F489717

General Info

Members Datasets Scaffolds Average Seq Length
1083 368 1052 242

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10215605|Ga0163161_102156051
Length 280
Sequence LICNRQYHQYLSIITNQFQDMLSIKKIKCLVIDDEQPARDILHKHIDGVESLELTGSCNNAVEALSFLQSNTVDLLFLDIQMPHILGTNFIRTLKNPPKVIFTTAYRKYAIEGFELDAVDFLLKPISFDRFLKAVNKILQLNLQSNLPEPDKSESMKEPAQPFLYFRSDRKMVKVLFNDILYIEGLRDYIKIFTTSKIIVTKHLLSSLQEMLPADSFLRIHRSYIISISKIDSYNADSIEISKKELPIGRMYKNDVNKLLNSSSLDSNLKKNTKDFNSTK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
4 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
5 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
6 2738541278 Niastella sp. CF465 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
9 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
10 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
11 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
12 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
15 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
16 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
17 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
18 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
19 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
20 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
21 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
22 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
23 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
24 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
25 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
26 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
27 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
28 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
35 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
50 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
51 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
155 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
156 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
222 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
225 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
230 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
255 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
256 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
257 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
260 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
261 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
262 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
263 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
324 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
330 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
331 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
332 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
333 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
334 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
335 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
336 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
337 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
340 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
352 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
353 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
354 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
355 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
356 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
357 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
358 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
359 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
360 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
361 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
362 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
363 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
364 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
368 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.66
Nodule 0
Rhizoplane 0.55
Rhizosphere 84.86
Stem 0
Stem Tuber 0
Unclassified 6.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1761633 2162886007 Bacteria 195701
2 JGI24740J21852_10003050 3300001979 Bacteria 7403
3 JGI24739J22299_10000854 3300001989 Bacteria 11220
4 JGI24739J22299_10041297 3300001989 Bacteria 1535
5 JGI24739J22299_10048706 3300001989 Bacteria 1377
6 JGI24735J21928_10000004 3300002067 Bacteria 381713
7 JGI24751J29686_10012501 3300002459 Unclassified 1750
8 JGI25154J39366_1000001 3300002738 Bacteria 483450
9 JGI25158J39367_1008471 3300002739 Bacteria 1429
10 JGI25157J39369_1004584 3300002741 Bacteria 2464
11 JGI25157J39369_1005924 3300002741 Bacteria 1921
12 JGI25153J46596_10005860 3300003215 Bacteria 6366
13 JGI25153J46596_10072175 3300003215 Bacteria 889
14 rootH1_10035387 3300003316 Bacteria 1994
15 rootH1_10089594 3300003316 Bacteria 1959
16 rootH1_10152184 3300003316 Bacteria 1786
17 rootH1_10171005 3300003316 Bacteria 1378
18 rootH2_10016087 3300003320 Bacteria 4315
19 rootH2_10024764 3300003320 Bacteria 50525
20 rootH2_10097190 3300003320 Bacteria 5351
21 rootL2_10056586 3300003322 Bacteria 7772
22 rootL2_10084252 3300003322 Unclassified 1344
23 rootL2_10107136 3300003322 Bacteria 1448
24 rootL2_10171357 3300003322 Bacteria 4145
25 rootL2_10206605 3300003322 Bacteria 2879
26 rootL2_10352985 3300003322 Bacteria 1678
27 rootH1_10000759 3300003323 Bacteria 51501
28 rootH1_10000976 3300003323 Bacteria 12600
29 rootH1_10008757 3300003323 Bacteria 5802
30 rootH1_10209329 3300003323 Bacteria 6768
31 rootH1_10209779 3300003323 Bacteria 1521
32 rootH1_10243959 3300003323 Bacteria 2801
33 rootH1_10374623 3300003323 Bacteria 1206
34 JGI25160J50197_1003397 3300003354 Bacteria 7134
35 JGI25160J50197_1004076 3300003354 Bacteria 6360
36 JGI25160J50197_1015650 3300003354 Bacteria 2482
37 JGI25160J50197_1034227 3300003354 Bacteria 1265
38 Ga0055526_1014997 3300003771 Bacteria 3140
39 Ga0055526_1015094 3300003771 Bacteria 3121
40 Ga0055536_1014199 3300003781 Unclassified 2815
41 Ga0055528_1000278 3300003790 Bacteria 43601
42 Ga0055530_10003481 3300003791 Bacteria 8923
43 Ga0055531_10000148 3300003794 Bacteria 80963
44 Ga0055531_10002422 3300003794 Bacteria 12490
45 Ga0055531_10016402 3300003794 Bacteria 3197
46 Ga0065165_1000010 3300005262 Bacteria 323737
47 Ga0065165_1001093 3300005262 Bacteria 32227
48 Ga0065165_1014272 3300005262 Bacteria 3095
49 Ga0065714_10007502 3300005288 Bacteria 4297
50 Ga0065714_10022017 3300005288 Bacteria 1256
51 Ga0065714_10064431 3300005288 Bacteria 135024
52 Ga0065704_10000195 3300005289 Bacteria 195830
53 Ga0065704_10073560 3300005289 Bacteria 7015
54 Ga0065704_10148664 3300005289 Bacteria 1449
55 Ga0065712_10027579 3300005290 Bacteria 1290
56 Ga0065712_10069410 3300005290 Bacteria 7353
57 Ga0065712_10069552 3300005290 Bacteria 7064
58 Ga0065712_10236413 3300005290 Unclassified 996
59 Ga0065715_10116182 3300005293 Bacteria 2389
60 Ga0065707_10126201 3300005295 Bacteria 2008
61 Ga0070658_10050583 3300005327 Bacteria 3368
62 Ga0070676_10238440 3300005328 Unclassified 1208
63 Ga0070683_100005303 3300005329 Bacteria 10741
64 Ga0070683_100006292 3300005329 Bacteria 9964
65 Ga0070683_100010600 3300005329 Bacteria 7923
66 Ga0070683_100023042 3300005329 Bacteria 5569
67 Ga0070683_100039199 3300005329 Unclassified 4348
68 Ga0070690_100008412 3300005330 Bacteria 5941
69 Ga0070690_100375635 3300005330 Unclassified 1038
70 Ga0070670_100005179 3300005331 Bacteria 10975
71 Ga0070670_100010624 3300005331 Bacteria 7864
72 Ga0070670_100019943 3300005331 Bacteria 5755
73 Ga0070670_100021066 3300005331 Bacteria 5607
74 Ga0070670_100027115 3300005331 Unclassified 4927
75 Ga0070670_100101770 3300005331 Bacteria 2474
76 Ga0070670_100285043 3300005331 Bacteria 1443
77 Ga0070677_10076581 3300005333 Bacteria 1421
78 Ga0070677_10185258 3300005333 Bacteria 994
79 Ga0068869_100004357 3300005334 Bacteria 8787
80 Ga0068869_100059516 3300005334 Bacteria 2797
81 Ga0068869_100063547 3300005334 Bacteria 2713
82 Ga0068869_100299674 3300005334 Unclassified 1298
83 Ga0068869_100406633 3300005334 Bacteria 1121
84 Ga0068869_100642772 3300005334 Bacteria 900
85 Ga0070666_10031661 3300005335 Unclassified 3492
86 Ga0070666_10037322 3300005335 Bacteria 3230
87 Ga0070666_10071460 3300005335 Bacteria 2362
88 Ga0070666_10216582 3300005335 Bacteria 1350
89 Ga0070666_10377066 3300005335 Bacteria 1018
90 Ga0070680_100053462 3300005336 Bacteria 3297
91 Ga0070680_100333483 3300005336 Bacteria 1288
92 Ga0070680_100355947 3300005336 Bacteria 1245
93 Ga0070680_100429040 3300005336 Bacteria 1128
94 Ga0070682_100049572 3300005337 Bacteria 2618
95 Ga0068868_100070337 3300005338 Bacteria 2790
96 Ga0068868_100108996 3300005338 Unclassified 2248
97 Ga0068868_100298576 3300005338 Unclassified 1368
98 Ga0068868_100411187 3300005338 Bacteria 1169
99 Ga0070660_100000519 3300005339 Bacteria 25704
100 Ga0070689_100022207 3300005340 Bacteria 4736
101 Ga0070689_100033280 3300005340 Bacteria 3926
102 Ga0070689_100141592 3300005340 Bacteria 1934
103 Ga0070689_100280994 3300005340 Bacteria 1381
104 Ga0070689_100316251 3300005340 Unclassified 1303
105 Ga0070689_100660105 3300005340 Bacteria 910
106 Ga0070687_100025075 3300005343 Unclassified 2856
107 Ga0070687_100168757 3300005343 Bacteria 1301
108 Ga0070661_100037377 3300005344 Bacteria 3532
109 Ga0070661_100076665 3300005344 Unclassified 2464
110 Ga0070692_10076047 3300005345 Bacteria 1799
111 Ga0070668_100040034 3300005347 Bacteria 3585
112 Ga0070668_100063469 3300005347 Bacteria 2863
113 Ga0070668_100128182 3300005347 Unclassified 2034
114 Ga0070668_100146819 3300005347 Bacteria 1904
115 Ga0070668_100210811 3300005347 Bacteria 1598
116 Ga0070669_100074078 3300005353 Bacteria 2524
117 Ga0070669_100296295 3300005353 Bacteria 1300
118 Ga0070669_100359962 3300005353 Bacteria 1183
119 Ga0070675_100033260 3300005354 Bacteria 4180
120 Ga0070675_100180486 3300005354 Bacteria 1825
121 Ga0070675_100183207 3300005354 Bacteria 1811
122 Ga0070675_100375560 3300005354 Bacteria 1264
123 Ga0070671_100035739 3300005355 Bacteria 4116
124 Ga0070671_100062198 3300005355 Bacteria 3109
125 Ga0070671_100107854 3300005355 Bacteria 2338
126 Ga0070671_100318746 3300005355 Bacteria 1325
127 Ga0070671_100359829 3300005355 Unclassified 1242
128 Ga0070671_100387078 3300005355 Bacteria 1195
129 Ga0070674_100061294 3300005356 Unclassified 2625
130 Ga0070674_100073427 3300005356 Bacteria 2425
131 Ga0070674_100303210 3300005356 Bacteria 1274
132 Ga0070673_100012549 3300005364 Bacteria 5821
133 Ga0070673_100015208 3300005364 Bacteria 5396
134 Ga0070673_100195777 3300005364 Bacteria 1738
135 Ga0070673_100200682 3300005364 Bacteria 1717
136 Ga0070673_100215003 3300005364 Bacteria 1661
137 Ga0070673_100231825 3300005364 Bacteria 1602
138 Ga0070688_100012275 3300005365 Bacteria 4795
139 Ga0070688_100049537 3300005365 Bacteria 2614
140 Ga0070688_100239052 3300005365 Unclassified 1288
141 Ga0070667_100056492 3300005367 Bacteria 3316
142 Ga0070667_100070796 3300005367 Bacteria 2969
143 Ga0070667_100116847 3300005367 Bacteria 2317
144 Ga0070667_100178140 3300005367 Bacteria 1879
145 Ga0070667_100235187 3300005367 Unclassified 1635
146 Ga0070667_100441188 3300005367 Bacteria 1189
147 Ga0070667_100797971 3300005367 Bacteria 876
148 Ga0070700_100077071 3300005441 Bacteria 2143
149 Ga0070700_100230312 3300005441 Unclassified 1318
150 Ga0070678_100433016 3300005456 Bacteria 1149
151 Ga0070662_100016718 3300005457 Bacteria 4931
152 Ga0070681_10036122 3300005458 Bacteria 4963
153 Ga0070681_10118004 3300005458 Unclassified 2590
154 Ga0070681_10348521 3300005458 Bacteria 1391
155 Ga0070681_10730906 3300005458 Bacteria 906
156 Ga0068867_100003722 3300005459 Bacteria 10733
157 Ga0068867_100122941 3300005459 Unclassified 2008
158 Ga0068867_100140091 3300005459 Bacteria 1890
159 Ga0068867_100268680 3300005459 Bacteria 1393
160 Ga0068867_100529416 3300005459 Unclassified 1017
161 Ga0070685_10084911 3300005466 Bacteria 1905
162 Ga0070685_10263973 3300005466 Bacteria 1146
163 Ga0070698_100008374 3300005471 Bacteria 11176
164 Ga0070698_100157042 3300005471 Bacteria 2220
165 Ga0070699_100131640 3300005518 Bacteria 2205
166 Ga0070699_100416452 3300005518 Bacteria 1216
167 Ga0070679_100011937 3300005530 Bacteria 8293
168 Ga0070679_100064943 3300005530 Bacteria 3638
169 Ga0070679_100084235 3300005530 Bacteria 3168
170 Ga0070679_100106752 3300005530 Bacteria 2786
171 Ga0070679_100171751 3300005530 Unclassified 2140
172 Ga0070684_100016467 3300005535 Bacteria 6044
173 Ga0070684_100022390 3300005535 Bacteria 5270
174 Ga0070684_100024874 3300005535 Bacteria 5026
175 Ga0070697_100477518 3300005536 Unclassified 1088
176 Ga0068853_100017196 3300005539 Bacteria 5968
177 Ga0068853_100044306 3300005539 Bacteria 3809
178 Ga0068853_100083133 3300005539 Bacteria 2805
179 Ga0068853_100118647 3300005539 Bacteria 2358
180 Ga0068853_100218350 3300005539 Bacteria 1740
181 Ga0070672_100120391 3300005543 Bacteria 2148
182 Ga0070672_100328596 3300005543 Bacteria 1301
183 Ga0070672_100366204 3300005543 Bacteria 1231
184 Ga0070686_100008748 3300005544 Bacteria 5675
185 Ga0070686_100029580 3300005544 Bacteria 3334
186 Ga0070665_100000001 3300005548 Bacteria 1083363
187 Ga0070665_100000052 3300005548 Bacteria 245694
188 Ga0070665_100260871 3300005548 Bacteria 1734
189 Ga0068855_100042540 3300005563 Bacteria 5382
190 Ga0068855_100071060 3300005563 Bacteria 4048
191 Ga0068855_100071573 3300005563 Bacteria 4032
192 Ga0068855_100106839 3300005563 Unclassified 3216
193 Ga0068855_100113035 3300005563 Bacteria 3116
194 Ga0068855_100171360 3300005563 Bacteria 2458
195 Ga0068855_100404142 3300005563 Unclassified 1496
196 Ga0068855_101094636 3300005563 Bacteria 833
197 Ga0070664_100004539 3300005564 Bacteria 11139
198 Ga0070664_100282206 3300005564 Unclassified 1498
199 Ga0070664_100400340 3300005564 Bacteria 1255
200 Ga0070664_100434391 3300005564 Bacteria 1204
201 Ga0070664_100586448 3300005564 Bacteria 1033
202 Ga0068857_100254525 3300005577 Unclassified 1610
203 Ga0068857_100377317 3300005577 Unclassified 1316
204 Ga0068854_100086243 3300005578 Bacteria 2327
205 Ga0068856_100026045 3300005614 Bacteria 5704
206 Ga0068856_100157672 3300005614 Unclassified 2280
207 Ga0068856_100613680 3300005614 Bacteria 1109
208 Ga0070702_100541167 3300005615 Bacteria 863
209 Ga0068852_100029713 3300005616 Bacteria 4492
210 Ga0068852_100032145 3300005616 Bacteria 4341
211 Ga0068852_100041480 3300005616 Unclassified 3890
212 Ga0068852_100150676 3300005616 Unclassified 2162
213 Ga0068852_100503675 3300005616 Bacteria 1206
214 Ga0068852_100573908 3300005616 Bacteria 1130
215 Ga0068852_100594771 3300005616 Bacteria 1110
216 Ga0068852_101028232 3300005616 Unclassified 843
217 Ga0068859_100017085 3300005617 Bacteria 7284
218 Ga0068859_100030941 3300005617 Bacteria 5371
219 Ga0068859_100087099 3300005617 Bacteria 3170
220 Ga0068859_100135036 3300005617 Bacteria 2539
221 Ga0068859_100163375 3300005617 Bacteria 2306
222 Ga0068859_100417252 3300005617 Bacteria 1438
223 Ga0068859_100561765 3300005617 Bacteria 1235
224 Ga0068859_100833121 3300005617 Bacteria 1009
225 Ga0068864_100076708 3300005618 Bacteria 2921
226 Ga0068864_100102913 3300005618 Unclassified 2535
227 Ga0068864_100109277 3300005618 Unclassified 2462
228 Ga0068864_100156435 3300005618 Bacteria 2069
229 Ga0068864_100270505 3300005618 Unclassified 1583
230 Ga0068864_100437777 3300005618 Bacteria 1248
231 Ga0068866_10027937 3300005718 Bacteria 2684
232 Ga0068861_100014998 3300005719 Bacteria 5450
233 Ga0068861_100127720 3300005719 Bacteria 2060
234 Ga0068861_100368564 3300005719 Bacteria 1265
235 Ga0068861_100453628 3300005719 Bacteria 1149
236 Ga0068851_10082297 3300005834 Bacteria 1683
237 Ga0068851_10212408 3300005834 Bacteria 1084
238 Ga0068870_10062898 3300005840 Bacteria 2000
239 Ga0068863_100001267 3300005841 Bacteria 25182
240 Ga0068863_100005658 3300005841 Bacteria 12272
241 Ga0068863_100225021 3300005841 Bacteria 1808
242 Ga0068863_100284251 3300005841 Bacteria 1603
243 Ga0068863_100407345 3300005841 Bacteria 1331
244 Ga0068863_100451788 3300005841 Bacteria 1261
245 Ga0068858_100244438 3300005842 Bacteria 1703
246 Ga0068860_100002275 3300005843 Bacteria 20173
247 Ga0068860_100002698 3300005843 Bacteria 18476
248 Ga0068860_100004510 3300005843 Bacteria 14207
249 Ga0068860_100040606 3300005843 Bacteria 4446
250 Ga0068860_100067089 3300005843 Bacteria 3409
251 Ga0068860_100241604 3300005843 Unclassified 1757
252 Ga0068860_100616658 3300005843 Bacteria 1091
253 Ga0068860_100854471 3300005843 Bacteria 925
254 Ga0068862_100005444 3300005844 Bacteria 10638
255 Ga0068862_100390073 3300005844 Bacteria 1301
256 Ga0081539_10077544 3300005985 Bacteria 1756
257 Ga0081539_10099800 3300005985 Unclassified 1482
258 Ga0070715_10006279 3300006163 Unclassified 4028
259 Ga0075366_10150932 3300006195 Bacteria 1407
260 Ga0075366_10156423 3300006195 Bacteria 1381
261 Ga0075366_10327363 3300006195 Unclassified 939
262 Ga0097621_100004872 3300006237 Bacteria 9409
263 Ga0097621_100007184 3300006237 Bacteria 7945
264 Ga0097621_100015835 3300006237 Bacteria 5685
265 Ga0097621_100075262 3300006237 Bacteria 2798
266 Ga0097621_100165697 3300006237 Bacteria 1903
267 Ga0097621_100165949 3300006237 Bacteria 1901
268 Ga0097621_100193831 3300006237 Bacteria 1761
269 Ga0097621_100369999 3300006237 Unclassified 1278
270 Ga0097621_100745031 3300006237 Bacteria 905
271 Ga0068871_100049163 3300006358 Unclassified 3407
272 Ga0068871_100074511 3300006358 Bacteria 2800
273 Ga0068871_100090845 3300006358 Bacteria 2544
274 Ga0068871_100118650 3300006358 Unclassified 2232
275 Ga0068871_100205853 3300006358 Bacteria 1700
276 Ga0068871_100310920 3300006358 Unclassified 1385
277 Ga0068871_100634437 3300006358 Bacteria 974
278 Ga0075428_100019483 3300006844 Bacteria 7508
279 Ga0075428_100022380 3300006844 Bacteria 6998
280 Ga0075428_100042483 3300006844 Bacteria 4998
281 Ga0075428_100107372 3300006844 Bacteria 3043
282 Ga0075428_100147774 3300006844 Bacteria 2554
283 Ga0075428_100190031 3300006844 Bacteria 2221
284 Ga0075428_100778056 3300006844 Bacteria 1018
285 Ga0075430_100058156 3300006846 Bacteria 3250
286 Ga0075431_100075499 3300006847 Bacteria 3478
287 Ga0075431_100317440 3300006847 Bacteria 1572
288 Ga0075434_100312680 3300006871 Bacteria 1591
289 Ga0075429_100002169 3300006880 Bacteria 16387
290 Ga0075429_100004571 3300006880 Bacteria 11893
291 Ga0075429_100007858 3300006880 Bacteria 9263
292 Ga0075429_100141752 3300006880 Bacteria 2104
293 Ga0075429_100276982 3300006880 Bacteria 1469
294 Ga0068865_100009188 3300006881 Bacteria 6118
295 Ga0068865_100018914 3300006881 Bacteria 4452
296 Ga0068865_100566514 3300006881 Bacteria 956
297 Ga0097620_100017084 3300006931 Bacteria 7284
298 Ga0097620_100030940 3300006931 Bacteria 5371
299 Ga0097620_100087106 3300006931 Bacteria 3170
300 Ga0097620_100135041 3300006931 Bacteria 2539
301 Ga0097620_100163374 3300006931 Bacteria 2306
302 Ga0097620_100417262 3300006931 Bacteria 1438
303 Ga0097620_100561753 3300006931 Bacteria 1235
304 Ga0097620_100833177 3300006931 Bacteria 1009
305 Ga0105244_10131388 3300009036 Unclassified 1208
306 Ga0105240_10000072 3300009093 Bacteria 201388
307 Ga0105240_10000390 3300009093 Bacteria 82256
308 Ga0105240_10000547 3300009093 Bacteria 69491
309 Ga0105240_10002124 3300009093 Bacteria 32402
310 Ga0105240_10027343 3300009093 Bacteria 7468
311 Ga0105240_10038286 3300009093 Bacteria 6152
312 Ga0105240_10076543 3300009093 Bacteria 4124
313 Ga0105240_10136825 3300009093 Bacteria 2933
314 Ga0105240_10723326 3300009093 Bacteria 1085
315 Ga0111539_10011626 3300009094 Bacteria 11045
316 Ga0111539_10058706 3300009094 Bacteria 4564
317 Ga0111539_10249013 3300009094 Bacteria 2069
318 Ga0111539_10266393 3300009094 Unclassified 1994
319 Ga0111539_10287143 3300009094 Unclassified 1914
320 Ga0111539_10474745 3300009094 Bacteria 1456
321 Ga0111539_10497107 3300009094 Bacteria 1420
322 Ga0111539_10759943 3300009094 Bacteria 1128
323 Ga0111539_11014893 3300009094 Bacteria 964
324 Ga0105245_10294354 3300009098 Bacteria 1591
325 Ga0114129_10002413 3300009147 Bacteria 25964
326 Ga0114129_10262423 3300009147 Unclassified 2314
327 Ga0105243_10000002 3300009148 Bacteria 856281
328 Ga0105241_10030828 3300009174 Bacteria 4011
329 Ga0105241_10031464 3300009174 Bacteria 3973
330 Ga0105241_10052619 3300009174 Bacteria 3110
331 Ga0105241_10082299 3300009174 Bacteria 2523
332 Ga0105241_10321964 3300009174 Bacteria 1334
333 Ga0105241_10364129 3300009174 Bacteria 1259
334 Ga0105242_10007760 3300009176 Bacteria 8256
335 Ga0105242_10038005 3300009176 Bacteria 3869
336 Ga0105242_10044485 3300009176 Bacteria 3596
337 Ga0105242_10056701 3300009176 Unclassified 3206
338 Ga0105242_10293334 3300009176 Bacteria 1482
339 Ga0105248_10071249 3300009177 Bacteria 3904
340 Ga0105248_10416786 3300009177 Bacteria 1512
341 Ga0105237_10002078 3300009545 Bacteria 25315
342 Ga0105237_10013011 3300009545 Bacteria 8737
343 Ga0105237_10026340 3300009545 Bacteria 5943
344 Ga0105237_10032433 3300009545 Bacteria 5289
345 Ga0105237_10043859 3300009545 Bacteria 4503
346 Ga0105237_10231604 3300009545 Bacteria 1848
347 Ga0105237_10441695 3300009545 Bacteria 1307
348 Ga0105249_10012432 3300009553 Bacteria 7505
349 Ga0105249_10032078 3300009553 Bacteria 4752
350 Ga0105249_10037077 3300009553 Bacteria 4424
351 Ga0105249_10128076 3300009553 Bacteria 2420
352 Ga0105249_10162612 3300009553 Bacteria 2158
353 Ga0105249_10211671 3300009553 Bacteria 1903
354 Ga0105249_10368536 3300009553 Unclassified 1459
355 Ga0105249_10469646 3300009553 Unclassified 1299
356 Ga0105249_10669945 3300009553 Bacteria 1096
357 Ga0105249_10821094 3300009553 Bacteria 994
358 Ga0105249_11002978 3300009553 Bacteria 904
359 Ga0105249_11012651 3300009553 Bacteria 900
360 Ga0105239_10000004 3300010375 Bacteria 532483
361 Ga0105239_10000016 3300010375 Bacteria 293142
362 Ga0105239_10000184 3300010375 Bacteria 91348
363 Ga0105239_10003592 3300010375 Bacteria 18944
364 Ga0105239_10004803 3300010375 Bacteria 16040
365 Ga0105239_10013420 3300010375 Bacteria 9104
366 Ga0105239_10453908 3300010375 Bacteria 1454
367 Ga0105239_10590492 3300010375 Bacteria 1266
368 Ga0105246_10003431 3300011119 Bacteria 9610
369 Ga0105246_10086442 3300011119 Bacteria 2248
370 Ga0105246_10297078 3300011119 Bacteria 1302
371 Ga0157325_1001948 3300012485 Bacteria 1004
372 Ga0157373_10000076 3300013100 Bacteria 85437
373 Ga0157373_10000115 3300013100 Bacteria 63326
374 Ga0157373_10000271 3300013100 Bacteria 41646
375 Ga0157373_10002170 3300013100 Bacteria 14866
376 Ga0157373_10004999 3300013100 Bacteria 9961
377 Ga0157373_10006670 3300013100 Bacteria 8601
378 Ga0157371_10012850 3300013102 Bacteria 6376
379 Ga0157371_10017042 3300013102 Bacteria 5408
380 Ga0157371_10030564 3300013102 Bacteria 3885
381 Ga0157371_10036888 3300013102 Bacteria 3501
382 Ga0157371_10083626 3300013102 Bacteria 2260
383 Ga0157371_10104283 3300013102 Unclassified 2012
384 Ga0157371_10290466 3300013102 Bacteria 1182
385 Ga0157371_10467637 3300013102 Bacteria 928
386 Ga0157370_10001337 3300013104 Bacteria 30618
387 Ga0157370_10001568 3300013104 Bacteria 28277
388 Ga0157370_10004435 3300013104 Bacteria 16085
389 Ga0157370_10006123 3300013104 Bacteria 13352
390 Ga0157370_10009531 3300013104 Bacteria 10357
391 Ga0157370_10011412 3300013104 Bacteria 9294
392 Ga0157370_10025346 3300013104 Bacteria 5870
393 Ga0157370_10054900 3300013104 Unclassified 3797
394 Ga0157370_10075619 3300013104 Bacteria 3174
395 Ga0157370_10162775 3300013104 Bacteria 2076
396 Ga0157370_10168523 3300013104 Bacteria 2036
397 Ga0157370_10233542 3300013104 Bacteria 1702
398 Ga0157370_10244746 3300013104 Unclassified 1659
399 Ga0157370_10270379 3300013104 Bacteria 1570
400 Ga0157370_10324294 3300013104 Bacteria 1420
401 Ga0157369_10035509 3300013105 Bacteria 5465
402 Ga0157369_10068104 3300013105 Bacteria 3824
403 Ga0157374_10000007 3300013296 Bacteria 595643
404 Ga0157374_10003994 3300013296 Bacteria 12396
405 Ga0157374_10077624 3300013296 Bacteria 3143
406 Ga0157374_10077932 3300013296 Bacteria 3138
407 Ga0157374_10128713 3300013296 Bacteria 2449
408 Ga0157374_10155651 3300013296 Bacteria 2224
409 Ga0157374_10262274 3300013296 Bacteria 1702
410 Ga0157374_10305340 3300013296 Bacteria 1575
411 Ga0157374_10342448 3300013296 Bacteria 1484
412 Ga0157378_10028280 3300013297 Unclassified 4945
413 Ga0157378_10040141 3300013297 Bacteria 4150
414 Ga0157378_10148384 3300013297 Bacteria 2183
415 Ga0157378_10323871 3300013297 Bacteria 1498
416 Ga0157378_10425086 3300013297 Unclassified 1314
417 Ga0163162_10000306 3300013306 Bacteria 45352
418 Ga0163162_10009325 3300013306 Bacteria 9543
419 Ga0163162_10016895 3300013306 Bacteria 7134
420 Ga0163162_10045607 3300013306 Bacteria 4392
421 Ga0163162_10054666 3300013306 Unclassified 4017
422 Ga0163162_10069227 3300013306 Bacteria 3581
423 Ga0163162_10074637 3300013306 Bacteria 3450
424 Ga0163162_10090243 3300013306 Bacteria 3146
425 Ga0163162_10092864 3300013306 Unclassified 3102
426 Ga0163162_10193458 3300013306 Bacteria 2162
427 Ga0163162_10635222 3300013306 Bacteria 1192
428 Ga0157372_10002566 3300013307 Bacteria 19696
429 Ga0157372_10009642 3300013307 Bacteria 10262
430 Ga0157372_10010784 3300013307 Bacteria 9728
431 Ga0157372_10062986 3300013307 Bacteria 4157
432 Ga0157372_10121838 3300013307 Bacteria 2996
433 Ga0157372_10202223 3300013307 Bacteria 2301
434 Ga0157372_10344993 3300013307 Bacteria 1735
435 Ga0157372_10453950 3300013307 Bacteria 1494
436 Ga0157372_10465685 3300013307 Bacteria 1473
437 Ga0157372_10719070 3300013307 Unclassified 1162
438 Ga0157375_10008461 3300013308 Bacteria 9011
439 Ga0157375_10009146 3300013308 Bacteria 8683
440 Ga0157375_10019607 3300013308 Bacteria 6156
441 Ga0157375_10034920 3300013308 Bacteria 4795
442 Ga0157375_10082855 3300013308 Bacteria 3251
443 Ga0157375_10090980 3300013308 Unclassified 3111
444 Ga0157375_10248050 3300013308 Bacteria 1941
445 Ga0157375_10404441 3300013308 Bacteria 1532
446 Ga0157375_10481662 3300013308 Bacteria 1406
447 Ga0157375_10615358 3300013308 Bacteria 1244
448 Ga0157375_10623401 3300013308 Bacteria 1236
449 Ga0157375_10991351 3300013308 Bacteria 980
450 Ga0163163_10000129 3300014325 Bacteria 77897
451 Ga0163163_10012157 3300014325 Bacteria 7833
452 Ga0163163_10032538 3300014325 Bacteria 5037
453 Ga0163163_10035414 3300014325 Unclassified 4842
454 Ga0163163_10329397 3300014325 Bacteria 1581
455 Ga0163163_10382263 3300014325 Bacteria 1465
456 Ga0157380_10000002 3300014326 Bacteria 236273
457 Ga0157380_10004552 3300014326 Bacteria 9623
458 Ga0157380_10021105 3300014326 Bacteria 4881
459 Ga0157380_10063986 3300014326 Bacteria 2951
460 Ga0157380_10123349 3300014326 Bacteria 2198
461 Ga0157380_10143094 3300014326 Bacteria 2057
462 Ga0157380_10256015 3300014326 Bacteria 1587
463 Ga0157380_10265446 3300014326 Bacteria 1562
464 Ga0157380_10455386 3300014326 Bacteria 1230
465 Ga0157380_10800115 3300014326 Unclassified 960
466 Ga0157380_10822296 3300014326 Bacteria 948
467 Ga0182008_10000081 3300014497 Bacteria 75637
468 Ga0157377_10008940 3300014745 Bacteria 4901
469 Ga0157377_10023994 3300014745 Unclassified 3239
470 Ga0157377_10191200 3300014745 Bacteria 1294
471 Ga0157379_10123016 3300014968 Bacteria 2335
472 Ga0157379_10135382 3300014968 Bacteria 2219
473 Ga0157379_10198766 3300014968 Bacteria 1812
474 Ga0157379_10317238 3300014968 Bacteria 1423
475 Ga0157379_10342781 3300014968 Bacteria 1367
476 Ga0157379_10417862 3300014968 Bacteria 1235
477 Ga0157376_10002014 3300014969 Bacteria 13616
478 Ga0157376_10023367 3300014969 Bacteria 4837
479 Ga0157376_10257831 3300014969 Bacteria 1632
480 Ga0157376_10491456 3300014969 Bacteria 1204
481 Ga0182006_1000094 3300015261 Bacteria 106056
482 Ga0182006_1001215 3300015261 Bacteria 16079
483 Ga0182006_1042607 3300015261 Bacteria 1778
484 Ga0163161_10000095 3300017792 Bacteria 87781
485 Ga0163161_10000230 3300017792 Bacteria 51536
486 Ga0163161_10002240 3300017792 Bacteria 13918
487 Ga0163161_10003268 3300017792 Bacteria 11395
488 Ga0163161_10056319 3300017792 Unclassified 2855
489 Ga0163161_10185167 3300017792 Bacteria 1598
490 Ga0163161_10215605 3300017792 Bacteria 1484
491 Ga0163161_10309295 3300017792 Bacteria 1246
492 Ga0213876_10190854 3300021384 Unclassified 1089
493 Ga0213876_10253201 3300021384 Bacteria 936
494 Ga0209436_101495 3300025208 Bacteria 8070
495 Ga0209646_1000002 3300025246 Bacteria 1425781
496 Ga0209026_1000218 3300025250 Bacteria 79205
497 Ga0209026_1000502 3300025250 Bacteria 28374
498 Ga0207666_1005654 3300025271 Bacteria 1602
499 Ga0207666_1016817 3300025271 Bacteria 1052
500 Ga0209673_1000082 3300025273 Bacteria 219716
501 Ga0209673_1055161 3300025273 Bacteria 1025
502 Ga0209676_1000321 3300025292 Bacteria 92845
503 Ga0209564_1007986 3300025295 Bacteria 5317
504 Ga0209564_1012344 3300025295 Bacteria 3733
505 Ga0209564_1028609 3300025295 Unclassified 1777
506 Ga0209758_1015100 3300025297 Bacteria 4034
507 Ga0209758_1024663 3300025297 Bacteria 2672
508 Ga0209758_1082446 3300025297 Bacteria 968
509 Ga0209050_1000577 3300025298 Bacteria 59430
510 Ga0209050_1006924 3300025298 Bacteria 6549
511 Ga0209050_1025306 3300025298 Bacteria 2021
512 Ga0207426_1000502 3300025302 Bacteria 58023
513 Ga0207426_1007377 3300025302 Bacteria 4612
514 Ga0207426_1044041 3300025302 Bacteria 1366
515 Ga0209257_1000006 3300025304 Bacteria 1570111
516 Ga0209257_1000007 3300025304 Bacteria 1564415
517 Ga0209257_1004063 3300025304 Bacteria 11744
518 Ga0209257_1068589 3300025304 Bacteria 941
519 Ga0207682_10048820 3300025893 Bacteria 1746
520 Ga0207682_10160512 3300025893 Unclassified 1018
521 Ga0207642_10012892 3300025899 Bacteria 3032
522 Ga0207642_10238725 3300025899 Bacteria 1025
523 Ga0207710_10001409 3300025900 Bacteria 12027
524 Ga0207688_10015186 3300025901 Bacteria 4177
525 Ga0207680_10089346 3300025903 Unclassified 1956
526 Ga0207680_10094534 3300025903 Bacteria 1908
527 Ga0207647_10134190 3300025904 Bacteria 1453
528 Ga0207685_10214742 3300025905 Bacteria 911
529 Ga0207645_10000545 3300025907 Bacteria 31363
530 Ga0207645_10068466 3300025907 Bacteria 2270
531 Ga0207643_10042769 3300025908 Bacteria 2554
532 Ga0207643_10045817 3300025908 Archaea 2470
533 Ga0207643_10080008 3300025908 Bacteria 1892
534 Ga0207705_10045650 3300025909 Bacteria 3148
535 Ga0207705_10372739 3300025909 Bacteria 1102
536 Ga0207654_10039283 3300025911 Bacteria 2661
537 Ga0207654_10045585 3300025911 Unclassified 2496
538 Ga0207654_10109797 3300025911 Bacteria 1714
539 Ga0207654_10335224 3300025911 Bacteria 1038
540 Ga0207707_10124522 3300025912 Bacteria 2254
541 Ga0207695_10000020 3300025913 Bacteria 723025
542 Ga0207695_10000067 3300025913 Bacteria 330915
543 Ga0207695_10001914 3300025913 Bacteria 32387
544 Ga0207695_10026583 3300025913 Bacteria 6459
545 Ga0207695_10039570 3300025913 Bacteria 5067
546 Ga0207695_10092622 3300025913 Bacteria 3032
547 Ga0207695_10119054 3300025913 Bacteria 2611
548 Ga0207695_10509493 3300025913 Unclassified 1085
549 Ga0207671_10005696 3300025914 Bacteria 11383
550 Ga0207671_10011524 3300025914 Bacteria 7184
551 Ga0207671_10025795 3300025914 Bacteria 4410
552 Ga0207671_10059616 3300025914 Bacteria 2830
553 Ga0207671_10187785 3300025914 Bacteria 1610
554 Ga0207660_10015857 3300025917 Bacteria 4980
555 Ga0207660_10112529 3300025917 Bacteria 2050
556 Ga0207662_10022459 3300025918 Bacteria 3618
557 Ga0207662_10071706 3300025918 Bacteria 2098
558 Ga0207662_10131734 3300025918 Bacteria 1577
559 Ga0207657_10002923 3300025919 Bacteria 18338
560 Ga0207657_10524382 3300025919 Unclassified 927
561 Ga0207649_10024388 3300025920 Bacteria 3515
562 Ga0207649_10173702 3300025920 Bacteria 1503
563 Ga0207652_10008396 3300025921 Bacteria 8310
564 Ga0207652_10019917 3300025921 Bacteria 5524
565 Ga0207652_10115321 3300025921 Bacteria 2386
566 Ga0207652_10146009 3300025921 Unclassified 2117
567 Ga0207681_10073547 3300025923 Bacteria 2391
568 Ga0207681_10079873 3300025923 Bacteria 2306
569 Ga0207681_10089067 3300025923 Bacteria 2199
570 Ga0207650_10000926 3300025925 Bacteria 22125
571 Ga0207650_10003183 3300025925 Bacteria 11310
572 Ga0207650_10007080 3300025925 Bacteria 7643
573 Ga0207650_10134530 3300025925 Bacteria 1938
574 Ga0207650_10205380 3300025925 Unclassified 1580
575 Ga0207650_10210857 3300025925 Bacteria 1560
576 Ga0207650_10220389 3300025925 Unclassified 1526
577 Ga0207659_10120144 3300025926 Bacteria 2012
578 Ga0207659_10151219 3300025926 Bacteria 1813
579 Ga0207659_10171952 3300025926 Bacteria 1710
580 Ga0207659_10189170 3300025926 Bacteria 1637
581 Ga0207659_10198729 3300025926 Unclassified 1600
582 Ga0207659_10572235 3300025926 Unclassified 961
583 Ga0207644_10166818 3300025931 Bacteria 1716
584 Ga0207644_10177590 3300025931 Unclassified 1667
585 Ga0207644_10210817 3300025931 Bacteria 1536
586 Ga0207644_10264882 3300025931 Bacteria 1375
587 Ga0207706_10016752 3300025933 Bacteria 6615
588 Ga0207706_10134079 3300025933 Unclassified 2178
589 Ga0207706_10514399 3300025933 Bacteria 1032
590 Ga0207686_10000351 3300025934 Bacteria 32797
591 Ga0207686_10047597 3300025934 Unclassified 2652
592 Ga0207686_10061703 3300025934 Unclassified 2378
593 Ga0207686_10283639 3300025934 Bacteria 1224
594 Ga0207709_10000003 3300025935 Bacteria 1050072
595 Ga0207670_10037057 3300025936 Bacteria 3176
596 Ga0207670_10099674 3300025936 Unclassified 2073
597 Ga0207670_10115899 3300025936 Bacteria 1939
598 Ga0207670_10129313 3300025936 Bacteria 1847
599 Ga0207670_10182545 3300025936 Bacteria 1582
600 Ga0207670_10220248 3300025936 Bacteria 1452
601 Ga0207670_10254124 3300025936 Bacteria 1359
602 Ga0207670_10393430 3300025936 Unclassified 1106
603 Ga0207669_10071014 3300025937 Bacteria 2186
604 Ga0207704_10033662 3300025938 Unclassified 2917
605 Ga0207691_10003442 3300025940 Bacteria 15396
606 Ga0207691_10021838 3300025940 Bacteria 6041
607 Ga0207691_10026518 3300025940 Bacteria 5436
608 Ga0207691_10033672 3300025940 Unclassified 4771
609 Ga0207691_10212977 3300025940 Bacteria 1678
610 Ga0207691_10348895 3300025940 Bacteria 1266
611 Ga0207691_10363671 3300025940 Bacteria 1237
612 Ga0207689_10000466 3300025942 Bacteria 37961
613 Ga0207689_10016155 3300025942 Bacteria 6321
614 Ga0207689_10020450 3300025942 Bacteria 5570
615 Ga0207689_10032891 3300025942 Bacteria 4310
616 Ga0207689_10078416 3300025942 Unclassified 2715
617 Ga0207689_10200678 3300025942 Bacteria 1646
618 Ga0207689_10271421 3300025942 Bacteria 1404
619 Ga0207661_10019688 3300025944 Bacteria 5037
620 Ga0207661_10057726 3300025944 Unclassified 3122
621 Ga0207661_10584836 3300025944 Unclassified 1024
622 Ga0207679_10042698 3300025945 Bacteria 3261
623 Ga0207679_10222463 3300025945 Unclassified 1589
624 Ga0207667_10057093 3300025949 Bacteria 4099
625 Ga0207667_10091730 3300025949 Bacteria 3138
626 Ga0207667_10098902 3300025949 Bacteria 3010
627 Ga0207667_10277793 3300025949 Bacteria 1712
628 Ga0207667_10412417 3300025949 Bacteria 1375
629 Ga0207667_10980036 3300025949 Bacteria 834
630 Ga0207651_10074605 3300025960 Bacteria 2416
631 Ga0207651_10119412 3300025960 Bacteria 1996
632 Ga0207651_10188565 3300025960 Bacteria 1643
633 Ga0207712_10002030 3300025961 Bacteria 13283
634 Ga0207712_10008088 3300025961 Bacteria 6652
635 Ga0207712_10018788 3300025961 Bacteria 4507
636 Ga0207712_10072899 3300025961 Bacteria 2474
637 Ga0207712_10090966 3300025961 Bacteria 2247
638 Ga0207712_10168440 3300025961 Bacteria 1710
639 Ga0207712_10443845 3300025961 Bacteria 1099
640 Ga0207668_10039606 3300025972 Bacteria 3174
641 Ga0207668_10105333 3300025972 Unclassified 2105
642 Ga0207640_10384150 3300025981 Bacteria 1139
643 Ga0207658_10020456 3300025986 Bacteria 4582
644 Ga0207658_10024814 3300025986 Unclassified 4196
645 Ga0207658_10119658 3300025986 Bacteria 2097
646 Ga0207658_10145173 3300025986 Unclassified 1926
647 Ga0207658_10200657 3300025986 Unclassified 1665
648 Ga0207658_10282990 3300025986 Bacteria 1422
649 Ga0207658_10337142 3300025986 Bacteria 1310
650 Ga0207677_10388378 3300026023 Unclassified 1180
651 Ga0207677_10667397 3300026023 Unclassified 919
652 Ga0207703_10019810 3300026035 Bacteria 5258
653 Ga0207703_10278326 3300026035 Bacteria 1519
654 Ga0207703_10383490 3300026035 Bacteria 1300
655 Ga0207639_10101786 3300026041 Bacteria 2324
656 Ga0207639_10238454 3300026041 Bacteria 1580
657 Ga0207639_10266326 3300026041 Bacteria 1501
658 Ga0207639_10511791 3300026041 Bacteria 1098
659 Ga0207678_10129022 3300026067 Bacteria 2156
660 Ga0207708_10007230 3300026075 Bacteria 8209
661 Ga0207708_10103243 3300026075 Bacteria 2208
662 Ga0207708_10195412 3300026075 Bacteria 1612
663 Ga0207702_11045364 3300026078 Unclassified 810
664 Ga0207641_10000191 3300026088 Bacteria 84147
665 Ga0207641_10000377 3300026088 Bacteria 53065
666 Ga0207641_10106293 3300026088 Bacteria 2480
667 Ga0207641_10175113 3300026088 Bacteria 1961
668 Ga0207641_10207456 3300026088 Bacteria 1810
669 Ga0207641_10276044 3300026088 Bacteria 1579
670 Ga0207641_10345770 3300026088 Bacteria 1416
671 Ga0207641_10411366 3300026088 Bacteria 1301
672 Ga0207641_10553306 3300026088 Bacteria 1122
673 Ga0207641_10795338 3300026088 Bacteria 935
674 Ga0207648_10003831 3300026089 Bacteria 15710
675 Ga0207648_10010349 3300026089 Bacteria 8845
676 Ga0207648_10026591 3300026089 Bacteria 5140
677 Ga0207648_10091570 3300026089 Unclassified 2658
678 Ga0207648_10229172 3300026089 Unclassified 1652
679 Ga0207648_10679017 3300026089 Bacteria 953
680 Ga0207676_10063799 3300026095 Bacteria 2927
681 Ga0207676_10260949 3300026095 Bacteria 1564
682 Ga0207676_10424122 3300026095 Bacteria 1248
683 Ga0207676_10470416 3300026095 Unclassified 1188
684 Ga0207676_10539429 3300026095 Unclassified 1113
685 Ga0207676_10673083 3300026095 Unclassified 1000
686 Ga0207674_10210346 3300026116 Bacteria 1894
687 Ga0207674_10294481 3300026116 Bacteria 1572
688 Ga0207674_10453707 3300026116 Unclassified 1239
689 Ga0207675_100010785 3300026118 Bacteria 8562
690 Ga0207675_100012127 3300026118 Bacteria 8051
691 Ga0207675_100043581 3300026118 Bacteria 4190
692 Ga0207675_100305019 3300026118 Bacteria 1552
693 Ga0207683_10012032 3300026121 Bacteria 7387
694 Ga0207683_10192381 3300026121 Bacteria 1853
695 Ga0207683_10511944 3300026121 Bacteria 1109
696 Ga0207698_10038499 3300026142 Bacteria 3534
697 Ga0207698_10100407 3300026142 Bacteria 2397
698 Ga0207698_10148024 3300026142 Bacteria 2034
699 Ga0207698_10156004 3300026142 Unclassified 1989
700 Ga0207698_10190523 3300026142 Bacteria 1826
701 Ga0207698_10293362 3300026142 Bacteria 1510
702 Ga0209995_1001603 3300027471 Bacteria 3509
703 Ga0207428_10496084 3300027907 Bacteria 887
704 Ga0268266_10000049 3300028379 Bacteria 307763
705 Ga0268266_10000070 3300028379 Bacteria 235423
706 Ga0268266_10313865 3300028379 Bacteria 1465
707 Ga0268265_10012408 3300028380 Bacteria 5774
708 Ga0268265_10219797 3300028380 Bacteria 1661
709 Ga0268265_10460478 3300028380 Bacteria 1190
710 Ga0268264_10016393 3300028381 Bacteria 6065
711 Ga0268264_10025036 3300028381 Unclassified 4876
712 Ga0268264_10124820 3300028381 Bacteria 2273
713 Ga0268264_10142323 3300028381 Unclassified 2140
714 Ga0268264_10157801 3300028381 Bacteria 2040
715 Ga0268264_10205192 3300028381 Bacteria 1806
716 Ga0268264_10319615 3300028381 Unclassified 1467
717 Ga0268264_10363248 3300028381 Unclassified 1382
718 Ga0268264_10652979 3300028381 Bacteria 1041
719 Ga0265336_10028594 3300028666 Bacteria 1742
720 Ga0307517_10011996 3300028786 Bacteria 11955
721 Ga0307517_10193999 3300028786 Bacteria 1283
722 Ga0307515_10000251 3300028794 Bacteria 132970
723 Ga0307515_10000479 3300028794 Bacteria 95197
724 Ga0307515_10009312 3300028794 Bacteria 19000
725 Ga0307515_10106040 3300028794 Bacteria 3339
726 Ga0316179_1035183 3300030734 Bacteria 2407
727 Ga0265327_10000073 3300031251 Bacteria 214772
728 Ga0265327_10001129 3300031251 Bacteria 36728
729 Ga0265327_10001423 3300031251 Bacteria 30459
730 Ga0265327_10043350 3300031251 Bacteria 2408
731 Ga0265327_10092761 3300031251 Bacteria 1470
732 Ga0307513_10077090 3300031456 Bacteria 3454
733 Ga0307513_10361649 3300031456 Bacteria 1196
734 Ga0307509_10025664 3300031507 Bacteria 6578
735 Ga0307509_10138196 3300031507 Unclassified 2378
736 Ga0307509_10155728 3300031507 Bacteria 2191
737 Ga0307408_100000261 3300031548 Bacteria 53515
738 Ga0307408_100000947 3300031548 Bacteria 22518
739 Ga0307408_100059395 3300031548 Bacteria 2783
740 Ga0307508_10000969 3300031616 Bacteria 33410
741 Ga0316576_10392479 3300031727 Bacteria 1029
742 Ga0307405_10000008 3300031731 Bacteria 264953
743 Ga0307405_10379220 3300031731 Bacteria 1100
744 Ga0307413_10096748 3300031824 Bacteria 1939
745 Ga0307410_10007044 3300031852 Bacteria 6124
746 Ga0307406_10000287 3300031901 Bacteria 29607
747 Ga0307407_10000785 3300031903 Bacteria 10496
748 Ga0307407_10058688 3300031903 Bacteria 2238
749 Ga0307412_10002921 3300031911 Bacteria 9482
750 Ga0307412_10040897 3300031911 Bacteria 3001
751 Ga0307412_10228158 3300031911 Unclassified 1432
752 Ga0307412_10247868 3300031911 Bacteria 1381
753 Ga0307416_100102620 3300032002 Bacteria 2494
754 Ga0307414_10000005 3300032004 Bacteria 452161
755 Ga0307414_10000574 3300032004 Bacteria 19147
756 Ga0307414_10103564 3300032004 Bacteria 2148
757 Ga0307414_10536299 3300032004 Bacteria 1041
758 Ga0307415_100125907 3300032126 Bacteria 1931
759 Ga0307510_10017440 3300033180 Bacteria 8467
760 Ga0373955_0027088 3300035172 Bacteria 2959
761 Ga0373935_0226057 3300035692 Bacteria 1302
762 Ga0373933_0038641 3300035724 Bacteria 2805
763 Ga0373937_0009021 3300036401 Bacteria 8656
764 Ga0373937_0110657 3300036401 Bacteria 2555
765 Ga0373937_0461137 3300036401 Bacteria 1207
766 Ga0373937_0504689 3300036401 Unclassified 1149
767 Ga0373937_0587534 3300036401 Unclassified 1057
768 Ga0373925_0156848 3300037068 Bacteria 1791
769 Ga0395899_0000001 3300037312 Bacteria 1750322
770 Ga0395899_0002759 3300037312 Bacteria 14170
771 Ga0395899_0173061 3300037312 Unclassified 1519
772 Ga0395900_0007814 3300037418 Bacteria 11023
773 Ga0395900_0467044 3300037418 Bacteria 1216
774 Ga0395898_0006869 3300037466 Bacteria 12105
775 Ga0395898_0153074 3300037466 Bacteria 2206
776 Ga0395905_0041473 3300037471 Bacteria 4319
777 Ga0395901_0006235 3300038443 Bacteria 12089
778 Ga0400483_036718 3300039062 Bacteria 1091
779 Ga0400483_085096 3300039062 Bacteria 22135
780 Ga0400483_131968 3300039062 Bacteria 1665
781 Ga0400483_156766 3300039062 Bacteria 1197
782 Ga0400483_185962 3300039062 Bacteria 60212
783 Ga0436365_1031676 3300039437 Bacteria 1652
784 Ga0436365_1622828 3300039437 Bacteria 27494
785 Ga0436361_1171170 3300039447 Bacteria 1882
786 Ga0439466_0031994 3300041411 Bacteria 1796
787 Ga0451798_0297405 3300041458 Bacteria 949
788 Ga0451807_0096103 3300041486 Bacteria 1039
789 Ga0451855_1823717 3300041511 Bacteria 1211
790 Ga0451853_0411948 3300041512 Bacteria 917
791 Ga0451853_2161633 3300041512 Unclassified 1870
792 Ga0439441_008694 3300042001 Bacteria 1665
793 Ga0439449_0028648 3300042007 Bacteria 2076
794 Ga0439449_0083402 3300042007 Bacteria 1179
795 Ga0439457_011920 3300042014 Unclassified 1965
796 Ga0450898_028749 3300042134 Bacteria 1011
797 Ga0439460_0060285 3300042461 Bacteria 1157
798 Ga0451577_0000030 3300042876 Bacteria 391423
799 Ga0451577_0000066 3300042876 Bacteria 257650
800 Ga0451577_0003571 3300042876 Bacteria 17138
801 Ga0451577_0010709 3300042876 Bacteria 8731
802 Ga0451577_0066957 3300042876 Bacteria 3203
803 Ga0451577_0079256 3300042876 Unclassified 2928
804 Ga0451577_0192273 3300042876 Bacteria 1841
805 Ga0451577_0229120 3300042876 Bacteria 1680
806 Ga0451577_0266104 3300042876 Bacteria 1552
807 Ga0451577_0336172 3300042876 Bacteria 1370
808 Ga0451577_0368554 3300042876 Unclassified 1303
809 Ga0451577_0376778 3300042876 Bacteria 1287
810 Ga0451577_0377632 3300042876 Bacteria 1286
811 Ga0451577_0396117 3300042876 Bacteria 1253
812 Ga0451577_0457930 3300042876 Unclassified 1158
813 Ga0451577_0764229 3300042876 Unclassified 874
814 Ga0466972_0000015 3300044658 Bacteria 210687
815 Ga0466972_0000024 3300044658 Bacteria 187985
816 Ga0466972_0000027 3300044658 Bacteria 174082
817 Ga0466972_0002328 3300044658 Bacteria 9355
818 Ga0466972_0177502 3300044658 Bacteria 999
819 Ga0453683_0000022 3300044673 Bacteria 269593
820 Ga0453683_0000112 3300044673 Bacteria 121330
821 Ga0453683_0000329 3300044673 Bacteria 58367
822 Ga0453683_0002791 3300044673 Bacteria 13286
823 Ga0453683_0009620 3300044673 Bacteria 6445
824 Ga0453683_0022796 3300044673 Bacteria 3992
825 Ga0453683_0023532 3300044673 Bacteria 3926
826 Ga0453683_0045522 3300044673 Bacteria 2751
827 Ga0453683_0097063 3300044673 Bacteria 1849
828 Ga0453683_0195091 3300044673 Bacteria 1285
829 Ga0453683_0291355 3300044673 Bacteria 1043
830 Ga0453684_0000051 3300044712 Bacteria 551033
831 Ga0453684_0000206 3300044712 Bacteria 257650
832 Ga0453684_0000260 3300044712 Bacteria 227076
833 Ga0453684_0001207 3300044712 Bacteria 79602
834 Ga0453684_0002151 3300044712 Bacteria 49340
835 Ga0453684_0010954 3300044712 Bacteria 15328
836 Ga0453684_0015660 3300044712 Bacteria 11953
837 Ga0453684_0018383 3300044712 Bacteria 10729
838 Ga0453684_0025910 3300044712 Bacteria 8491
839 Ga0453684_0030168 3300044712 Bacteria 7668
840 Ga0453684_0058021 3300044712 Bacteria 5002
841 Ga0453684_0109194 3300044712 Unclassified 3365
842 Ga0453684_0134820 3300044712 Bacteria 2958
843 Ga0453684_0140459 3300044712 Bacteria 2885
844 Ga0453684_0146361 3300044712 Bacteria 2813
845 Ga0453684_0177372 3300044712 Bacteria 2504
846 Ga0453684_0195770 3300044712 Bacteria 2361
847 Ga0453684_0280276 3300044712 Bacteria 1901
848 Ga0453684_0328350 3300044712 Unclassified 1730
849 Ga0453684_0333713 3300044712 Bacteria 1714
850 Ga0453684_0449951 3300044712 Bacteria 1434
851 Ga0453684_0525383 3300044712 Unclassified 1307
852 Ga0453684_0585335 3300044712 Bacteria 1225
853 Ga0453684_0698513 3300044712 Bacteria 1102
854 Ga0453684_1062071 3300044712 Bacteria 858
855 Ga0466970_0001866 3300044765 Bacteria 10187
856 Ga0466970_0004459 3300044765 Bacteria 6901
857 Ga0466957_0005893 3300044842 Bacteria 6909
858 Ga0466957_0063074 3300044842 Bacteria 2277
859 Ga0466957_0108799 3300044842 Unclassified 1756
860 Ga0466957_0265578 3300044842 Bacteria 1145
861 Ga0451576_0000003 3300045051 Bacteria 1550573
862 Ga0451576_0000072 3300045051 Bacteria 257650
863 Ga0451576_0000103 3300045051 Bacteria 217967
864 Ga0451576_0002639 3300045051 Bacteria 26206
865 Ga0451576_0012627 3300045051 Bacteria 9482
866 Ga0451576_0029708 3300045051 Bacteria 5847
867 Ga0451576_0034004 3300045051 Bacteria 5416
868 Ga0451576_0057828 3300045051 Bacteria 4053
869 Ga0451576_0071073 3300045051 Unclassified 3622
870 Ga0451576_0086893 3300045051 Bacteria 3253
871 Ga0451576_0115965 3300045051 Bacteria 2788
872 Ga0451576_0208997 3300045051 Bacteria 2038
873 Ga0451576_0388447 3300045051 Bacteria 1463
874 Ga0495592_0080635 3300046454 Bacteria 2354
875 Ga0495629_0019970 3300046459 Bacteria 4781
876 Ga0495629_0098988 3300046459 Bacteria 2035
877 Ga0495638_0000005 3300046460 Bacteria 680627
878 Ga0495638_0000015 3300046460 Bacteria 414645
879 Ga0495638_0037364 3300046460 Bacteria 3089
880 Ga0495638_0167419 3300046460 Unclassified 1263
881 Ga0495580_0032933 3300046472 Bacteria 3735
882 Ga0495580_0132391 3300046472 Bacteria 1729
883 Ga0495580_0139573 3300046472 Bacteria 1680
884 Ga0495580_0265776 3300046472 Bacteria 1173
885 Ga0495582_0113336 3300046473 Unclassified 1524
886 Ga0495585_0004232 3300046492 Bacteria 9360
887 Ga0495594_0123316 3300046499 Bacteria 1465
888 Ga0495606_0000100 3300046507 Bacteria 147592
889 Ga0495606_0003289 3300046507 Bacteria 17293
890 Ga0495606_0011306 3300046507 Bacteria 7293
891 Ga0495606_0011360 3300046507 Bacteria 7271
892 Ga0495606_0029217 3300046507 Unclassified 3876
893 Ga0495606_0236657 3300046507 Bacteria 1020
894 Ga0495616_0006946 3300046513 Bacteria 6816
895 Ga0495616_0007179 3300046513 Bacteria 6678
896 Ga0495616_0152375 3300046513 Bacteria 1045
897 Ga0495618_0061110 3300046514 Bacteria 2390
898 Ga0495628_0129609 3300046516 Bacteria 1930
899 Ga0495630_0035374 3300046517 Bacteria 3733
900 Ga0495631_0062010 3300046518 Bacteria 1621
901 Ga0495632_0001210 3300046519 Bacteria 21930
902 Ga0495637_0065093 3300046520 Bacteria 1485
903 Ga0495643_0000596 3300046522 Bacteria 43864
904 Ga0495648_0003814 3300046524 Bacteria 13094
905 Ga0495648_0009384 3300046524 Bacteria 7593
906 Ga0495648_0025243 3300046524 Bacteria 4027
907 Ga0495648_0167449 3300046524 Unclassified 1130
908 Ga0495652_0032026 3300046529 Bacteria 4600
909 Ga0495652_0137447 3300046529 Bacteria 1926
910 Ga0495652_0323784 3300046529 Bacteria 1113
911 Ga0495586_0080270 3300046535 Bacteria 1792
912 Ga0495598_0016928 3300046537 Bacteria 1870
913 Ga0495609_0003828 3300046538 Bacteria 8464
914 Ga0495621_0013481 3300046539 Bacteria 2570
915 Ga0495621_0044062 3300046539 Bacteria 1576
916 Ga0495633_0000002 3300046558 Bacteria 488754
917 Ga0495633_0000067 3300046558 Bacteria 139122
918 Ga0495668_0000009 3300046616 Bacteria 492623
919 Ga0495634_0018697 3300046642 Unclassified 4930
920 Ga0495611_0120853 3300046648 Bacteria 1221
921 Ga0495625_0000144 3300046660 Bacteria 109247
922 Ga0495625_0001749 3300046660 Bacteria 25117
923 Ga0495625_0007755 3300046660 Bacteria 9270
924 Ga0495625_0028526 3300046660 Bacteria 4186
925 Ga0495625_0155301 3300046660 Bacteria 1536
926 Ga0495661_0000114 3300046665 Bacteria 95935
927 Ga0495658_0006551 3300046683 Bacteria 5721
928 Ga0495658_0068490 3300046683 Bacteria 2055
929 Ga0495658_0101063 3300046683 Bacteria 1721
930 Ga0495670_0152549 3300046691 Unclassified 1212
931 Ga0495649_0000112 3300046694 Bacteria 71657
932 Ga0495600_0044433 3300046809 Bacteria 2899
933 Ga0495600_0188304 3300046809 Bacteria 1328
934 Ga0495660_0017439 3300046810 Bacteria 4134
935 Ga0495660_0024633 3300046810 Unclassified 3427
936 Ga0495660_0034191 3300046810 Bacteria 2846
937 Ga0495581_0035024 3300047315 Bacteria 2905
938 Ga0495604_0389047 3300047317 Bacteria 920
939 Ga0495604_0413721 3300047317 Bacteria 886
940 Ga0495674_0028918 3300047319 Bacteria 5049
941 Ga0495674_0186293 3300047319 Bacteria 1727
942 Ga0495672_0039736 3300047320 Unclassified 2859
943 Ga0495676_0029247 3300047321 Bacteria 4693
944 Ga0495676_0309077 3300047321 Bacteria 1064
945 Ga0495687_000006 3300047443 Bacteria 571936
946 Ga0495684_0261104 3300047471 Unclassified 1256
947 Ga0495686_0051377 3300047472 Bacteria 2587
948 Ga0495614_0048477 3300048089 Bacteria 1821
949 Ga0496100_0670016 3300048903 Unclassified 809
950 Ga0496104_0391855 3300048907 Bacteria 1301
951 Ga0496110_0470567 3300048913 Unclassified 1145
952 Ga0496116_0000002 3300048919 Bacteria 920291
953 Ga0496116_0022382 3300048919 Bacteria 4736
954 Ga0496117_0006510 3300048920 Bacteria 11776
955 Ga0496118_0025785 3300048921 Bacteria 5029
956 Ga0496118_0201570 3300048921 Bacteria 1178
957 Ga0496122_0078960 3300048925 Bacteria 2302
958 Ga0496124_0016379 3300048927 Bacteria 7051
959 Ga0496125_0000007 3300048928 Bacteria 715355
960 Ga0496126_0068377 3300048929 Bacteria 3171
961 Ga0495682_0014555 3300049460 Bacteria 2982
962 Ga0501290_009895 3300049513 Bacteria 1216
963 Ga0501033_0026491 3300049570 Bacteria 4363
964 Ga0501034_0062200 3300049571 Bacteria 3748
965 Ga0501034_0660540 3300049571 Bacteria 946
966 Ga0501037_0337864 3300049573 Bacteria 1041
967 Ga0501047_0020221 3300049581 Bacteria 6393
968 Ga0501047_0216992 3300049581 Bacteria 1770
969 Ga0501199_004813 3300049650 Bacteria 1342
970 Ga0501206_047472 3300049653 Bacteria 676
971 Ga0501224_000714 3300049664 Bacteria 4165
972 Ga0501238_000120 3300049671 Bacteria 12227
973 Ga0501242_000211 3300049674 Bacteria 4522
974 Ga0501252_024044 3300049682 Bacteria 813
975 Ga0501257_002012 3300049686 Bacteria 4235
976 Ga0501257_019077 3300049686 Bacteria 1603
977 Ga0501259_042052 3300049688 Bacteria 902
978 Ga0501225_0000665 3300049705 Bacteria 10702
979 Ga0501225_0002947 3300049705 Bacteria 5215
980 Ga0501225_0020336 3300049705 Bacteria 1835
981 Ga0501080_0151799 3300049742 Bacteria 2141
982 Ga0501080_0635023 3300049742 Bacteria 946
983 Ga0501241_002088 3300049758 Bacteria 3916
984 Ga0501241_051264 3300049758 Bacteria 816
985 Ga0501280_000875 3300049776 Bacteria 6470
986 Ga0501035_0326638 3300049822 Bacteria 1288
987 Ga0501044_0036903 3300049823 Bacteria 5111
988 Ga0501044_0055830 3300049823 Bacteria 4055
989 Ga0501044_0280509 3300049823 Bacteria 1600
990 nmdc:mga0k408_255503_c1 3300050493 Bacteria 1046
991 nmdc:mga0k408_377960_c1 3300050493 Bacteria 844
992 nmdc:mga0k408_43005_c1 3300050493 Bacteria 2602
993 nmdc:mga09592_110384_c1 3300050508 Bacteria 2359
994 nmdc:mga09592_20613_c1 3300050508 Bacteria 5423
995 nmdc:mga09592_25320_c1 3300050508 Bacteria 4911
996 nmdc:mga09592_32604_c1 3300050508 Bacteria 4343
997 nmdc:mga09592_6481_c1 3300050508 Bacteria 9534
998 nmdc:mga09592_68914_c1 3300050508 Bacteria 3001
999 nmdc:mga0qj67_22434_c1 3300050509 Bacteria 4849
1000 nmdc:mga0qj67_333355_c1 3300050509 Bacteria 1227
1001 nmdc:mga06r32_307059_c1 3300050510 Bacteria 1572
1002 nmdc:mga06r32_560092_c1 3300050510 Bacteria 1116
1003 nmdc:mga08y16_280328_c1 3300050511 Bacteria 1719
1004 nmdc:mga08y16_304676_c1 3300050511 Unclassified 1641
1005 nmdc:mga08y16_48805_c1 3300050511 Bacteria 4430
1006 nmdc:mga08y16_499714_c1 3300050511 Unclassified 1236
1007 nmdc:mga08y16_581473_c1 3300050511 Bacteria 1131
1008 nmdc:mga08y16_723317_c1 3300050511 Unclassified 993
1009 nmdc:mga08y16_99108_c1 3300050511 Bacteria 3034
1010 nmdc:mga08y16_991352_c1 3300050511 Bacteria 821
1011 nmdc:mga0n895_323834_c1 3300050512 Bacteria 1562
1012 nmdc:mga0rr50_499487_c1 3300050513 Bacteria 1034
1013 Ga0495619_0160716 3300053085 Bacteria 1552
1014 Ga0500646_0052912 3300053090 Bacteria 1176
1015 Ga0500583_0000030 3300053092 Bacteria 105809
1016 Ga0500583_0000215 3300053092 Bacteria 21565
1017 Ga0500583_0005514 3300053092 Bacteria 4251
1018 Ga0500583_0009892 3300053092 Bacteria 3509
1019 Ga0500583_0152666 3300053092 Unclassified 1150
1020 Ga0500651_0000485 3300053093 Bacteria 20743
1021 Ga0500651_0073389 3300053093 Bacteria 2127
1022 Ga0500641_0013408 3300053096 Unclassified 3011
1023 Ga0500562_020810 3300053108 Bacteria 1704
1024 Ga0500608_000292 3300053122 Bacteria 19418
1025 Ga0500608_007141 3300053122 Bacteria 4598
1026 Ga0500608_010579 3300053122 Bacteria 3966
1027 Ga0500614_131886 3300053123 Bacteria 742
1028 Ga0500618_000148 3300053125 Bacteria 58264
1029 Ga0500642_0016675 3300053130 Unclassified 2797
1030 Ga0500642_0022291 3300053130 Bacteria 2525
1031 Ga0500561_0064035 3300053137 Bacteria 1037
1032 Ga0500568_0013513 3300053139 Bacteria 3720
1033 Ga0500568_0018116 3300053139 Bacteria 3091
1034 Ga0500568_0042061 3300053139 Bacteria 1833
1035 Ga0500588_0000359 3300053146 Bacteria 6993
1036 Ga0500589_071911 3300053147 Bacteria 1563
1037 Ga0500604_0005834 3300053151 Unclassified 3255
1038 Ga0500604_0072938 3300053151 Unclassified 1098
1039 Ga0500616_0000003 3300053153 Bacteria 1220687
1040 Ga0500616_0008489 3300053153 Bacteria 6372
1041 Ga0500616_0026551 3300053153 Bacteria 3204
1042 Ga0500616_0044311 3300053153 Bacteria 2374
1043 Ga0500616_0052611 3300053153 Bacteria 2141
1044 Ga0500616_0071849 3300053153 Bacteria 1761
1045 Ga0500622_0000017 3300053156 Bacteria 332114
1046 Ga0500622_0000058 3300053156 Bacteria 134237
1047 Ga0500622_0000786 3300053156 Bacteria 27529
1048 Ga0500622_0001315 3300053156 Bacteria 20207
1049 Ga0500622_0001463 3300053156 Bacteria 18819
1050 Ga0500622_0065034 3300053156 Bacteria 1854
1051 Ga0500622_0076405 3300053156 Bacteria 1684
1052 Ga0500636_0032141 3300053177 Bacteria 3106

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0291355 Ga0453683_0291355_415_1017 179
2 3300013100 Ga0157373_10000076 Ga0157373_1000007646 183
3 3300013104 Ga0157370_10001337 Ga0157370_1000133719 183
4 3300015261 Ga0182006_1001215 Ga0182006_10012159 183
5 3300025919 Ga0207657_10524382 Ga0207657_105243822 186
6 3300036401 Ga0373937_0461137 Ga0373937_0461137_568_1161 186
7 3300036401 Ga0373937_0587534 Ga0373937_0587534_66_659 186
8 3300041512 Ga0451853_2161633 Ga0451853_2161633_21_635 186
9 3300046535 Ga0495586_0080270 Ga0495586_0080270_29_643 186
10 3300046809 Ga0495600_0188304 Ga0495600_0188304_671_1285 186
11 3300047317 Ga0495604_0413721 Ga0495604_0413721_29_622 186
12 3300049653 Ga0501206_047472 Ga0501206_047472_41_661 193
13 3300025961 Ga0207712_10018788 Ga0207712_100187882 194
14 3300046558 Ga0495633_0000067 Ga0495633_0000067_93147_93797 195
15 3300028379 Ga0268266_10313865 Ga0268266_103138653 196
16 3300003316 rootH1_10152184 rootH1_101521842 197
17 3300003322 rootL2_10206605 rootL2_102066053 197
18 3300046507 Ga0495606_0029217 Ga0495606_0029217_3213_3845 197
19 3300050508 nmdc:mga09592_20613_c1 nmdc:mga09592_20613_c1_25_720 198
20 3300009553 Ga0105249_10032078 Ga0105249_100320782 200
21 3300017792 Ga0163161_10000095 Ga0163161_1000009540 200
22 3300041512 Ga0451853_0411948 Ga0451853_0411948_140_856 200
23 3300002738 JGI25154J39366_1000001 JGI25154J39366_1000001424 202
24 3300002741 JGI25157J39369_1004584 JGI25157J39369_10045842 202
25 3300003215 JGI25153J46596_10005860 JGI25153J46596_100058603 202
26 3300003323 rootH1_10008757 rootH1_100087574 202
27 3300003354 JGI25160J50197_1003397 JGI25160J50197_10033972 202
28 3300003354 JGI25160J50197_1004076 JGI25160J50197_10040762 202
29 3300013102 Ga0157371_10012850 Ga0157371_100128501 202
30 3300013104 Ga0157370_10006123 Ga0157370_100061232 202
31 3300013105 Ga0157369_10068104 Ga0157369_100681045 202
32 3300015261 Ga0182006_1042607 Ga0182006_10426073 202
33 3300025246 Ga0209646_1000002 Ga0209646_1000002421 202
34 3300025250 Ga0209026_1000218 Ga0209026_100021813 202
35 3300025297 Ga0209758_1024663 Ga0209758_10246633 202
36 3300025302 Ga0207426_1000502 Ga0207426_10005026 202
37 3300048919 Ga0496116_0000002 Ga0496116_0000002_127081_127797 202
38 3300048921 Ga0496118_0025785 Ga0496118_0025785_1553_2269 202
39 3300048927 Ga0496124_0016379 Ga0496124_0016379_1356_2072 202
40 3300048928 Ga0496125_0000007 Ga0496125_0000007_128073_128789 202
41 3300048929 Ga0496126_0068377 Ga0496126_0068377_411_1127 202
42 3300003323 rootH1_10243959 rootH1_102439592 203
43 3300005329 Ga0070683_100023042 Ga0070683_1000230424 203
44 3300005535 Ga0070684_100016467 Ga0070684_1000164673 203
45 3300013100 Ga0157373_10000115 Ga0157373_1000011535 203
46 3300013307 Ga0157372_10010784 Ga0157372_100107849 203
47 3300030734 Ga0316179_1035183 Ga0316179_10351833 203
48 3300031548 Ga0307408_100000947 Ga0307408_10000094718 203
49 3300031731 Ga0307405_10379220 Ga0307405_103792202 203
50 3300031852 Ga0307410_10007044 Ga0307410_100070444 203
51 3300031901 Ga0307406_10000287 Ga0307406_100002872 203
52 3300031903 Ga0307407_10000785 Ga0307407_100007856 203
53 3300031911 Ga0307412_10247868 Ga0307412_102478682 203
54 3300032004 Ga0307414_10000005 Ga0307414_10000005338 203
55 3300049664 Ga0501224_000714 Ga0501224_000714_2238_2954 203
56 3300049671 Ga0501238_000120 Ga0501238_000120_8369_9085 203
57 3300049758 Ga0501241_051264 Ga0501241_051264_49_765 203
58 3300049776 Ga0501280_000875 Ga0501280_000875_1299_2015 203
59 3300053153 Ga0500616_0008489 Ga0500616_0008489_1182_1913 203
60 3300028794 Ga0307515_10106040 Ga0307515_101060404 204
61 3300037312 Ga0395899_0000001 Ga0395899_0000001_1555452_1556168 204
62 3300053123 Ga0500614_131886 Ga0500614_131886_43_723 205
63 3300005288 Ga0065714_10022017 Ga0065714_100220171 206
64 3300050493 nmdc:mga0k408_377960_c1 nmdc:mga0k408_377960_c1_160_831 206
65 3300003323 rootH1_10209779 rootH1_102097792 207
66 3300041486 Ga0451807_0096103 Ga0451807_0096103_166_882 207
67 3300005262 Ga0065165_1014272 Ga0065165_10142723 208
68 3300013308 Ga0157375_10009146 Ga0157375_100091467 209
69 3300041411 Ga0439466_0031994 Ga0439466_0031994_480_1196 209
70 3300025899 Ga0207642_10238725 Ga0207642_102387252 210
71 3300025934 Ga0207686_10283639 Ga0207686_102836391 210
72 3300031727 Ga0316576_10392479 Ga0316576_103924792 210
73 iso_pu_bacteria 2904445276 2904447469 210
74 3300003322 rootL2_10107136 rootL2_101071362 211
75 3300014326 Ga0157380_10265446 Ga0157380_102654462 211
76 3300050511 nmdc:mga08y16_48805_c1 nmdc:mga08y16_48805_c1_959_1663 211
77 iso_pu_bacteria 2839989709 2839991946 211
78 iso_pu_bacteria 2929921140 2929923137 211
79 iso_pu_bacteria 8003151029 8003155972 211
80 3300013102 Ga0157371_10104283 Ga0157371_101042832 212
81 3300042014 Ga0439457_011920 Ga0439457_011920_1007_1738 212
82 3300013102 Ga0157371_10017042 Ga0157371_100170425 213
83 3300013307 Ga0157372_10062986 Ga0157372_100629862 213
84 3300039062 Ga0400483_131968 Ga0400483_131968_66_773 213
85 3300046472 Ga0495580_0139573 Ga0495580_0139573_791_1510 213
86 3300046507 Ga0495606_0011360 Ga0495606_0011360_5993_6712 213
87 3300003323 rootH1_10374623 rootH1_103746231 214
88 3300005288 Ga0065714_10064431 Ga0065714_1006443125 214
89 3300005329 Ga0070683_100039199 Ga0070683_1000391992 214
90 3300005338 Ga0068868_100108996 Ga0068868_1001089962 214
91 3300005355 Ga0070671_100107854 Ga0070671_1001078542 214
92 3300005459 Ga0068867_100003722 Ga0068867_1000037222 214
93 3300005563 Ga0068855_101094636 Ga0068855_1010946361 214
94 3300005616 Ga0068852_100503675 Ga0068852_1005036752 214
95 3300005618 Ga0068864_100102913 Ga0068864_1001029132 214
96 3300005843 Ga0068860_100854471 Ga0068860_1008544712 214
97 3300006237 Ga0097621_100193831 Ga0097621_1001938311 214
98 3300006358 Ga0068871_100205853 Ga0068871_1002058532 214
99 3300006881 Ga0068865_100018914 Ga0068865_1000189142 214
100 3300009036 Ga0105244_10131388 Ga0105244_101313882 214
101 3300009094 Ga0111539_10011626 Ga0111539_100116265 214
102 3300009176 Ga0105242_10044485 Ga0105242_100444852 214
103 3300009176 Ga0105242_10293334 Ga0105242_102933342 214
104 3300013296 Ga0157374_10342448 Ga0157374_103424482 214
105 3300013297 Ga0157378_10040141 Ga0157378_100401412 214
106 3300013306 Ga0163162_10045607 Ga0163162_100456072 214
107 3300014325 Ga0163163_10329397 Ga0163163_103293971 214
108 3300014326 Ga0157380_10004552 Ga0157380_100045523 214
109 3300015261 Ga0182006_1000094 Ga0182006_100009429 214
110 3300025905 Ga0207685_10214742 Ga0207685_102147421 214
111 3300025907 Ga0207645_10068466 Ga0207645_100684662 214
112 3300025931 Ga0207644_10210817 Ga0207644_102108172 214
113 3300025944 Ga0207661_10584836 Ga0207661_105848362 214
114 3300025949 Ga0207667_10980036 Ga0207667_109800361 214
115 3300026088 Ga0207641_10276044 Ga0207641_102760442 214
116 3300026089 Ga0207648_10003831 Ga0207648_100038317 214
117 3300026095 Ga0207676_10539429 Ga0207676_105394292 214
118 3300035172 Ga0373955_0027088 Ga0373955_0027088_884_1588 214
119 3300035724 Ga0373933_0038641 Ga0373933_0038641_1826_2530 214
120 3300036401 Ga0373937_0009021 Ga0373937_0009021_3620_4324 214
121 3300037068 Ga0373925_0156848 Ga0373925_0156848_565_1266 214
122 3300046454 Ga0495592_0080635 Ga0495592_0080635_1085_1789 214
123 3300046472 Ga0495580_0265776 Ga0495580_0265776_138_839 214
124 3300046514 Ga0495618_0061110 Ga0495618_0061110_1456_2160 214
125 3300046516 Ga0495628_0129609 Ga0495628_0129609_1126_1830 214
126 3300046642 Ga0495634_0018697 Ga0495634_0018697_3863_4567 214
127 3300047317 Ga0495604_0389047 Ga0495604_0389047_105_809 214
128 3300047319 Ga0495674_0186293 Ga0495674_0186293_509_1213 214
129 3300047321 Ga0495676_0309077 Ga0495676_0309077_83_784 214
130 iso_pu_bacteria 2721755487 2722729589 214
131 3300001979 JGI24740J21852_10003050 JGI24740J21852_100030503 215
132 3300001989 JGI24739J22299_10000854 JGI24739J22299_100008549 215
133 3300003320 rootH2_10016087 rootH2_100160872 215
134 3300003322 rootL2_10352985 rootL2_103529852 215
135 3300003323 rootH1_10209329 rootH1_102093295 215
136 3300003354 JGI25160J50197_1015650 JGI25160J50197_10156502 215
137 3300003354 JGI25160J50197_1034227 JGI25160J50197_10342271 215
138 3300003771 Ga0055526_1014997 Ga0055526_10149971 215
139 3300003771 Ga0055526_1015094 Ga0055526_10150941 215
140 3300003790 Ga0055528_1000278 Ga0055528_100027831 215
141 3300003791 Ga0055530_10003481 Ga0055530_100034815 215
142 3300003794 Ga0055531_10016402 Ga0055531_100164023 215
143 3300005262 Ga0065165_1000010 Ga0065165_100001018 215
144 3300005841 Ga0068863_100001267 Ga0068863_1000012673 215
145 3300006195 Ga0075366_10156423 Ga0075366_101564231 215
146 3300013104 Ga0157370_10054900 Ga0157370_100549003 215
147 3300013104 Ga0157370_10244746 Ga0157370_102447462 215
148 3300025273 Ga0209673_1000082 Ga0209673_10000822 215
149 3300025273 Ga0209673_1055161 Ga0209673_10551612 215
150 3300025295 Ga0209564_1007986 Ga0209564_10079862 215
151 3300025295 Ga0209564_1012344 Ga0209564_10123442 215
152 3300025297 Ga0209758_1015100 Ga0209758_10151004 215
153 3300025298 Ga0209050_1000577 Ga0209050_100057753 215
154 3300025302 Ga0207426_1007377 Ga0207426_10073774 215
155 3300025304 Ga0209257_1004063 Ga0209257_10040638 215
156 3300025904 Ga0207647_10134190 Ga0207647_101341902 215
157 3300026088 Ga0207641_10000377 Ga0207641_1000037733 215
158 3300031251 Ga0265327_10000073 Ga0265327_10000073151 215
159 3300049823 Ga0501044_0280509 Ga0501044_0280509_206_934 215
160 3300050493 nmdc:mga0k408_255503_c1 nmdc:mga0k408_255503_c1_266_964 215
161 3300053139 Ga0500568_0018116 Ga0500568_0018116_2184_2909 215
162 3300005365 Ga0070688_100049537 Ga0070688_1000495372 216
163 3300005466 Ga0070685_10084911 Ga0070685_100849112 216
164 3300005618 Ga0068864_100437777 Ga0068864_1004377771 216
165 3300005985 Ga0081539_10077544 Ga0081539_100775442 216
166 3300006358 Ga0068871_100634437 Ga0068871_1006344371 216
167 3300006844 Ga0075428_100147774 Ga0075428_1001477742 216
168 3300006846 Ga0075430_100058156 Ga0075430_1000581562 216
169 3300006847 Ga0075431_100075499 Ga0075431_1000754992 216
170 3300009093 Ga0105240_10000547 Ga0105240_1000054721 216
171 3300013306 Ga0163162_10074637 Ga0163162_100746373 216
172 3300014325 Ga0163163_10012157 Ga0163163_100121577 216
173 3300014326 Ga0157380_10000002 Ga0157380_1000000217 216
174 3300025913 Ga0207695_10000067 Ga0207695_10000067207 216
175 3300025931 Ga0207644_10264882 Ga0207644_102648822 216
176 3300025936 Ga0207670_10115899 Ga0207670_101158992 216
177 3300026095 Ga0207676_10424122 Ga0207676_104241221 216
178 3300028381 Ga0268264_10016393 Ga0268264_100163934 216
179 3300042876 Ga0451577_0079256 Ga0451577_0079256_939_1646 216
180 3300042876 Ga0451577_0192273 Ga0451577_0192273_893_1600 216
181 3300044712 Ga0453684_0134820 Ga0453684_0134820_1019_1726 216
182 3300044712 Ga0453684_0449951 Ga0453684_0449951_693_1400 216
183 3300045051 Ga0451576_0086893 Ga0451576_0086893_1926_2633 216
184 3300045051 Ga0451576_0388447 Ga0451576_0388447_368_1075 216
185 3300047315 Ga0495581_0035024 Ga0495581_0035024_981_1664 216
186 3300050508 nmdc:mga09592_25320_c1 nmdc:mga09592_25320_c1_1370_2119 216
187 3300050509 nmdc:mga0qj67_22434_c1 nmdc:mga0qj67_22434_c1_432_1181 216
188 3300050510 nmdc:mga06r32_307059_c1 nmdc:mga06r32_307059_c1_612_1361 216
189 3300053122 Ga0500608_007141 Ga0500608_007141_1482_2195 216
190 3300053153 Ga0500616_0026551 Ga0500616_0026551_1861_2586 216
191 iso_pu_bacteria 2904780799 2904781205 216
192 iso_pu_bacteria 2919177583 2919178808 216
193 3300005336 Ga0070680_100355947 Ga0070680_1003559472 217
194 3300005347 Ga0070668_100146819 Ga0070668_1001468192 217
195 3300005367 Ga0070667_100070796 Ga0070667_1000707963 217
196 3300005539 Ga0068853_100118647 Ga0068853_1001186471 217
197 3300005563 Ga0068855_100404142 Ga0068855_1004041422 217
198 3300005614 Ga0068856_100613680 Ga0068856_1006136801 217
199 3300005841 Ga0068863_100451788 Ga0068863_1004517882 217
200 3300006358 Ga0068871_100118650 Ga0068871_1001186502 217
201 3300009093 Ga0105240_10038286 Ga0105240_100382865 217
202 3300009174 Ga0105241_10030828 Ga0105241_100308283 217
203 3300009174 Ga0105241_10082299 Ga0105241_100822993 217
204 3300009545 Ga0105237_10013011 Ga0105237_100130113 217
205 3300009545 Ga0105237_10026340 Ga0105237_100263404 217
206 3300010375 Ga0105239_10000004 Ga0105239_1000000424 217
207 3300010375 Ga0105239_10000016 Ga0105239_10000016187 217
208 3300010375 Ga0105239_10004803 Ga0105239_100048034 217
209 3300013104 Ga0157370_10009531 Ga0157370_100095313 217
210 3300013307 Ga0157372_10344993 Ga0157372_103449932 217
211 3300014497 Ga0182008_10000081 Ga0182008_1000008129 217
212 3300025909 Ga0207705_10372739 Ga0207705_103727392 217
213 3300025911 Ga0207654_10039283 Ga0207654_100392834 217
214 3300025913 Ga0207695_10026583 Ga0207695_100265832 217
215 3300025913 Ga0207695_10509493 Ga0207695_105094931 217
216 3300025914 Ga0207671_10005696 Ga0207671_100056967 217
217 3300025914 Ga0207671_10059616 Ga0207671_100596161 217
218 3300025949 Ga0207667_10412417 Ga0207667_104124172 217
219 3300025986 Ga0207658_10020456 Ga0207658_100204565 217
220 3300026041 Ga0207639_10101786 Ga0207639_101017862 217
221 3300026078 Ga0207702_11045364 Ga0207702_110453641 217
222 3300026088 Ga0207641_10411366 Ga0207641_104113662 217
223 3300031251 Ga0265327_10001129 Ga0265327_1000112929 217
224 3300031731 Ga0307405_10000008 Ga0307405_1000000817 217
225 3300032004 Ga0307414_10000574 Ga0307414_1000057420 217
226 3300039062 Ga0400483_036718 Ga0400483_036718_69_770 217
227 3300042876 Ga0451577_0066957 Ga0451577_0066957_1325_2035 217
228 3300044658 Ga0466972_0177502 Ga0466972_0177502_211_909 217
229 3300044712 Ga0453684_0177372 Ga0453684_0177372_1150_1875 217
230 3300045051 Ga0451576_0000003 Ga0451576_0000003_1319276_1319980 217
231 3300046507 Ga0495606_0011306 Ga0495606_0011306_6006_6719 217
232 3300046529 Ga0495652_0137447 Ga0495652_0137447_1015_1731 217
233 3300048919 Ga0496116_0022382 Ga0496116_0022382_605_1294 217
234 3300048920 Ga0496117_0006510 Ga0496117_0006510_1108_1797 217
235 3300048921 Ga0496118_0201570 Ga0496118_0201570_259_948 217
236 3300048925 Ga0496122_0078960 Ga0496122_0078960_204_893 217
237 3300049758 Ga0501241_002088 Ga0501241_002088_1403_2113 217
238 iso_pu_bacteria 2643221600 2644010698 217
239 iso_pu_bacteria 2643221725 2644684226 217
240 iso_pu_bacteria 2802428842 2802651880 217
241 iso_pu_bacteria 2857613821 2857615275 217
242 iso_pu_bacteria 2881359912 2881360230 217
243 iso_pu_bacteria 2904419702 2904423949 217
244 iso_pu_bacteria 2904555929 2904560411 217
245 iso_pu_bacteria 2919683626 2919684774 217
246 iso_pu_bacteria 2977268062 2977268624 217
247 3300003215 JGI25153J46596_10072175 JGI25153J46596_100721751 218
248 3300003316 rootH1_10035387 rootH1_100353872 218
249 3300003316 rootH1_10171005 rootH1_101710052 218
250 3300003322 rootL2_10084252 rootL2_100842522 218
251 3300005336 Ga0070680_100053462 Ga0070680_1000534623 218
252 3300005336 Ga0070680_100429040 Ga0070680_1004290401 218
253 3300005337 Ga0070682_100049572 Ga0070682_1000495722 218
254 3300005458 Ga0070681_10036122 Ga0070681_100361223 218
255 3300005530 Ga0070679_100011937 Ga0070679_1000119373 218
256 3300005530 Ga0070679_100106752 Ga0070679_1001067523 218
257 3300005539 Ga0068853_100083133 Ga0068853_1000831334 218
258 3300005563 Ga0068855_100042540 Ga0068855_1000425405 218
259 3300005564 Ga0070664_100400340 Ga0070664_1004003402 218
260 3300005614 Ga0068856_100026045 Ga0068856_1000260451 218
261 3300005616 Ga0068852_100032145 Ga0068852_1000321452 218
262 3300006844 Ga0075428_100022380 Ga0075428_1000223807 218
263 3300009093 Ga0105240_10000390 Ga0105240_1000039023 218
264 3300009174 Ga0105241_10031464 Ga0105241_100314643 218
265 3300009545 Ga0105237_10441695 Ga0105237_104416952 218
266 3300010375 Ga0105239_10000184 Ga0105239_1000018445 218
267 3300013100 Ga0157373_10002170 Ga0157373_100021708 218
268 3300013102 Ga0157371_10290466 Ga0157371_102904662 218
269 3300013296 Ga0157374_10262274 Ga0157374_102622742 218
270 3300014325 Ga0163163_10000129 Ga0163163_1000012947 218
271 3300025295 Ga0209564_1028609 Ga0209564_10286091 218
272 3300025297 Ga0209758_1082446 Ga0209758_10824462 218
273 3300025911 Ga0207654_10045585 Ga0207654_100455852 218
274 3300025912 Ga0207707_10124522 Ga0207707_101245223 218
275 3300025913 Ga0207695_10000020 Ga0207695_1000002084 218
276 3300025913 Ga0207695_10039570 Ga0207695_100395702 218
277 3300025917 Ga0207660_10015857 Ga0207660_100158575 218
278 3300025921 Ga0207652_10008396 Ga0207652_100083963 218
279 3300025921 Ga0207652_10115321 Ga0207652_101153211 218
280 3300028786 Ga0307517_10011996 Ga0307517_1001199611 218
281 3300031507 Ga0307509_10138196 Ga0307509_101381962 218
282 3300031548 Ga0307408_100059395 Ga0307408_1000593952 218
283 3300031824 Ga0307413_10096748 Ga0307413_100967483 218
284 3300031903 Ga0307407_10058688 Ga0307407_100586883 218
285 3300032002 Ga0307416_100102620 Ga0307416_1001026203 218
286 3300032126 Ga0307415_100125907 Ga0307415_1001259073 218
287 3300039062 Ga0400483_156766 Ga0400483_156766_230_952 218
288 3300042876 Ga0451577_0266104 Ga0451577_0266104_280_1002 218
289 3300044658 Ga0466972_0000027 Ga0466972_0000027_92586_93317 218
290 3300044673 Ga0453683_0045522 Ga0453683_0045522_869_1570 218
291 3300044712 Ga0453684_0195770 Ga0453684_0195770_794_1495 218
292 3300044765 Ga0466970_0001866 Ga0466970_0001866_8913_9644 218
293 3300045051 Ga0451576_0034004 Ga0451576_0034004_2842_3543 218
294 3300045051 Ga0451576_0057828 Ga0451576_0057828_2192_2914 218
295 3300046524 Ga0495648_0167449 Ga0495648_0167449_172_885 218
296 3300047320 Ga0495672_0039736 Ga0495672_0039736_960_1676 218
297 3300053153 Ga0500616_0044311 Ga0500616_0044311_744_1448 218
298 iso_pu_bacteria 2738541278 2738728145 218
299 iso_pu_bacteria 2911138879 2911143717 218
300 3300003794 Ga0055531_10002422 Ga0055531_100024226 219
301 3300005289 Ga0065704_10073560 Ga0065704_100735604 219
302 3300005356 Ga0070674_100061294 Ga0070674_1000612942 219
303 3300005367 Ga0070667_100178140 Ga0070667_1001781402 219
304 3300005539 Ga0068853_100017196 Ga0068853_1000171962 219
305 3300005548 Ga0070665_100000052 Ga0070665_100000052127 219
306 3300005563 Ga0068855_100106839 Ga0068855_1001068393 219
307 3300009148 Ga0105243_10000002 Ga0105243_10000002666 219
308 3300013100 Ga0157373_10004999 Ga0157373_1000499910 219
309 3300013102 Ga0157371_10036888 Ga0157371_100368883 219
310 3300013104 Ga0157370_10233542 Ga0157370_102335422 219
311 3300013296 Ga0157374_10077932 Ga0157374_100779323 219
312 3300013307 Ga0157372_10121838 Ga0157372_101218385 219
313 3300017792 Ga0163161_10000230 Ga0163161_1000023023 219
314 3300025298 Ga0209050_1006924 Ga0209050_10069242 219
315 3300025304 Ga0209257_1000007 Ga0209257_10000071290 219
316 3300025935 Ga0207709_10000003 Ga0207709_10000003673 219
317 3300025986 Ga0207658_10337142 Ga0207658_103371422 219
318 3300028379 Ga0268266_10000070 Ga0268266_1000007054 219
319 3300028786 Ga0307517_10193999 Ga0307517_101939992 219
320 3300031548 Ga0307408_100000261 Ga0307408_1000002615 219
321 3300031911 Ga0307412_10002921 Ga0307412_100029213 219
322 3300032004 Ga0307414_10536299 Ga0307414_105362991 219
323 3300037312 Ga0395899_0002759 Ga0395899_0002759_3356_4069 219
324 3300037418 Ga0395900_0007814 Ga0395900_0007814_8004_8717 219
325 3300037466 Ga0395898_0006869 Ga0395898_0006869_4174_4887 219
326 3300037466 Ga0395898_0153074 Ga0395898_0153074_1482_2195 219
327 3300038443 Ga0395901_0006235 Ga0395901_0006235_3671_4384 219
328 3300039062 Ga0400483_085096 Ga0400483_085096_252_1001 219
329 3300039062 Ga0400483_185962 Ga0400483_185962_6767_7516 219
330 3300042134 Ga0450898_028749 Ga0450898_028749_142_861 219
331 3300042876 Ga0451577_0000030 Ga0451577_0000030_48651_49370 219
332 3300042876 Ga0451577_0000066 Ga0451577_0000066_159773_160489 219
333 3300042876 Ga0451577_0003571 Ga0451577_0003571_5647_6363 219
334 3300042876 Ga0451577_0010709 Ga0451577_0010709_3675_4391 219
335 3300042876 Ga0451577_0229120 Ga0451577_0229120_609_1328 219
336 3300042876 Ga0451577_0336172 Ga0451577_0336172_212_928 219
337 3300042876 Ga0451577_0376778 Ga0451577_0376778_421_1137 219
338 3300042876 Ga0451577_0377632 Ga0451577_0377632_109_822 219
339 3300042876 Ga0451577_0396117 Ga0451577_0396117_255_971 219
340 3300042876 Ga0451577_0764229 Ga0451577_0764229_88_804 219
341 3300044658 Ga0466972_0000024 Ga0466972_0000024_24465_25169 219
342 3300044673 Ga0453683_0000022 Ga0453683_0000022_69268_69984 219
343 3300044673 Ga0453683_0000112 Ga0453683_0000112_97104_97820 219
344 3300044673 Ga0453683_0000329 Ga0453683_0000329_25988_26704 219
345 3300044673 Ga0453683_0002791 Ga0453683_0002791_5063_5779 219
346 3300044673 Ga0453683_0009620 Ga0453683_0009620_2489_3205 219
347 3300044673 Ga0453683_0023532 Ga0453683_0023532_170_883 219
348 3300044673 Ga0453683_0097063 Ga0453683_0097063_1043_1762 219
349 3300044673 Ga0453683_0195091 Ga0453683_0195091_189_905 219
350 3300044712 Ga0453684_0000051 Ga0453684_0000051_507909_508625 219
351 3300044712 Ga0453684_0000206 Ga0453684_0000206_97162_97878 219
352 3300044712 Ga0453684_0000260 Ga0453684_0000260_49108_49827 219
353 3300044712 Ga0453684_0001207 Ga0453684_0001207_14524_15240 219
354 3300044712 Ga0453684_0002151 Ga0453684_0002151_14739_15458 219
355 3300044712 Ga0453684_0010954 Ga0453684_0010954_8911_9624 219
356 3300044712 Ga0453684_0015660 Ga0453684_0015660_4014_4727 219
357 3300044712 Ga0453684_0018383 Ga0453684_0018383_1928_2644 219
358 3300044712 Ga0453684_0025910 Ga0453684_0025910_5848_6564 219
359 3300044712 Ga0453684_0058021 Ga0453684_0058021_1035_1745 219
360 3300044712 Ga0453684_0140459 Ga0453684_0140459_234_947 219
361 3300044712 Ga0453684_0146361 Ga0453684_0146361_1877_2593 219
362 3300044712 Ga0453684_0280276 Ga0453684_0280276_609_1319 219
363 3300044712 Ga0453684_0328350 Ga0453684_0328350_835_1545 219
364 3300044712 Ga0453684_0585335 Ga0453684_0585335_250_966 219
365 3300044712 Ga0453684_0698513 Ga0453684_0698513_130_846 219
366 3300044712 Ga0453684_1062071 Ga0453684_1062071_80_796 219
367 3300044765 Ga0466970_0004459 Ga0466970_0004459_925_1629 219
368 3300044842 Ga0466957_0108799 Ga0466957_0108799_425_1129 219
369 3300044842 Ga0466957_0265578 Ga0466957_0265578_101_814 219
370 3300045051 Ga0451576_0000072 Ga0451576_0000072_97162_97878 219
371 3300045051 Ga0451576_0000103 Ga0451576_0000103_37610_38329 219
372 3300045051 Ga0451576_0002639 Ga0451576_0002639_20556_21272 219
373 3300045051 Ga0451576_0012627 Ga0451576_0012627_5558_6274 219
374 3300045051 Ga0451576_0029708 Ga0451576_0029708_108_824 219
375 3300045051 Ga0451576_0071073 Ga0451576_0071073_1855_2571 219
376 3300045051 Ga0451576_0208997 Ga0451576_0208997_733_1449 219
377 3300046460 Ga0495638_0000015 Ga0495638_0000015_79766_80473 219
378 3300046460 Ga0495638_0037364 Ga0495638_0037364_1854_2546 219
379 3300046524 Ga0495648_0003814 Ga0495648_0003814_354_1046 219
380 3300046648 Ga0495611_0120853 Ga0495611_0120853_361_1053 219
381 3300047443 Ga0495687_000006 Ga0495687_000006_314862_315554 219
382 3300049822 Ga0501035_0326638 Ga0501035_0326638_38_751 219
383 3300053090 Ga0500646_0052912 Ga0500646_0052912_424_1116 219
384 3300053092 Ga0500583_0009892 Ga0500583_0009892_359_1051 219
385 3300053130 Ga0500642_0022291 Ga0500642_0022291_701_1393 219
386 3300053139 Ga0500568_0013513 Ga0500568_0013513_2713_3405 219
387 3300053151 Ga0500604_0072938 Ga0500604_0072938_83_802 219
388 iso_pu_bacteria 2599185184 2599480907 219
389 iso_pu_bacteria 2919186247 2919187625 219
390 iso_pu_bacteria 2928078545 2928080824 219
391 iso_pu_bacteria 2928147474 2928151045 219
392 iso_pu_bacteria 2932082852 2932087600 219
393 iso_pu_bacteria 2939664404 2939665109 219
394 3300003320 rootH2_10024764 rootH2_1002476410 220
395 3300003323 rootH1_10000976 rootH1_100009767 220
396 3300005330 Ga0070690_100008412 Ga0070690_1000084124 220
397 3300005333 Ga0070677_10185258 Ga0070677_101852582 220
398 3300005334 Ga0068869_100004357 Ga0068869_1000043575 220
399 3300005335 Ga0070666_10031661 Ga0070666_100316614 220
400 3300005335 Ga0070666_10037322 Ga0070666_100373222 220
401 3300005355 Ga0070671_100035739 Ga0070671_1000357392 220
402 3300005364 Ga0070673_100200682 Ga0070673_1002006822 220
403 3300005367 Ga0070667_100797971 Ga0070667_1007979711 220
404 3300005457 Ga0070662_100016718 Ga0070662_1000167184 220
405 3300005458 Ga0070681_10730906 Ga0070681_107309061 220
406 3300005544 Ga0070686_100008748 Ga0070686_1000087482 220
407 3300005548 Ga0070665_100000001 Ga0070665_100000001724 220
408 3300005564 Ga0070664_100586448 Ga0070664_1005864481 220
409 3300005578 Ga0068854_100086243 Ga0068854_1000862432 220
410 3300005616 Ga0068852_100029713 Ga0068852_1000297134 220
411 3300005616 Ga0068852_101028232 Ga0068852_1010282321 220
412 3300005618 Ga0068864_100156435 Ga0068864_1001564352 220
413 3300005840 Ga0068870_10062898 Ga0068870_100628982 220
414 3300005843 Ga0068860_100616658 Ga0068860_1006166582 220
415 3300005985 Ga0081539_10099800 Ga0081539_100998002 220
416 3300006237 Ga0097621_100007184 Ga0097621_1000071842 220
417 3300006237 Ga0097621_100369999 Ga0097621_1003699991 220
418 3300006358 Ga0068871_100074511 Ga0068871_1000745113 220
419 3300006358 Ga0068871_100310920 Ga0068871_1003109201 220
420 3300006844 Ga0075428_100190031 Ga0075428_1001900312 220
421 3300009093 Ga0105240_10000072 Ga0105240_1000007237 220
422 3300009093 Ga0105240_10076543 Ga0105240_100765433 220
423 3300009147 Ga0114129_10002413 Ga0114129_100024132 220
424 3300009174 Ga0105241_10364129 Ga0105241_103641292 220
425 3300009176 Ga0105242_10007760 Ga0105242_100077608 220
426 3300009545 Ga0105237_10002078 Ga0105237_100020782 220
427 3300009545 Ga0105237_10043859 Ga0105237_100438594 220
428 3300009553 Ga0105249_10162612 Ga0105249_101626122 220
429 3300010375 Ga0105239_10003592 Ga0105239_1000359215 220
430 3300013104 Ga0157370_10004435 Ga0157370_100044358 220
431 3300013296 Ga0157374_10003994 Ga0157374_100039947 220
432 3300013297 Ga0157378_10148384 Ga0157378_101483842 220
433 3300013297 Ga0157378_10425086 Ga0157378_104250862 220
434 3300013306 Ga0163162_10009325 Ga0163162_100093252 220
435 3300013306 Ga0163162_10016895 Ga0163162_100168957 220
436 3300013308 Ga0157375_10008461 Ga0157375_100084614 220
437 3300014325 Ga0163163_10035414 Ga0163163_100354145 220
438 3300014969 Ga0157376_10002014 Ga0157376_100020145 220
439 3300025903 Ga0207680_10089346 Ga0207680_100893462 220
440 3300025903 Ga0207680_10094534 Ga0207680_100945342 220
441 3300025913 Ga0207695_10000067 Ga0207695_1000006778 220
442 3300025913 Ga0207695_10119054 Ga0207695_101190543 220
443 3300025914 Ga0207671_10011524 Ga0207671_100115242 220
444 3300025914 Ga0207671_10025795 Ga0207671_100257952 220
445 3300025931 Ga0207644_10166818 Ga0207644_101668182 220
446 3300025933 Ga0207706_10016752 Ga0207706_100167525 220
447 3300025942 Ga0207689_10020450 Ga0207689_100204502 220
448 3300026023 Ga0207677_10388378 Ga0207677_103883782 220
449 3300026121 Ga0207683_10012032 Ga0207683_100120326 220
450 3300026142 Ga0207698_10038499 Ga0207698_100384992 220
451 3300026142 Ga0207698_10148024 Ga0207698_101480241 220
452 3300028379 Ga0268266_10000049 Ga0268266_1000004985 220
453 3300028666 Ga0265336_10028594 Ga0265336_100285941 220
454 3300031616 Ga0307508_10000969 Ga0307508_1000096925 220
455 3300044712 Ga0453684_0525383 Ga0453684_0525383_456_1187 220
456 3300044842 Ga0466957_0063074 Ga0466957_0063074_408_1130 220
457 3300046460 Ga0495638_0167419 Ga0495638_0167419_89_817 220
458 3300046524 Ga0495648_0025243 Ga0495648_0025243_1090_1818 220
459 3300046810 Ga0495660_0034191 Ga0495660_0034191_1252_1968 220
460 3300049581 Ga0501047_0216992 Ga0501047_0216992_115_837 220
461 3300049682 Ga0501252_024044 Ga0501252_024044_28_756 220
462 3300049823 Ga0501044_0036903 Ga0501044_0036903_3830_4552 220
463 3300050509 nmdc:mga0qj67_333355_c1 nmdc:mga0qj67_333355_c1_326_1033 220
464 3300053092 Ga0500583_0005514 Ga0500583_0005514_722_1450 220
465 3300053096 Ga0500641_0013408 Ga0500641_0013408_1226_1945 220
466 3300053125 Ga0500618_000148 Ga0500618_000148_45676_46401 220
467 3300053130 Ga0500642_0016675 Ga0500642_0016675_597_1325 220
468 3300053139 Ga0500568_0042061 Ga0500568_0042061_121_849 220
469 3300053146 Ga0500588_0000359 Ga0500588_0000359_2204_2926 220
470 3300053156 Ga0500622_0001463 Ga0500622_0001463_6193_6921 220
471 iso_pu_bacteria 2945924605 2945926182 220
472 iso_pu_bacteria 2977243572 2977245162 220
473 3300002459 JGI24751J29686_10012501 JGI24751J29686_100125012 221
474 3300005288 Ga0065714_10007502 Ga0065714_100075023 221
475 3300005290 Ga0065712_10027579 Ga0065712_100275792 221
476 3300005290 Ga0065712_10069410 Ga0065712_100694103 221
477 3300005290 Ga0065712_10069552 Ga0065712_100695524 221
478 3300005290 Ga0065712_10236413 Ga0065712_102364132 221
479 3300005293 Ga0065715_10116182 Ga0065715_101161823 221
480 3300005295 Ga0065707_10126201 Ga0065707_101262012 221
481 3300005329 Ga0070683_100005303 Ga0070683_1000053037 221
482 3300005329 Ga0070683_100010600 Ga0070683_1000106004 221
483 3300005331 Ga0070670_100005179 Ga0070670_1000051795 221
484 3300005331 Ga0070670_100010624 Ga0070670_1000106245 221
485 3300005331 Ga0070670_100021066 Ga0070670_1000210664 221
486 3300005331 Ga0070670_100027115 Ga0070670_1000271154 221
487 3300005331 Ga0070670_100101770 Ga0070670_1001017702 221
488 3300005333 Ga0070677_10076581 Ga0070677_100765811 221
489 3300005334 Ga0068869_100059516 Ga0068869_1000595162 221
490 3300005334 Ga0068869_100299674 Ga0068869_1002996742 221
491 3300005334 Ga0068869_100406633 Ga0068869_1004066332 221
492 3300005336 Ga0070680_100333483 Ga0070680_1003334831 221
493 3300005339 Ga0070660_100000519 Ga0070660_10000051918 221
494 3300005340 Ga0070689_100022207 Ga0070689_1000222074 221
495 3300005340 Ga0070689_100033280 Ga0070689_1000332802 221
496 3300005340 Ga0070689_100141592 Ga0070689_1001415922 221
497 3300005340 Ga0070689_100280994 Ga0070689_1002809941 221
498 3300005340 Ga0070689_100316251 Ga0070689_1003162511 221
499 3300005340 Ga0070689_100660105 Ga0070689_1006601051 221
500 3300005343 Ga0070687_100025075 Ga0070687_1000250753 221
501 3300005343 Ga0070687_100168757 Ga0070687_1001687572 221
502 3300005344 Ga0070661_100037377 Ga0070661_1000373772 221
503 3300005344 Ga0070661_100076665 Ga0070661_1000766652 221
504 3300005345 Ga0070692_10076047 Ga0070692_100760472 221
505 3300005347 Ga0070668_100128182 Ga0070668_1001281822 221
506 3300005347 Ga0070668_100210811 Ga0070668_1002108112 221
507 3300005353 Ga0070669_100296295 Ga0070669_1002962952 221
508 3300005354 Ga0070675_100180486 Ga0070675_1001804862 221
509 3300005354 Ga0070675_100183207 Ga0070675_1001832072 221
510 3300005354 Ga0070675_100375560 Ga0070675_1003755602 221
511 3300005355 Ga0070671_100062198 Ga0070671_1000621983 221
512 3300005355 Ga0070671_100359829 Ga0070671_1003598291 221
513 3300005356 Ga0070674_100073427 Ga0070674_1000734273 221
514 3300005364 Ga0070673_100015208 Ga0070673_1000152084 221
515 3300005364 Ga0070673_100215003 Ga0070673_1002150032 221
516 3300005364 Ga0070673_100231825 Ga0070673_1002318252 221
517 3300005365 Ga0070688_100012275 Ga0070688_1000122753 221
518 3300005367 Ga0070667_100056492 Ga0070667_1000564923 221
519 3300005367 Ga0070667_100235187 Ga0070667_1002351872 221
520 3300005441 Ga0070700_100077071 Ga0070700_1000770711 221
521 3300005441 Ga0070700_100230312 Ga0070700_1002303121 221
522 3300005458 Ga0070681_10118004 Ga0070681_101180041 221
523 3300005458 Ga0070681_10348521 Ga0070681_103485211 221
524 3300005459 Ga0068867_100122941 Ga0068867_1001229412 221
525 3300005459 Ga0068867_100140091 Ga0068867_1001400912 221
526 3300005466 Ga0070685_10263973 Ga0070685_102639732 221
527 3300005471 Ga0070698_100008374 Ga0070698_10000837410 221
528 3300005518 Ga0070699_100131640 Ga0070699_1001316402 221
529 3300005530 Ga0070679_100064943 Ga0070679_1000649432 221
530 3300005530 Ga0070679_100084235 Ga0070679_1000842352 221
531 3300005535 Ga0070684_100022390 Ga0070684_1000223903 221
532 3300005535 Ga0070684_100024874 Ga0070684_1000248743 221
533 3300005536 Ga0070697_100477518 Ga0070697_1004775182 221
534 3300005539 Ga0068853_100218350 Ga0068853_1002183502 221
535 3300005543 Ga0070672_100328596 Ga0070672_1003285962 221
536 3300005543 Ga0070672_100366204 Ga0070672_1003662041 221
537 3300005544 Ga0070686_100029580 Ga0070686_1000295803 221
538 3300005563 Ga0068855_100071060 Ga0068855_1000710602 221
539 3300005563 Ga0068855_100071573 Ga0068855_1000715732 221
540 3300005563 Ga0068855_100171360 Ga0068855_1001713602 221
541 3300005564 Ga0070664_100004539 Ga0070664_10000453911 221
542 3300005577 Ga0068857_100254525 Ga0068857_1002545252 221
543 3300005577 Ga0068857_100377317 Ga0068857_1003773172 221
544 3300005615 Ga0070702_100541167 Ga0070702_1005411671 221
545 3300005616 Ga0068852_100041480 Ga0068852_1000414801 221
546 3300005616 Ga0068852_100150676 Ga0068852_1001506762 221
547 3300005616 Ga0068852_100594771 Ga0068852_1005947712 221
548 3300005617 Ga0068859_100017085 Ga0068859_1000170852 221
549 3300005617 Ga0068859_100030941 Ga0068859_1000309416 221
550 3300005617 Ga0068859_100087099 Ga0068859_1000870992 221
551 3300005617 Ga0068859_100163375 Ga0068859_1001633752 221
552 3300005617 Ga0068859_100417252 Ga0068859_1004172522 221
553 3300005617 Ga0068859_100561765 Ga0068859_1005617651 221
554 3300005617 Ga0068859_100833121 Ga0068859_1008331211 221
555 3300005618 Ga0068864_100076708 Ga0068864_1000767082 221
556 3300005618 Ga0068864_100270505 Ga0068864_1002705052 221
557 3300005719 Ga0068861_100014998 Ga0068861_1000149986 221
558 3300005719 Ga0068861_100368564 Ga0068861_1003685642 221
559 3300005719 Ga0068861_100453628 Ga0068861_1004536281 221
560 3300005834 Ga0068851_10212408 Ga0068851_102124081 221
561 3300005841 Ga0068863_100001267 Ga0068863_10000126711 221
562 3300005841 Ga0068863_100005658 Ga0068863_10000565811 221
563 3300005841 Ga0068863_100225021 Ga0068863_1002250212 221
564 3300005841 Ga0068863_100407345 Ga0068863_1004073452 221
565 3300005842 Ga0068858_100244438 Ga0068858_1002444382 221
566 3300005843 Ga0068860_100002275 Ga0068860_10000227511 221
567 3300005843 Ga0068860_100067089 Ga0068860_1000670893 221
568 3300005843 Ga0068860_100241604 Ga0068860_1002416042 221
569 3300005844 Ga0068862_100005444 Ga0068862_1000054448 221
570 3300005844 Ga0068862_100390073 Ga0068862_1003900731 221
571 3300006163 Ga0070715_10006279 Ga0070715_100062793 221
572 3300006195 Ga0075366_10327363 Ga0075366_103273632 221
573 3300006237 Ga0097621_100004872 Ga0097621_1000048722 221
574 3300006237 Ga0097621_100075262 Ga0097621_1000752622 221
575 3300006237 Ga0097621_100165697 Ga0097621_1001656972 221
576 3300006237 Ga0097621_100745031 Ga0097621_1007450311 221
577 3300006358 Ga0068871_100049163 Ga0068871_1000491633 221
578 3300006844 Ga0075428_100019483 Ga0075428_1000194832 221
579 3300006844 Ga0075428_100042483 Ga0075428_1000424834 221
580 3300006844 Ga0075428_100107372 Ga0075428_1001073722 221
581 3300006844 Ga0075428_100778056 Ga0075428_1007780561 221
582 3300006847 Ga0075431_100317440 Ga0075431_1003174402 221
583 3300006871 Ga0075434_100312680 Ga0075434_1003126802 221
584 3300006880 Ga0075429_100002169 Ga0075429_1000021699 221
585 3300006880 Ga0075429_100004571 Ga0075429_10000457110 221
586 3300006880 Ga0075429_100007858 Ga0075429_1000078584 221
587 3300006880 Ga0075429_100141752 Ga0075429_1001417522 221
588 3300006880 Ga0075429_100276982 Ga0075429_1002769821 221
589 3300006881 Ga0068865_100566514 Ga0068865_1005665142 221
590 3300006931 Ga0097620_100017084 Ga0097620_1000170842 221
591 3300006931 Ga0097620_100030940 Ga0097620_1000309402 221
592 3300006931 Ga0097620_100087106 Ga0097620_1000871063 221
593 3300006931 Ga0097620_100163374 Ga0097620_1001633742 221
594 3300006931 Ga0097620_100417262 Ga0097620_1004172622 221
595 3300006931 Ga0097620_100561753 Ga0097620_1005617531 221
596 3300006931 Ga0097620_100833177 Ga0097620_1008331771 221
597 3300009093 Ga0105240_10027343 Ga0105240_100273434 221
598 3300009093 Ga0105240_10136825 Ga0105240_101368253 221
599 3300009094 Ga0111539_10058706 Ga0111539_100587062 221
600 3300009094 Ga0111539_10266393 Ga0111539_102663932 221
601 3300009094 Ga0111539_10287143 Ga0111539_102871432 221
602 3300009094 Ga0111539_10474745 Ga0111539_104747452 221
603 3300009094 Ga0111539_10497107 Ga0111539_104971072 221
604 3300009094 Ga0111539_10759943 Ga0111539_107599432 221
605 3300009094 Ga0111539_11014893 Ga0111539_110148931 221
606 3300009147 Ga0114129_10262423 Ga0114129_102624233 221
607 3300009176 Ga0105242_10038005 Ga0105242_100380053 221
608 3300009176 Ga0105242_10056701 Ga0105242_100567012 221
609 3300009177 Ga0105248_10071249 Ga0105248_100712493 221
610 3300009177 Ga0105248_10416786 Ga0105248_104167862 221
611 3300009545 Ga0105237_10032433 Ga0105237_100324332 221
612 3300009545 Ga0105237_10231604 Ga0105237_102316042 221
613 3300009553 Ga0105249_10012432 Ga0105249_100124326 221
614 3300009553 Ga0105249_10037077 Ga0105249_100370772 221
615 3300009553 Ga0105249_10128076 Ga0105249_101280762 221
616 3300009553 Ga0105249_10211671 Ga0105249_102116712 221
617 3300009553 Ga0105249_10469646 Ga0105249_104696462 221
618 3300009553 Ga0105249_10821094 Ga0105249_108210941 221
619 3300009553 Ga0105249_11002978 Ga0105249_110029781 221
620 3300009553 Ga0105249_11012651 Ga0105249_110126511 221
621 3300010375 Ga0105239_10013420 Ga0105239_100134206 221
622 3300010375 Ga0105239_10453908 Ga0105239_104539082 221
623 3300010375 Ga0105239_10590492 Ga0105239_105904922 221
624 3300011119 Ga0105246_10003431 Ga0105246_100034315 221
625 3300013100 Ga0157373_10006670 Ga0157373_100066706 221
626 3300013102 Ga0157371_10467637 Ga0157371_104676371 221
627 3300013104 Ga0157370_10001568 Ga0157370_1000156812 221
628 3300013104 Ga0157370_10011412 Ga0157370_100114123 221
629 3300013104 Ga0157370_10162775 Ga0157370_101627752 221
630 3300013104 Ga0157370_10168523 Ga0157370_101685232 221
631 3300013104 Ga0157370_10324294 Ga0157370_103242942 221
632 3300013296 Ga0157374_10000007 Ga0157374_10000007286 221
633 3300013296 Ga0157374_10077624 Ga0157374_100776242 221
634 3300013296 Ga0157374_10155651 Ga0157374_101556513 221
635 3300013297 Ga0157378_10028280 Ga0157378_100282802 221
636 3300013297 Ga0157378_10323871 Ga0157378_103238712 221
637 3300013306 Ga0163162_10054666 Ga0163162_100546662 221
638 3300013306 Ga0163162_10090243 Ga0163162_100902432 221
639 3300013306 Ga0163162_10092864 Ga0163162_100928641 221
640 3300013306 Ga0163162_10635222 Ga0163162_106352222 221
641 3300013307 Ga0157372_10465685 Ga0157372_104656851 221
642 3300013308 Ga0157375_10019607 Ga0157375_100196075 221
643 3300013308 Ga0157375_10034920 Ga0157375_100349205 221
644 3300013308 Ga0157375_10082855 Ga0157375_100828552 221
645 3300013308 Ga0157375_10090980 Ga0157375_100909802 221
646 3300013308 Ga0157375_10481662 Ga0157375_104816622 221
647 3300013308 Ga0157375_10615358 Ga0157375_106153582 221
648 3300013308 Ga0157375_10991351 Ga0157375_109913512 221
649 3300014325 Ga0163163_10032538 Ga0163163_100325384 221
650 3300014325 Ga0163163_10382263 Ga0163163_103822631 221
651 3300014326 Ga0157380_10021105 Ga0157380_100211055 221
652 3300014326 Ga0157380_10063986 Ga0157380_100639862 221
653 3300014326 Ga0157380_10123349 Ga0157380_101233492 221
654 3300014326 Ga0157380_10143094 Ga0157380_101430942 221
655 3300014326 Ga0157380_10256015 Ga0157380_102560152 221
656 3300014326 Ga0157380_10455386 Ga0157380_104553862 221
657 3300014326 Ga0157380_10800115 Ga0157380_108001151 221
658 3300014745 Ga0157377_10008940 Ga0157377_100089402 221
659 3300014745 Ga0157377_10023994 Ga0157377_100239942 221
660 3300014968 Ga0157379_10123016 Ga0157379_101230162 221
661 3300014968 Ga0157379_10135382 Ga0157379_101353822 221
662 3300014968 Ga0157379_10342781 Ga0157379_103427812 221
663 3300014969 Ga0157376_10023367 Ga0157376_100233673 221
664 3300014969 Ga0157376_10491456 Ga0157376_104914562 221
665 3300017792 Ga0163161_10002240 Ga0163161_1000224011 221
666 3300017792 Ga0163161_10003268 Ga0163161_100032686 221
667 3300017792 Ga0163161_10056319 Ga0163161_100563193 221
668 3300017792 Ga0163161_10185167 Ga0163161_101851672 221
669 3300017792 Ga0163161_10215605 Ga0163161_102156051 221
670 3300017792 Ga0163161_10309295 Ga0163161_103092951 221
671 3300025271 Ga0207666_1005654 Ga0207666_10056542 221
672 3300025271 Ga0207666_1016817 Ga0207666_10168171 221
673 3300025893 Ga0207682_10048820 Ga0207682_100488202 221
674 3300025900 Ga0207710_10001409 Ga0207710_100014095 221
675 3300025908 Ga0207643_10042769 Ga0207643_100427692 221
676 3300025908 Ga0207643_10045817 Ga0207643_100458172 221
677 3300025909 Ga0207705_10045650 Ga0207705_100456503 221
678 3300025913 Ga0207695_10092622 Ga0207695_100926222 221
679 3300025914 Ga0207671_10187785 Ga0207671_101877852 221
680 3300025917 Ga0207660_10112529 Ga0207660_101125292 221
681 3300025918 Ga0207662_10022459 Ga0207662_100224592 221
682 3300025918 Ga0207662_10071706 Ga0207662_100717062 221
683 3300025918 Ga0207662_10131734 Ga0207662_101317342 221
684 3300025919 Ga0207657_10002923 Ga0207657_1000292319 221
685 3300025920 Ga0207649_10024388 Ga0207649_100243882 221
686 3300025921 Ga0207652_10019917 Ga0207652_100199174 221
687 3300025923 Ga0207681_10073547 Ga0207681_100735472 221
688 3300025923 Ga0207681_10089067 Ga0207681_100890673 221
689 3300025925 Ga0207650_10000926 Ga0207650_1000092616 221
690 3300025925 Ga0207650_10003183 Ga0207650_100031834 221
691 3300025925 Ga0207650_10007080 Ga0207650_100070803 221
692 3300025925 Ga0207650_10205380 Ga0207650_102053803 221
693 3300025925 Ga0207650_10210857 Ga0207650_102108572 221
694 3300025926 Ga0207659_10151219 Ga0207659_101512193 221
695 3300025926 Ga0207659_10171952 Ga0207659_101719522 221
696 3300025926 Ga0207659_10198729 Ga0207659_101987292 221
697 3300025931 Ga0207644_10177590 Ga0207644_101775902 221
698 3300025934 Ga0207686_10000351 Ga0207686_1000035113 221
699 3300025934 Ga0207686_10047597 Ga0207686_100475972 221
700 3300025936 Ga0207670_10037057 Ga0207670_100370572 221
701 3300025936 Ga0207670_10099674 Ga0207670_100996742 221
702 3300025936 Ga0207670_10129313 Ga0207670_101293131 221
703 3300025936 Ga0207670_10182545 Ga0207670_101825451 221
704 3300025936 Ga0207670_10220248 Ga0207670_102202481 221
705 3300025936 Ga0207670_10254124 Ga0207670_102541242 221
706 3300025937 Ga0207669_10071014 Ga0207669_100710141 221
707 3300025940 Ga0207691_10021838 Ga0207691_100218382 221
708 3300025940 Ga0207691_10026518 Ga0207691_100265185 221
709 3300025940 Ga0207691_10212977 Ga0207691_102129772 221
710 3300025940 Ga0207691_10348895 Ga0207691_103488952 221
711 3300025940 Ga0207691_10363671 Ga0207691_103636712 221
712 3300025942 Ga0207689_10016155 Ga0207689_100161554 221
713 3300025942 Ga0207689_10032891 Ga0207689_100328913 221
714 3300025942 Ga0207689_10078416 Ga0207689_100784161 221
715 3300025942 Ga0207689_10200678 Ga0207689_102006782 221
716 3300025944 Ga0207661_10019688 Ga0207661_100196883 221
717 3300025944 Ga0207661_10057726 Ga0207661_100577262 221
718 3300025945 Ga0207679_10042698 Ga0207679_100426983 221
719 3300025945 Ga0207679_10222463 Ga0207679_102224632 221
720 3300025949 Ga0207667_10057093 Ga0207667_100570932 221
721 3300025949 Ga0207667_10098902 Ga0207667_100989022 221
722 3300025949 Ga0207667_10277793 Ga0207667_102777932 221
723 3300025960 Ga0207651_10074605 Ga0207651_100746052 221
724 3300025960 Ga0207651_10119412 Ga0207651_101194121 221
725 3300025961 Ga0207712_10002030 Ga0207712_100020306 221
726 3300025961 Ga0207712_10008088 Ga0207712_100080882 221
727 3300025961 Ga0207712_10072899 Ga0207712_100728992 221
728 3300025961 Ga0207712_10090966 Ga0207712_100909663 221
729 3300025961 Ga0207712_10168440 Ga0207712_101684402 221
730 3300025961 Ga0207712_10443845 Ga0207712_104438452 221
731 3300025972 Ga0207668_10105333 Ga0207668_101053332 221
732 3300025981 Ga0207640_10384150 Ga0207640_103841502 221
733 3300025986 Ga0207658_10024814 Ga0207658_100248143 221
734 3300025986 Ga0207658_10145173 Ga0207658_101451732 221
735 3300025986 Ga0207658_10200657 Ga0207658_102006572 221
736 3300025986 Ga0207658_10282990 Ga0207658_102829901 221
737 3300026035 Ga0207703_10019810 Ga0207703_100198103 221
738 3300026035 Ga0207703_10383490 Ga0207703_103834901 221
739 3300026041 Ga0207639_10238454 Ga0207639_102384542 221
740 3300026041 Ga0207639_10266326 Ga0207639_102663262 221
741 3300026041 Ga0207639_10511791 Ga0207639_105117912 221
742 3300026075 Ga0207708_10007230 Ga0207708_100072305 221
743 3300026075 Ga0207708_10103243 Ga0207708_101032432 221
744 3300026075 Ga0207708_10195412 Ga0207708_101954123 221
745 3300026088 Ga0207641_10000191 Ga0207641_1000019146 221
746 3300026088 Ga0207641_10000377 Ga0207641_1000037726 221
747 3300026088 Ga0207641_10106293 Ga0207641_101062931 221
748 3300026088 Ga0207641_10175113 Ga0207641_101751132 221
749 3300026088 Ga0207641_10207456 Ga0207641_102074561 221
750 3300026088 Ga0207641_10553306 Ga0207641_105533062 221
751 3300026088 Ga0207641_10795338 Ga0207641_107953381 221
752 3300026089 Ga0207648_10026591 Ga0207648_100265913 221
753 3300026089 Ga0207648_10229172 Ga0207648_102291722 221
754 3300026095 Ga0207676_10063799 Ga0207676_100637992 221
755 3300026095 Ga0207676_10260949 Ga0207676_102609492 221
756 3300026095 Ga0207676_10673083 Ga0207676_106730832 221
757 3300026116 Ga0207674_10453707 Ga0207674_104537071 221
758 3300026118 Ga0207675_100010785 Ga0207675_1000107852 221
759 3300026118 Ga0207675_100012127 Ga0207675_1000121274 221
760 3300026121 Ga0207683_10511944 Ga0207683_105119442 221
761 3300026142 Ga0207698_10100407 Ga0207698_101004072 221
762 3300026142 Ga0207698_10156004 Ga0207698_101560042 221
763 3300026142 Ga0207698_10293362 Ga0207698_102933622 221
764 3300027471 Ga0209995_1001603 Ga0209995_10016033 221
765 3300027907 Ga0207428_10496084 Ga0207428_104960841 221
766 3300028380 Ga0268265_10012408 Ga0268265_100124083 221
767 3300028380 Ga0268265_10219797 Ga0268265_102197972 221
768 3300028380 Ga0268265_10460478 Ga0268265_104604782 221
769 3300028381 Ga0268264_10205192 Ga0268264_102051922 221
770 3300028381 Ga0268264_10319615 Ga0268264_103196152 221
771 3300028381 Ga0268264_10652979 Ga0268264_106529792 221
772 3300028794 Ga0307515_10000251 Ga0307515_1000025155 221
773 3300031251 Ga0265327_10092761 Ga0265327_100927612 221
774 3300031507 Ga0307509_10025664 Ga0307509_100256646 221
775 3300032004 Ga0307414_10103564 Ga0307414_101035642 221
776 3300035692 Ga0373935_0226057 Ga0373935_0226057_97_840 221
777 3300036401 Ga0373937_0110657 Ga0373937_0110657_1391_2161 221
778 3300036401 Ga0373937_0504689 Ga0373937_0504689_345_1109 221
779 3300037312 Ga0395899_0173061 Ga0395899_0173061_47_850 221
780 3300037471 Ga0395905_0041473 Ga0395905_0041473_3176_3895 221
781 3300041511 Ga0451855_1823717 Ga0451855_1823717_474_1193 221
782 3300042001 Ga0439441_008694 Ga0439441_008694_452_1237 221
783 3300042007 Ga0439449_0028648 Ga0439449_0028648_150_875 221
784 3300042461 Ga0439460_0060285 Ga0439460_0060285_209_994 221
785 3300042876 Ga0451577_0368554 Ga0451577_0368554_42_779 221
786 3300042876 Ga0451577_0457930 Ga0451577_0457930_155_886 221
787 3300044658 Ga0466972_0002328 Ga0466972_0002328_8032_8736 221
788 3300044673 Ga0453683_0022796 Ga0453683_0022796_2934_3665 221
789 3300044712 Ga0453684_0030168 Ga0453684_0030168_4121_4852 221
790 3300044712 Ga0453684_0333713 Ga0453684_0333713_584_1306 221
791 3300045051 Ga0451576_0115965 Ga0451576_0115965_1024_1761 221
792 3300046459 Ga0495629_0098988 Ga0495629_0098988_824_1555 221
793 3300046472 Ga0495580_0132391 Ga0495580_0132391_837_1607 221
794 3300046492 Ga0495585_0004232 Ga0495585_0004232_7269_8000 221
795 3300046499 Ga0495594_0123316 Ga0495594_0123316_95_835 221
796 3300046507 Ga0495606_0003289 Ga0495606_0003289_4785_5516 221
797 3300046513 Ga0495616_0006946 Ga0495616_0006946_4409_5146 221
798 3300046513 Ga0495616_0152375 Ga0495616_0152375_197_928 221
799 3300046518 Ga0495631_0062010 Ga0495631_0062010_771_1502 221
800 3300046524 Ga0495648_0009384 Ga0495648_0009384_4989_5720 221
801 3300046537 Ga0495598_0016928 Ga0495598_0016928_94_876 221
802 3300046538 Ga0495609_0003828 Ga0495609_0003828_5679_6410 221
803 3300046539 Ga0495621_0013481 Ga0495621_0013481_655_1443 221
804 3300046616 Ga0495668_0000009 Ga0495668_0000009_132095_132826 221
805 3300046660 Ga0495625_0000144 Ga0495625_0000144_87807_88544 221
806 3300046660 Ga0495625_0001749 Ga0495625_0001749_4668_5399 221
807 3300046660 Ga0495625_0155301 Ga0495625_0155301_75_806 221
808 3300046665 Ga0495661_0000114 Ga0495661_0000114_77093_77821 221
809 3300046683 Ga0495658_0068490 Ga0495658_0068490_1202_1972 221
810 3300046683 Ga0495658_0101063 Ga0495658_0101063_293_1024 221
811 3300046691 Ga0495670_0152549 Ga0495670_0152549_311_1039 221
812 3300046694 Ga0495649_0000112 Ga0495649_0000112_50232_50969 221
813 3300046809 Ga0495600_0044433 Ga0495600_0044433_1904_2635 221
814 3300046810 Ga0495660_0017439 Ga0495660_0017439_2533_3267 221
815 3300047471 Ga0495684_0261104 Ga0495684_0261104_187_957 221
816 3300047472 Ga0495686_0051377 Ga0495686_0051377_455_1189 221
817 3300048089 Ga0495614_0048477 Ga0495614_0048477_788_1519 221
818 3300049460 Ga0495682_0014555 Ga0495682_0014555_1320_2051 221
819 3300049686 Ga0501257_019077 Ga0501257_019077_583_1311 221
820 3300049688 Ga0501259_042052 Ga0501259_042052_134_874 221
821 3300050508 nmdc:mga09592_110384_c1 nmdc:mga09592_110384_c1_1466_2257 221
822 3300050508 nmdc:mga09592_32604_c1 nmdc:mga09592_32604_c1_745_1485 221
823 3300050508 nmdc:mga09592_6481_c1 nmdc:mga09592_6481_c1_1277_2086 221
824 3300050508 nmdc:mga09592_68914_c1 nmdc:mga09592_68914_c1_1999_2739 221
825 3300050510 nmdc:mga06r32_560092_c1 nmdc:mga06r32_560092_c1_93_803 221
826 3300050511 nmdc:mga08y16_280328_c1 nmdc:mga08y16_280328_c1_106_897 221
827 3300050511 nmdc:mga08y16_304676_c1 nmdc:mga08y16_304676_c1_143_919 221
828 3300050511 nmdc:mga08y16_499714_c1 nmdc:mga08y16_499714_c1_305_1087 221
829 3300050511 nmdc:mga08y16_581473_c1 nmdc:mga08y16_581473_c1_306_1016 221
830 3300050511 nmdc:mga08y16_99108_c1 nmdc:mga08y16_99108_c1_1669_2469 221
831 3300050511 nmdc:mga08y16_991352_c1 nmdc:mga08y16_991352_c1_19_798 221
832 3300050512 nmdc:mga0n895_323834_c1 nmdc:mga0n895_323834_c1_351_1160 221
833 3300053085 Ga0495619_0160716 Ga0495619_0160716_502_1272 221
834 3300053122 Ga0500608_010579 Ga0500608_010579_1033_1761 221
835 3300053156 Ga0500622_0000786 Ga0500622_0000786_17606_18337 221
836 iso_pu_bacteria 2739367663 2739648244 221
837 iso_pu_bacteria 2929154850 2929158377 221
838 3300001989 JGI24739J22299_10041297 JGI24739J22299_100412972 222
839 3300001989 JGI24739J22299_10048706 JGI24739J22299_100487062 222
840 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004315 222
841 3300002739 JGI25158J39367_1008471 JGI25158J39367_10084712 222
842 3300003316 rootH1_10089594 rootH1_100895942 222
843 3300003320 rootH2_10097190 rootH2_100971903 222
844 3300003322 rootL2_10056586 rootL2_100565866 222
845 3300003322 rootL2_10171357 rootL2_101713573 222
846 3300003323 rootH1_10000759 rootH1_1000075919 222
847 3300003794 Ga0055531_10000148 Ga0055531_100001488 222
848 3300005328 Ga0070676_10238440 Ga0070676_102384402 222
849 3300005330 Ga0070690_100375635 Ga0070690_1003756351 222
850 3300005331 Ga0070670_100019943 Ga0070670_1000199432 222
851 3300005331 Ga0070670_100285043 Ga0070670_1002850432 222
852 3300005334 Ga0068869_100063547 Ga0068869_1000635472 222
853 3300005334 Ga0068869_100642772 Ga0068869_1006427721 222
854 3300005335 Ga0070666_10071460 Ga0070666_100714603 222
855 3300005335 Ga0070666_10216582 Ga0070666_102165822 222
856 3300005338 Ga0068868_100070337 Ga0068868_1000703371 222
857 3300005338 Ga0068868_100298576 Ga0068868_1002985761 222
858 3300005338 Ga0068868_100411187 Ga0068868_1004111872 222
859 3300005347 Ga0070668_100040034 Ga0070668_1000400344 222
860 3300005347 Ga0070668_100063469 Ga0070668_1000634693 222
861 3300005353 Ga0070669_100074078 Ga0070669_1000740783 222
862 3300005353 Ga0070669_100359962 Ga0070669_1003599621 222
863 3300005354 Ga0070675_100033260 Ga0070675_1000332603 222
864 3300005355 Ga0070671_100318746 Ga0070671_1003187461 222
865 3300005355 Ga0070671_100387078 Ga0070671_1003870782 222
866 3300005356 Ga0070674_100303210 Ga0070674_1003032102 222
867 3300005364 Ga0070673_100012549 Ga0070673_1000125492 222
868 3300005364 Ga0070673_100195777 Ga0070673_1001957772 222
869 3300005365 Ga0070688_100239052 Ga0070688_1002390522 222
870 3300005367 Ga0070667_100116847 Ga0070667_1001168473 222
871 3300005367 Ga0070667_100441188 Ga0070667_1004411882 222
872 3300005456 Ga0070678_100433016 Ga0070678_1004330162 222
873 3300005459 Ga0068867_100268680 Ga0068867_1002686802 222
874 3300005459 Ga0068867_100529416 Ga0068867_1005294161 222
875 3300005471 Ga0070698_100157042 Ga0070698_1001570422 222
876 3300005518 Ga0070699_100416452 Ga0070699_1004164521 222
877 3300005539 Ga0068853_100044306 Ga0068853_1000443066 222
878 3300005543 Ga0070672_100120391 Ga0070672_1001203912 222
879 3300005548 Ga0070665_100260871 Ga0070665_1002608712 222
880 3300005563 Ga0068855_100113035 Ga0068855_1001130353 222
881 3300005564 Ga0070664_100434391 Ga0070664_1004343912 222
882 3300005614 Ga0068856_100157672 Ga0068856_1001576722 222
883 3300005616 Ga0068852_100573908 Ga0068852_1005739081 222
884 3300005617 Ga0068859_100135036 Ga0068859_1001350362 222
885 3300005618 Ga0068864_100109277 Ga0068864_1001092772 222
886 3300005718 Ga0068866_10027937 Ga0068866_100279372 222
887 3300005719 Ga0068861_100127720 Ga0068861_1001277202 222
888 3300005834 Ga0068851_10082297 Ga0068851_100822972 222
889 3300005841 Ga0068863_100284251 Ga0068863_1002842512 222
890 3300005843 Ga0068860_100002698 Ga0068860_1000026984 222
891 3300005843 Ga0068860_100004510 Ga0068860_10000451014 222
892 3300005843 Ga0068860_100040606 Ga0068860_1000406064 222
893 3300006195 Ga0075366_10150932 Ga0075366_101509322 222
894 3300006237 Ga0097621_100015835 Ga0097621_1000158357 222
895 3300006237 Ga0097621_100165949 Ga0097621_1001659492 222
896 3300006358 Ga0068871_100090845 Ga0068871_1000908453 222
897 3300006881 Ga0068865_100009188 Ga0068865_1000091886 222
898 3300006931 Ga0097620_100135041 Ga0097620_1001350412 222
899 3300009094 Ga0111539_10249013 Ga0111539_102490132 222
900 3300009174 Ga0105241_10052619 Ga0105241_100526193 222
901 3300009174 Ga0105241_10321964 Ga0105241_103219642 222
902 3300009553 Ga0105249_10368536 Ga0105249_103685362 222
903 3300009553 Ga0105249_10669945 Ga0105249_106699451 222
904 3300011119 Ga0105246_10086442 Ga0105246_100864422 222
905 3300011119 Ga0105246_10297078 Ga0105246_102970781 222
906 3300013102 Ga0157371_10030564 Ga0157371_100305643 222
907 3300013104 Ga0157370_10270379 Ga0157370_102703792 222
908 3300013105 Ga0157369_10035509 Ga0157369_100355094 222
909 3300013296 Ga0157374_10128713 Ga0157374_101287133 222
910 3300013296 Ga0157374_10305340 Ga0157374_103053402 222
911 3300013306 Ga0163162_10000306 Ga0163162_1000030612 222
912 3300013307 Ga0157372_10002566 Ga0157372_100025663 222
913 3300013307 Ga0157372_10453950 Ga0157372_104539502 222
914 3300013307 Ga0157372_10719070 Ga0157372_107190702 222
915 3300013308 Ga0157375_10248050 Ga0157375_102480502 222
916 3300013308 Ga0157375_10404441 Ga0157375_104044411 222
917 3300013308 Ga0157375_10623401 Ga0157375_106234012 222
918 3300014326 Ga0157380_10822296 Ga0157380_108222961 222
919 3300014745 Ga0157377_10191200 Ga0157377_101912002 222
920 3300014968 Ga0157379_10198766 Ga0157379_101987661 222
921 3300014968 Ga0157379_10317238 Ga0157379_103172381 222
922 3300014968 Ga0157379_10417862 Ga0157379_104178621 222
923 3300014969 Ga0157376_10257831 Ga0157376_102578312 222
924 3300025208 Ga0209436_101495 Ga0209436_1014952 222
925 3300025298 Ga0209050_1025306 Ga0209050_10253061 222
926 3300025302 Ga0207426_1044041 Ga0207426_10440412 222
927 3300025304 Ga0209257_1000006 Ga0209257_10000061285 222
928 3300025304 Ga0209257_1068589 Ga0209257_10685891 222
929 3300025899 Ga0207642_10012892 Ga0207642_100128922 222
930 3300025901 Ga0207688_10015186 Ga0207688_100151863 222
931 3300025907 Ga0207645_10000545 Ga0207645_1000054518 222
932 3300025908 Ga0207643_10080008 Ga0207643_100800082 222
933 3300025911 Ga0207654_10109797 Ga0207654_101097972 222
934 3300025911 Ga0207654_10335224 Ga0207654_103352242 222
935 3300025923 Ga0207681_10079873 Ga0207681_100798733 222
936 3300025925 Ga0207650_10134530 Ga0207650_101345302 222
937 3300025925 Ga0207650_10220389 Ga0207650_102203892 222
938 3300025926 Ga0207659_10120144 Ga0207659_101201442 222
939 3300025926 Ga0207659_10189170 Ga0207659_101891702 222
940 3300025926 Ga0207659_10572235 Ga0207659_105722352 222
941 3300025933 Ga0207706_10134079 Ga0207706_101340792 222
942 3300025933 Ga0207706_10514399 Ga0207706_105143992 222
943 3300025934 Ga0207686_10061703 Ga0207686_100617033 222
944 3300025936 Ga0207670_10393430 Ga0207670_103934301 222
945 3300025938 Ga0207704_10033662 Ga0207704_100336622 222
946 3300025940 Ga0207691_10003442 Ga0207691_1000344213 222
947 3300025940 Ga0207691_10033672 Ga0207691_100336723 222
948 3300025942 Ga0207689_10000466 Ga0207689_1000046614 222
949 3300025942 Ga0207689_10271421 Ga0207689_102714212 222
950 3300025949 Ga0207667_10091730 Ga0207667_100917303 222
951 3300025960 Ga0207651_10188565 Ga0207651_101885652 222
952 3300025972 Ga0207668_10039606 Ga0207668_100396065 222
953 3300025986 Ga0207658_10119658 Ga0207658_101196583 222
954 3300026023 Ga0207677_10667397 Ga0207677_106673971 222
955 3300026035 Ga0207703_10278326 Ga0207703_102783262 222
956 3300026067 Ga0207678_10129022 Ga0207678_101290222 222
957 3300026088 Ga0207641_10345770 Ga0207641_103457702 222
958 3300026089 Ga0207648_10010349 Ga0207648_100103493 222
959 3300026089 Ga0207648_10091570 Ga0207648_100915702 222
960 3300026095 Ga0207676_10470416 Ga0207676_104704162 222
961 3300026116 Ga0207674_10210346 Ga0207674_102103462 222
962 3300026116 Ga0207674_10294481 Ga0207674_102944812 222
963 3300026118 Ga0207675_100043581 Ga0207675_1000435813 222
964 3300026118 Ga0207675_100305019 Ga0207675_1003050192 222
965 3300026121 Ga0207683_10192381 Ga0207683_101923811 222
966 3300026142 Ga0207698_10190523 Ga0207698_101905232 222
967 3300028381 Ga0268264_10025036 Ga0268264_100250364 222
968 3300028381 Ga0268264_10124820 Ga0268264_101248202 222
969 3300028381 Ga0268264_10142323 Ga0268264_101423232 222
970 3300028381 Ga0268264_10157801 Ga0268264_101578012 222
971 3300028381 Ga0268264_10363248 Ga0268264_103632482 222
972 3300028794 Ga0307515_10000479 Ga0307515_1000047920 222
973 3300028794 Ga0307515_10009312 Ga0307515_1000931219 222
974 3300031456 Ga0307513_10077090 Ga0307513_100770902 222
975 3300031456 Ga0307513_10361649 Ga0307513_103616491 222
976 3300031507 Ga0307509_10155728 Ga0307509_101557282 222
977 3300031911 Ga0307412_10040897 Ga0307412_100408972 222
978 3300033180 Ga0307510_10017440 Ga0307510_100174404 222
979 3300041458 Ga0451798_0297405 Ga0451798_0297405_167_874 222
980 3300042007 Ga0439449_0083402 Ga0439449_0083402_118_825 222
981 3300044658 Ga0466972_0000015 Ga0466972_0000015_199457_200164 222
982 3300044842 Ga0466957_0005893 Ga0466957_0005893_2421_3125 222
983 3300046459 Ga0495629_0019970 Ga0495629_0019970_4002_4703 222
984 3300046460 Ga0495638_0000005 Ga0495638_0000005_319643_320356 222
985 3300046472 Ga0495580_0032933 Ga0495580_0032933_975_1676 222
986 3300046473 Ga0495582_0113336 Ga0495582_0113336_105_806 222
987 3300046507 Ga0495606_0236657 Ga0495606_0236657_151_876 222
988 3300046513 Ga0495616_0007179 Ga0495616_0007179_2199_2930 222
989 3300046517 Ga0495630_0035374 Ga0495630_0035374_2615_3316 222
990 3300046519 Ga0495632_0001210 Ga0495632_0001210_7695_8417 222
991 3300046522 Ga0495643_0000596 Ga0495643_0000596_10086_10817 222
992 3300046529 Ga0495652_0323784 Ga0495652_0323784_200_901 222
993 3300046539 Ga0495621_0044062 Ga0495621_0044062_25_774 222
994 3300046558 Ga0495633_0000002 Ga0495633_0000002_258369_259091 222
995 3300046660 Ga0495625_0007755 Ga0495625_0007755_8162_8893 222
996 3300046660 Ga0495625_0028526 Ga0495625_0028526_3398_4147 222
997 3300046683 Ga0495658_0006551 Ga0495658_0006551_1329_2030 222
998 3300047319 Ga0495674_0028918 Ga0495674_0028918_2236_2937 222
999 3300047321 Ga0495676_0029247 Ga0495676_0029247_1113_1814 222
1000 3300048903 Ga0496100_0670016 Ga0496100_0670016_23_772 222
1001 3300048907 Ga0496104_0391855 Ga0496104_0391855_435_1136 222
1002 3300048913 Ga0496110_0470567 Ga0496110_0470567_316_1065 222
1003 3300049581 Ga0501047_0020221 Ga0501047_0020221_82_789 222
1004 3300049705 Ga0501225_0000665 Ga0501225_0000665_3169_3867 222
1005 3300049705 Ga0501225_0002947 Ga0501225_0002947_1501_2208 222
1006 3300049823 Ga0501044_0055830 Ga0501044_0055830_2300_3007 222
1007 3300050493 nmdc:mga0k408_43005_c1 nmdc:mga0k408_43005_c1_98_841 222
1008 3300050511 nmdc:mga08y16_723317_c1 nmdc:mga08y16_723317_c1_135_884 222
1009 3300050513 nmdc:mga0rr50_499487_c1 nmdc:mga0rr50_499487_c1_310_1017 222
1010 3300053092 Ga0500583_0000030 Ga0500583_0000030_20116_20823 222
1011 3300053092 Ga0500583_0000215 Ga0500583_0000215_6561_7268 222
1012 3300053093 Ga0500651_0000485 Ga0500651_0000485_12875_13630 222
1013 3300053093 Ga0500651_0073389 Ga0500651_0073389_379_1089 222
1014 3300053108 Ga0500562_020810 Ga0500562_020810_52_768 222
1015 3300053122 Ga0500608_000292 Ga0500608_000292_1741_2496 222
1016 3300053137 Ga0500561_0064035 Ga0500561_0064035_221_928 222
1017 3300053147 Ga0500589_071911 Ga0500589_071911_154_861 222
1018 3300053151 Ga0500604_0005834 Ga0500604_0005834_91_807 222
1019 3300053153 Ga0500616_0000003 Ga0500616_0000003_854106_854819 222
1020 3300053153 Ga0500616_0052611 Ga0500616_0052611_511_1230 222
1021 3300053153 Ga0500616_0071849 Ga0500616_0071849_981_1688 222
1022 3300053156 Ga0500622_0000017 Ga0500622_0000017_63263_63979 222
1023 3300053156 Ga0500622_0000058 Ga0500622_0000058_116742_117458 222
1024 3300053156 Ga0500622_0001315 Ga0500622_0001315_3257_4006 222
1025 3300053156 Ga0500622_0065034 Ga0500622_0065034_646_1353 222
1026 3300053156 Ga0500622_0076405 Ga0500622_0076405_401_1108 222
1027 3300053177 Ga0500636_0032141 Ga0500636_0032141_59_766 222
1028 3300002741 JGI25157J39369_1005924 JGI25157J39369_10059241 223
1029 3300005289 Ga0065704_10148664 Ga0065704_101486642 223
1030 3300005327 Ga0070658_10050583 Ga0070658_100505833 223
1031 3300005335 Ga0070666_10377066 Ga0070666_103770662 223
1032 3300005530 Ga0070679_100171751 Ga0070679_1001717512 223
1033 3300005564 Ga0070664_100282206 Ga0070664_1002822062 223
1034 3300009093 Ga0105240_10723326 Ga0105240_107233262 223
1035 3300012485 Ga0157325_1001948 Ga0157325_10019481 223
1036 3300013102 Ga0157371_10083626 Ga0157371_100836262 223
1037 3300013104 Ga0157370_10075619 Ga0157370_100756194 223
1038 3300013307 Ga0157372_10202223 Ga0157372_102022231 223
1039 3300025893 Ga0207682_10160512 Ga0207682_101605122 223
1040 3300025920 Ga0207649_10173702 Ga0207649_101737022 223
1041 3300025921 Ga0207652_10146009 Ga0207652_101460091 223
1042 3300037418 Ga0395900_0467044 Ga0395900_0467044_266_1018 223
1043 3300044712 Ga0453684_0109194 Ga0453684_0109194_1183_1899 223
1044 3300046529 Ga0495652_0032026 Ga0495652_0032026_2325_3032 223
1045 3300049513 Ga0501290_009895 Ga0501290_009895_40_774 223
1046 3300049650 Ga0501199_004813 Ga0501199_004813_377_1111 223
1047 3300049674 Ga0501242_000211 Ga0501242_000211_710_1444 223
1048 3300049686 Ga0501257_002012 Ga0501257_002012_296_1030 223
1049 3300049705 Ga0501225_0020336 Ga0501225_0020336_789_1523 223
1050 3300003781 Ga0055536_1014199 Ga0055536_10141992 224
1051 3300005262 Ga0065165_1001093 Ga0065165_10010937 224
1052 3300005329 Ga0070683_100006292 Ga0070683_1000062922 224
1053 3300009093 Ga0105240_10002124 Ga0105240_1000212423 224
1054 3300013100 Ga0157373_10000271 Ga0157373_100002712 224
1055 3300013104 Ga0157370_10025346 Ga0157370_100253465 224
1056 3300013307 Ga0157372_10009642 Ga0157372_100096423 224
1057 3300025250 Ga0209026_1000502 Ga0209026_100050222 224
1058 3300025292 Ga0209676_1000321 Ga0209676_100032130 224
1059 3300025913 Ga0207695_10001914 Ga0207695_1000191423 224
1060 3300026089 Ga0207648_10679017 Ga0207648_106790172 224
1061 3300031251 Ga0265327_10001423 Ga0265327_100014237 224
1062 3300031911 Ga0307412_10228158 Ga0307412_102281582 224
1063 3300046810 Ga0495660_0024633 Ga0495660_0024633_2646_3359 224
1064 3300053092 Ga0500583_0152666 Ga0500583_0152666_347_1069 224
1065 3300013306 Ga0163162_10193458 Ga0163162_101934582 225
1066 3300046507 Ga0495606_0000100 Ga0495606_0000100_76586_77302 225
1067 3300046520 Ga0495637_0065093 Ga0495637_0065093_577_1293 225
1068 3300009098 Ga0105245_10294354 Ga0105245_102943542 226
1069 3300013306 Ga0163162_10069227 Ga0163162_100692272 226
1070 3300021384 Ga0213876_10190854 Ga0213876_101908542 226
1071 3300021384 Ga0213876_10253201 Ga0213876_102532011 226
1072 3300031251 Ga0265327_10043350 Ga0265327_100433502 226
1073 3300039437 Ga0436365_1031676 Ga0436365_1031676_245_943 226
1074 3300039437 Ga0436365_1622828 Ga0436365_1622828_1725_2423 226
1075 3300039447 Ga0436361_1171170 Ga0436361_1171170_978_1676 226
1076 3300049570 Ga0501033_0026491 Ga0501033_0026491_929_1627 226
1077 3300049571 Ga0501034_0062200 Ga0501034_0062200_2664_3362 226
1078 3300049571 Ga0501034_0660540 Ga0501034_0660540_166_864 226
1079 3300049573 Ga0501037_0337864 Ga0501037_0337864_160_858 226
1080 3300049742 Ga0501080_0151799 Ga0501080_0151799_998_1696 226
1081 3300049742 Ga0501080_0635023 Ga0501080_0635023_48_746 226
1082 2162886007 SwRhRL2b_contig_1761633 SwRhRL2b_0391.00006210 227
1083 3300005289 Ga0065704_10000195 Ga0065704_1000019593 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

29

136

0.95

PF04397

LytTR

LytTr DNA-binding domain

170

261

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.9256 3 119
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9169 1 112
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.9139 3 113
6swf-assembly1.cif.gz_A selenomethionine derivative of the rec domain of arat, a response regulator from geobacillus stearothermophilus 0.9016 2 121
6zix-assembly1.cif.gz_B structure of rcsb from salmonella enterica serovar typhimurium bound to promoter p1flhdc in the presence of phosphomimetic bef3- 0.8997 2 111
ID Description Score Start End Superfamily
2qv0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9218 3 119 3.40.50.2300
af_A0A0P0W8Y3_12_90_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9206 2 67 3.40.50.2300
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9168 1 114 3.40.50.2300
6m8oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9139 3 113 3.40.50.2300
af_P60611_135_244_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9139 125 225 2.40.50.1020
ID Description Score Start End GO Terms
AF-A0A520C3L2-F1-model_v4 Response regulator 0.9759 3 100 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1G7PZ04-F1-model_v4 Response regulator receiver domain-containing protein 0.9732 1 108 GO:0000156
GO:0003677
GO:0005737
AF-A0A256WLE8-F1-model_v4 Response regulatory domain-containing protein 0.9678 2 106 GO:0000156
GO:0003677
GO:0005737
AF-A0A2M8AEV0-F1-model_v4 DNA-binding response regulator 0.9642 3 120 GO:0000156
GO:0003677
GO:0005737
AF-A0A4Q8QFW8-F1-model_v4 Response regulator 0.962 1 122 GO:0000160

Feature Viewer

pLDDT pTM Quality
92.32 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map