F489708

General Info

Members Datasets Scaffolds Average Seq Length
1083 482 2166 71

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_101564676|Ga0070668_1015646762
Length 76
Sequence MTRDRNLRAGGPGRAAAMKDGQFKTWQLMILHALAAATFIFLLQRYGLNASLDSALLWALTFGGCAAGLAYSQSKR

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
123 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
124 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
125 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
126 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
127 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
128 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
243 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
244 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
245 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
246 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
247 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
255 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
262 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
272 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
273 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
274 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
275 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
276 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
277 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
278 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
279 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
280 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
281 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
282 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
283 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
284 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
285 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
286 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
287 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
293 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
303 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
304 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
305 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
306 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
309 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
310 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
318 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
319 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
320 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
327 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
328 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
329 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
330 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
331 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
332 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
335 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
336 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
337 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
338 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
339 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
340 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
341 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
346 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
347 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
350 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
351 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
352 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
353 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
354 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
355 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
359 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
360 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
361 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
362 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
363 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
364 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
365 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
366 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
367 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
368 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
369 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
370 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
377 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
378 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
379 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
380 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
381 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
382 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
383 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
384 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
385 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
386 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
387 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
388 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
389 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
390 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
391 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
392 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
393 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
394 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
395 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
396 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
397 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
398 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
399 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
411 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
412 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
413 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
414 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
415 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
416 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
417 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
418 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
419 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
420 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
421 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
422 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
423 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
424 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
425 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
426 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
427 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
428 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
429 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
430 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
431 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
432 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
433 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
434 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
435 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
436 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
437 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
438 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
439 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
440 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
441 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
442 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
443 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
444 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
445 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
446 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
447 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
448 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
449 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
450 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
451 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
452 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
453 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
454 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
455 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
456 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
457 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
458 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
459 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
460 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
461 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
462 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
463 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
464 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
465 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
466 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
467 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
468 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
469 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
470 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
471 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
472 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
473 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
474 2791355199
475 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
476 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
477 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
478 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
479 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
480 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
481 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
482 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.49
Nodule 0.55
Rhizoplane 4.89
Rhizosphere 81.63
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_101564676 3300005347 Bacteria 603
2 LJQas_1003452 3300000549 Bacteria 2114
3 JGI24737J22298_10172485 3300001990 Bacteria 638
4 JGI24742J22300_10009356 3300002244 Bacteria 1617
5 JGI25406J46586_10007934 3300003203 Bacteria 4829
6 JGI25406J46586_10010769 3300003203 Bacteria 4038
7 JGI25406J46586_10139833 3300003203 Bacteria 708
8 JGI25404J52841_10006374 3300003659 Bacteria 2466
9 JGI25404J52841_10021421 3300003659 Bacteria 1400
10 JGI25404J52841_10033319 3300003659 Bacteria 1098
11 JGI25404J52841_10110964 3300003659 Bacteria 577
12 JGI25405J52794_10035592 3300003911 Bacteria 1043
13 JGI25405J52794_10143965 3300003911 Bacteria 542
14 Ga0070658_10086028 3300005327 Bacteria 2586
15 Ga0070676_11042553 3300005328 Bacteria 616
16 Ga0070676_11245726 3300005328 Bacteria 567
17 Ga0070690_100098584 3300005330 Bacteria 1934
18 Ga0070690_100357644 3300005330 Bacteria 1061
19 Ga0070670_100370546 3300005331 Bacteria 1260
20 Ga0070670_100996817 3300005331 Bacteria 762
21 Ga0068869_100098437 3300005334 Bacteria 2209
22 Ga0068869_100619970 3300005334 Bacteria 915
23 Ga0068869_100709341 3300005334 Bacteria 858
24 Ga0070666_10213199 3300005335 Bacteria 1360
25 Ga0070666_10352201 3300005335 Bacteria 1054
26 Ga0070680_100231609 3300005336 Bacteria 1560
27 Ga0070680_101264331 3300005336 Bacteria 639
28 Ga0070680_101881256 3300005336 Bacteria 519
29 Ga0070682_100192533 3300005337 Bacteria 1433
30 Ga0070682_101466476 3300005337 Bacteria 586
31 Ga0070682_101530416 3300005337 Bacteria 574
32 Ga0070682_101662526 3300005337 Bacteria 554
33 Ga0068868_100446177 3300005338 Bacteria 1124
34 Ga0068868_100565487 3300005338 Bacteria 1004
35 Ga0068868_100906121 3300005338 Bacteria 802
36 Ga0068868_101575682 3300005338 Bacteria 617
37 Ga0068868_102250364 3300005338 Bacteria 520
38 Ga0070660_100005300 3300005339 Bacteria 8924
39 Ga0070660_100596235 3300005339 Bacteria 923
40 Ga0070660_101335937 3300005339 Bacteria 608
41 Ga0070689_100478422 3300005340 Bacteria 1063
42 Ga0070689_101318034 3300005340 Bacteria 651
43 Ga0070689_101879426 3300005340 Bacteria 547
44 Ga0070691_10838806 3300005341 Bacteria 562
45 Ga0070691_10848442 3300005341 Bacteria 560
46 Ga0070691_11037406 3300005341 Bacteria 513
47 Ga0070687_100281157 3300005343 Bacteria 1047
48 Ga0070661_100208363 3300005344 Bacteria 1496
49 Ga0070661_100306338 3300005344 Bacteria 1238
50 Ga0070661_100378343 3300005344 Bacteria 1116
51 Ga0070661_101673837 3300005344 Bacteria 539
52 Ga0070692_10463535 3300005345 Bacteria 814
53 Ga0070668_100341284 3300005347 Bacteria 1265
54 Ga0070668_100366176 3300005347 Bacteria 1223
55 Ga0070668_100410737 3300005347 Bacteria 1157
56 Ga0070668_100501849 3300005347 Bacteria 1050
57 Ga0070668_100763837 3300005347 Bacteria 856
58 Ga0070668_101068459 3300005347 Bacteria 727
59 Ga0070668_101728961 3300005347 Bacteria 574
60 Ga0070668_102235732 3300005347 Bacteria 505
61 Ga0070669_100656712 3300005353 Bacteria 882
62 Ga0070669_100972149 3300005353 Bacteria 727
63 Ga0070669_101135878 3300005353 Bacteria 673
64 Ga0070675_100786142 3300005354 Bacteria 869
65 Ga0070675_100789674 3300005354 Bacteria 867
66 Ga0070671_100108695 3300005355 Bacteria 2328
67 Ga0070671_100143884 3300005355 Bacteria 2013
68 Ga0070671_100153076 3300005355 Bacteria 1948
69 Ga0070671_100617238 3300005355 Bacteria 937
70 Ga0070674_100035769 3300005356 Bacteria 3328
71 Ga0070674_100203483 3300005356 Bacteria 1530
72 Ga0070674_101977399 3300005356 Bacteria 530
73 Ga0070673_100523673 3300005364 Bacteria 1075
74 Ga0070673_100947968 3300005364 Bacteria 800
75 Ga0070688_100347130 3300005365 Bacteria 1085
76 Ga0070659_100247627 3300005366 Bacteria 1476
77 Ga0070659_101490132 3300005366 Bacteria 603
78 Ga0070667_100330264 3300005367 Bacteria 1377
79 Ga0070667_100649901 3300005367 Bacteria 974
80 Ga0070667_101064580 3300005367 Bacteria 755
81 Ga0070667_101136131 3300005367 Bacteria 730
82 Ga0070667_101381054 3300005367 Bacteria 660
83 Ga0070709_10175270 3300005434 Bacteria 1502
84 Ga0070709_11656940 3300005434 Bacteria 522
85 Ga0070714_100049796 3300005435 Bacteria 3567
86 Ga0070713_100027003 3300005436 Bacteria 4515
87 Ga0070713_100249794 3300005436 Bacteria 1618
88 Ga0070713_102317271 3300005436 Bacteria 520
89 Ga0070710_10529773 3300005437 Bacteria 811
90 Ga0070701_11135060 3300005438 Bacteria 552
91 Ga0070711_101190759 3300005439 Bacteria 659
92 Ga0070711_101310054 3300005439 Bacteria 629
93 Ga0070705_100115633 3300005440 Bacteria 1723
94 Ga0070700_100222336 3300005441 Bacteria 1339
95 Ga0070700_100755634 3300005441 Bacteria 778
96 Ga0070700_100910998 3300005441 Bacteria 716
97 Ga0070700_101178935 3300005441 Bacteria 638
98 Ga0070700_101755071 3300005441 Bacteria 533
99 Ga0070694_100709412 3300005444 Bacteria 818
100 Ga0070694_101363671 3300005444 Bacteria 598
101 Ga0070708_101468204 3300005445 Bacteria 636
102 Ga0070663_100013100 3300005455 Bacteria 5271
103 Ga0070663_100271068 3300005455 Bacteria 1349
104 Ga0070663_100414558 3300005455 Bacteria 1103
105 Ga0070663_100424252 3300005455 Bacteria 1091
106 Ga0070663_100508501 3300005455 Bacteria 1001
107 Ga0070663_100524563 3300005455 Bacteria 986
108 Ga0070663_100690787 3300005455 Bacteria 866
109 Ga0070678_100120449 3300005456 Bacteria 2068
110 Ga0070678_100296092 3300005456 Bacteria 1373
111 Ga0070678_100420135 3300005456 Bacteria 1165
112 Ga0070678_101824033 3300005456 Bacteria 574
113 Ga0070662_100699482 3300005457 Bacteria 857
114 Ga0070662_102009465 3300005457 Bacteria 500
115 Ga0070681_10767994 3300005458 Bacteria 880
116 Ga0070681_11809903 3300005458 Bacteria 538
117 Ga0068867_100139211 3300005459 Bacteria 1895
118 Ga0068867_100570858 3300005459 Bacteria 982
119 Ga0068867_101153963 3300005459 Bacteria 709
120 Ga0068867_101423045 3300005459 Bacteria 643
121 Ga0070706_101352356 3300005467 Bacteria 652
122 Ga0070706_101922792 3300005467 Bacteria 536
123 Ga0070707_101330901 3300005468 Bacteria 685
124 Ga0070707_101687429 3300005468 Bacteria 601
125 Ga0074259_11235176 3300005507 Bacteria 568
126 Ga0070699_100270931 3300005518 Bacteria 1519
127 Ga0070679_100353315 3300005530 Bacteria 1417
128 Ga0070679_101778973 3300005530 Bacteria 564
129 Ga0070679_101816483 3300005530 Bacteria 558
130 Ga0070679_101853467 3300005530 Bacteria 552
131 Ga0070684_100199865 3300005535 Bacteria 1820
132 Ga0070684_100976703 3300005535 Bacteria 794
133 Ga0070684_101485564 3300005535 Bacteria 638
134 Ga0068853_100091702 3300005539 Bacteria 2672
135 Ga0068853_100827006 3300005539 Bacteria 887
136 Ga0068853_101030520 3300005539 Bacteria 793
137 Ga0068853_101172027 3300005539 Bacteria 742
138 Ga0070672_100128188 3300005543 Bacteria 2083
139 Ga0070672_100275934 3300005543 Bacteria 1420
140 Ga0070672_100319013 3300005543 Bacteria 1321
141 Ga0070672_101521830 3300005543 Bacteria 600
142 Ga0070686_100167540 3300005544 Bacteria 1551
143 Ga0070695_100573216 3300005545 Bacteria 883
144 Ga0070696_100603039 3300005546 Bacteria 885
145 Ga0070693_100348652 3300005547 Bacteria 1013
146 Ga0070693_100421097 3300005547 Bacteria 931
147 Ga0070693_100523589 3300005547 Bacteria 844
148 Ga0070665_100052156 3300005548 Bacteria 4104
149 Ga0070665_100116662 3300005548 Bacteria 2672
150 Ga0070665_100264723 3300005548 Bacteria 1720
151 Ga0070665_100528355 3300005548 Bacteria 1191
152 Ga0070665_100697214 3300005548 Bacteria 1028
153 Ga0070665_100894752 3300005548 Bacteria 900
154 Ga0070665_100961491 3300005548 Bacteria 866
155 Ga0070665_102327249 3300005548 Bacteria 539
156 Ga0070704_100562524 3300005549 Bacteria 998
157 Ga0070704_101356144 3300005549 Bacteria 652
158 Ga0068855_100540386 3300005563 Bacteria 1263
159 Ga0070664_100233733 3300005564 Bacteria 1648
160 Ga0070664_100563807 3300005564 Bacteria 1054
161 Ga0070664_100915042 3300005564 Bacteria 823
162 Ga0070664_101444035 3300005564 Bacteria 651
163 Ga0070664_102142491 3300005564 Bacteria 530
164 Ga0068857_100304564 3300005577 Bacteria 1469
165 Ga0068857_101346706 3300005577 Bacteria 694
166 Ga0068857_102120856 3300005577 Bacteria 552
167 Ga0068854_101702216 3300005578 Bacteria 576
168 Ga0068854_102169475 3300005578 Bacteria 514
169 Ga0068856_100341977 3300005614 Bacteria 1514
170 Ga0070702_100040417 3300005615 Bacteria 2609
171 Ga0070702_100199111 3300005615 Bacteria 1324
172 Ga0068852_100271002 3300005616 Bacteria 1633
173 Ga0068852_100501254 3300005616 Bacteria 1209
174 Ga0068852_100945819 3300005616 Bacteria 880
175 Ga0068852_101019635 3300005616 Bacteria 846
176 Ga0068859_100537487 3300005617 Bacteria 1263
177 Ga0068859_101096821 3300005617 Bacteria 875
178 Ga0068859_101231259 3300005617 Bacteria 824
179 Ga0068859_101328397 3300005617 Bacteria 792
180 Ga0068864_100015580 3300005618 Bacteria 6322
181 Ga0068864_101084495 3300005618 Bacteria 796
182 Ga0068866_10134574 3300005718 Bacteria 1411
183 Ga0068866_10149312 3300005718 Bacteria 1351
184 Ga0068866_10577412 3300005718 Bacteria 756
185 Ga0068866_10801951 3300005718 Bacteria 655
186 Ga0068861_100054513 3300005719 Bacteria 3046
187 Ga0068861_100161751 3300005719 Bacteria 1847
188 Ga0068861_100939703 3300005719 Bacteria 821
189 Ga0068861_101714088 3300005719 Bacteria 622
190 Ga0068861_102585526 3300005719 Bacteria 511
191 Ga0068851_10063560 3300005834 Bacteria 1896
192 Ga0068851_10236844 3300005834 Bacteria 1031
193 Ga0068870_10118175 3300005840 Bacteria 1523
194 Ga0068870_11073911 3300005840 Bacteria 578
195 Ga0068863_100095029 3300005841 Bacteria 2829
196 Ga0068863_101367412 3300005841 Bacteria 715
197 Ga0068863_101826917 3300005841 Bacteria 617
198 Ga0068858_100279556 3300005842 Bacteria 1589
199 Ga0068858_101255835 3300005842 Bacteria 728
200 Ga0068860_100120926 3300005843 Bacteria 2507
201 Ga0068860_100280027 3300005843 Bacteria 1629
202 Ga0068860_100714213 3300005843 Bacteria 1012
203 Ga0068860_100799290 3300005843 Bacteria 956
204 Ga0068860_100880996 3300005843 Bacteria 911
205 Ga0068860_101514217 3300005843 Bacteria 692
206 Ga0068860_101803235 3300005843 Bacteria 634
207 Ga0068862_100068047 3300005844 Bacteria 3071
208 Ga0068862_100249415 3300005844 Bacteria 1617
209 Ga0068862_100364113 3300005844 Bacteria 1344
210 Ga0068862_100543574 3300005844 Bacteria 1108
211 Ga0068862_102395669 3300005844 Bacteria 539
212 Ga0081455_10059345 3300005937 Bacteria 3231
213 Ga0081455_10085186 3300005937 Bacteria 2578
214 Ga0081455_10091358 3300005937 Bacteria 2466
215 Ga0081455_10157271 3300005937 Bacteria 1746
216 Ga0081455_10661721 3300005937 Bacteria 671
217 Ga0081538_10036458 3300005981 Bacteria 3208
218 Ga0081538_10178629 3300005981 Bacteria 912
219 Ga0081540_1008342 3300005983 Bacteria 7244
220 Ga0081540_1015698 3300005983 Bacteria 4781
221 Ga0081540_1017290 3300005983 Bacteria 4469
222 Ga0081540_1036212 3300005983 Bacteria 2635
223 Ga0081540_1038775 3300005983 Bacteria 2507
224 Ga0081540_1039881 3300005983 Bacteria 2456
225 Ga0081540_1042788 3300005983 Bacteria 2332
226 Ga0081540_1090656 3300005983 Bacteria 1346
227 Ga0081539_10000250 3300005985 Bacteria 125352
228 Ga0081539_10027360 3300005985 Bacteria 3614
229 Ga0070717_11177203 3300006028 Bacteria 698
230 Ga0070717_11536677 3300006028 Bacteria 604
231 Ga0075365_10124448 3300006038 Bacteria 1781
232 Ga0075365_10208332 3300006038 Bacteria 1370
233 Ga0075365_10424762 3300006038 Bacteria 938
234 Ga0075365_11213792 3300006038 Bacteria 530
235 Ga0075368_10135869 3300006042 Bacteria 1023
236 Ga0075368_10322141 3300006042 Bacteria 670
237 Ga0075368_10336462 3300006042 Bacteria 655
238 Ga0075368_10366847 3300006042 Bacteria 628
239 Ga0075363_100010490 3300006048 Bacteria 4404
240 Ga0075363_100245357 3300006048 Bacteria 1030
241 Ga0075363_100696006 3300006048 Bacteria 613
242 Ga0075364_10204594 3300006051 Bacteria 1338
243 Ga0075364_10360801 3300006051 Bacteria 991
244 Ga0075432_10112979 3300006058 Bacteria 1014
245 Ga0070715_10596980 3300006163 Bacteria 646
246 Ga0070712_100116165 3300006175 Bacteria 2006
247 Ga0070712_100128345 3300006175 Bacteria 1919
248 Ga0075362_10057891 3300006177 Bacteria 1747
249 Ga0075362_10384171 3300006177 Bacteria 706
250 Ga0075367_10179637 3300006178 Bacteria 1319
251 Ga0075367_10490049 3300006178 Bacteria 779
252 Ga0075367_10491414 3300006178 Bacteria 778
253 Ga0075367_11005700 3300006178 Bacteria 532
254 Ga0075369_10102721 3300006186 Bacteria 1283
255 Ga0075369_10114089 3300006186 Bacteria 1219
256 Ga0075369_10139813 3300006186 Bacteria 1103
257 Ga0075369_10262050 3300006186 Bacteria 804
258 Ga0075369_10581258 3300006186 Bacteria 536
259 Ga0075366_10138874 3300006195 Bacteria 1468
260 Ga0075366_10427260 3300006195 Bacteria 816
261 Ga0075366_10663099 3300006195 Bacteria 647
262 Ga0075366_10911683 3300006195 Bacteria 547
263 Ga0097621_100199930 3300006237 Bacteria 1735
264 Ga0097621_100289583 3300006237 Bacteria 1444
265 Ga0097621_100883884 3300006237 Bacteria 831
266 Ga0097621_100956962 3300006237 Bacteria 800
267 Ga0097621_101463304 3300006237 Bacteria 648
268 Ga0097621_101481945 3300006237 Bacteria 644
269 Ga0075370_10019945 3300006353 Bacteria 3655
270 Ga0075370_10079596 3300006353 Bacteria 1882
271 Ga0075370_10714285 3300006353 Bacteria 609
272 Ga0075370_10817618 3300006353 Bacteria 568
273 Ga0068871_100519093 3300006358 Bacteria 1075
274 Ga0068871_100544502 3300006358 Bacteria 1050
275 Ga0068871_100603208 3300006358 Bacteria 999
276 Ga0068871_101190226 3300006358 Bacteria 714
277 Ga0068871_101373494 3300006358 Bacteria 665
278 Ga0068871_101855904 3300006358 Bacteria 573
279 Ga0075428_100510071 3300006844 Bacteria 1286
280 Ga0075428_100510122 3300006844 Bacteria 1286
281 Ga0075428_101960507 3300006844 Bacteria 607
282 Ga0075433_10474788 3300006852 Bacteria 1102
283 Ga0075434_100148429 3300006871 Bacteria 2364
284 Ga0075434_101235831 3300006871 Bacteria 759
285 Ga0075434_101686681 3300006871 Bacteria 641
286 Ga0075434_102554864 3300006871 Bacteria 511
287 Ga0075429_100749253 3300006880 Bacteria 856
288 Ga0068865_100059750 3300006881 Bacteria 2667
289 Ga0068865_101466837 3300006881 Bacteria 610
290 Ga0097620_100537484 3300006931 Bacteria 1263
291 Ga0097620_101096807 3300006931 Bacteria 875
292 Ga0097620_101231254 3300006931 Bacteria 824
293 Ga0097620_101328452 3300006931 Bacteria 792
294 Ga0075435_100073102 3300007076 Bacteria 2802
295 Ga0075435_100328387 3300007076 Bacteria 1310
296 Ga0099794_10015141 3300007265 Bacteria 3398
297 Ga0099794_10071065 3300007265 Bacteria 1705
298 Ga0099794_10533435 3300007265 Bacteria 619
299 Ga0099794_10582735 3300007265 Bacteria 592
300 Ga0099795_10024086 3300007788 Bacteria 2026
301 Ga0099795_10146110 3300007788 Bacteria 965
302 Ga0099795_10153867 3300007788 Bacteria 944
303 Ga0099795_10267970 3300007788 Bacteria 742
304 Ga0099795_10382177 3300007788 Bacteria 636
305 Ga0105251_10150104 3300009011 Bacteria 1053
306 Ga0105250_10263427 3300009092 Bacteria 739
307 Ga0105240_10056547 3300009093 Bacteria 4909
308 Ga0105240_10980907 3300009093 Bacteria 905
309 Ga0111539_10413324 3300009094 Bacteria 1571
310 Ga0111539_11263038 3300009094 Bacteria 857
311 Ga0105245_10371776 3300009098 Bacteria 1421
312 Ga0105245_11137307 3300009098 Bacteria 828
313 Ga0105247_10030092 3300009101 Bacteria 3291
314 Ga0105247_10993990 3300009101 Bacteria 655
315 Ga0105247_11799318 3300009101 Bacteria 509
316 Ga0114129_10596215 3300009147 Bacteria 1432
317 Ga0105243_10187950 3300009148 Bacteria 1802
318 Ga0105243_10305641 3300009148 Bacteria 1443
319 Ga0105243_10524067 3300009148 Bacteria 1127
320 Ga0105243_12462730 3300009148 Bacteria 559
321 Ga0105241_10873457 3300009174 Bacteria 833
322 Ga0105241_11056808 3300009174 Bacteria 762
323 Ga0105241_11452921 3300009174 Bacteria 658
324 Ga0105242_10500990 3300009176 Bacteria 1155
325 Ga0105242_11695041 3300009176 Bacteria 668
326 Ga0105248_10134532 3300009177 Bacteria 2789
327 Ga0105248_12245364 3300009177 Bacteria 621
328 Ga0105248_13251034 3300009177 Bacteria 517
329 Ga0105237_10044108 3300009545 Bacteria 4491
330 Ga0105237_10327371 3300009545 Bacteria 1536
331 Ga0105238_10021504 3300009551 Bacteria 6570
332 Ga0105238_11022839 3300009551 Bacteria 847
333 Ga0105238_12222247 3300009551 Bacteria 583
334 Ga0105238_12582761 3300009551 Bacteria 544
335 Ga0105249_10318791 3300009553 Bacteria 1565
336 Ga0105249_10329500 3300009553 Bacteria 1540
337 Ga0105249_11358138 3300009553 Bacteria 782
338 Ga0105249_12503234 3300009553 Bacteria 588
339 Ga0105249_13080748 3300009553 Bacteria 535
340 Ga0105249_13185196 3300009553 Bacteria 527
341 Ga0099796_10030633 3300010159 Bacteria 1747
342 Ga0099796_10044637 3300010159 Bacteria 1515
343 Ga0099796_10071033 3300010159 Bacteria 1257
344 Ga0099796_10204882 3300010159 Bacteria 802
345 Ga0099796_10366441 3300010159 Bacteria 624
346 Ga0105239_10068557 3300010375 Bacteria 3898
347 Ga0105239_10231039 3300010375 Bacteria 2075
348 Ga0105239_10235272 3300010375 Bacteria 2056
349 Ga0105239_11594649 3300010375 Bacteria 755
350 Ga0105239_11912571 3300010375 Bacteria 688
351 Ga0105239_12421753 3300010375 Bacteria 611
352 Ga0105246_10080117 3300011119 Bacteria 2324
353 Ga0105246_10454233 3300011119 Bacteria 1077
354 Ga0105246_11898268 3300011119 Bacteria 572
355 Ga0157329_1038237 3300012491 Bacteria 528
356 Ga0157319_1007371 3300012497 Bacteria 815
357 Ga0157339_1019518 3300012505 Bacteria 708
358 Ga0157324_1026101 3300012506 Bacteria 631
359 Ga0157315_1012783 3300012508 Bacteria 780
360 Ga0157316_1020230 3300012510 Bacteria 721
361 Ga0157327_1043745 3300012512 Bacteria 612
362 Ga0157373_10376663 3300013100 Bacteria 1015
363 Ga0157370_10196716 3300013104 Bacteria 1871
364 Ga0157369_10008863 3300013105 Bacteria 11522
365 Ga0157374_10103960 3300013296 Bacteria 2726
366 Ga0157374_12728831 3300013296 Bacteria 522
367 Ga0157378_10033388 3300013297 Bacteria 4548
368 Ga0157378_10269253 3300013297 Bacteria 1638
369 Ga0157378_10732788 3300013297 Bacteria 1010
370 Ga0163162_10595170 3300013306 Bacteria 1232
371 Ga0163162_10677013 3300013306 Bacteria 1154
372 Ga0163162_12084573 3300013306 Bacteria 650
373 Ga0157372_11281351 3300013307 Bacteria 846
374 Ga0157375_10115953 3300013308 Bacteria 2782
375 Ga0157375_10563992 3300013308 Bacteria 1300
376 Ga0157375_10593440 3300013308 Bacteria 1267
377 Ga0157375_11310359 3300013308 Bacteria 852
378 Ga0163163_10505882 3300014325 Bacteria 1270
379 Ga0163163_10770689 3300014325 Bacteria 1025
380 Ga0163163_10846612 3300014325 Bacteria 978
381 Ga0163163_11813233 3300014325 Bacteria 670
382 Ga0163163_12142344 3300014325 Bacteria 619
383 Ga0163163_12626381 3300014325 Bacteria 561
384 Ga0163163_12731432 3300014325 Bacteria 551
385 Ga0163163_12778174 3300014325 Bacteria 546
386 Ga0163163_13047064 3300014325 Bacteria 523
387 Ga0157380_10575887 3300014326 Bacteria 1109
388 Ga0157380_10633981 3300014326 Bacteria 1063
389 Ga0157380_10883885 3300014326 Bacteria 918
390 Ga0157377_10102760 3300014745 Bacteria 1706
391 Ga0157377_10705749 3300014745 Bacteria 733
392 Ga0157377_11505823 3300014745 Bacteria 535
393 Ga0157379_11049582 3300014968 Bacteria 779
394 Ga0157379_11582276 3300014968 Bacteria 639
395 Ga0157376_11341403 3300014969 Bacteria 746
396 Ga0182006_1195969 3300015261 Bacteria 670
397 Ga0163161_10164102 3300017792 Bacteria 1695
398 Ga0163161_10231275 3300017792 Bacteria 1435
399 Ga0163161_10701139 3300017792 Bacteria 843
400 Ga0207666_1005953 3300025271 Bacteria 1570
401 Ga0207673_1057817 3300025290 Bacteria 551
402 Ga0209758_1003248 3300025297 Bacteria 15075
403 Ga0209758_1100790 3300025297 Bacteria 822
404 Ga0207426_1117214 3300025302 Bacteria 663
405 Ga0207697_10088123 3300025315 Bacteria 1314
406 Ga0207656_10161802 3300025321 Bacteria 1066
407 Ga0207656_10231881 3300025321 Bacteria 900
408 Ga0207656_10318112 3300025321 Bacteria 773
409 Ga0207656_10541340 3300025321 Bacteria 593
410 Ga0207653_10017165 3300025885 Bacteria 2276
411 Ga0207692_10855360 3300025898 Bacteria 597
412 Ga0207642_10174845 3300025899 Bacteria 1165
413 Ga0207642_10670450 3300025899 Bacteria 651
414 Ga0207710_10124295 3300025900 Bacteria 1235
415 Ga0207710_10572353 3300025900 Bacteria 589
416 Ga0207710_10631222 3300025900 Bacteria 560
417 Ga0207710_10678253 3300025900 Bacteria 540
418 Ga0207688_10131777 3300025901 Bacteria 1466
419 Ga0207688_10139039 3300025901 Bacteria 1428
420 Ga0207688_10803318 3300025901 Bacteria 596
421 Ga0207680_10352686 3300025903 Bacteria 1034
422 Ga0207680_11014252 3300025903 Bacteria 594
423 Ga0207647_10059219 3300025904 Bacteria 2344
424 Ga0207647_10336143 3300025904 Bacteria 856
425 Ga0207647_10425511 3300025904 Bacteria 746
426 Ga0207685_10107246 3300025905 Bacteria 1205
427 Ga0207685_10531986 3300025905 Bacteria 623
428 Ga0207699_10188350 3300025906 Bacteria 1391
429 Ga0207645_10054365 3300025907 Bacteria 2557
430 Ga0207645_10892462 3300025907 Bacteria 604
431 Ga0207643_10446754 3300025908 Bacteria 822
432 Ga0207643_10646043 3300025908 Bacteria 682
433 Ga0207705_10070774 3300025909 Bacteria 2528
434 Ga0207705_10234829 3300025909 Bacteria 1395
435 Ga0207705_11002122 3300025909 Bacteria 645
436 Ga0207684_10683650 3300025910 Bacteria 873
437 Ga0207654_10139023 3300025911 Bacteria 1547
438 Ga0207654_10972707 3300025911 Bacteria 617
439 Ga0207707_10001296 3300025912 Bacteria 23280
440 Ga0207707_11278168 3300025912 Bacteria 590
441 Ga0207707_11390282 3300025912 Bacteria 560
442 Ga0207707_11514370 3300025912 Bacteria 531
443 Ga0207695_10141586 3300025913 Bacteria 2353
444 Ga0207671_10007041 3300025914 Bacteria 9851
445 Ga0207671_10021353 3300025914 Bacteria 4913
446 Ga0207671_10090815 3300025914 Bacteria 2301
447 Ga0207671_10525160 3300025914 Bacteria 944
448 Ga0207671_10750540 3300025914 Bacteria 775
449 Ga0207693_10238814 3300025915 Bacteria 1427
450 Ga0207693_10601704 3300025915 Bacteria 856
451 Ga0207693_10902417 3300025915 Bacteria 678
452 Ga0207663_11172069 3300025916 Bacteria 618
453 Ga0207660_10236701 3300025917 Bacteria 1437
454 Ga0207662_10150616 3300025918 Bacteria 1479
455 Ga0207657_10006577 3300025919 Bacteria 12035
456 Ga0207657_10099572 3300025919 Bacteria 2414
457 Ga0207657_10328099 3300025919 Bacteria 1209
458 Ga0207657_10686784 3300025919 Bacteria 796
459 Ga0207652_10005830 3300025921 Bacteria 9984
460 Ga0207652_10565730 3300025921 Bacteria 1021
461 Ga0207652_11882082 3300025921 Bacteria 504
462 Ga0207646_10411737 3300025922 Bacteria 1221
463 Ga0207681_10355557 3300025923 Bacteria 1173
464 Ga0207681_10484612 3300025923 Bacteria 1010
465 Ga0207681_11061231 3300025923 Bacteria 680
466 Ga0207681_11838165 3300025923 Bacteria 505
467 Ga0207694_10021768 3300025924 Bacteria 4859
468 Ga0207650_11172776 3300025925 Bacteria 654
469 Ga0207659_10689390 3300025926 Bacteria 874
470 Ga0207687_10047614 3300025927 Bacteria 2973
471 Ga0207687_10653290 3300025927 Bacteria 890
472 Ga0207687_11292987 3300025927 Bacteria 627
473 Ga0207700_10181994 3300025928 Bacteria 1760
474 Ga0207700_11655817 3300025928 Bacteria 565
475 Ga0207664_10053225 3300025929 Bacteria 3203
476 Ga0207644_10139855 3300025931 Bacteria 1863
477 Ga0207644_10178407 3300025931 Bacteria 1663
478 Ga0207644_10654807 3300025931 Bacteria 874
479 Ga0207644_11133163 3300025931 Bacteria 657
480 Ga0207644_11874270 3300025931 Bacteria 501
481 Ga0207690_11059863 3300025932 Bacteria 675
482 Ga0207690_11680042 3300025932 Bacteria 530
483 Ga0207706_10147379 3300025933 Bacteria 2070
484 Ga0207706_10303642 3300025933 Bacteria 1390
485 Ga0207686_10067968 3300025934 Bacteria 2281
486 Ga0207686_10128413 3300025934 Bacteria 1735
487 Ga0207709_10618891 3300025935 Bacteria 859
488 Ga0207709_10679494 3300025935 Bacteria 822
489 Ga0207709_10947829 3300025935 Bacteria 701
490 Ga0207709_11237835 3300025935 Bacteria 616
491 Ga0207709_11485905 3300025935 Bacteria 562
492 Ga0207709_11498274 3300025935 Bacteria 560
493 Ga0207670_10212249 3300025936 Bacteria 1477
494 Ga0207670_11780040 3300025936 Bacteria 524
495 Ga0207669_10186486 3300025937 Bacteria 1492
496 Ga0207669_10989203 3300025937 Bacteria 706
497 Ga0207704_10419584 3300025938 Bacteria 1060
498 Ga0207704_10520919 3300025938 Bacteria 961
499 Ga0207704_10870111 3300025938 Bacteria 756
500 Ga0207665_10282255 3300025939 Bacteria 1236
501 Ga0207665_10296379 3300025939 Bacteria 1208
502 Ga0207691_10203451 3300025940 Bacteria 1722
503 Ga0207691_10229936 3300025940 Bacteria 1606
504 Ga0207691_10395247 3300025940 Bacteria 1179
505 Ga0207691_11244095 3300025940 Bacteria 616
506 Ga0207711_10097167 3300025941 Bacteria 2600
507 Ga0207711_11085016 3300025941 Bacteria 741
508 Ga0207711_11490963 3300025941 Bacteria 619
509 Ga0207711_12054854 3300025941 Bacteria 514
510 Ga0207689_10265797 3300025942 Bacteria 1420
511 Ga0207689_10433652 3300025942 Bacteria 1097
512 Ga0207661_10882891 3300025944 Bacteria 823
513 Ga0207661_11958729 3300025944 Bacteria 532
514 Ga0207679_10143113 3300025945 Bacteria 1935
515 Ga0207679_11091237 3300025945 Bacteria 732
516 Ga0207679_11278282 3300025945 Bacteria 673
517 Ga0207667_10016602 3300025949 Bacteria 8310
518 Ga0207667_10187627 3300025949 Bacteria 2122
519 Ga0207667_12095436 3300025949 Bacteria 524
520 Ga0207651_10052362 3300025960 Bacteria 2783
521 Ga0207651_10309802 3300025960 Bacteria 1316
522 Ga0207651_10373534 3300025960 Bacteria 1207
523 Ga0207712_10153225 3300025961 Bacteria 1783
524 Ga0207712_10176190 3300025961 Bacteria 1676
525 Ga0207712_10928483 3300025961 Bacteria 770
526 Ga0207712_11560303 3300025961 Bacteria 592
527 Ga0207668_10044453 3300025972 Bacteria 3021
528 Ga0207668_10127417 3300025972 Bacteria 1938
529 Ga0207668_10369048 3300025972 Bacteria 1205
530 Ga0207668_10776993 3300025972 Bacteria 846
531 Ga0207668_10875234 3300025972 Bacteria 798
532 Ga0207668_12074572 3300025972 Bacteria 512
533 Ga0207640_10187831 3300025981 Bacteria 1555
534 Ga0207640_11001413 3300025981 Bacteria 735
535 Ga0207658_10788810 3300025986 Bacteria 862
536 Ga0207658_10797588 3300025986 Bacteria 857
537 Ga0207658_11212127 3300025986 Bacteria 690
538 Ga0207677_10106238 3300026023 Bacteria 2079
539 Ga0207677_10412277 3300026023 Bacteria 1148
540 Ga0207677_10565046 3300026023 Bacteria 993
541 Ga0207677_10918699 3300026023 Bacteria 790
542 Ga0207677_11582778 3300026023 Bacteria 606
543 Ga0207703_10194577 3300026035 Bacteria 1798
544 Ga0207703_10878123 3300026035 Bacteria 858
545 Ga0207703_11604930 3300026035 Bacteria 626
546 Ga0207639_10010311 3300026041 Bacteria 6468
547 Ga0207639_10360292 3300026041 Bacteria 1301
548 Ga0207639_11262454 3300026041 Bacteria 693
549 Ga0207678_10046087 3300026067 Bacteria 3771
550 Ga0207678_10075216 3300026067 Bacteria 2893
551 Ga0207678_10422761 3300026067 Bacteria 1156
552 Ga0207678_10626163 3300026067 Bacteria 944
553 Ga0207708_10068571 3300026075 Bacteria 2715
554 Ga0207708_10182740 3300026075 Bacteria 1665
555 Ga0207708_11219144 3300026075 Bacteria 658
556 Ga0207708_11291791 3300026075 Bacteria 639
557 Ga0207708_11397104 3300026075 Bacteria 614
558 Ga0207702_10268605 3300026078 Bacteria 1608
559 Ga0207641_10243298 3300026088 Bacteria 1677
560 Ga0207641_10530704 3300026088 Bacteria 1146
561 Ga0207648_10096241 3300026089 Bacteria 2590
562 Ga0207648_10518567 3300026089 Bacteria 1092
563 Ga0207648_10603133 3300026089 Bacteria 1012
564 Ga0207648_11492787 3300026089 Bacteria 635
565 Ga0207676_10307677 3300026095 Bacteria 1449
566 Ga0207676_10742310 3300026095 Bacteria 954
567 Ga0207674_10020322 3300026116 Bacteria 7175
568 Ga0207674_10904543 3300026116 Bacteria 851
569 Ga0207674_11017537 3300026116 Bacteria 798
570 Ga0207674_11952169 3300026116 Bacteria 552
571 Ga0207675_100365563 3300026118 Bacteria 1416
572 Ga0207675_100470939 3300026118 Bacteria 1247
573 Ga0207675_101264848 3300026118 Bacteria 758
574 Ga0207675_101527425 3300026118 Bacteria 688
575 Ga0207683_10231004 3300026121 Bacteria 1687
576 Ga0207683_10798166 3300026121 Bacteria 876
577 Ga0207683_11018550 3300026121 Bacteria 769
578 Ga0207683_11111858 3300026121 Bacteria 733
579 Ga0207683_11440154 3300026121 Bacteria 637
580 Ga0207683_12085076 3300026121 Bacteria 515
581 Ga0207683_12118679 3300026121 Bacteria 510
582 Ga0207683_12129910 3300026121 Unclassified 509
583 Ga0207698_10319600 3300026142 Bacteria 1453
584 Ga0207698_11352015 3300026142 Bacteria 727
585 Ga0207698_11985946 3300026142 Bacteria 596
586 Ga0209179_1014850 3300027512 Bacteria 1437
587 Ga0209588_1008437 3300027671 Bacteria 3056
588 Ga0209588_1118074 3300027671 Bacteria 850
589 Ga0209813_10276116 3300027866 Bacteria 646
590 Ga0209813_10279577 3300027866 Bacteria 642
591 Ga0207428_10147578 3300027907 Bacteria 1792
592 Ga0207428_10148303 3300027907 Bacteria 1787
593 Ga0207428_11231705 3300027907 Bacteria 520
594 Ga0268266_10003299 3300028379 Bacteria 16216
595 Ga0268266_10078801 3300028379 Bacteria 2867
596 Ga0268266_10097490 3300028379 Bacteria 2585
597 Ga0268266_10199713 3300028379 Bacteria 1829
598 Ga0268266_10203997 3300028379 Bacteria 1810
599 Ga0268266_11612321 3300028379 Bacteria 624
600 Ga0268266_12339539 3300028379 Bacteria 505
601 Ga0268265_10033437 3300028380 Bacteria 3738
602 Ga0268265_10319465 3300028380 Bacteria 1405
603 Ga0268265_10366021 3300028380 Bacteria 1321
604 Ga0268265_10454080 3300028380 Bacteria 1197
605 Ga0268265_11790336 3300028380 Bacteria 620
606 Ga0268265_12624191 3300028380 Bacteria 509
607 Ga0268265_12704483 3300028380 Bacteria 501
608 Ga0268264_10320190 3300028381 Bacteria 1466
609 Ga0268264_10906165 3300028381 Bacteria 885
610 Ga0268264_11311671 3300028381 Bacteria 734
611 Ga0307517_10000111 3300028786 Bacteria 120304
612 Ga0307515_10693750 3300028794 Bacteria 633
613 Ga0307515_10743823 3300028794 Bacteria 599
614 Ga0307512_10183786 3300030522 Bacteria 1169
615 Ga0307513_10142176 3300031456 Bacteria 2324
616 Ga0307513_10746781 3300031456 Bacteria 684
617 Ga0307513_10873143 3300031456 Bacteria 606
618 Ga0307509_10182348 3300031507 Bacteria 1962
619 Ga0307509_10378568 3300031507 Bacteria 1129
620 Ga0307408_100727373 3300031548 Bacteria 894
621 Ga0307408_102056266 3300031548 Bacteria 550
622 Ga0307408_102058627 3300031548 Bacteria 550
623 Ga0307508_10193310 3300031616 Bacteria 1636
624 Ga0307514_10393519 3300031649 Bacteria 712
625 Ga0265314_10212953 3300031711 Bacteria 1133
626 Ga0307516_10274467 3300031730 Bacteria 1370
627 Ga0307516_10543843 3300031730 Bacteria 815
628 Ga0307516_10942883 3300031730 Bacteria 532
629 Ga0307405_10127189 3300031731 Bacteria 1754
630 Ga0307405_11271117 3300031731 Bacteria 639
631 Ga0307405_11475263 3300031731 Bacteria 597
632 Ga0307405_11781070 3300031731 Bacteria 547
633 Ga0307413_10063826 3300031824 Bacteria 2285
634 Ga0307410_10872448 3300031852 Bacteria 769
635 Ga0307406_10774699 3300031901 Bacteria 807
636 Ga0307406_11800236 3300031901 Bacteria 544
637 Ga0307407_10688655 3300031903 Bacteria 769
638 Ga0307407_11078630 3300031903 Bacteria 623
639 Ga0307412_11171244 3300031911 Bacteria 687
640 Ga0307412_11408515 3300031911 Bacteria 631
641 Ga0307412_11959541 3300031911 Bacteria 541
642 Ga0307409_100794455 3300031995 Bacteria 953
643 Ga0307409_101105173 3300031995 Bacteria 814
644 Ga0307409_101593008 3300031995 Bacteria 681
645 Ga0307416_100391769 3300032002 Bacteria 1423
646 Ga0307416_100437814 3300032002 Bacteria 1356
647 Ga0307416_101890916 3300032002 Bacteria 700
648 Ga0307416_101892393 3300032002 Bacteria 700
649 Ga0307414_10598903 3300032004 Bacteria 988
650 Ga0307411_10021434 3300032005 Bacteria 3782
651 Ga0307411_11442893 3300032005 Bacteria 631
652 Ga0307411_12144179 3300032005 Bacteria 523
653 Ga0307415_100369973 3300032126 Bacteria 1213
654 Ga0307415_100577568 3300032126 Bacteria 996
655 Ga0307510_10002750 3300033180 Bacteria 20142
656 Ga0307510_10149085 3300033180 Bacteria 1963
657 Ga0307510_10575475 3300033180 Bacteria 575
658 Ga0373958_0071218 3300034819 Bacteria 772
659 Ga0373959_0143984 3300034820 Bacteria 599
660 Ga0373934_0002075 3300035086 Bacteria 7353
661 Ga0373934_0169542 3300035086 Bacteria 896
662 Ga0373940_0187135 3300035088 Bacteria 676
663 Ga0373949_0139892 3300035090 Bacteria 693
664 Ga0373951_0225526 3300035091 Bacteria 555
665 Ga0373952_0003893 3300035092 Bacteria 2701
666 Ga0373923_0001160 3300035111 Bacteria 7320
667 Ga0373923_0012462 3300035111 Bacteria 3144
668 Ga0373932_0065719 3300035112 Bacteria 1113
669 Ga0373936_0505177 3300035113 Bacteria 562
670 Ga0373939_0505722 3300035114 Bacteria 516
671 Ga0373953_0000167 3300035117 Bacteria 17273
672 Ga0373953_0090502 3300035117 Bacteria 1279
673 Ga0373953_0561520 3300035117 Bacteria 508
674 Ga0373954_0000035 3300035118 Bacteria 51266
675 Ga0373954_0053470 3300035118 Bacteria 1898
676 Ga0373956_0016799 3300035119 Bacteria 3076
677 Ga0373956_0024009 3300035119 Bacteria 2622
678 Ga0373957_0001600 3300035120 Bacteria 6196
679 Ga0373957_0034223 3300035120 Bacteria 1880
680 Ga0373957_0482519 3300035120 Bacteria 538
681 Ga0373943_0017761 3300035170 Bacteria 3258
682 Ga0373943_0443437 3300035170 Bacteria 754
683 Ga0373946_0354120 3300035171 Bacteria 734
684 Ga0373955_0014576 3300035172 Bacteria 3827
685 Ga0373955_0101864 3300035172 Bacteria 1649
686 Ga0373955_0134921 3300035172 Bacteria 1443
687 Ga0373942_0162658 3300035207 Bacteria 723
688 Ga0373962_0392675 3300035242 Bacteria 509
689 Ga0373924_0014763 3300035410 Bacteria 2955
690 Ga0373924_0139489 3300035410 Bacteria 1057
691 Ga0373931_0299093 3300035691 Bacteria 993
692 Ga0373931_0303577 3300035691 Bacteria 986
693 Ga0373931_0618681 3300035691 Bacteria 709
694 Ga0373935_0213088 3300035692 Bacteria 1339
695 Ga0373935_0382096 3300035692 Bacteria 1009
696 Ga0373935_0857116 3300035692 Bacteria 672
697 Ga0373935_1005982 3300035692 Bacteria 619
698 Ga0373927_0219366 3300035695 Bacteria 1249
699 Ga0373927_0286865 3300035695 Bacteria 1083
700 Ga0373933_0000037 3300035724 Bacteria 81092
701 Ga0373933_0034742 3300035724 Bacteria 2940
702 Ga0373933_0149863 3300035724 Bacteria 1477
703 Ga0373947_0067044 3300035725 Bacteria 2191
704 Ga0373947_0747020 3300035725 Bacteria 668
705 Ga0373947_0811807 3300035725 Bacteria 639
706 Ga0373937_0000118 3300036401 Bacteria 75902
707 Ga0373937_0387534 3300036401 Bacteria 1325
708 Ga0373937_1072673 3300036401 Bacteria 754
709 Ga0373937_1159549 3300036401 Bacteria 721
710 Ga0373937_1198145 3300036401 Bacteria 708
711 Ga0373925_0086267 3300037068 Bacteria 2394
712 Ga0373925_0649556 3300037068 Bacteria 869
713 Ga0439461_0090154 3300041410 Bacteria 735
714 Ga0439465_0014802 3300041413 Bacteria 2433
715 Ga0451787_361978 3300041441 Bacteria 652
716 Ga0451793_0004900 3300041452 Bacteria 578
717 Ga0451797_0902045 3300041453 Bacteria 769
718 Ga0451795_1326094 3300041456 Bacteria 626
719 Ga0451804_0442419 3300041463 Bacteria 536
720 Ga0451835_0544806 3300041492 Bacteria 606
721 Ga0451843_0073144 3300041509 Bacteria 683
722 Ga0451855_0044892 3300041511 Bacteria 711
723 Ga0451853_0747090 3300041512 Bacteria 564
724 Ga0451853_1128668 3300041512 Bacteria 594
725 Ga0451853_3276822 3300041512 Bacteria 663
726 Ga0439431_0060257 3300041997 Bacteria 997
727 Ga0439431_0219014 3300041997 Bacteria 558
728 Ga0439431_0221951 3300041997 Bacteria 555
729 Ga0439445_0164856 3300042004 Bacteria 648
730 Ga0439445_0249223 3300042004 Bacteria 530
731 Ga0439454_023123 3300042011 Bacteria 931
732 Ga0439458_0055355 3300042157 Bacteria 984
733 Ga0439459_0190058 3300042438 Bacteria 556
734 Ga0439440_0139380 3300042993 Bacteria 688
735 Ga0451576_2173644 3300045051 Bacteria 570
736 Ga0495617_093944 3300046452 Bacteria 978
737 Ga0495592_0002185 3300046454 Bacteria 13770
738 Ga0495592_0256997 3300046454 Bacteria 1152
739 Ga0495603_0231552 3300046455 Bacteria 1065
740 Ga0495603_0394247 3300046455 Bacteria 793
741 Ga0495603_0685023 3300046455 Bacteria 586
742 Ga0495590_0050004 3300046457 Bacteria 1458
743 Ga0495591_110392 3300046458 Bacteria 676
744 Ga0495629_0861157 3300046459 Bacteria 595
745 Ga0495629_1137534 3300046459 Bacteria 503
746 Ga0495638_0281421 3300046460 Bacteria 903
747 Ga0495641_0079949 3300046461 Bacteria 1465
748 Ga0495651_0000412 3300046462 Bacteria 33198
749 Ga0495651_0132930 3300046462 Bacteria 1814
750 Ga0495651_0996625 3300046462 Bacteria 508
751 Ga0495653_0000161 3300046463 Bacteria 55322
752 Ga0495653_0724475 3300046463 Bacteria 602
753 Ga0495650_0168162 3300046471 Bacteria 778
754 Ga0495580_0121307 3300046472 Bacteria 1815
755 Ga0495582_0153241 3300046473 Bacteria 1309
756 Ga0495605_0351132 3300046474 Bacteria 618
757 Ga0495639_0114216 3300046475 Bacteria 1284
758 Ga0495639_0255963 3300046475 Bacteria 866
759 Ga0495639_0327468 3300046475 Bacteria 767
760 Ga0495639_0556149 3300046475 Bacteria 588
761 Ga0495662_0392443 3300046476 Bacteria 682
762 Ga0495664_0070855 3300046477 Bacteria 2082
763 Ga0495584_0210877 3300046491 Bacteria 987
764 Ga0495585_0121514 3300046492 Bacteria 1381
765 Ga0495594_0517753 3300046499 Bacteria 677
766 Ga0495594_0543729 3300046499 Bacteria 659
767 Ga0495596_0086424 3300046500 Bacteria 1217
768 Ga0495596_0324870 3300046500 Bacteria 598
769 Ga0495596_0450133 3300046500 Bacteria 502
770 Ga0495583_0174650 3300046506 Bacteria 881
771 Ga0495608_0000337 3300046511 Bacteria 33005
772 Ga0495608_0014802 3300046511 Bacteria 5411
773 Ga0495608_0278922 3300046511 Bacteria 1038
774 Ga0495610_0227769 3300046512 Bacteria 749
775 Ga0495616_0122446 3300046513 Bacteria 1199
776 Ga0495616_0442681 3300046513 Bacteria 527
777 Ga0495618_0016579 3300046514 Bacteria 4510
778 Ga0495618_0135194 3300046514 Bacteria 1577
779 Ga0495628_0052165 3300046516 Bacteria 3231
780 Ga0495628_0259781 3300046516 Bacteria 1294
781 Ga0495628_0951891 3300046516 Bacteria 593
782 Ga0495630_0529119 3300046517 Bacteria 904
783 Ga0495630_0795990 3300046517 Bacteria 722
784 Ga0495631_0277209 3300046518 Bacteria 714
785 Ga0495631_0293124 3300046518 Bacteria 692
786 Ga0495632_0164845 3300046519 Bacteria 1019
787 Ga0495644_0073785 3300046523 Bacteria 1283
788 Ga0495644_0160269 3300046523 Bacteria 862
789 Ga0495648_0458640 3300046524 Bacteria 555
790 Ga0495666_0123258 3300046526 Bacteria 1213
791 Ga0495652_0012092 3300046529 Bacteria 7798
792 Ga0495652_0094557 3300046529 Bacteria 2437
793 Ga0495652_1145000 3300046529 Bacteria 504
794 Ga0495652_1159737 3300046529 Bacteria 500
795 Ga0495654_0379405 3300046530 Bacteria 564
796 Ga0495640_0004805 3300046533 Bacteria 10757
797 Ga0495640_0643437 3300046533 Bacteria 638
798 Ga0495587_0000668 3300046536 Bacteria 22979
799 Ga0495587_0011627 3300046536 Bacteria 5571
800 Ga0495587_0793142 3300046536 Bacteria 517
801 Ga0495598_0356065 3300046537 Bacteria 564
802 Ga0495598_0381944 3300046537 Bacteria 547
803 Ga0495609_0088709 3300046538 Bacteria 1346
804 Ga0495609_0162662 3300046538 Bacteria 945
805 Ga0495621_0220021 3300046539 Bacteria 768
806 Ga0495597_0098168 3300046542 Bacteria 1237
807 Ga0495597_0375725 3300046542 Bacteria 543
808 Ga0495645_0050107 3300046543 Bacteria 3040
809 Ga0495645_0443762 3300046543 Bacteria 819
810 Ga0495633_0213849 3300046558 Bacteria 883
811 Ga0495633_0479939 3300046558 Bacteria 561
812 Ga0495667_0000147 3300046559 Bacteria 47993
813 Ga0495667_0067315 3300046559 Bacteria 2340
814 Ga0495656_0136760 3300046615 Bacteria 1171
815 Ga0495656_0310088 3300046615 Bacteria 810
816 Ga0495656_0802881 3300046615 Bacteria 508
817 Ga0495668_0138438 3300046616 Bacteria 1332
818 Ga0495668_0184604 3300046616 Bacteria 1142
819 Ga0495668_0560840 3300046616 Bacteria 630
820 Ga0495668_0602327 3300046616 Bacteria 607
821 Ga0495668_0674857 3300046616 Bacteria 571
822 Ga0495634_0035144 3300046642 Bacteria 3434
823 Ga0495634_0057519 3300046642 Bacteria 2595
824 Ga0495634_0554755 3300046642 Bacteria 670
825 Ga0495625_0421074 3300046660 Bacteria 830
826 Ga0495625_0644339 3300046660 Bacteria 631
827 Ga0495635_0000094 3300046663 Bacteria 52578
828 Ga0495635_0507277 3300046663 Bacteria 794
829 Ga0495635_0951724 3300046663 Bacteria 548
830 Ga0495659_0067824 3300046664 Bacteria 1331
831 Ga0495659_0268733 3300046664 Bacteria 714
832 Ga0495661_0340704 3300046665 Bacteria 740
833 Ga0495661_0528811 3300046665 Bacteria 560
834 Ga0495588_0145728 3300046674 Bacteria 1251
835 Ga0495657_0001420 3300046675 Bacteria 20703
836 Ga0495657_0282650 3300046675 Bacteria 993
837 Ga0495657_0369058 3300046675 Bacteria 847
838 Ga0495599_0000253 3300046678 Bacteria 33822
839 Ga0495599_0164784 3300046678 Bacteria 1369
840 Ga0495623_0000768 3300046679 Bacteria 21497
841 Ga0495623_0055642 3300046679 Bacteria 2493
842 Ga0495623_0699203 3300046679 Bacteria 519
843 Ga0495623_0706073 3300046679 Bacteria 516
844 Ga0495646_0002668 3300046680 Bacteria 11037
845 Ga0495646_0450837 3300046680 Bacteria 664
846 Ga0495647_0097997 3300046681 Bacteria 1211
847 Ga0495647_0497878 3300046681 Bacteria 567
848 Ga0495658_0322373 3300046683 Bacteria 979
849 Ga0495669_0036463 3300046684 Bacteria 2174
850 Ga0495669_0088254 3300046684 Bacteria 1429
851 Ga0495613_1069896 3300046689 Bacteria 516
852 Ga0495624_0149894 3300046690 Bacteria 1427
853 Ga0495624_0241288 3300046690 Bacteria 1094
854 Ga0495670_0290313 3300046691 Bacteria 875
855 Ga0495671_0363658 3300046692 Bacteria 694
856 Ga0495671_0566675 3300046692 Bacteria 540
857 Ga0495671_0583689 3300046692 Bacteria 532
858 Ga0495649_0105324 3300046694 Bacteria 1497
859 Ga0495649_0442214 3300046694 Bacteria 650
860 Ga0495649_0550075 3300046694 Bacteria 571
861 Ga0495589_0235900 3300046794 Bacteria 857
862 Ga0495589_0394538 3300046794 Bacteria 635
863 Ga0495600_0002207 3300046809 Bacteria 11075
864 Ga0495600_0369202 3300046809 Bacteria 896
865 Ga0495600_0582800 3300046809 Bacteria 681
866 Ga0495660_0143205 3300046810 Bacteria 1187
867 Ga0495581_0602791 3300047315 Bacteria 636
868 Ga0495604_0000253 3300047317 Bacteria 47392
869 Ga0495636_0309672 3300047318 Bacteria 740
870 Ga0495674_0054162 3300047319 Bacteria 3524
871 Ga0495674_0102638 3300047319 Bacteria 2432
872 Ga0495674_0329410 3300047319 Bacteria 1242
873 Ga0495674_1051330 3300047319 Bacteria 622
874 Ga0495672_0013492 3300047320 Bacteria 5637
875 Ga0495672_0081335 3300047320 Bacteria 1804
876 Ga0495672_0175059 3300047320 Bacteria 1091
877 Ga0495672_0402271 3300047320 Bacteria 626
878 Ga0495676_1107803 3300047321 Bacteria 503
879 Ga0495680_0000406 3300047322 Bacteria 48300
880 Ga0495680_0327964 3300047322 Bacteria 1070
881 Ga0495680_0539252 3300047322 Bacteria 787
882 Ga0495683_0238763 3300047323 Bacteria 802
883 Ga0495687_091360 3300047443 Bacteria 1165
884 Ga0495675_0000285 3300047444 Bacteria 36643
885 Ga0495675_0049747 3300047444 Bacteria 2663
886 Ga0495677_0110844 3300047445 Bacteria 1043
887 Ga0495677_0206329 3300047445 Bacteria 764
888 Ga0495679_160964 3300047446 Bacteria 600
889 Ga0495685_058173 3300047447 Bacteria 1305
890 Ga0495685_266775 3300047447 Bacteria 541
891 Ga0495673_0115167 3300047469 Bacteria 1070
892 Ga0495681_0076354 3300047470 Bacteria 1506
893 Ga0495681_0095808 3300047470 Bacteria 1304
894 Ga0495681_0301169 3300047470 Bacteria 620
895 Ga0495684_0000184 3300047471 Bacteria 47730
896 Ga0495684_0233186 3300047471 Bacteria 1345
897 Ga0495686_0090259 3300047472 Bacteria 1861
898 Ga0495686_0227621 3300047472 Bacteria 1057
899 Ga0495686_0630557 3300047472 Bacteria 552
900 Ga0495593_0004547 3300047673 Bacteria 8243
901 Ga0495593_0199426 3300047673 Bacteria 1006
902 Ga0495602_0001148 3300048088 Bacteria 25888
903 Ga0495602_0535799 3300048088 Bacteria 813
904 Ga0495602_0660732 3300048088 Bacteria 713
905 Ga0495614_0073214 3300048089 Bacteria 1479
906 Ga0495615_0166699 3300048090 Bacteria 664
907 Ga0495626_0408273 3300048091 Bacteria 524
908 Ga0496100_0008823 3300048903 Bacteria 5638
909 Ga0496101_0014849 3300048904 Bacteria 5240
910 Ga0496101_0323360 3300048904 Bacteria 1210
911 Ga0496101_0774286 3300048904 Bacteria 757
912 Ga0496101_0810263 3300048904 Bacteria 738
913 Ga0496101_1155972 3300048904 Bacteria 607
914 Ga0496102_0189199 3300048905 Bacteria 1939
915 Ga0496102_1713055 3300048905 Bacteria 546
916 Ga0496103_0038610 3300048906 Bacteria 2931
917 Ga0496103_0195116 3300048906 Bacteria 1302
918 Ga0496103_0528152 3300048906 Bacteria 754
919 Ga0496104_0093215 3300048907 Bacteria 2880
920 Ga0496104_0459544 3300048907 Bacteria 1185
921 Ga0496105_0003152 3300048908 Bacteria 12139
922 Ga0496105_1199023 3300048908 Bacteria 559
923 Ga0496106_0022284 3300048909 Bacteria 4705
924 Ga0496106_0150896 3300048909 Bacteria 1833
925 Ga0496106_0473586 3300048909 Bacteria 1006
926 Ga0496106_0743231 3300048909 Bacteria 780
927 Ga0496106_1025059 3300048909 Bacteria 648
928 Ga0496107_0009868 3300048910 Bacteria 6621
929 Ga0496107_0161008 3300048910 Bacteria 1663
930 Ga0496107_0484043 3300048910 Bacteria 918
931 Ga0496108_0002970 3300048911 Bacteria 13628
932 Ga0496108_0179011 3300048911 Bacteria 1835
933 Ga0496108_0359664 3300048911 Bacteria 1270
934 Ga0496109_0053669 3300048912 Bacteria 3676
935 Ga0496109_0622928 3300048912 Bacteria 1015
936 Ga0496109_1514838 3300048912 Bacteria 605
937 Ga0496110_0016721 3300048913 Bacteria 6127
938 Ga0496110_0869899 3300048913 Bacteria 807
939 Ga0496110_0893196 3300048913 Bacteria 794
940 Ga0496110_1341762 3300048913 Bacteria 624
941 Ga0496111_0059366 3300048914 Bacteria 2771
942 Ga0496111_0345933 3300048914 Bacteria 1101
943 Ga0496111_0571759 3300048914 Bacteria 829
944 Ga0496111_1117148 3300048914 Bacteria 561
945 Ga0496112_0029342 3300048915 Bacteria 5319
946 Ga0496112_0133971 3300048915 Bacteria 2448
947 Ga0496112_1345572 3300048915 Bacteria 629
948 Ga0496113_0143874 3300048916 Bacteria 1877
949 Ga0496113_0328911 3300048916 Bacteria 1225
950 Ga0496114_0032361 3300048917 Bacteria 4304
951 Ga0496114_0761098 3300048917 Bacteria 846
952 Ga0496115_0000957 3300048918 Bacteria 20941
953 Ga0496115_0059888 3300048918 Bacteria 3067
954 Ga0496115_0264860 3300048918 Bacteria 1413
955 Ga0496115_1258980 3300048918 Bacteria 553
956 Ga0496116_0221890 3300048919 Bacteria 968
957 Ga0496118_0222637 3300048921 Bacteria 1097
958 Ga0496119_0133349 3300048922 Bacteria 1350
959 Ga0496120_0138175 3300048923 Bacteria 1240
960 Ga0496120_0168153 3300048923 Bacteria 1087
961 Ga0496121_0002482 3300048924 Bacteria 28104
962 Ga0496121_0107938 3300048924 Bacteria 2130
963 Ga0496121_0118614 3300048924 Bacteria 2002
964 Ga0496121_0206211 3300048924 Bacteria 1396
965 Ga0496121_0215362 3300048924 Bacteria 1357
966 Ga0496121_0251661 3300048924 Bacteria 1225
967 Ga0496122_0059028 3300048925 Bacteria 2835
968 Ga0496124_0127104 3300048927 Bacteria 2029
969 Ga0496124_0155626 3300048927 Bacteria 1788
970 Ga0496124_0169588 3300048927 Bacteria 1692
971 Ga0496125_0388930 3300048928 Bacteria 819
972 Ga0496126_0003507 3300048929 Bacteria 19762
973 Ga0496126_0179446 3300048929 Bacteria 1799
974 Ga0496126_0296562 3300048929 Bacteria 1335
975 Ga0496126_0323724 3300048929 Bacteria 1266
976 Ga0496126_0922515 3300048929 Bacteria 661
977 Ga0495682_0049862 3300049460 Bacteria 1525
978 Ga0495682_0197417 3300049460 Bacteria 714
979 Ga0501036_0836773 3300049572 Bacteria 757
980 Ga0501040_0374169 3300049576 Bacteria 1022
981 Ga0501041_0803689 3300049577 Bacteria 603
982 Ga0501067_0194661 3300049583 Bacteria 1129
983 Ga0501067_0238070 3300049583 Bacteria 1013
984 Ga0501068_0585333 3300049584 Bacteria 727
985 Ga0501069_0516997 3300049585 Bacteria 713
986 Ga0501073_0536431 3300049589 Bacteria 809
987 Ga0501076_0840678 3300049592 Bacteria 757
988 Ga0501233_272934 3300049668 Bacteria 515
989 Ga0501221_236068 3300049704 Bacteria 520
990 Ga0501080_1585072 3300049742 Bacteria 555
991 Ga0501045_0594413 3300049824 Bacteria 820
992 nmdc:mga03683_254646_c1 3300050489 Bacteria 816
993 nmdc:mga03683_373442_c1 3300050489 Bacteria 678
994 nmdc:mga03683_517733_c1 3300050489 Bacteria 579
995 nmdc:mga00v17_1083817_c1 3300050491 Bacteria 502
996 nmdc:mga00v17_174547_c1 3300050491 Bacteria 1386
997 nmdc:mga0yw44_338364_c1 3300050492 Bacteria 1012
998 nmdc:mga0k408_156232_c1 3300050493 Bacteria 1359
999 nmdc:mga0k408_884006_c1 3300050493 Bacteria 519
1000 nmdc:mga0k408_90156_c1 3300050493 Bacteria 1800
1001 nmdc:mga0k408_95334_c1 3300050493 Bacteria 1751
1002 nmdc:mga06z11_391469_c1 3300050494 Bacteria 836
1003 nmdc:mga04h51_314520_c1 3300050495 Bacteria 641
1004 nmdc:mga07m45_714590_c1 3300050496 Bacteria 576
1005 nmdc:mga07m45_733380_c1 3300050496 Bacteria 568
1006 nmdc:mga07m45_79028_c1 3300050496 Bacteria 1877
1007 nmdc:mga07m45_856490_c1 3300050496 Bacteria 520
1008 nmdc:mga05p37_1891486_c1 3300050507 Bacteria 570
1009 nmdc:mga05p37_225957_c1 3300050507 Bacteria 2257
1010 nmdc:mga09592_405295_c1 3300050508 Bacteria 1178
1011 nmdc:mga06r32_627492_c1 3300050510 Bacteria 1044
1012 nmdc:mga08y16_268682_c1 3300050511 Bacteria 1761
1013 nmdc:mga08y16_424398_c1 3300050511 Bacteria 1359
1014 nmdc:mga08y16_692166_c1 3300050511 Bacteria 1020
1015 nmdc:mga0n895_1655123_c1 3300050512 Bacteria 603
1016 nmdc:mga0rr50_127900_c1 3300050513 Bacteria 2030
1017 nmdc:mga0rr50_814279_c1 3300050513 Bacteria 797
1018 nmdc:mga0a205_879088_c1 3300050515 Bacteria 743
1019 nmdc:mga0a205_883808_c1 3300050515 Bacteria 740
1020 nmdc:mga0sz30_110639_c1 3300050516 Bacteria 1204
1021 Ga0495601_0043689 3300053077 Bacteria 2814
1022 Ga0495601_0206412 3300053077 Bacteria 1283
1023 Ga0495601_0329454 3300053077 Bacteria 994
1024 Ga0495601_0601917 3300053077 Bacteria 705
1025 Ga0495612_0082575 3300053078 Bacteria 1351
1026 Ga0495612_0438119 3300053078 Bacteria 596
1027 Ga0500610_0213490 3300053079 Bacteria 920
1028 Ga0500635_0293960 3300053080 Bacteria 641
1029 Ga0495655_0221431 3300053083 Bacteria 626
1030 Ga0495655_0344992 3300053083 Bacteria 520
1031 Ga0495595_0008133 3300053084 Bacteria 4300
1032 Ga0495595_0192588 3300053084 Bacteria 1013
1033 Ga0495619_0000209 3300053085 Bacteria 42507
1034 Ga0495619_0391141 3300053085 Bacteria 960
1035 Ga0495619_1054480 3300053085 Bacteria 542
1036 Ga0500644_0514807 3300053088 Bacteria 527
1037 Ga0500646_0347305 3300053090 Bacteria 540
1038 Ga0500583_0389234 3300053092 Bacteria 670
1039 Ga0500651_0110766 3300053093 Bacteria 1675
1040 Ga0500641_0141711 3300053096 Bacteria 1038
1041 Ga0500641_0360881 3300053096 Bacteria 581
1042 Ga0500650_0395857 3300053098 Bacteria 598
1043 Ga0500654_172893 3300053099 Bacteria 706
1044 Ga0500555_115498 3300053103 Bacteria 673
1045 Ga0500569_036328 3300053109 Bacteria 1418
1046 Ga0500582_121064 3300053114 Bacteria 912
1047 Ga0500594_0175310 3300053118 Bacteria 698
1048 Ga0500595_046440 3300053119 Bacteria 1365
1049 Ga0500628_191124 3300053129 Bacteria 588
1050 Ga0500652_385402 3300053131 Bacteria 522
1051 Ga0500658_0360256 3300053134 Bacteria 667
1052 Ga0500561_0224405 3300053137 Bacteria 596
1053 Ga0500568_0040378 3300053139 Bacteria 1879
1054 Ga0500577_0271440 3300053142 Bacteria 738
1055 Ga0500588_0242333 3300053146 Bacteria 675
1056 Ga0500589_144523 3300053147 Bacteria 975
1057 Ga0500589_300838 3300053147 Bacteria 567
1058 Ga0500590_104433 3300053148 Bacteria 1355
1059 Ga0500604_0288581 3300053151 Bacteria 569
1060 Ga0500604_0364748 3300053151 Bacteria 502
1061 Ga0500616_0440495 3300053153 Bacteria 515
1062 Ga0500620_236677 3300053155 Bacteria 612
1063 Ga0500622_0436083 3300053156 Bacteria 524
1064 Ga0500627_0409393 3300053158 Bacteria 577
1065 Ga0500633_0069023 3300053160 Bacteria 1259
1066 Ga0500634_0266595 3300053161 Bacteria 700
1067 Ga0500636_0226509 3300053177 Bacteria 970
1068 Ga0500645_107407 3300053730 Bacteria 784
1069 Ga0500609_034210 3300053731 Bacteria 700
1070 Ga0500656_074785 3300053732 Bacteria 526
1071 Ga0500587_071477 3300053739 Bacteria 547
1072 Ga0501084_1220089 3300054114 Bacteria 631
1073 Ga0501082_1124301 3300060353 Bacteria 687
1074 2524466923 2524023210 Bacteria 9029266
1075 2793077270
1076 2876809508 2876808645 Bacteria 8824342
1077 2879118514 2879110137 Bacteria 8907982
1078 2889040572 2889033259 Bacteria 9099371
1079 2922367701 2922361189 Bacteria 7436256
1080 2922392403 2922386360 Bacteria 7017218
1081 8006988145 8006984368 Bacteria 9651211
1082 8056674504 8056673599 Bacteria 7871253
1083 8056685345 8056681323 Bacteria 8472857
1084 Ga0070668_101564676
1085 LJQas_1003452
1086 JGI24737J22298_10172485
1087 JGI24742J22300_10009356
1088 JGI25406J46586_10007934
1089 JGI25406J46586_10010769
1090 JGI25406J46586_10139833
1091 JGI25404J52841_10006374
1092 JGI25404J52841_10021421
1093 JGI25404J52841_10033319
1094 JGI25404J52841_10110964
1095 JGI25405J52794_10035592
1096 JGI25405J52794_10143965
1097 Ga0070658_10086028
1098 Ga0070676_11042553
1099 Ga0070676_11245726
1100 Ga0070690_100098584
1101 Ga0070690_100357644
1102 Ga0070670_100370546
1103 Ga0070670_100996817
1104 Ga0068869_100098437
1105 Ga0068869_100619970
1106 Ga0068869_100709341
1107 Ga0070666_10213199
1108 Ga0070666_10352201
1109 Ga0070680_100231609
1110 Ga0070680_101264331
1111 Ga0070680_101881256
1112 Ga0070682_100192533
1113 Ga0070682_101466476
1114 Ga0070682_101530416
1115 Ga0070682_101662526
1116 Ga0068868_100446177
1117 Ga0068868_100565487
1118 Ga0068868_100906121
1119 Ga0068868_101575682
1120 Ga0068868_102250364
1121 Ga0070660_100005300
1122 Ga0070660_100596235
1123 Ga0070660_101335937
1124 Ga0070689_100478422
1125 Ga0070689_101318034
1126 Ga0070689_101879426
1127 Ga0070691_10838806
1128 Ga0070691_10848442
1129 Ga0070691_11037406
1130 Ga0070687_100281157
1131 Ga0070661_100208363
1132 Ga0070661_100306338
1133 Ga0070661_100378343
1134 Ga0070661_101673837
1135 Ga0070692_10463535
1136 Ga0070668_100341284
1137 Ga0070668_100366176
1138 Ga0070668_100410737
1139 Ga0070668_100501849
1140 Ga0070668_100763837
1141 Ga0070668_101068459
1142 Ga0070668_101728961
1143 Ga0070668_102235732
1144 Ga0070669_100656712
1145 Ga0070669_100972149
1146 Ga0070669_101135878
1147 Ga0070675_100786142
1148 Ga0070675_100789674
1149 Ga0070671_100108695
1150 Ga0070671_100143884
1151 Ga0070671_100153076
1152 Ga0070671_100617238
1153 Ga0070674_100035769
1154 Ga0070674_100203483
1155 Ga0070674_101977399
1156 Ga0070673_100523673
1157 Ga0070673_100947968
1158 Ga0070688_100347130
1159 Ga0070659_100247627
1160 Ga0070659_101490132
1161 Ga0070667_100330264
1162 Ga0070667_100649901
1163 Ga0070667_101064580
1164 Ga0070667_101136131
1165 Ga0070667_101381054
1166 Ga0070709_10175270
1167 Ga0070709_11656940
1168 Ga0070714_100049796
1169 Ga0070713_100027003
1170 Ga0070713_100249794
1171 Ga0070713_102317271
1172 Ga0070710_10529773
1173 Ga0070701_11135060
1174 Ga0070711_101190759
1175 Ga0070711_101310054
1176 Ga0070705_100115633
1177 Ga0070700_100222336
1178 Ga0070700_100755634
1179 Ga0070700_100910998
1180 Ga0070700_101178935
1181 Ga0070700_101755071
1182 Ga0070694_100709412
1183 Ga0070694_101363671
1184 Ga0070708_101468204
1185 Ga0070663_100013100
1186 Ga0070663_100271068
1187 Ga0070663_100414558
1188 Ga0070663_100424252
1189 Ga0070663_100508501
1190 Ga0070663_100524563
1191 Ga0070663_100690787
1192 Ga0070678_100120449
1193 Ga0070678_100296092
1194 Ga0070678_100420135
1195 Ga0070678_101824033
1196 Ga0070662_100699482
1197 Ga0070662_102009465
1198 Ga0070681_10767994
1199 Ga0070681_11809903
1200 Ga0068867_100139211
1201 Ga0068867_100570858
1202 Ga0068867_101153963
1203 Ga0068867_101423045
1204 Ga0070706_101352356
1205 Ga0070706_101922792
1206 Ga0070707_101330901
1207 Ga0070707_101687429
1208 Ga0074259_11235176
1209 Ga0070699_100270931
1210 Ga0070679_100353315
1211 Ga0070679_101778973
1212 Ga0070679_101816483
1213 Ga0070679_101853467
1214 Ga0070684_100199865
1215 Ga0070684_100976703
1216 Ga0070684_101485564
1217 Ga0068853_100091702
1218 Ga0068853_100827006
1219 Ga0068853_101030520
1220 Ga0068853_101172027
1221 Ga0070672_100128188
1222 Ga0070672_100275934
1223 Ga0070672_100319013
1224 Ga0070672_101521830
1225 Ga0070686_100167540
1226 Ga0070695_100573216
1227 Ga0070696_100603039
1228 Ga0070693_100348652
1229 Ga0070693_100421097
1230 Ga0070693_100523589
1231 Ga0070665_100052156
1232 Ga0070665_100116662
1233 Ga0070665_100264723
1234 Ga0070665_100528355
1235 Ga0070665_100697214
1236 Ga0070665_100894752
1237 Ga0070665_100961491
1238 Ga0070665_102327249
1239 Ga0070704_100562524
1240 Ga0070704_101356144
1241 Ga0068855_100540386
1242 Ga0070664_100233733
1243 Ga0070664_100563807
1244 Ga0070664_100915042
1245 Ga0070664_101444035
1246 Ga0070664_102142491
1247 Ga0068857_100304564
1248 Ga0068857_101346706
1249 Ga0068857_102120856
1250 Ga0068854_101702216
1251 Ga0068854_102169475
1252 Ga0068856_100341977
1253 Ga0070702_100040417
1254 Ga0070702_100199111
1255 Ga0068852_100271002
1256 Ga0068852_100501254
1257 Ga0068852_100945819
1258 Ga0068852_101019635
1259 Ga0068859_100537487
1260 Ga0068859_101096821
1261 Ga0068859_101231259
1262 Ga0068859_101328397
1263 Ga0068864_100015580
1264 Ga0068864_101084495
1265 Ga0068866_10134574
1266 Ga0068866_10149312
1267 Ga0068866_10577412
1268 Ga0068866_10801951
1269 Ga0068861_100054513
1270 Ga0068861_100161751
1271 Ga0068861_100939703
1272 Ga0068861_101714088
1273 Ga0068861_102585526
1274 Ga0068851_10063560
1275 Ga0068851_10236844
1276 Ga0068870_10118175
1277 Ga0068870_11073911
1278 Ga0068863_100095029
1279 Ga0068863_101367412
1280 Ga0068863_101826917
1281 Ga0068858_100279556
1282 Ga0068858_101255835
1283 Ga0068860_100120926
1284 Ga0068860_100280027
1285 Ga0068860_100714213
1286 Ga0068860_100799290
1287 Ga0068860_100880996
1288 Ga0068860_101514217
1289 Ga0068860_101803235
1290 Ga0068862_100068047
1291 Ga0068862_100249415
1292 Ga0068862_100364113
1293 Ga0068862_100543574
1294 Ga0068862_102395669
1295 Ga0081455_10059345
1296 Ga0081455_10085186
1297 Ga0081455_10091358
1298 Ga0081455_10157271
1299 Ga0081455_10661721
1300 Ga0081538_10036458
1301 Ga0081538_10178629
1302 Ga0081540_1008342
1303 Ga0081540_1015698
1304 Ga0081540_1017290
1305 Ga0081540_1036212
1306 Ga0081540_1038775
1307 Ga0081540_1039881
1308 Ga0081540_1042788
1309 Ga0081540_1090656
1310 Ga0081539_10000250
1311 Ga0081539_10027360
1312 Ga0070717_11177203
1313 Ga0070717_11536677
1314 Ga0075365_10124448
1315 Ga0075365_10208332
1316 Ga0075365_10424762
1317 Ga0075365_11213792
1318 Ga0075368_10135869
1319 Ga0075368_10322141
1320 Ga0075368_10336462
1321 Ga0075368_10366847
1322 Ga0075363_100010490
1323 Ga0075363_100245357
1324 Ga0075363_100696006
1325 Ga0075364_10204594
1326 Ga0075364_10360801
1327 Ga0075432_10112979
1328 Ga0070715_10596980
1329 Ga0070712_100116165
1330 Ga0070712_100128345
1331 Ga0075362_10057891
1332 Ga0075362_10384171
1333 Ga0075367_10179637
1334 Ga0075367_10490049
1335 Ga0075367_10491414
1336 Ga0075367_11005700
1337 Ga0075369_10102721
1338 Ga0075369_10114089
1339 Ga0075369_10139813
1340 Ga0075369_10262050
1341 Ga0075369_10581258
1342 Ga0075366_10138874
1343 Ga0075366_10427260
1344 Ga0075366_10663099
1345 Ga0075366_10911683
1346 Ga0097621_100199930
1347 Ga0097621_100289583
1348 Ga0097621_100883884
1349 Ga0097621_100956962
1350 Ga0097621_101463304
1351 Ga0097621_101481945
1352 Ga0075370_10019945
1353 Ga0075370_10079596
1354 Ga0075370_10714285
1355 Ga0075370_10817618
1356 Ga0068871_100519093
1357 Ga0068871_100544502
1358 Ga0068871_100603208
1359 Ga0068871_101190226
1360 Ga0068871_101373494
1361 Ga0068871_101855904
1362 Ga0075428_100510071
1363 Ga0075428_100510122
1364 Ga0075428_101960507
1365 Ga0075433_10474788
1366 Ga0075434_100148429
1367 Ga0075434_101235831
1368 Ga0075434_101686681
1369 Ga0075434_102554864
1370 Ga0075429_100749253
1371 Ga0068865_100059750
1372 Ga0068865_101466837
1373 Ga0097620_100537484
1374 Ga0097620_101096807
1375 Ga0097620_101231254
1376 Ga0097620_101328452
1377 Ga0075435_100073102
1378 Ga0075435_100328387
1379 Ga0099794_10015141
1380 Ga0099794_10071065
1381 Ga0099794_10533435
1382 Ga0099794_10582735
1383 Ga0099795_10024086
1384 Ga0099795_10146110
1385 Ga0099795_10153867
1386 Ga0099795_10267970
1387 Ga0099795_10382177
1388 Ga0105251_10150104
1389 Ga0105250_10263427
1390 Ga0105240_10056547
1391 Ga0105240_10980907
1392 Ga0111539_10413324
1393 Ga0111539_11263038
1394 Ga0105245_10371776
1395 Ga0105245_11137307
1396 Ga0105247_10030092
1397 Ga0105247_10993990
1398 Ga0105247_11799318
1399 Ga0114129_10596215
1400 Ga0105243_10187950
1401 Ga0105243_10305641
1402 Ga0105243_10524067
1403 Ga0105243_12462730
1404 Ga0105241_10873457
1405 Ga0105241_11056808
1406 Ga0105241_11452921
1407 Ga0105242_10500990
1408 Ga0105242_11695041
1409 Ga0105248_10134532
1410 Ga0105248_12245364
1411 Ga0105248_13251034
1412 Ga0105237_10044108
1413 Ga0105237_10327371
1414 Ga0105238_10021504
1415 Ga0105238_11022839
1416 Ga0105238_12222247
1417 Ga0105238_12582761
1418 Ga0105249_10318791
1419 Ga0105249_10329500
1420 Ga0105249_11358138
1421 Ga0105249_12503234
1422 Ga0105249_13080748
1423 Ga0105249_13185196
1424 Ga0099796_10030633
1425 Ga0099796_10044637
1426 Ga0099796_10071033
1427 Ga0099796_10204882
1428 Ga0099796_10366441
1429 Ga0105239_10068557
1430 Ga0105239_10231039
1431 Ga0105239_10235272
1432 Ga0105239_11594649
1433 Ga0105239_11912571
1434 Ga0105239_12421753
1435 Ga0105246_10080117
1436 Ga0105246_10454233
1437 Ga0105246_11898268
1438 Ga0157329_1038237
1439 Ga0157319_1007371
1440 Ga0157339_1019518
1441 Ga0157324_1026101
1442 Ga0157315_1012783
1443 Ga0157316_1020230
1444 Ga0157327_1043745
1445 Ga0157373_10376663
1446 Ga0157370_10196716
1447 Ga0157369_10008863
1448 Ga0157374_10103960
1449 Ga0157374_12728831
1450 Ga0157378_10033388
1451 Ga0157378_10269253
1452 Ga0157378_10732788
1453 Ga0163162_10595170
1454 Ga0163162_10677013
1455 Ga0163162_12084573
1456 Ga0157372_11281351
1457 Ga0157375_10115953
1458 Ga0157375_10563992
1459 Ga0157375_10593440
1460 Ga0157375_11310359
1461 Ga0163163_10505882
1462 Ga0163163_10770689
1463 Ga0163163_10846612
1464 Ga0163163_11813233
1465 Ga0163163_12142344
1466 Ga0163163_12626381
1467 Ga0163163_12731432
1468 Ga0163163_12778174
1469 Ga0163163_13047064
1470 Ga0157380_10575887
1471 Ga0157380_10633981
1472 Ga0157380_10883885
1473 Ga0157377_10102760
1474 Ga0157377_10705749
1475 Ga0157377_11505823
1476 Ga0157379_11049582
1477 Ga0157379_11582276
1478 Ga0157376_11341403
1479 Ga0182006_1195969
1480 Ga0163161_10164102
1481 Ga0163161_10231275
1482 Ga0163161_10701139
1483 Ga0207666_1005953
1484 Ga0207673_1057817
1485 Ga0209758_1003248
1486 Ga0209758_1100790
1487 Ga0207426_1117214
1488 Ga0207697_10088123
1489 Ga0207656_10161802
1490 Ga0207656_10231881
1491 Ga0207656_10318112
1492 Ga0207656_10541340
1493 Ga0207653_10017165
1494 Ga0207692_10855360
1495 Ga0207642_10174845
1496 Ga0207642_10670450
1497 Ga0207710_10124295
1498 Ga0207710_10572353
1499 Ga0207710_10631222
1500 Ga0207710_10678253
1501 Ga0207688_10131777
1502 Ga0207688_10139039
1503 Ga0207688_10803318
1504 Ga0207680_10352686
1505 Ga0207680_11014252
1506 Ga0207647_10059219
1507 Ga0207647_10336143
1508 Ga0207647_10425511
1509 Ga0207685_10107246
1510 Ga0207685_10531986
1511 Ga0207699_10188350
1512 Ga0207645_10054365
1513 Ga0207645_10892462
1514 Ga0207643_10446754
1515 Ga0207643_10646043
1516 Ga0207705_10070774
1517 Ga0207705_10234829
1518 Ga0207705_11002122
1519 Ga0207684_10683650
1520 Ga0207654_10139023
1521 Ga0207654_10972707
1522 Ga0207707_10001296
1523 Ga0207707_11278168
1524 Ga0207707_11390282
1525 Ga0207707_11514370
1526 Ga0207695_10141586
1527 Ga0207671_10007041
1528 Ga0207671_10021353
1529 Ga0207671_10090815
1530 Ga0207671_10525160
1531 Ga0207671_10750540
1532 Ga0207693_10238814
1533 Ga0207693_10601704
1534 Ga0207693_10902417
1535 Ga0207663_11172069
1536 Ga0207660_10236701
1537 Ga0207662_10150616
1538 Ga0207657_10006577
1539 Ga0207657_10099572
1540 Ga0207657_10328099
1541 Ga0207657_10686784
1542 Ga0207652_10005830
1543 Ga0207652_10565730
1544 Ga0207652_11882082
1545 Ga0207646_10411737
1546 Ga0207681_10355557
1547 Ga0207681_10484612
1548 Ga0207681_11061231
1549 Ga0207681_11838165
1550 Ga0207694_10021768
1551 Ga0207650_11172776
1552 Ga0207659_10689390
1553 Ga0207687_10047614
1554 Ga0207687_10653290
1555 Ga0207687_11292987
1556 Ga0207700_10181994
1557 Ga0207700_11655817
1558 Ga0207664_10053225
1559 Ga0207644_10139855
1560 Ga0207644_10178407
1561 Ga0207644_10654807
1562 Ga0207644_11133163
1563 Ga0207644_11874270
1564 Ga0207690_11059863
1565 Ga0207690_11680042
1566 Ga0207706_10147379
1567 Ga0207706_10303642
1568 Ga0207686_10067968
1569 Ga0207686_10128413
1570 Ga0207709_10618891
1571 Ga0207709_10679494
1572 Ga0207709_10947829
1573 Ga0207709_11237835
1574 Ga0207709_11485905
1575 Ga0207709_11498274
1576 Ga0207670_10212249
1577 Ga0207670_11780040
1578 Ga0207669_10186486
1579 Ga0207669_10989203
1580 Ga0207704_10419584
1581 Ga0207704_10520919
1582 Ga0207704_10870111
1583 Ga0207665_10282255
1584 Ga0207665_10296379
1585 Ga0207691_10203451
1586 Ga0207691_10229936
1587 Ga0207691_10395247
1588 Ga0207691_11244095
1589 Ga0207711_10097167
1590 Ga0207711_11085016
1591 Ga0207711_11490963
1592 Ga0207711_12054854
1593 Ga0207689_10265797
1594 Ga0207689_10433652
1595 Ga0207661_10882891
1596 Ga0207661_11958729
1597 Ga0207679_10143113
1598 Ga0207679_11091237
1599 Ga0207679_11278282
1600 Ga0207667_10016602
1601 Ga0207667_10187627
1602 Ga0207667_12095436
1603 Ga0207651_10052362
1604 Ga0207651_10309802
1605 Ga0207651_10373534
1606 Ga0207712_10153225
1607 Ga0207712_10176190
1608 Ga0207712_10928483
1609 Ga0207712_11560303
1610 Ga0207668_10044453
1611 Ga0207668_10127417
1612 Ga0207668_10369048
1613 Ga0207668_10776993
1614 Ga0207668_10875234
1615 Ga0207668_12074572
1616 Ga0207640_10187831
1617 Ga0207640_11001413
1618 Ga0207658_10788810
1619 Ga0207658_10797588
1620 Ga0207658_11212127
1621 Ga0207677_10106238
1622 Ga0207677_10412277
1623 Ga0207677_10565046
1624 Ga0207677_10918699
1625 Ga0207677_11582778
1626 Ga0207703_10194577
1627 Ga0207703_10878123
1628 Ga0207703_11604930
1629 Ga0207639_10010311
1630 Ga0207639_10360292
1631 Ga0207639_11262454
1632 Ga0207678_10046087
1633 Ga0207678_10075216
1634 Ga0207678_10422761
1635 Ga0207678_10626163
1636 Ga0207708_10068571
1637 Ga0207708_10182740
1638 Ga0207708_11219144
1639 Ga0207708_11291791
1640 Ga0207708_11397104
1641 Ga0207702_10268605
1642 Ga0207641_10243298
1643 Ga0207641_10530704
1644 Ga0207648_10096241
1645 Ga0207648_10518567
1646 Ga0207648_10603133
1647 Ga0207648_11492787
1648 Ga0207676_10307677
1649 Ga0207676_10742310
1650 Ga0207674_10020322
1651 Ga0207674_10904543
1652 Ga0207674_11017537
1653 Ga0207674_11952169
1654 Ga0207675_100365563
1655 Ga0207675_100470939
1656 Ga0207675_101264848
1657 Ga0207675_101527425
1658 Ga0207683_10231004
1659 Ga0207683_10798166
1660 Ga0207683_11018550
1661 Ga0207683_11111858
1662 Ga0207683_11440154
1663 Ga0207683_12085076
1664 Ga0207683_12118679
1665 Ga0207683_12129910
1666 Ga0207698_10319600
1667 Ga0207698_11352015
1668 Ga0207698_11985946
1669 Ga0209179_1014850
1670 Ga0209588_1008437
1671 Ga0209588_1118074
1672 Ga0209813_10276116
1673 Ga0209813_10279577
1674 Ga0207428_10147578
1675 Ga0207428_10148303
1676 Ga0207428_11231705
1677 Ga0268266_10003299
1678 Ga0268266_10078801
1679 Ga0268266_10097490
1680 Ga0268266_10199713
1681 Ga0268266_10203997
1682 Ga0268266_11612321
1683 Ga0268266_12339539
1684 Ga0268265_10033437
1685 Ga0268265_10319465
1686 Ga0268265_10366021
1687 Ga0268265_10454080
1688 Ga0268265_11790336
1689 Ga0268265_12624191
1690 Ga0268265_12704483
1691 Ga0268264_10320190
1692 Ga0268264_10906165
1693 Ga0268264_11311671
1694 Ga0307517_10000111
1695 Ga0307515_10693750
1696 Ga0307515_10743823
1697 Ga0307512_10183786
1698 Ga0307513_10142176
1699 Ga0307513_10746781
1700 Ga0307513_10873143
1701 Ga0307509_10182348
1702 Ga0307509_10378568
1703 Ga0307408_100727373
1704 Ga0307408_102056266
1705 Ga0307408_102058627
1706 Ga0307508_10193310
1707 Ga0307514_10393519
1708 Ga0265314_10212953
1709 Ga0307516_10274467
1710 Ga0307516_10543843
1711 Ga0307516_10942883
1712 Ga0307405_10127189
1713 Ga0307405_11271117
1714 Ga0307405_11475263
1715 Ga0307405_11781070
1716 Ga0307413_10063826
1717 Ga0307410_10872448
1718 Ga0307406_10774699
1719 Ga0307406_11800236
1720 Ga0307407_10688655
1721 Ga0307407_11078630
1722 Ga0307412_11171244
1723 Ga0307412_11408515
1724 Ga0307412_11959541
1725 Ga0307409_100794455
1726 Ga0307409_101105173
1727 Ga0307409_101593008
1728 Ga0307416_100391769
1729 Ga0307416_100437814
1730 Ga0307416_101890916
1731 Ga0307416_101892393
1732 Ga0307414_10598903
1733 Ga0307411_10021434
1734 Ga0307411_11442893
1735 Ga0307411_12144179
1736 Ga0307415_100369973
1737 Ga0307415_100577568
1738 Ga0307510_10002750
1739 Ga0307510_10149085
1740 Ga0307510_10575475
1741 Ga0373958_0071218
1742 Ga0373959_0143984
1743 Ga0373934_0002075
1744 Ga0373934_0169542
1745 Ga0373940_0187135
1746 Ga0373949_0139892
1747 Ga0373951_0225526
1748 Ga0373952_0003893
1749 Ga0373923_0001160
1750 Ga0373923_0012462
1751 Ga0373932_0065719
1752 Ga0373936_0505177
1753 Ga0373939_0505722
1754 Ga0373953_0000167
1755 Ga0373953_0090502
1756 Ga0373953_0561520
1757 Ga0373954_0000035
1758 Ga0373954_0053470
1759 Ga0373956_0016799
1760 Ga0373956_0024009
1761 Ga0373957_0001600
1762 Ga0373957_0034223
1763 Ga0373957_0482519
1764 Ga0373943_0017761
1765 Ga0373943_0443437
1766 Ga0373946_0354120
1767 Ga0373955_0014576
1768 Ga0373955_0101864
1769 Ga0373955_0134921
1770 Ga0373942_0162658
1771 Ga0373962_0392675
1772 Ga0373924_0014763
1773 Ga0373924_0139489
1774 Ga0373931_0299093
1775 Ga0373931_0303577
1776 Ga0373931_0618681
1777 Ga0373935_0213088
1778 Ga0373935_0382096
1779 Ga0373935_0857116
1780 Ga0373935_1005982
1781 Ga0373927_0219366
1782 Ga0373927_0286865
1783 Ga0373933_0000037
1784 Ga0373933_0034742
1785 Ga0373933_0149863
1786 Ga0373947_0067044
1787 Ga0373947_0747020
1788 Ga0373947_0811807
1789 Ga0373937_0000118
1790 Ga0373937_0387534
1791 Ga0373937_1072673
1792 Ga0373937_1159549
1793 Ga0373937_1198145
1794 Ga0373925_0086267
1795 Ga0373925_0649556
1796 Ga0439461_0090154
1797 Ga0439465_0014802
1798 Ga0451787_361978
1799 Ga0451793_0004900
1800 Ga0451797_0902045
1801 Ga0451795_1326094
1802 Ga0451804_0442419
1803 Ga0451835_0544806
1804 Ga0451843_0073144
1805 Ga0451855_0044892
1806 Ga0451853_0747090
1807 Ga0451853_1128668
1808 Ga0451853_3276822
1809 Ga0439431_0060257
1810 Ga0439431_0219014
1811 Ga0439431_0221951
1812 Ga0439445_0164856
1813 Ga0439445_0249223
1814 Ga0439454_023123
1815 Ga0439458_0055355
1816 Ga0439459_0190058
1817 Ga0439440_0139380
1818 Ga0451576_2173644
1819 Ga0495617_093944
1820 Ga0495592_0002185
1821 Ga0495592_0256997
1822 Ga0495603_0231552
1823 Ga0495603_0394247
1824 Ga0495603_0685023
1825 Ga0495590_0050004
1826 Ga0495591_110392
1827 Ga0495629_0861157
1828 Ga0495629_1137534
1829 Ga0495638_0281421
1830 Ga0495641_0079949
1831 Ga0495651_0000412
1832 Ga0495651_0132930
1833 Ga0495651_0996625
1834 Ga0495653_0000161
1835 Ga0495653_0724475
1836 Ga0495650_0168162
1837 Ga0495580_0121307
1838 Ga0495582_0153241
1839 Ga0495605_0351132
1840 Ga0495639_0114216
1841 Ga0495639_0255963
1842 Ga0495639_0327468
1843 Ga0495639_0556149
1844 Ga0495662_0392443
1845 Ga0495664_0070855
1846 Ga0495584_0210877
1847 Ga0495585_0121514
1848 Ga0495594_0517753
1849 Ga0495594_0543729
1850 Ga0495596_0086424
1851 Ga0495596_0324870
1852 Ga0495596_0450133
1853 Ga0495583_0174650
1854 Ga0495608_0000337
1855 Ga0495608_0014802
1856 Ga0495608_0278922
1857 Ga0495610_0227769
1858 Ga0495616_0122446
1859 Ga0495616_0442681
1860 Ga0495618_0016579
1861 Ga0495618_0135194
1862 Ga0495628_0052165
1863 Ga0495628_0259781
1864 Ga0495628_0951891
1865 Ga0495630_0529119
1866 Ga0495630_0795990
1867 Ga0495631_0277209
1868 Ga0495631_0293124
1869 Ga0495632_0164845
1870 Ga0495644_0073785
1871 Ga0495644_0160269
1872 Ga0495648_0458640
1873 Ga0495666_0123258
1874 Ga0495652_0012092
1875 Ga0495652_0094557
1876 Ga0495652_1145000
1877 Ga0495652_1159737
1878 Ga0495654_0379405
1879 Ga0495640_0004805
1880 Ga0495640_0643437
1881 Ga0495587_0000668
1882 Ga0495587_0011627
1883 Ga0495587_0793142
1884 Ga0495598_0356065
1885 Ga0495598_0381944
1886 Ga0495609_0088709
1887 Ga0495609_0162662
1888 Ga0495621_0220021
1889 Ga0495597_0098168
1890 Ga0495597_0375725
1891 Ga0495645_0050107
1892 Ga0495645_0443762
1893 Ga0495633_0213849
1894 Ga0495633_0479939
1895 Ga0495667_0000147
1896 Ga0495667_0067315
1897 Ga0495656_0136760
1898 Ga0495656_0310088
1899 Ga0495656_0802881
1900 Ga0495668_0138438
1901 Ga0495668_0184604
1902 Ga0495668_0560840
1903 Ga0495668_0602327
1904 Ga0495668_0674857
1905 Ga0495634_0035144
1906 Ga0495634_0057519
1907 Ga0495634_0554755
1908 Ga0495625_0421074
1909 Ga0495625_0644339
1910 Ga0495635_0000094
1911 Ga0495635_0507277
1912 Ga0495635_0951724
1913 Ga0495659_0067824
1914 Ga0495659_0268733
1915 Ga0495661_0340704
1916 Ga0495661_0528811
1917 Ga0495588_0145728
1918 Ga0495657_0001420
1919 Ga0495657_0282650
1920 Ga0495657_0369058
1921 Ga0495599_0000253
1922 Ga0495599_0164784
1923 Ga0495623_0000768
1924 Ga0495623_0055642
1925 Ga0495623_0699203
1926 Ga0495623_0706073
1927 Ga0495646_0002668
1928 Ga0495646_0450837
1929 Ga0495647_0097997
1930 Ga0495647_0497878
1931 Ga0495658_0322373
1932 Ga0495669_0036463
1933 Ga0495669_0088254
1934 Ga0495613_1069896
1935 Ga0495624_0149894
1936 Ga0495624_0241288
1937 Ga0495670_0290313
1938 Ga0495671_0363658
1939 Ga0495671_0566675
1940 Ga0495671_0583689
1941 Ga0495649_0105324
1942 Ga0495649_0442214
1943 Ga0495649_0550075
1944 Ga0495589_0235900
1945 Ga0495589_0394538
1946 Ga0495600_0002207
1947 Ga0495600_0369202
1948 Ga0495600_0582800
1949 Ga0495660_0143205
1950 Ga0495581_0602791
1951 Ga0495604_0000253
1952 Ga0495636_0309672
1953 Ga0495674_0054162
1954 Ga0495674_0102638
1955 Ga0495674_0329410
1956 Ga0495674_1051330
1957 Ga0495672_0013492
1958 Ga0495672_0081335
1959 Ga0495672_0175059
1960 Ga0495672_0402271
1961 Ga0495676_1107803
1962 Ga0495680_0000406
1963 Ga0495680_0327964
1964 Ga0495680_0539252
1965 Ga0495683_0238763
1966 Ga0495687_091360
1967 Ga0495675_0000285
1968 Ga0495675_0049747
1969 Ga0495677_0110844
1970 Ga0495677_0206329
1971 Ga0495679_160964
1972 Ga0495685_058173
1973 Ga0495685_266775
1974 Ga0495673_0115167
1975 Ga0495681_0076354
1976 Ga0495681_0095808
1977 Ga0495681_0301169
1978 Ga0495684_0000184
1979 Ga0495684_0233186
1980 Ga0495686_0090259
1981 Ga0495686_0227621
1982 Ga0495686_0630557
1983 Ga0495593_0004547
1984 Ga0495593_0199426
1985 Ga0495602_0001148
1986 Ga0495602_0535799
1987 Ga0495602_0660732
1988 Ga0495614_0073214
1989 Ga0495615_0166699
1990 Ga0495626_0408273
1991 Ga0496100_0008823
1992 Ga0496101_0014849
1993 Ga0496101_0323360
1994 Ga0496101_0774286
1995 Ga0496101_0810263
1996 Ga0496101_1155972
1997 Ga0496102_0189199
1998 Ga0496102_1713055
1999 Ga0496103_0038610
2000 Ga0496103_0195116
2001 Ga0496103_0528152
2002 Ga0496104_0093215
2003 Ga0496104_0459544
2004 Ga0496105_0003152
2005 Ga0496105_1199023
2006 Ga0496106_0022284
2007 Ga0496106_0150896
2008 Ga0496106_0473586
2009 Ga0496106_0743231
2010 Ga0496106_1025059
2011 Ga0496107_0009868
2012 Ga0496107_0161008
2013 Ga0496107_0484043
2014 Ga0496108_0002970
2015 Ga0496108_0179011
2016 Ga0496108_0359664
2017 Ga0496109_0053669
2018 Ga0496109_0622928
2019 Ga0496109_1514838
2020 Ga0496110_0016721
2021 Ga0496110_0869899
2022 Ga0496110_0893196
2023 Ga0496110_1341762
2024 Ga0496111_0059366
2025 Ga0496111_0345933
2026 Ga0496111_0571759
2027 Ga0496111_1117148
2028 Ga0496112_0029342
2029 Ga0496112_0133971
2030 Ga0496112_1345572
2031 Ga0496113_0143874
2032 Ga0496113_0328911
2033 Ga0496114_0032361
2034 Ga0496114_0761098
2035 Ga0496115_0000957
2036 Ga0496115_0059888
2037 Ga0496115_0264860
2038 Ga0496115_1258980
2039 Ga0496116_0221890
2040 Ga0496118_0222637
2041 Ga0496119_0133349
2042 Ga0496120_0138175
2043 Ga0496120_0168153
2044 Ga0496121_0002482
2045 Ga0496121_0107938
2046 Ga0496121_0118614
2047 Ga0496121_0206211
2048 Ga0496121_0215362
2049 Ga0496121_0251661
2050 Ga0496122_0059028
2051 Ga0496124_0127104
2052 Ga0496124_0155626
2053 Ga0496124_0169588
2054 Ga0496125_0388930
2055 Ga0496126_0003507
2056 Ga0496126_0179446
2057 Ga0496126_0296562
2058 Ga0496126_0323724
2059 Ga0496126_0922515
2060 Ga0495682_0049862
2061 Ga0495682_0197417
2062 Ga0501036_0836773
2063 Ga0501040_0374169
2064 Ga0501041_0803689
2065 Ga0501067_0194661
2066 Ga0501067_0238070
2067 Ga0501068_0585333
2068 Ga0501069_0516997
2069 Ga0501073_0536431
2070 Ga0501076_0840678
2071 Ga0501233_272934
2072 Ga0501221_236068
2073 Ga0501080_1585072
2074 Ga0501045_0594413
2075 nmdc:mga03683_254646_c1
2076 nmdc:mga03683_373442_c1
2077 nmdc:mga03683_517733_c1
2078 nmdc:mga00v17_1083817_c1
2079 nmdc:mga00v17_174547_c1
2080 nmdc:mga0yw44_338364_c1
2081 nmdc:mga0k408_156232_c1
2082 nmdc:mga0k408_884006_c1
2083 nmdc:mga0k408_90156_c1
2084 nmdc:mga0k408_95334_c1
2085 nmdc:mga06z11_391469_c1
2086 nmdc:mga04h51_314520_c1
2087 nmdc:mga07m45_714590_c1
2088 nmdc:mga07m45_733380_c1
2089 nmdc:mga07m45_79028_c1
2090 nmdc:mga07m45_856490_c1
2091 nmdc:mga05p37_1891486_c1
2092 nmdc:mga05p37_225957_c1
2093 nmdc:mga09592_405295_c1
2094 nmdc:mga06r32_627492_c1
2095 nmdc:mga08y16_268682_c1
2096 nmdc:mga08y16_424398_c1
2097 nmdc:mga08y16_692166_c1
2098 nmdc:mga0n895_1655123_c1
2099 nmdc:mga0rr50_127900_c1
2100 nmdc:mga0rr50_814279_c1
2101 nmdc:mga0a205_879088_c1
2102 nmdc:mga0a205_883808_c1
2103 nmdc:mga0sz30_110639_c1
2104 Ga0495601_0043689
2105 Ga0495601_0206412
2106 Ga0495601_0329454
2107 Ga0495601_0601917
2108 Ga0495612_0082575
2109 Ga0495612_0438119
2110 Ga0500610_0213490
2111 Ga0500635_0293960
2112 Ga0495655_0221431
2113 Ga0495655_0344992
2114 Ga0495595_0008133
2115 Ga0495595_0192588
2116 Ga0495619_0000209
2117 Ga0495619_0391141
2118 Ga0495619_1054480
2119 Ga0500644_0514807
2120 Ga0500646_0347305
2121 Ga0500583_0389234
2122 Ga0500651_0110766
2123 Ga0500641_0141711
2124 Ga0500641_0360881
2125 Ga0500650_0395857
2126 Ga0500654_172893
2127 Ga0500555_115498
2128 Ga0500569_036328
2129 Ga0500582_121064
2130 Ga0500594_0175310
2131 Ga0500595_046440
2132 Ga0500628_191124
2133 Ga0500652_385402
2134 Ga0500658_0360256
2135 Ga0500561_0224405
2136 Ga0500568_0040378
2137 Ga0500577_0271440
2138 Ga0500588_0242333
2139 Ga0500589_144523
2140 Ga0500589_300838
2141 Ga0500590_104433
2142 Ga0500604_0288581
2143 Ga0500604_0364748
2144 Ga0500616_0440495
2145 Ga0500620_236677
2146 Ga0500622_0436083
2147 Ga0500627_0409393
2148 Ga0500633_0069023
2149 Ga0500634_0266595
2150 Ga0500636_0226509
2151 Ga0500645_107407
2152 Ga0500609_034210
2153 Ga0500656_074785
2154 Ga0500587_071477
2155 Ga0501084_1220089
2156 Ga0501082_1124301
2157 2524466923
2158 2793077270
2159 2876809508
2160 2879118514
2161 2889040572
2162 2922367701
2163 2922392403
2164 8006988145
2165 8056674504
2166 8056685345

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l85-assembly1.cif.gz_A the sodium-dependent phosphate transporter 0.9135 20 70
8b6h-assembly1.cif.gz_EG cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.8063 15 70
8b6h-assembly1.cif.gz_EG cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.6508 15 70
3zo6-assembly1.cif.gz_M crystal structure of bacillus pseudofirmus of4 mutant atp synthase c12 ring. 0.6369 15 69
3m6k-assembly1.cif.gz_A crystal structure of n-terminal 44 kda fragment of topoisomerase v in the presence of guanidium hydrochloride 0.6365 22 59
ID Description Score Start End Superfamily
af_Q2FVI8_12_124_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9617 21 62 1.20.1280.290
af_Q54D80_1_349_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9498 27 58 3.40.1190.20
af_P9WMS9_2_118_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9454 21 68 1.10.287.70
af_P77682_7_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.941 21 68 1.20.1280.290
af_Q59SL4_3_181_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.896 27 70 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A850E335-F1-model_v4 deleted 0.9916 20 71
AF-A0A2G6HJW1-F1-model_v4 GtrA/DPMS transmembrane domain-containing protein 0.984 11 65 GO:0000271
GO:0016020
AF-A0A3A3ZIW7-F1-model_v4 GtrA family protein 0.9811 12 64 GO:0000271
GO:0005886
AF-A0A120HNG3-F1-model_v4 Polysaccharide biosynthesis protein 0.9796 12 71 GO:0016020
AF-A0A4R6RGP2-F1-model_v4 Uncharacterized protein (DUF983 family) 0.9793 20 65 GO:0016020

Map