Ga0439446_0156179
1427 Ga0450908_001121
1428 Ga0450908_013702
1429 Ga0450908_027630
1430 Ga0450909_000558
1431 Ga0450909_003241
1432 Ga0450909_013996
1433 Ga0439434_0001096
1434 Ga0439434_0372949
1435 Ga0439460_0000125
1436 Ga0439460_0002258
1437 Ga0439460_0016544
1438 Ga0439460_0019019
1439 Ga0450918_004915
1440 Ga0450918_009433
1441 Ga0450893_0009040
1442 Ga0450893_0049292
1443 Ga0439440_0000511
1444 Ga0439440_0001054
1445 Ga0439440_0005229
1446 Ga0439440_0073112
1447 Ga0495617_000724
1448 Ga0495617_001081
1449 Ga0495617_002113
1450 Ga0495617_005624
1451 Ga0495617_005959
1452 Ga0495617_009141
1453 Ga0495617_010383
1454 Ga0495617_018536
1455 Ga0495617_054809
1456 Ga0495617_061971
1457 Ga0495627_002113
1458 Ga0495627_003934
1459 Ga0495627_012594
1460 Ga0495627_014962
1461 Ga0495603_0008313
1462 Ga0495603_0023331
1463 Ga0495603_0522978
1464 Ga0495603_0708235
1465 Ga0495590_0000664
1466 Ga0495590_0001952
1467 Ga0495590_0007655
1468 Ga0495590_0022165
1469 Ga0495590_0046900
1470 Ga0495590_0055249
1471 Ga0495590_0289620
1472 Ga0495591_001774
1473 Ga0495591_002124
1474 Ga0495591_005352
1475 Ga0495591_009372
1476 Ga0495591_013853
1477 Ga0495591_022822
1478 Ga0495591_026377
1479 Ga0495591_044690
1480 Ga0495591_068213
1481 Ga0495591_170562
1482 Ga0495638_0000675
1483 Ga0495638_0003108
1484 Ga0495638_0004385
1485 Ga0495638_0008486
1486 Ga0495638_0019265
1487 Ga0495638_0022180
1488 Ga0495638_0030335
1489 Ga0495638_0030573
1490 Ga0495638_0041071
1491 Ga0495638_0051386
1492 Ga0495638_0068853
1493 Ga0495638_0114918
1494 Ga0495638_0118200
1495 Ga0495638_0260486
1496 Ga0495638_0298629
1497 Ga0495653_0031034
1498 Ga0495650_0009261
1499 Ga0495650_0012679
1500 Ga0495650_0012690
1501 Ga0495650_0018020
1502 Ga0495650_0021842
1503 Ga0495650_0034867
1504 Ga0495650_0039601
1505 Ga0495650_0041047
1506 Ga0495605_0000353
1507 Ga0495605_0018259
1508 Ga0495605_0019089
1509 Ga0495605_0029161
1510 Ga0495605_0029701
1511 Ga0495605_0036456
1512 Ga0495605_0049965
1513 Ga0495605_0054802
1514 Ga0495605_0095597
1515 Ga0495639_0000338
1516 Ga0495639_0027448
1517 Ga0495584_0000726
1518 Ga0495584_0001156
1519 Ga0495584_0002464
1520 Ga0495584_0004354
1521 Ga0495584_0005797
1522 Ga0495584_0007707
1523 Ga0495584_0011657
1524 Ga0495584_0012986
1525 Ga0495584_0017434
1526 Ga0495584_0020571
1527 Ga0495584_0029975
1528 Ga0495584_0038955
1529 Ga0495585_0002507
1530 Ga0495585_0010109
1531 Ga0495585_0015869
1532 Ga0495585_0025748
1533 Ga0495585_0028726
1534 Ga0495585_0029790
1535 Ga0495585_0043036
1536 Ga0495585_0055264
1537 Ga0495585_0094072
1538 Ga0495585_0118873
1539 Ga0495585_0215726
1540 Ga0495585_0243669
1541 Ga0495585_0435708
1542 Ga0495594_0004302
1543 Ga0495594_0010838
1544 Ga0495594_0030502
1545 Ga0495596_0004590
1546 Ga0495596_0010701
1547 Ga0495607_0001439
1548 Ga0495607_0002741
1549 Ga0495607_0007786
1550 Ga0495607_0011464
1551 Ga0495607_0012872
1552 Ga0495607_0015443
1553 Ga0495607_0015890
1554 Ga0495607_0020017
1555 Ga0495607_0034336
1556 Ga0495607_0037772
1557 Ga0495607_0047068
1558 Ga0495607_0047237
1559 Ga0495607_0050612
1560 Ga0495607_0069152
1561 Ga0495607_0072061
1562 Ga0495607_0217510
1563 Ga0495607_0323657
1564 Ga0495607_0403920
1565 Ga0495583_0003432
1566 Ga0495583_0018739
1567 Ga0495583_0029403
1568 Ga0495583_0038821
1569 Ga0495583_0040330
1570 Ga0495583_0156743
1571 Ga0495583_0196987
1572 Ga0495583_0400100
1573 Ga0495606_0003734
1574 Ga0495606_0004433
1575 Ga0495606_0080290
1576 Ga0495606_0215695
1577 Ga0495606_0302294
1578 Ga0495610_0002132
1579 Ga0495610_0008268
1580 Ga0495610_0013992
1581 Ga0495610_0018154
1582 Ga0495610_0022281
1583 Ga0495610_0029274
1584 Ga0495610_0045193
1585 Ga0495610_0053014
1586 Ga0495610_0065661
1587 Ga0495610_0074758
1588 Ga0495616_0001333
1589 Ga0495616_0005088
1590 Ga0495616_0010916
1591 Ga0495616_0013091
1592 Ga0495616_0013281
1593 Ga0495616_0014716
1594 Ga0495616_0032548
1595 Ga0495616_0034364
1596 Ga0495616_0055738
1597 Ga0495616_0080349
1598 Ga0495616_0113062
1599 Ga0495616_0131063
1600 Ga0495616_0132843
1601 Ga0495616_0139438
1602 Ga0495616_0264394
1603 Ga0495620_0002523
1604 Ga0495620_0008973
1605 Ga0495620_0011736
1606 Ga0495620_0016239
1607 Ga0495620_0027622
1608 Ga0495620_0030340
1609 Ga0495620_0051056
1610 Ga0495628_0207807
1611 Ga0495630_0025909
1612 Ga0495630_0113205
1613 Ga0495631_0001079
1614 Ga0495631_0013760
1615 Ga0495631_0034439
1616 Ga0495631_0047940
1617 Ga0495631_0104681
1618 Ga0495631_0118510
1619 Ga0495632_0002027
1620 Ga0495632_0002163
1621 Ga0495632_0007242
1622 Ga0495632_0013786
1623 Ga0495632_0028229
1624 Ga0495632_0032257
1625 Ga0495632_0034845
1626 Ga0495632_0038971
1627 Ga0495632_0086708
1628 Ga0495632_0128265
1629 Ga0495632_0132455
1630 Ga0495632_0139911
1631 Ga0495632_0472377
1632 Ga0495637_0001125
1633 Ga0495637_0001320
1634 Ga0495637_0002591
1635 Ga0495637_0002950
1636 Ga0495637_0004612
1637 Ga0495637_0007686
1638 Ga0495637_0009669
1639 Ga0495637_0011363
1640 Ga0495637_0012886
1641 Ga0495637_0039957
1642 Ga0495637_0048975
1643 Ga0495637_0050492
1644 Ga0495637_0055046
1645 Ga0495637_0094737
1646 Ga0495637_0206186
1647 Ga0495643_0024717
1648 Ga0495643_0025659
1649 Ga0495643_0037694
1650 Ga0495643_0043312
1651 Ga0495643_0047259
1652 Ga0495643_0052477
1653 Ga0495643_0087530
1654 Ga0495643_0138571
1655 Ga0495643_0253329
1656 Ga0495643_0290531
1657 Ga0495644_0002956
1658 Ga0495644_0004115
1659 Ga0495644_0004612
1660 Ga0495644_0091919
1661 Ga0495644_0185511
1662 Ga0495644_0206808
1663 Ga0495648_0003822
1664 Ga0495648_0010556
1665 Ga0495648_0018696
1666 Ga0495648_0019644
1667 Ga0495648_0020044
1668 Ga0495648_0032546
1669 Ga0495648_0036954
1670 Ga0495648_0041251
1671 Ga0495648_0042558
1672 Ga0495648_0047178
1673 Ga0495648_0055385
1674 Ga0495648_0075516
1675 Ga0495648_0098098
1676 Ga0495648_0134149
1677 Ga0495648_0165665
1678 Ga0495648_0213244
1679 Ga0495648_0321805
1680 Ga0495666_0007568
1681 Ga0495666_0014599
1682 Ga0495666_0018440
1683 Ga0495666_0043929
1684 Ga0495666_0058631
1685 Ga0495642_0000194
1686 Ga0495642_0002058
1687 Ga0495642_0005920
1688 Ga0495654_0003039
1689 Ga0495654_0004633
1690 Ga0495654_0005151
1691 Ga0495654_0013202
1692 Ga0495654_0016257
1693 Ga0495654_0016356
1694 Ga0495654_0019823
1695 Ga0495654_0028949
1696 Ga0495654_0032869
1697 Ga0495654_0034511
1698 Ga0495654_0035117
1699 Ga0495654_0042619
1700 Ga0495654_0043745
1701 Ga0495654_0057435
1702 Ga0495654_0066241
1703 Ga0495654_0068326
1704 Ga0495654_0080643
1705 Ga0495654_0095161
1706 Ga0495654_0108112
1707 Ga0495654_0169812
1708 Ga0495587_0017806
1709 Ga0495609_0001443
1710 Ga0495609_0002477
1711 Ga0495609_0006410
1712 Ga0495609_0007833
1713 Ga0495609_0017388
1714 Ga0495609_0023339
1715 Ga0495609_0026648
1716 Ga0495609_0050070
1717 Ga0495597_0002877
1718 Ga0495597_0033767
1719 Ga0495597_0038114
1720 Ga0495597_0045016
1721 Ga0495597_0063404
1722 Ga0495597_0066232
1723 Ga0495597_0100588
1724 Ga0495597_0101605
1725 Ga0495597_0101758
1726 Ga0495597_0106023
1727 Ga0495597_0377985
1728 Ga0495622_0000881
1729 Ga0495622_0000886
1730 Ga0495622_0009258
1731 Ga0495622_0012465
1732 Ga0495622_0017327
1733 Ga0495622_0024315
1734 Ga0495622_0239057
1735 Ga0495622_0347452
1736 Ga0495633_0004434
1737 Ga0495633_0012019
1738 Ga0495633_0053141
1739 Ga0495633_0058201
1740 Ga0495633_0061059
1741 Ga0495633_0111835
1742 Ga0495633_0332935
1743 Ga0495656_0001745
1744 Ga0495656_0065979
1745 Ga0495656_0129419
1746 Ga0495668_0009763
1747 Ga0495668_0010985
1748 Ga0495668_0103848
1749 Ga0495668_0170013
1750 Ga0495668_0220851
1751 Ga0495634_0013161
1752 Ga0495611_0000552
1753 Ga0495611_0018239
1754 Ga0495611_0018849
1755 Ga0495611_0021690
1756 Ga0495611_0050499
1757 Ga0495611_0457433
1758 Ga0495625_0005100
1759 Ga0495625_0005658
1760 Ga0495625_0021767
1761 Ga0495625_0026415
1762 Ga0495625_0034884
1763 Ga0495625_0119926
1764 Ga0495625_0187608
1765 Ga0495625_0196027
1766 Ga0495625_0216865
1767 Ga0495625_0281177
1768 Ga0495625_0328256
1769 Ga0495625_0458230
1770 Ga0495625_0553012
1771 Ga0495625_0643622
1772 Ga0495635_0024515
1773 Ga0495659_0002195
1774 Ga0495659_0009040
1775 Ga0495659_0045969
1776 Ga0495659_0047655
1777 Ga0495659_0066190
1778 Ga0495661_0021821
1779 Ga0495661_0032366
1780 Ga0495661_0043799
1781 Ga0495661_0051273
1782 Ga0495661_0057856
1783 Ga0495661_0064299
1784 Ga0495661_0073725
1785 Ga0495661_0078726
1786 Ga0495661_0081106
1787 Ga0495661_0133764
1788 Ga0495661_0193882
1789 Ga0495661_0249785
1790 Ga0495661_0418377
1791 Ga0495661_0628533
1792 Ga0495588_0018387
1793 Ga0495588_0025831
1794 Ga0495588_0118027
1795 Ga0495657_0368500
1796 Ga0495623_0008028
1797 Ga0495623_0013999
1798 Ga0495646_0011163
1799 Ga0495646_0108855
1800 Ga0495669_0015646
1801 Ga0495669_0180378
1802 Ga0495613_0116239
1803 Ga0495670_0001941
1804 Ga0495670_0004255
1805 Ga0495670_0004830
1806 Ga0495670_0006899
1807 Ga0495670_0016945
1808 Ga0495670_0024202
1809 Ga0495670_0030970
1810 Ga0495670_0040860
1811 Ga0495670_0109323
1812 Ga0495670_0124175
1813 Ga0495670_0196867
1814 Ga0495671_0001748
1815 Ga0495671_0012398
1816 Ga0495671_0020510
1817 Ga0495671_0039860
1818 Ga0495671_0042849
1819 Ga0495671_0053361
1820 Ga0495671_0082704
1821 Ga0495671_0086822
1822 Ga0495671_0095014
1823 Ga0495671_0095391
1824 Ga0495671_0143045
1825 Ga0495671_0148422
1826 Ga0495671_0541690
1827 Ga0495649_0000624
1828 Ga0495649_0003989
1829 Ga0495649_0009449
1830 Ga0495649_0015911
1831 Ga0495649_0028634
1832 Ga0495649_0045315
1833 Ga0495649_0051540
1834 Ga0495649_0092065
1835 Ga0495649_0092818
1836 Ga0495649_0111812
1837 Ga0495649_0131123
1838 Ga0495649_0215284
1839 Ga0495649_0477423
1840 Ga0495649_0556680
1841 Ga0495589_0000179
1842 Ga0495589_0003706
1843 Ga0495589_0008366
1844 Ga0495589_0010280
1845 Ga0495589_0021806
1846 Ga0495589_0045684
1847 Ga0495589_0061305
1848 Ga0495589_0078265
1849 Ga0495589_0149311
1850 Ga0495589_0358299
1851 Ga0495600_0052953
1852 Ga0495660_0008576
1853 Ga0495660_0008627
1854 Ga0495660_0011667
1855 Ga0495660_0012498
1856 Ga0495660_0014397
1857 Ga0495660_0028401
1858 Ga0495660_0047486
1859 Ga0495660_0057714
1860 Ga0495660_0059987
1861 Ga0495660_0072558
1862 Ga0495660_0083832
1863 Ga0495660_0094151
1864 Ga0495660_0118750
1865 Ga0495660_0118766
1866 Ga0495660_0120323
1867 Ga0495660_0144608
1868 Ga0495660_0174205
1869 Ga0495581_0018822
1870 Ga0495604_0023158
1871 Ga0495604_0110925
1872 Ga0495636_0643894
1873 Ga0495674_0051563
1874 Ga0495672_0002638
1875 Ga0495672_0003679
1876 Ga0495672_0009355
1877 Ga0495672_0011410
1878 Ga0495672_0020821
1879 Ga0495672_0026753
1880 Ga0495672_0034737
1881 Ga0495672_0035253
1882 Ga0495672_0035687
1883 Ga0495672_0041085
1884 Ga0495672_0051165
1885 Ga0495672_0051955
1886 Ga0495672_0080805
1887 Ga0495672_0085343
1888 Ga0495672_0105646
1889 Ga0495672_0439239
1890 Ga0495680_0031628
1891 Ga0495680_0065453
1892 Ga0495680_0147772
1893 Ga0495680_0276112
1894 Ga0495683_0001305
1895 Ga0495683_0012545
1896 Ga0495683_0012723
1897 Ga0495683_0014353
1898 Ga0495683_0023987
1899 Ga0495683_0031913
1900 Ga0495683_0036771
1901 Ga0495683_0037852
1902 Ga0495683_0040482
1903 Ga0495683_0040623
1904 Ga0495683_0041211
1905 Ga0495683_0082731
1906 Ga0495683_0098112
1907 Ga0495687_001795
1908 Ga0495687_001904
1909 Ga0495687_007827
1910 Ga0495687_012255
1911 Ga0495687_070304
1912 Ga0495675_0160741
1913 Ga0495677_0005485
1914 Ga0495677_0295802
1915 Ga0495679_013219
1916 Ga0495679_016431
1917 Ga0495679_022051
1918 Ga0495685_116856
1919 Ga0495673_0001119
1920 Ga0495673_0002216
1921 Ga0495673_0003127
1922 Ga0495673_0003780
1923 Ga0495673_0005243
1924 Ga0495673_0009263
1925 Ga0495673_0015211
1926 Ga0495673_0016463
1927 Ga0495673_0019682
1928 Ga0495673_0022011
1929 Ga0495673_0026486
1930 Ga0495673_0030610
1931 Ga0495673_0036686
1932 Ga0495673_0076669
1933 Ga0495673_0161287
1934 Ga0495673_0209148
1935 Ga0495681_0000894
1936 Ga0495681_0002117
1937 Ga0495681_0003240
1938 Ga0495681_0003535
1939 Ga0495681_0004183
1940 Ga0495681_0005394
1941 Ga0495681_0007949
1942 Ga0495681_0009632
1943 Ga0495681_0011180
1944 Ga0495681_0015723
1945 Ga0495681_0016894
1946 Ga0495681_0024210
1947 Ga0495681_0130621
1948 Ga0495684_0070134
1949 Ga0495686_0008517
1950 Ga0495686_0037597
1951 Ga0495686_0043947
1952 Ga0495686_0053595
1953 Ga0495686_0127427
1954 Ga0495686_0180421
1955 Ga0495686_0735782
1956 Ga0495593_0004837
1957 Ga0495593_0018133
1958 Ga0495593_0037129
1959 Ga0495593_0050868
1960 Ga0495593_0083058
1961 Ga0495593_0243424
1962 Ga0495593_0323490
1963 Ga0495614_0106417
1964 Ga0495614_0317800
1965 Ga0495626_0000983
1966 Ga0495626_0001235
1967 Ga0495626_0001815
1968 Ga0495626_0003151
1969 Ga0495626_0004148
1970 Ga0495626_0005033
1971 Ga0495626_0014966
1972 Ga0495626_0050804
1973 Ga0495626_0086929
1974 Ga0495626_0159215
1975 Ga0495626_0184380
1976 Ga0495626_0193844
1977 Ga0495626_0213853
1978 Ga0496102_0003520
1979 Ga0496102_0332504
1980 Ga0496102_0812361
1981 Ga0496103_0067125
1982 Ga0496103_0589824
1983 Ga0496104_1822267
1984 Ga0496105_0216672
1985 Ga0496106_0355714
1986 Ga0496110_0070779
1987 Ga0496110_0249530
1988 Ga0496110_1300313
1989 Ga0496111_0328254
1990 Ga0496111_0864316
1991 Ga0496113_0323489
1992 Ga0496114_0758562
1993 Ga0496116_0002114
1994 Ga0496116_0024314
1995 Ga0496116_0030939
1996 Ga0496116_0182443
1997 Ga0496117_0012224
1998 Ga0496117_0035963
1999 Ga0496117_0059011
2000 Ga0496117_0245486
2001 Ga0496118_0016753
2002 Ga0496118_0026103
2003 Ga0496118_0027448
2004 Ga0496118_0040175
2005 Ga0496121_0043999
2006 Ga0496121_0270272
2007 Ga0496121_0329570
2008 Ga0496121_0566653
2009 Ga0496122_0008052
2010 Ga0496122_0081927
2011 Ga0496123_0032511
2012 Ga0496124_0006359
2013 Ga0496124_0041439
2014 Ga0496124_0131531
2015 Ga0496124_0139997
2016 Ga0496124_0176879
2017 Ga0496124_0198623
2018 Ga0496124_0362692
2019 Ga0496125_0037301
2020 Ga0496125_0073666
2021 Ga0496125_0093999
2022 Ga0496125_0698873
2023 Ga0496126_0171275
2024 Ga0496126_0666105
2025 Ga0495678_001895
2026 Ga0495678_010895
2027 Ga0495678_012438
2028 Ga0495678_012896
2029 Ga0495678_020263
2030 Ga0495678_021070
2031 Ga0495678_021732
2032 Ga0495678_022585
2033 Ga0495678_054369
2034 Ga0495678_065565
2035 Ga0495678_068712
2036 Ga0495678_102481
2037 Ga0495678_219930
2038 Ga0495678_219943
2039 Ga0495678_266710
2040 Ga0495682_0007042
2041 Ga0495682_0007072
2042 Ga0495682_0008752
2043 Ga0495682_0018254
2044 Ga0495682_0047060
2045 Ga0495682_0069596
2046 Ga0495682_0085743
2047 Ga0495682_0090591
2048 Ga0495682_0118604
2049 Ga0495682_0252049
2050 Ga0495682_0286531
2051 Ga0495682_0330517
2052 Ga0501269_012096
2053 Ga0501226_002292
2054 nmdc:mga03683_249101_c1
2055 nmdc:mga03683_278130_c1
2056 nmdc:mga03n38_356531_c1
2057 nmdc:mga00v17_113950_c1
2058 nmdc:mga00v17_132980_c1
2059 nmdc:mga00v17_156632_c1
2060 nmdc:mga00v17_51637_c1
2061 nmdc:mga08x19_122368_c1
2062 nmdc:mga08x19_178486_c1
2063 nmdc:mga08x19_518800_c1
2064 nmdc:mga0sz30_2376_c1
2065 nmdc:mga0sz30_521086_c1
2066 Ga0500647_0285291
2067 Ga0500572_002635
2068 Ga0500568_0164643
2069 2511257365
2070 2511263716
2071 2511274436
2072 2511275934
2073 2511299263
2074 2511313952
2075 2511321456
2076 2511329091
2077 2511334468
2078 2511342614
2079 2511348497
2080 2511355604
2081 2511363177
2082 2511414908
2083 2511826834
2084 2512324353
2085 2583794459
2086 2597860044
2087 2599502809
2088 2599614098
2089 2599771357
2090 2599888702
2091 2599900711
2092 2599930163
2093 2599960955
2094 2599966590
2095 2599977845
2096 2599996348
2097 2600005751
2098 2600011896
2099 2600020605
2100 2600024285
2101 2600027908
2102 2600033393
2103 2600055204
2104 2600060831
2105 2600071129
2106 2600078745
2107 2600357075
2108 2624490313
2109 2643844137
2110 2644188291
2111 2644285846
2112 2652543762
2113 2671092994
2114 2671125688
2115 2678265208
2116 2739200351
2117 2739258223
2118 2743739578
2119 2745005665
2120 2774122123
2121 2784314368
2122 2808853987
2123 2808923280
2124 2808930285
2125 2808934019
2126 2808945445
2127 2808952407
2128 2808959713
2129 2808962580
2130 2808997379
2131 2825655899
2132 2826584051
2133 2842819529
2134 2842849770
2135 2842856300
2136 2860344492
2137 2904521571
2138 2904550986
2139 2913037808
2140 2919459607
2141 2919482686
2142 2919703965
2143 2923158664
2144 2923590459
2145 2929149132
2146 2931373457
2147 2931397261
2148 2939638233
2149 2969309347
2150 2988732767
2151 3007398294
2152 3007420592
2153 3007516376
2154 3007622736
2155 3007867521
2156 8015692750
2157 8019782248
2158 8055775984
2159 8056126964
2160 8056144250
2161 8056155634
2162 8056180692
2163 8056574448
2164 8057804867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fhp-assembly2.cif.gz_B daip in complex with a c-terminal fragment of thermolysin 0.732 60 96
5ta7-assembly2.cif.gz_B crystal structure of bugh117bwt 0.701 48 96
2y5d-assembly1.cif.gz_A crystal structure of c296a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 0.6977 44 69
2y52-assembly1.cif.gz_A crystal structure of e496a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 0.6951 44 69
2vro-assembly1.cif.gz_A crystal structure of aldehyde dehydrogenase from burkholderia xenovorans lb400 0.6925 44 69
ID Description Score Start End Superfamily
af_F1Q6L2_34_478_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8488 45 88 2.130.10.10
af_F1QPQ6_56_508_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7997 43 88 2.130.10.10
af_Q4CNM8_63_471_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.7191 43 95 2.120.10.10
af_P9WLW7_1_144_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.6986 46 97 2.115.10.20
af_Q9C627_65_218_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6944 45 102 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A7G2JHU8-F1-model_v4 deleted 0.9475 15 82
AF-A0A1Q8SUU4-F1-model_v4 Uncharacterized protein 0.9355 13 96
AF-A0A423FUE6-F1-model_v4 deleted 0.9205 14 103
AF-A0A0Q5E9C4-F1-model_v4 Secreted protein 0.9152 14 103
AF-A0A0A8RI64-F1-model_v4 deleted 0.9125 10 82

Map