F489717
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1083 | 368 | 1052 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10215605|Ga0163161_102156051 |
| Length | 280 |
| Sequence | LICNRQYHQYLSIITNQFQDMLSIKKIKCLVIDDEQPARDILHKHIDGVESLELTGSCNNAVEALSFLQSNTVDLLFLDIQMPHILGTNFIRTLKNPPKVIFTTAYRKYAIEGFELDAVDFLLKPISFDRFLKAVNKILQLNLQSNLPEPDKSESMKEPAQPFLYFRSDRKMVKVLFNDILYIEGLRDYIKIFTTSKIIVTKHLLSSLQEMLPADSFLRIHRSYIISISKIDSYNADSIEISKKELPIGRMYKNDVNKLLNSSSLDSNLKKNTKDFNSTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 3 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 4 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 5 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 6 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 7 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 8 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 9 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 10 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 11 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 12 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 13 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 14 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 15 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 16 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 17 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 18 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 19 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 20 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 21 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 22 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 23 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 24 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 25 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 26 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 27 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 28 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 29 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 30 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 31 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 32 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 33 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 34 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 35 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 38 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 39 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 40 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 41 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 51 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 60 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 64 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 225 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 230 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 255 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 260 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 261 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 262 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 263 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 264 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 265 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 266 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 320 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 321 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 325 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 330 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 331 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 333 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 334 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 336 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 337 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 352 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 353 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 354 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 355 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 356 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 358 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 360 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 362 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 363 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 364 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 367 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 368 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.41 |
| Metatranscriptomes | 0 |
| Isolates | 2.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.66 |
| Nodule | 0 |
| Rhizoplane | 0.55 |
| Rhizosphere | 84.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1761633 | 2162886007 | Bacteria | 195701 |
| 2 | JGI24740J21852_10003050 | 3300001979 | Bacteria | 7403 |
| 3 | JGI24739J22299_10000854 | 3300001989 | Bacteria | 11220 |
| 4 | JGI24739J22299_10041297 | 3300001989 | Bacteria | 1535 |
| 5 | JGI24739J22299_10048706 | 3300001989 | Bacteria | 1377 |
| 6 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 7 | JGI24751J29686_10012501 | 3300002459 | Unclassified | 1750 |
| 8 | JGI25154J39366_1000001 | 3300002738 | Bacteria | 483450 |
| 9 | JGI25158J39367_1008471 | 3300002739 | Bacteria | 1429 |
| 10 | JGI25157J39369_1004584 | 3300002741 | Bacteria | 2464 |
| 11 | JGI25157J39369_1005924 | 3300002741 | Bacteria | 1921 |
| 12 | JGI25153J46596_10005860 | 3300003215 | Bacteria | 6366 |
| 13 | JGI25153J46596_10072175 | 3300003215 | Bacteria | 889 |
| 14 | rootH1_10035387 | 3300003316 | Bacteria | 1994 |
| 15 | rootH1_10089594 | 3300003316 | Bacteria | 1959 |
| 16 | rootH1_10152184 | 3300003316 | Bacteria | 1786 |
| 17 | rootH1_10171005 | 3300003316 | Bacteria | 1378 |
| 18 | rootH2_10016087 | 3300003320 | Bacteria | 4315 |
| 19 | rootH2_10024764 | 3300003320 | Bacteria | 50525 |
| 20 | rootH2_10097190 | 3300003320 | Bacteria | 5351 |
| 21 | rootL2_10056586 | 3300003322 | Bacteria | 7772 |
| 22 | rootL2_10084252 | 3300003322 | Unclassified | 1344 |
| 23 | rootL2_10107136 | 3300003322 | Bacteria | 1448 |
| 24 | rootL2_10171357 | 3300003322 | Bacteria | 4145 |
| 25 | rootL2_10206605 | 3300003322 | Bacteria | 2879 |
| 26 | rootL2_10352985 | 3300003322 | Bacteria | 1678 |
| 27 | rootH1_10000759 | 3300003323 | Bacteria | 51501 |
| 28 | rootH1_10000976 | 3300003323 | Bacteria | 12600 |
| 29 | rootH1_10008757 | 3300003323 | Bacteria | 5802 |
| 30 | rootH1_10209329 | 3300003323 | Bacteria | 6768 |
| 31 | rootH1_10209779 | 3300003323 | Bacteria | 1521 |
| 32 | rootH1_10243959 | 3300003323 | Bacteria | 2801 |
| 33 | rootH1_10374623 | 3300003323 | Bacteria | 1206 |
| 34 | JGI25160J50197_1003397 | 3300003354 | Bacteria | 7134 |
| 35 | JGI25160J50197_1004076 | 3300003354 | Bacteria | 6360 |
| 36 | JGI25160J50197_1015650 | 3300003354 | Bacteria | 2482 |
| 37 | JGI25160J50197_1034227 | 3300003354 | Bacteria | 1265 |
| 38 | Ga0055526_1014997 | 3300003771 | Bacteria | 3140 |
| 39 | Ga0055526_1015094 | 3300003771 | Bacteria | 3121 |
| 40 | Ga0055536_1014199 | 3300003781 | Unclassified | 2815 |
| 41 | Ga0055528_1000278 | 3300003790 | Bacteria | 43601 |
| 42 | Ga0055530_10003481 | 3300003791 | Bacteria | 8923 |
| 43 | Ga0055531_10000148 | 3300003794 | Bacteria | 80963 |
| 44 | Ga0055531_10002422 | 3300003794 | Bacteria | 12490 |
| 45 | Ga0055531_10016402 | 3300003794 | Bacteria | 3197 |
| 46 | Ga0065165_1000010 | 3300005262 | Bacteria | 323737 |
| 47 | Ga0065165_1001093 | 3300005262 | Bacteria | 32227 |
| 48 | Ga0065165_1014272 | 3300005262 | Bacteria | 3095 |
| 49 | Ga0065714_10007502 | 3300005288 | Bacteria | 4297 |
| 50 | Ga0065714_10022017 | 3300005288 | Bacteria | 1256 |
| 51 | Ga0065714_10064431 | 3300005288 | Bacteria | 135024 |
| 52 | Ga0065704_10000195 | 3300005289 | Bacteria | 195830 |
| 53 | Ga0065704_10073560 | 3300005289 | Bacteria | 7015 |
| 54 | Ga0065704_10148664 | 3300005289 | Bacteria | 1449 |
| 55 | Ga0065712_10027579 | 3300005290 | Bacteria | 1290 |
| 56 | Ga0065712_10069410 | 3300005290 | Bacteria | 7353 |
| 57 | Ga0065712_10069552 | 3300005290 | Bacteria | 7064 |
| 58 | Ga0065712_10236413 | 3300005290 | Unclassified | 996 |
| 59 | Ga0065715_10116182 | 3300005293 | Bacteria | 2389 |
| 60 | Ga0065707_10126201 | 3300005295 | Bacteria | 2008 |
| 61 | Ga0070658_10050583 | 3300005327 | Bacteria | 3368 |
| 62 | Ga0070676_10238440 | 3300005328 | Unclassified | 1208 |
| 63 | Ga0070683_100005303 | 3300005329 | Bacteria | 10741 |
| 64 | Ga0070683_100006292 | 3300005329 | Bacteria | 9964 |
| 65 | Ga0070683_100010600 | 3300005329 | Bacteria | 7923 |
| 66 | Ga0070683_100023042 | 3300005329 | Bacteria | 5569 |
| 67 | Ga0070683_100039199 | 3300005329 | Unclassified | 4348 |
| 68 | Ga0070690_100008412 | 3300005330 | Bacteria | 5941 |
| 69 | Ga0070690_100375635 | 3300005330 | Unclassified | 1038 |
| 70 | Ga0070670_100005179 | 3300005331 | Bacteria | 10975 |
| 71 | Ga0070670_100010624 | 3300005331 | Bacteria | 7864 |
| 72 | Ga0070670_100019943 | 3300005331 | Bacteria | 5755 |
| 73 | Ga0070670_100021066 | 3300005331 | Bacteria | 5607 |
| 74 | Ga0070670_100027115 | 3300005331 | Unclassified | 4927 |
| 75 | Ga0070670_100101770 | 3300005331 | Bacteria | 2474 |
| 76 | Ga0070670_100285043 | 3300005331 | Bacteria | 1443 |
| 77 | Ga0070677_10076581 | 3300005333 | Bacteria | 1421 |
| 78 | Ga0070677_10185258 | 3300005333 | Bacteria | 994 |
| 79 | Ga0068869_100004357 | 3300005334 | Bacteria | 8787 |
| 80 | Ga0068869_100059516 | 3300005334 | Bacteria | 2797 |
| 81 | Ga0068869_100063547 | 3300005334 | Bacteria | 2713 |
| 82 | Ga0068869_100299674 | 3300005334 | Unclassified | 1298 |
| 83 | Ga0068869_100406633 | 3300005334 | Bacteria | 1121 |
| 84 | Ga0068869_100642772 | 3300005334 | Bacteria | 900 |
| 85 | Ga0070666_10031661 | 3300005335 | Unclassified | 3492 |
| 86 | Ga0070666_10037322 | 3300005335 | Bacteria | 3230 |
| 87 | Ga0070666_10071460 | 3300005335 | Bacteria | 2362 |
| 88 | Ga0070666_10216582 | 3300005335 | Bacteria | 1350 |
| 89 | Ga0070666_10377066 | 3300005335 | Bacteria | 1018 |
| 90 | Ga0070680_100053462 | 3300005336 | Bacteria | 3297 |
| 91 | Ga0070680_100333483 | 3300005336 | Bacteria | 1288 |
| 92 | Ga0070680_100355947 | 3300005336 | Bacteria | 1245 |
| 93 | Ga0070680_100429040 | 3300005336 | Bacteria | 1128 |
| 94 | Ga0070682_100049572 | 3300005337 | Bacteria | 2618 |
| 95 | Ga0068868_100070337 | 3300005338 | Bacteria | 2790 |
| 96 | Ga0068868_100108996 | 3300005338 | Unclassified | 2248 |
| 97 | Ga0068868_100298576 | 3300005338 | Unclassified | 1368 |
| 98 | Ga0068868_100411187 | 3300005338 | Bacteria | 1169 |
| 99 | Ga0070660_100000519 | 3300005339 | Bacteria | 25704 |
| 100 | Ga0070689_100022207 | 3300005340 | Bacteria | 4736 |
| 101 | Ga0070689_100033280 | 3300005340 | Bacteria | 3926 |
| 102 | Ga0070689_100141592 | 3300005340 | Bacteria | 1934 |
| 103 | Ga0070689_100280994 | 3300005340 | Bacteria | 1381 |
| 104 | Ga0070689_100316251 | 3300005340 | Unclassified | 1303 |
| 105 | Ga0070689_100660105 | 3300005340 | Bacteria | 910 |
| 106 | Ga0070687_100025075 | 3300005343 | Unclassified | 2856 |
| 107 | Ga0070687_100168757 | 3300005343 | Bacteria | 1301 |
| 108 | Ga0070661_100037377 | 3300005344 | Bacteria | 3532 |
| 109 | Ga0070661_100076665 | 3300005344 | Unclassified | 2464 |
| 110 | Ga0070692_10076047 | 3300005345 | Bacteria | 1799 |
| 111 | Ga0070668_100040034 | 3300005347 | Bacteria | 3585 |
| 112 | Ga0070668_100063469 | 3300005347 | Bacteria | 2863 |
| 113 | Ga0070668_100128182 | 3300005347 | Unclassified | 2034 |
| 114 | Ga0070668_100146819 | 3300005347 | Bacteria | 1904 |
| 115 | Ga0070668_100210811 | 3300005347 | Bacteria | 1598 |
| 116 | Ga0070669_100074078 | 3300005353 | Bacteria | 2524 |
| 117 | Ga0070669_100296295 | 3300005353 | Bacteria | 1300 |
| 118 | Ga0070669_100359962 | 3300005353 | Bacteria | 1183 |
| 119 | Ga0070675_100033260 | 3300005354 | Bacteria | 4180 |
| 120 | Ga0070675_100180486 | 3300005354 | Bacteria | 1825 |
| 121 | Ga0070675_100183207 | 3300005354 | Bacteria | 1811 |
| 122 | Ga0070675_100375560 | 3300005354 | Bacteria | 1264 |
| 123 | Ga0070671_100035739 | 3300005355 | Bacteria | 4116 |
| 124 | Ga0070671_100062198 | 3300005355 | Bacteria | 3109 |
| 125 | Ga0070671_100107854 | 3300005355 | Bacteria | 2338 |
| 126 | Ga0070671_100318746 | 3300005355 | Bacteria | 1325 |
| 127 | Ga0070671_100359829 | 3300005355 | Unclassified | 1242 |
| 128 | Ga0070671_100387078 | 3300005355 | Bacteria | 1195 |
| 129 | Ga0070674_100061294 | 3300005356 | Unclassified | 2625 |
| 130 | Ga0070674_100073427 | 3300005356 | Bacteria | 2425 |
| 131 | Ga0070674_100303210 | 3300005356 | Bacteria | 1274 |
| 132 | Ga0070673_100012549 | 3300005364 | Bacteria | 5821 |
| 133 | Ga0070673_100015208 | 3300005364 | Bacteria | 5396 |
| 134 | Ga0070673_100195777 | 3300005364 | Bacteria | 1738 |
| 135 | Ga0070673_100200682 | 3300005364 | Bacteria | 1717 |
| 136 | Ga0070673_100215003 | 3300005364 | Bacteria | 1661 |
| 137 | Ga0070673_100231825 | 3300005364 | Bacteria | 1602 |
| 138 | Ga0070688_100012275 | 3300005365 | Bacteria | 4795 |
| 139 | Ga0070688_100049537 | 3300005365 | Bacteria | 2614 |
| 140 | Ga0070688_100239052 | 3300005365 | Unclassified | 1288 |
| 141 | Ga0070667_100056492 | 3300005367 | Bacteria | 3316 |
| 142 | Ga0070667_100070796 | 3300005367 | Bacteria | 2969 |
| 143 | Ga0070667_100116847 | 3300005367 | Bacteria | 2317 |
| 144 | Ga0070667_100178140 | 3300005367 | Bacteria | 1879 |
| 145 | Ga0070667_100235187 | 3300005367 | Unclassified | 1635 |
| 146 | Ga0070667_100441188 | 3300005367 | Bacteria | 1189 |
| 147 | Ga0070667_100797971 | 3300005367 | Bacteria | 876 |
| 148 | Ga0070700_100077071 | 3300005441 | Bacteria | 2143 |
| 149 | Ga0070700_100230312 | 3300005441 | Unclassified | 1318 |
| 150 | Ga0070678_100433016 | 3300005456 | Bacteria | 1149 |
| 151 | Ga0070662_100016718 | 3300005457 | Bacteria | 4931 |
| 152 | Ga0070681_10036122 | 3300005458 | Bacteria | 4963 |
| 153 | Ga0070681_10118004 | 3300005458 | Unclassified | 2590 |
| 154 | Ga0070681_10348521 | 3300005458 | Bacteria | 1391 |
| 155 | Ga0070681_10730906 | 3300005458 | Bacteria | 906 |
| 156 | Ga0068867_100003722 | 3300005459 | Bacteria | 10733 |
| 157 | Ga0068867_100122941 | 3300005459 | Unclassified | 2008 |
| 158 | Ga0068867_100140091 | 3300005459 | Bacteria | 1890 |
| 159 | Ga0068867_100268680 | 3300005459 | Bacteria | 1393 |
| 160 | Ga0068867_100529416 | 3300005459 | Unclassified | 1017 |
| 161 | Ga0070685_10084911 | 3300005466 | Bacteria | 1905 |
| 162 | Ga0070685_10263973 | 3300005466 | Bacteria | 1146 |
| 163 | Ga0070698_100008374 | 3300005471 | Bacteria | 11176 |
| 164 | Ga0070698_100157042 | 3300005471 | Bacteria | 2220 |
| 165 | Ga0070699_100131640 | 3300005518 | Bacteria | 2205 |
| 166 | Ga0070699_100416452 | 3300005518 | Bacteria | 1216 |
| 167 | Ga0070679_100011937 | 3300005530 | Bacteria | 8293 |
| 168 | Ga0070679_100064943 | 3300005530 | Bacteria | 3638 |
| 169 | Ga0070679_100084235 | 3300005530 | Bacteria | 3168 |
| 170 | Ga0070679_100106752 | 3300005530 | Bacteria | 2786 |
| 171 | Ga0070679_100171751 | 3300005530 | Unclassified | 2140 |
| 172 | Ga0070684_100016467 | 3300005535 | Bacteria | 6044 |
| 173 | Ga0070684_100022390 | 3300005535 | Bacteria | 5270 |
| 174 | Ga0070684_100024874 | 3300005535 | Bacteria | 5026 |
| 175 | Ga0070697_100477518 | 3300005536 | Unclassified | 1088 |
| 176 | Ga0068853_100017196 | 3300005539 | Bacteria | 5968 |
| 177 | Ga0068853_100044306 | 3300005539 | Bacteria | 3809 |
| 178 | Ga0068853_100083133 | 3300005539 | Bacteria | 2805 |
| 179 | Ga0068853_100118647 | 3300005539 | Bacteria | 2358 |
| 180 | Ga0068853_100218350 | 3300005539 | Bacteria | 1740 |
| 181 | Ga0070672_100120391 | 3300005543 | Bacteria | 2148 |
| 182 | Ga0070672_100328596 | 3300005543 | Bacteria | 1301 |
| 183 | Ga0070672_100366204 | 3300005543 | Bacteria | 1231 |
| 184 | Ga0070686_100008748 | 3300005544 | Bacteria | 5675 |
| 185 | Ga0070686_100029580 | 3300005544 | Bacteria | 3334 |
| 186 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 187 | Ga0070665_100000052 | 3300005548 | Bacteria | 245694 |
| 188 | Ga0070665_100260871 | 3300005548 | Bacteria | 1734 |
| 189 | Ga0068855_100042540 | 3300005563 | Bacteria | 5382 |
| 190 | Ga0068855_100071060 | 3300005563 | Bacteria | 4048 |
| 191 | Ga0068855_100071573 | 3300005563 | Bacteria | 4032 |
| 192 | Ga0068855_100106839 | 3300005563 | Unclassified | 3216 |
| 193 | Ga0068855_100113035 | 3300005563 | Bacteria | 3116 |
| 194 | Ga0068855_100171360 | 3300005563 | Bacteria | 2458 |
| 195 | Ga0068855_100404142 | 3300005563 | Unclassified | 1496 |
| 196 | Ga0068855_101094636 | 3300005563 | Bacteria | 833 |
| 197 | Ga0070664_100004539 | 3300005564 | Bacteria | 11139 |
| 198 | Ga0070664_100282206 | 3300005564 | Unclassified | 1498 |
| 199 | Ga0070664_100400340 | 3300005564 | Bacteria | 1255 |
| 200 | Ga0070664_100434391 | 3300005564 | Bacteria | 1204 |
| 201 | Ga0070664_100586448 | 3300005564 | Bacteria | 1033 |
| 202 | Ga0068857_100254525 | 3300005577 | Unclassified | 1610 |
| 203 | Ga0068857_100377317 | 3300005577 | Unclassified | 1316 |
| 204 | Ga0068854_100086243 | 3300005578 | Bacteria | 2327 |
| 205 | Ga0068856_100026045 | 3300005614 | Bacteria | 5704 |
| 206 | Ga0068856_100157672 | 3300005614 | Unclassified | 2280 |
| 207 | Ga0068856_100613680 | 3300005614 | Bacteria | 1109 |
| 208 | Ga0070702_100541167 | 3300005615 | Bacteria | 863 |
| 209 | Ga0068852_100029713 | 3300005616 | Bacteria | 4492 |
| 210 | Ga0068852_100032145 | 3300005616 | Bacteria | 4341 |
| 211 | Ga0068852_100041480 | 3300005616 | Unclassified | 3890 |
| 212 | Ga0068852_100150676 | 3300005616 | Unclassified | 2162 |
| 213 | Ga0068852_100503675 | 3300005616 | Bacteria | 1206 |
| 214 | Ga0068852_100573908 | 3300005616 | Bacteria | 1130 |
| 215 | Ga0068852_100594771 | 3300005616 | Bacteria | 1110 |
| 216 | Ga0068852_101028232 | 3300005616 | Unclassified | 843 |
| 217 | Ga0068859_100017085 | 3300005617 | Bacteria | 7284 |
| 218 | Ga0068859_100030941 | 3300005617 | Bacteria | 5371 |
| 219 | Ga0068859_100087099 | 3300005617 | Bacteria | 3170 |
| 220 | Ga0068859_100135036 | 3300005617 | Bacteria | 2539 |
| 221 | Ga0068859_100163375 | 3300005617 | Bacteria | 2306 |
| 222 | Ga0068859_100417252 | 3300005617 | Bacteria | 1438 |
| 223 | Ga0068859_100561765 | 3300005617 | Bacteria | 1235 |
| 224 | Ga0068859_100833121 | 3300005617 | Bacteria | 1009 |
| 225 | Ga0068864_100076708 | 3300005618 | Bacteria | 2921 |
| 226 | Ga0068864_100102913 | 3300005618 | Unclassified | 2535 |
| 227 | Ga0068864_100109277 | 3300005618 | Unclassified | 2462 |
| 228 | Ga0068864_100156435 | 3300005618 | Bacteria | 2069 |
| 229 | Ga0068864_100270505 | 3300005618 | Unclassified | 1583 |
| 230 | Ga0068864_100437777 | 3300005618 | Bacteria | 1248 |
| 231 | Ga0068866_10027937 | 3300005718 | Bacteria | 2684 |
| 232 | Ga0068861_100014998 | 3300005719 | Bacteria | 5450 |
| 233 | Ga0068861_100127720 | 3300005719 | Bacteria | 2060 |
| 234 | Ga0068861_100368564 | 3300005719 | Bacteria | 1265 |
| 235 | Ga0068861_100453628 | 3300005719 | Bacteria | 1149 |
| 236 | Ga0068851_10082297 | 3300005834 | Bacteria | 1683 |
| 237 | Ga0068851_10212408 | 3300005834 | Bacteria | 1084 |
| 238 | Ga0068870_10062898 | 3300005840 | Bacteria | 2000 |
| 239 | Ga0068863_100001267 | 3300005841 | Bacteria | 25182 |
| 240 | Ga0068863_100005658 | 3300005841 | Bacteria | 12272 |
| 241 | Ga0068863_100225021 | 3300005841 | Bacteria | 1808 |
| 242 | Ga0068863_100284251 | 3300005841 | Bacteria | 1603 |
| 243 | Ga0068863_100407345 | 3300005841 | Bacteria | 1331 |
| 244 | Ga0068863_100451788 | 3300005841 | Bacteria | 1261 |
| 245 | Ga0068858_100244438 | 3300005842 | Bacteria | 1703 |
| 246 | Ga0068860_100002275 | 3300005843 | Bacteria | 20173 |
| 247 | Ga0068860_100002698 | 3300005843 | Bacteria | 18476 |
| 248 | Ga0068860_100004510 | 3300005843 | Bacteria | 14207 |
| 249 | Ga0068860_100040606 | 3300005843 | Bacteria | 4446 |
| 250 | Ga0068860_100067089 | 3300005843 | Bacteria | 3409 |
| 251 | Ga0068860_100241604 | 3300005843 | Unclassified | 1757 |
| 252 | Ga0068860_100616658 | 3300005843 | Bacteria | 1091 |
| 253 | Ga0068860_100854471 | 3300005843 | Bacteria | 925 |
| 254 | Ga0068862_100005444 | 3300005844 | Bacteria | 10638 |
| 255 | Ga0068862_100390073 | 3300005844 | Bacteria | 1301 |
| 256 | Ga0081539_10077544 | 3300005985 | Bacteria | 1756 |
| 257 | Ga0081539_10099800 | 3300005985 | Unclassified | 1482 |
| 258 | Ga0070715_10006279 | 3300006163 | Unclassified | 4028 |
| 259 | Ga0075366_10150932 | 3300006195 | Bacteria | 1407 |
| 260 | Ga0075366_10156423 | 3300006195 | Bacteria | 1381 |
| 261 | Ga0075366_10327363 | 3300006195 | Unclassified | 939 |
| 262 | Ga0097621_100004872 | 3300006237 | Bacteria | 9409 |
| 263 | Ga0097621_100007184 | 3300006237 | Bacteria | 7945 |
| 264 | Ga0097621_100015835 | 3300006237 | Bacteria | 5685 |
| 265 | Ga0097621_100075262 | 3300006237 | Bacteria | 2798 |
| 266 | Ga0097621_100165697 | 3300006237 | Bacteria | 1903 |
| 267 | Ga0097621_100165949 | 3300006237 | Bacteria | 1901 |
| 268 | Ga0097621_100193831 | 3300006237 | Bacteria | 1761 |
| 269 | Ga0097621_100369999 | 3300006237 | Unclassified | 1278 |
| 270 | Ga0097621_100745031 | 3300006237 | Bacteria | 905 |
| 271 | Ga0068871_100049163 | 3300006358 | Unclassified | 3407 |
| 272 | Ga0068871_100074511 | 3300006358 | Bacteria | 2800 |
| 273 | Ga0068871_100090845 | 3300006358 | Bacteria | 2544 |
| 274 | Ga0068871_100118650 | 3300006358 | Unclassified | 2232 |
| 275 | Ga0068871_100205853 | 3300006358 | Bacteria | 1700 |
| 276 | Ga0068871_100310920 | 3300006358 | Unclassified | 1385 |
| 277 | Ga0068871_100634437 | 3300006358 | Bacteria | 974 |
| 278 | Ga0075428_100019483 | 3300006844 | Bacteria | 7508 |
| 279 | Ga0075428_100022380 | 3300006844 | Bacteria | 6998 |
| 280 | Ga0075428_100042483 | 3300006844 | Bacteria | 4998 |
| 281 | Ga0075428_100107372 | 3300006844 | Bacteria | 3043 |
| 282 | Ga0075428_100147774 | 3300006844 | Bacteria | 2554 |
| 283 | Ga0075428_100190031 | 3300006844 | Bacteria | 2221 |
| 284 | Ga0075428_100778056 | 3300006844 | Bacteria | 1018 |
| 285 | Ga0075430_100058156 | 3300006846 | Bacteria | 3250 |
| 286 | Ga0075431_100075499 | 3300006847 | Bacteria | 3478 |
| 287 | Ga0075431_100317440 | 3300006847 | Bacteria | 1572 |
| 288 | Ga0075434_100312680 | 3300006871 | Bacteria | 1591 |
| 289 | Ga0075429_100002169 | 3300006880 | Bacteria | 16387 |
| 290 | Ga0075429_100004571 | 3300006880 | Bacteria | 11893 |
| 291 | Ga0075429_100007858 | 3300006880 | Bacteria | 9263 |
| 292 | Ga0075429_100141752 | 3300006880 | Bacteria | 2104 |
| 293 | Ga0075429_100276982 | 3300006880 | Bacteria | 1469 |
| 294 | Ga0068865_100009188 | 3300006881 | Bacteria | 6118 |
| 295 | Ga0068865_100018914 | 3300006881 | Bacteria | 4452 |
| 296 | Ga0068865_100566514 | 3300006881 | Bacteria | 956 |
| 297 | Ga0097620_100017084 | 3300006931 | Bacteria | 7284 |
| 298 | Ga0097620_100030940 | 3300006931 | Bacteria | 5371 |
| 299 | Ga0097620_100087106 | 3300006931 | Bacteria | 3170 |
| 300 | Ga0097620_100135041 | 3300006931 | Bacteria | 2539 |
| 301 | Ga0097620_100163374 | 3300006931 | Bacteria | 2306 |
| 302 | Ga0097620_100417262 | 3300006931 | Bacteria | 1438 |
| 303 | Ga0097620_100561753 | 3300006931 | Bacteria | 1235 |
| 304 | Ga0097620_100833177 | 3300006931 | Bacteria | 1009 |
| 305 | Ga0105244_10131388 | 3300009036 | Unclassified | 1208 |
| 306 | Ga0105240_10000072 | 3300009093 | Bacteria | 201388 |
| 307 | Ga0105240_10000390 | 3300009093 | Bacteria | 82256 |
| 308 | Ga0105240_10000547 | 3300009093 | Bacteria | 69491 |
| 309 | Ga0105240_10002124 | 3300009093 | Bacteria | 32402 |
| 310 | Ga0105240_10027343 | 3300009093 | Bacteria | 7468 |
| 311 | Ga0105240_10038286 | 3300009093 | Bacteria | 6152 |
| 312 | Ga0105240_10076543 | 3300009093 | Bacteria | 4124 |
| 313 | Ga0105240_10136825 | 3300009093 | Bacteria | 2933 |
| 314 | Ga0105240_10723326 | 3300009093 | Bacteria | 1085 |
| 315 | Ga0111539_10011626 | 3300009094 | Bacteria | 11045 |
| 316 | Ga0111539_10058706 | 3300009094 | Bacteria | 4564 |
| 317 | Ga0111539_10249013 | 3300009094 | Bacteria | 2069 |
| 318 | Ga0111539_10266393 | 3300009094 | Unclassified | 1994 |
| 319 | Ga0111539_10287143 | 3300009094 | Unclassified | 1914 |
| 320 | Ga0111539_10474745 | 3300009094 | Bacteria | 1456 |
| 321 | Ga0111539_10497107 | 3300009094 | Bacteria | 1420 |
| 322 | Ga0111539_10759943 | 3300009094 | Bacteria | 1128 |
| 323 | Ga0111539_11014893 | 3300009094 | Bacteria | 964 |
| 324 | Ga0105245_10294354 | 3300009098 | Bacteria | 1591 |
| 325 | Ga0114129_10002413 | 3300009147 | Bacteria | 25964 |
| 326 | Ga0114129_10262423 | 3300009147 | Unclassified | 2314 |
| 327 | Ga0105243_10000002 | 3300009148 | Bacteria | 856281 |
| 328 | Ga0105241_10030828 | 3300009174 | Bacteria | 4011 |
| 329 | Ga0105241_10031464 | 3300009174 | Bacteria | 3973 |
| 330 | Ga0105241_10052619 | 3300009174 | Bacteria | 3110 |
| 331 | Ga0105241_10082299 | 3300009174 | Bacteria | 2523 |
| 332 | Ga0105241_10321964 | 3300009174 | Bacteria | 1334 |
| 333 | Ga0105241_10364129 | 3300009174 | Bacteria | 1259 |
| 334 | Ga0105242_10007760 | 3300009176 | Bacteria | 8256 |
| 335 | Ga0105242_10038005 | 3300009176 | Bacteria | 3869 |
| 336 | Ga0105242_10044485 | 3300009176 | Bacteria | 3596 |
| 337 | Ga0105242_10056701 | 3300009176 | Unclassified | 3206 |
| 338 | Ga0105242_10293334 | 3300009176 | Bacteria | 1482 |
| 339 | Ga0105248_10071249 | 3300009177 | Bacteria | 3904 |
| 340 | Ga0105248_10416786 | 3300009177 | Bacteria | 1512 |
| 341 | Ga0105237_10002078 | 3300009545 | Bacteria | 25315 |
| 342 | Ga0105237_10013011 | 3300009545 | Bacteria | 8737 |
| 343 | Ga0105237_10026340 | 3300009545 | Bacteria | 5943 |
| 344 | Ga0105237_10032433 | 3300009545 | Bacteria | 5289 |
| 345 | Ga0105237_10043859 | 3300009545 | Bacteria | 4503 |
| 346 | Ga0105237_10231604 | 3300009545 | Bacteria | 1848 |
| 347 | Ga0105237_10441695 | 3300009545 | Bacteria | 1307 |
| 348 | Ga0105249_10012432 | 3300009553 | Bacteria | 7505 |
| 349 | Ga0105249_10032078 | 3300009553 | Bacteria | 4752 |
| 350 | Ga0105249_10037077 | 3300009553 | Bacteria | 4424 |
| 351 | Ga0105249_10128076 | 3300009553 | Bacteria | 2420 |
| 352 | Ga0105249_10162612 | 3300009553 | Bacteria | 2158 |
| 353 | Ga0105249_10211671 | 3300009553 | Bacteria | 1903 |
| 354 | Ga0105249_10368536 | 3300009553 | Unclassified | 1459 |
| 355 | Ga0105249_10469646 | 3300009553 | Unclassified | 1299 |
| 356 | Ga0105249_10669945 | 3300009553 | Bacteria | 1096 |
| 357 | Ga0105249_10821094 | 3300009553 | Bacteria | 994 |
| 358 | Ga0105249_11002978 | 3300009553 | Bacteria | 904 |
| 359 | Ga0105249_11012651 | 3300009553 | Bacteria | 900 |
| 360 | Ga0105239_10000004 | 3300010375 | Bacteria | 532483 |
| 361 | Ga0105239_10000016 | 3300010375 | Bacteria | 293142 |
| 362 | Ga0105239_10000184 | 3300010375 | Bacteria | 91348 |
| 363 | Ga0105239_10003592 | 3300010375 | Bacteria | 18944 |
| 364 | Ga0105239_10004803 | 3300010375 | Bacteria | 16040 |
| 365 | Ga0105239_10013420 | 3300010375 | Bacteria | 9104 |
| 366 | Ga0105239_10453908 | 3300010375 | Bacteria | 1454 |
| 367 | Ga0105239_10590492 | 3300010375 | Bacteria | 1266 |
| 368 | Ga0105246_10003431 | 3300011119 | Bacteria | 9610 |
| 369 | Ga0105246_10086442 | 3300011119 | Bacteria | 2248 |
| 370 | Ga0105246_10297078 | 3300011119 | Bacteria | 1302 |
| 371 | Ga0157325_1001948 | 3300012485 | Bacteria | 1004 |
| 372 | Ga0157373_10000076 | 3300013100 | Bacteria | 85437 |
| 373 | Ga0157373_10000115 | 3300013100 | Bacteria | 63326 |
| 374 | Ga0157373_10000271 | 3300013100 | Bacteria | 41646 |
| 375 | Ga0157373_10002170 | 3300013100 | Bacteria | 14866 |
| 376 | Ga0157373_10004999 | 3300013100 | Bacteria | 9961 |
| 377 | Ga0157373_10006670 | 3300013100 | Bacteria | 8601 |
| 378 | Ga0157371_10012850 | 3300013102 | Bacteria | 6376 |
| 379 | Ga0157371_10017042 | 3300013102 | Bacteria | 5408 |
| 380 | Ga0157371_10030564 | 3300013102 | Bacteria | 3885 |
| 381 | Ga0157371_10036888 | 3300013102 | Bacteria | 3501 |
| 382 | Ga0157371_10083626 | 3300013102 | Bacteria | 2260 |
| 383 | Ga0157371_10104283 | 3300013102 | Unclassified | 2012 |
| 384 | Ga0157371_10290466 | 3300013102 | Bacteria | 1182 |
| 385 | Ga0157371_10467637 | 3300013102 | Bacteria | 928 |
| 386 | Ga0157370_10001337 | 3300013104 | Bacteria | 30618 |
| 387 | Ga0157370_10001568 | 3300013104 | Bacteria | 28277 |
| 388 | Ga0157370_10004435 | 3300013104 | Bacteria | 16085 |
| 389 | Ga0157370_10006123 | 3300013104 | Bacteria | 13352 |
| 390 | Ga0157370_10009531 | 3300013104 | Bacteria | 10357 |
| 391 | Ga0157370_10011412 | 3300013104 | Bacteria | 9294 |
| 392 | Ga0157370_10025346 | 3300013104 | Bacteria | 5870 |
| 393 | Ga0157370_10054900 | 3300013104 | Unclassified | 3797 |
| 394 | Ga0157370_10075619 | 3300013104 | Bacteria | 3174 |
| 395 | Ga0157370_10162775 | 3300013104 | Bacteria | 2076 |
| 396 | Ga0157370_10168523 | 3300013104 | Bacteria | 2036 |
| 397 | Ga0157370_10233542 | 3300013104 | Bacteria | 1702 |
| 398 | Ga0157370_10244746 | 3300013104 | Unclassified | 1659 |
| 399 | Ga0157370_10270379 | 3300013104 | Bacteria | 1570 |
| 400 | Ga0157370_10324294 | 3300013104 | Bacteria | 1420 |
| 401 | Ga0157369_10035509 | 3300013105 | Bacteria | 5465 |
| 402 | Ga0157369_10068104 | 3300013105 | Bacteria | 3824 |
| 403 | Ga0157374_10000007 | 3300013296 | Bacteria | 595643 |
| 404 | Ga0157374_10003994 | 3300013296 | Bacteria | 12396 |
| 405 | Ga0157374_10077624 | 3300013296 | Bacteria | 3143 |
| 406 | Ga0157374_10077932 | 3300013296 | Bacteria | 3138 |
| 407 | Ga0157374_10128713 | 3300013296 | Bacteria | 2449 |
| 408 | Ga0157374_10155651 | 3300013296 | Bacteria | 2224 |
| 409 | Ga0157374_10262274 | 3300013296 | Bacteria | 1702 |
| 410 | Ga0157374_10305340 | 3300013296 | Bacteria | 1575 |
| 411 | Ga0157374_10342448 | 3300013296 | Bacteria | 1484 |
| 412 | Ga0157378_10028280 | 3300013297 | Unclassified | 4945 |
| 413 | Ga0157378_10040141 | 3300013297 | Bacteria | 4150 |
| 414 | Ga0157378_10148384 | 3300013297 | Bacteria | 2183 |
| 415 | Ga0157378_10323871 | 3300013297 | Bacteria | 1498 |
| 416 | Ga0157378_10425086 | 3300013297 | Unclassified | 1314 |
| 417 | Ga0163162_10000306 | 3300013306 | Bacteria | 45352 |
| 418 | Ga0163162_10009325 | 3300013306 | Bacteria | 9543 |
| 419 | Ga0163162_10016895 | 3300013306 | Bacteria | 7134 |
| 420 | Ga0163162_10045607 | 3300013306 | Bacteria | 4392 |
| 421 | Ga0163162_10054666 | 3300013306 | Unclassified | 4017 |
| 422 | Ga0163162_10069227 | 3300013306 | Bacteria | 3581 |
| 423 | Ga0163162_10074637 | 3300013306 | Bacteria | 3450 |
| 424 | Ga0163162_10090243 | 3300013306 | Bacteria | 3146 |
| 425 | Ga0163162_10092864 | 3300013306 | Unclassified | 3102 |
| 426 | Ga0163162_10193458 | 3300013306 | Bacteria | 2162 |
| 427 | Ga0163162_10635222 | 3300013306 | Bacteria | 1192 |
| 428 | Ga0157372_10002566 | 3300013307 | Bacteria | 19696 |
| 429 | Ga0157372_10009642 | 3300013307 | Bacteria | 10262 |
| 430 | Ga0157372_10010784 | 3300013307 | Bacteria | 9728 |
| 431 | Ga0157372_10062986 | 3300013307 | Bacteria | 4157 |
| 432 | Ga0157372_10121838 | 3300013307 | Bacteria | 2996 |
| 433 | Ga0157372_10202223 | 3300013307 | Bacteria | 2301 |
| 434 | Ga0157372_10344993 | 3300013307 | Bacteria | 1735 |
| 435 | Ga0157372_10453950 | 3300013307 | Bacteria | 1494 |
| 436 | Ga0157372_10465685 | 3300013307 | Bacteria | 1473 |
| 437 | Ga0157372_10719070 | 3300013307 | Unclassified | 1162 |
| 438 | Ga0157375_10008461 | 3300013308 | Bacteria | 9011 |
| 439 | Ga0157375_10009146 | 3300013308 | Bacteria | 8683 |
| 440 | Ga0157375_10019607 | 3300013308 | Bacteria | 6156 |
| 441 | Ga0157375_10034920 | 3300013308 | Bacteria | 4795 |
| 442 | Ga0157375_10082855 | 3300013308 | Bacteria | 3251 |
| 443 | Ga0157375_10090980 | 3300013308 | Unclassified | 3111 |
| 444 | Ga0157375_10248050 | 3300013308 | Bacteria | 1941 |
| 445 | Ga0157375_10404441 | 3300013308 | Bacteria | 1532 |
| 446 | Ga0157375_10481662 | 3300013308 | Bacteria | 1406 |
| 447 | Ga0157375_10615358 | 3300013308 | Bacteria | 1244 |
| 448 | Ga0157375_10623401 | 3300013308 | Bacteria | 1236 |
| 449 | Ga0157375_10991351 | 3300013308 | Bacteria | 980 |
| 450 | Ga0163163_10000129 | 3300014325 | Bacteria | 77897 |
| 451 | Ga0163163_10012157 | 3300014325 | Bacteria | 7833 |
| 452 | Ga0163163_10032538 | 3300014325 | Bacteria | 5037 |
| 453 | Ga0163163_10035414 | 3300014325 | Unclassified | 4842 |
| 454 | Ga0163163_10329397 | 3300014325 | Bacteria | 1581 |
| 455 | Ga0163163_10382263 | 3300014325 | Bacteria | 1465 |
| 456 | Ga0157380_10000002 | 3300014326 | Bacteria | 236273 |
| 457 | Ga0157380_10004552 | 3300014326 | Bacteria | 9623 |
| 458 | Ga0157380_10021105 | 3300014326 | Bacteria | 4881 |
| 459 | Ga0157380_10063986 | 3300014326 | Bacteria | 2951 |
| 460 | Ga0157380_10123349 | 3300014326 | Bacteria | 2198 |
| 461 | Ga0157380_10143094 | 3300014326 | Bacteria | 2057 |
| 462 | Ga0157380_10256015 | 3300014326 | Bacteria | 1587 |
| 463 | Ga0157380_10265446 | 3300014326 | Bacteria | 1562 |
| 464 | Ga0157380_10455386 | 3300014326 | Bacteria | 1230 |
| 465 | Ga0157380_10800115 | 3300014326 | Unclassified | 960 |
| 466 | Ga0157380_10822296 | 3300014326 | Bacteria | 948 |
| 467 | Ga0182008_10000081 | 3300014497 | Bacteria | 75637 |
| 468 | Ga0157377_10008940 | 3300014745 | Bacteria | 4901 |
| 469 | Ga0157377_10023994 | 3300014745 | Unclassified | 3239 |
| 470 | Ga0157377_10191200 | 3300014745 | Bacteria | 1294 |
| 471 | Ga0157379_10123016 | 3300014968 | Bacteria | 2335 |
| 472 | Ga0157379_10135382 | 3300014968 | Bacteria | 2219 |
| 473 | Ga0157379_10198766 | 3300014968 | Bacteria | 1812 |
| 474 | Ga0157379_10317238 | 3300014968 | Bacteria | 1423 |
| 475 | Ga0157379_10342781 | 3300014968 | Bacteria | 1367 |
| 476 | Ga0157379_10417862 | 3300014968 | Bacteria | 1235 |
| 477 | Ga0157376_10002014 | 3300014969 | Bacteria | 13616 |
| 478 | Ga0157376_10023367 | 3300014969 | Bacteria | 4837 |
| 479 | Ga0157376_10257831 | 3300014969 | Bacteria | 1632 |
| 480 | Ga0157376_10491456 | 3300014969 | Bacteria | 1204 |
| 481 | Ga0182006_1000094 | 3300015261 | Bacteria | 106056 |
| 482 | Ga0182006_1001215 | 3300015261 | Bacteria | 16079 |
| 483 | Ga0182006_1042607 | 3300015261 | Bacteria | 1778 |
| 484 | Ga0163161_10000095 | 3300017792 | Bacteria | 87781 |
| 485 | Ga0163161_10000230 | 3300017792 | Bacteria | 51536 |
| 486 | Ga0163161_10002240 | 3300017792 | Bacteria | 13918 |
| 487 | Ga0163161_10003268 | 3300017792 | Bacteria | 11395 |
| 488 | Ga0163161_10056319 | 3300017792 | Unclassified | 2855 |
| 489 | Ga0163161_10185167 | 3300017792 | Bacteria | 1598 |
| 490 | Ga0163161_10215605 | 3300017792 | Bacteria | 1484 |
| 491 | Ga0163161_10309295 | 3300017792 | Bacteria | 1246 |
| 492 | Ga0213876_10190854 | 3300021384 | Unclassified | 1089 |
| 493 | Ga0213876_10253201 | 3300021384 | Bacteria | 936 |
| 494 | Ga0209436_101495 | 3300025208 | Bacteria | 8070 |
| 495 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 496 | Ga0209026_1000218 | 3300025250 | Bacteria | 79205 |
| 497 | Ga0209026_1000502 | 3300025250 | Bacteria | 28374 |
| 498 | Ga0207666_1005654 | 3300025271 | Bacteria | 1602 |
| 499 | Ga0207666_1016817 | 3300025271 | Bacteria | 1052 |
| 500 | Ga0209673_1000082 | 3300025273 | Bacteria | 219716 |
| 501 | Ga0209673_1055161 | 3300025273 | Bacteria | 1025 |
| 502 | Ga0209676_1000321 | 3300025292 | Bacteria | 92845 |
| 503 | Ga0209564_1007986 | 3300025295 | Bacteria | 5317 |
| 504 | Ga0209564_1012344 | 3300025295 | Bacteria | 3733 |
| 505 | Ga0209564_1028609 | 3300025295 | Unclassified | 1777 |
| 506 | Ga0209758_1015100 | 3300025297 | Bacteria | 4034 |
| 507 | Ga0209758_1024663 | 3300025297 | Bacteria | 2672 |
| 508 | Ga0209758_1082446 | 3300025297 | Bacteria | 968 |
| 509 | Ga0209050_1000577 | 3300025298 | Bacteria | 59430 |
| 510 | Ga0209050_1006924 | 3300025298 | Bacteria | 6549 |
| 511 | Ga0209050_1025306 | 3300025298 | Bacteria | 2021 |
| 512 | Ga0207426_1000502 | 3300025302 | Bacteria | 58023 |
| 513 | Ga0207426_1007377 | 3300025302 | Bacteria | 4612 |
| 514 | Ga0207426_1044041 | 3300025302 | Bacteria | 1366 |
| 515 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 516 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 517 | Ga0209257_1004063 | 3300025304 | Bacteria | 11744 |
| 518 | Ga0209257_1068589 | 3300025304 | Bacteria | 941 |
| 519 | Ga0207682_10048820 | 3300025893 | Bacteria | 1746 |
| 520 | Ga0207682_10160512 | 3300025893 | Unclassified | 1018 |
| 521 | Ga0207642_10012892 | 3300025899 | Bacteria | 3032 |
| 522 | Ga0207642_10238725 | 3300025899 | Bacteria | 1025 |
| 523 | Ga0207710_10001409 | 3300025900 | Bacteria | 12027 |
| 524 | Ga0207688_10015186 | 3300025901 | Bacteria | 4177 |
| 525 | Ga0207680_10089346 | 3300025903 | Unclassified | 1956 |
| 526 | Ga0207680_10094534 | 3300025903 | Bacteria | 1908 |
| 527 | Ga0207647_10134190 | 3300025904 | Bacteria | 1453 |
| 528 | Ga0207685_10214742 | 3300025905 | Bacteria | 911 |
| 529 | Ga0207645_10000545 | 3300025907 | Bacteria | 31363 |
| 530 | Ga0207645_10068466 | 3300025907 | Bacteria | 2270 |
| 531 | Ga0207643_10042769 | 3300025908 | Bacteria | 2554 |
| 532 | Ga0207643_10045817 | 3300025908 | Archaea | 2470 |
| 533 | Ga0207643_10080008 | 3300025908 | Bacteria | 1892 |
| 534 | Ga0207705_10045650 | 3300025909 | Bacteria | 3148 |
| 535 | Ga0207705_10372739 | 3300025909 | Bacteria | 1102 |
| 536 | Ga0207654_10039283 | 3300025911 | Bacteria | 2661 |
| 537 | Ga0207654_10045585 | 3300025911 | Unclassified | 2496 |
| 538 | Ga0207654_10109797 | 3300025911 | Bacteria | 1714 |
| 539 | Ga0207654_10335224 | 3300025911 | Bacteria | 1038 |
| 540 | Ga0207707_10124522 | 3300025912 | Bacteria | 2254 |
| 541 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 542 | Ga0207695_10000067 | 3300025913 | Bacteria | 330915 |
| 543 | Ga0207695_10001914 | 3300025913 | Bacteria | 32387 |
| 544 | Ga0207695_10026583 | 3300025913 | Bacteria | 6459 |
| 545 | Ga0207695_10039570 | 3300025913 | Bacteria | 5067 |
| 546 | Ga0207695_10092622 | 3300025913 | Bacteria | 3032 |
| 547 | Ga0207695_10119054 | 3300025913 | Bacteria | 2611 |
| 548 | Ga0207695_10509493 | 3300025913 | Unclassified | 1085 |
| 549 | Ga0207671_10005696 | 3300025914 | Bacteria | 11383 |
| 550 | Ga0207671_10011524 | 3300025914 | Bacteria | 7184 |
| 551 | Ga0207671_10025795 | 3300025914 | Bacteria | 4410 |
| 552 | Ga0207671_10059616 | 3300025914 | Bacteria | 2830 |
| 553 | Ga0207671_10187785 | 3300025914 | Bacteria | 1610 |
| 554 | Ga0207660_10015857 | 3300025917 | Bacteria | 4980 |
| 555 | Ga0207660_10112529 | 3300025917 | Bacteria | 2050 |
| 556 | Ga0207662_10022459 | 3300025918 | Bacteria | 3618 |
| 557 | Ga0207662_10071706 | 3300025918 | Bacteria | 2098 |
| 558 | Ga0207662_10131734 | 3300025918 | Bacteria | 1577 |
| 559 | Ga0207657_10002923 | 3300025919 | Bacteria | 18338 |
| 560 | Ga0207657_10524382 | 3300025919 | Unclassified | 927 |
| 561 | Ga0207649_10024388 | 3300025920 | Bacteria | 3515 |
| 562 | Ga0207649_10173702 | 3300025920 | Bacteria | 1503 |
| 563 | Ga0207652_10008396 | 3300025921 | Bacteria | 8310 |
| 564 | Ga0207652_10019917 | 3300025921 | Bacteria | 5524 |
| 565 | Ga0207652_10115321 | 3300025921 | Bacteria | 2386 |
| 566 | Ga0207652_10146009 | 3300025921 | Unclassified | 2117 |
| 567 | Ga0207681_10073547 | 3300025923 | Bacteria | 2391 |
| 568 | Ga0207681_10079873 | 3300025923 | Bacteria | 2306 |
| 569 | Ga0207681_10089067 | 3300025923 | Bacteria | 2199 |
| 570 | Ga0207650_10000926 | 3300025925 | Bacteria | 22125 |
| 571 | Ga0207650_10003183 | 3300025925 | Bacteria | 11310 |
| 572 | Ga0207650_10007080 | 3300025925 | Bacteria | 7643 |
| 573 | Ga0207650_10134530 | 3300025925 | Bacteria | 1938 |
| 574 | Ga0207650_10205380 | 3300025925 | Unclassified | 1580 |
| 575 | Ga0207650_10210857 | 3300025925 | Bacteria | 1560 |
| 576 | Ga0207650_10220389 | 3300025925 | Unclassified | 1526 |
| 577 | Ga0207659_10120144 | 3300025926 | Bacteria | 2012 |
| 578 | Ga0207659_10151219 | 3300025926 | Bacteria | 1813 |
| 579 | Ga0207659_10171952 | 3300025926 | Bacteria | 1710 |
| 580 | Ga0207659_10189170 | 3300025926 | Bacteria | 1637 |
| 581 | Ga0207659_10198729 | 3300025926 | Unclassified | 1600 |
| 582 | Ga0207659_10572235 | 3300025926 | Unclassified | 961 |
| 583 | Ga0207644_10166818 | 3300025931 | Bacteria | 1716 |
| 584 | Ga0207644_10177590 | 3300025931 | Unclassified | 1667 |
| 585 | Ga0207644_10210817 | 3300025931 | Bacteria | 1536 |
| 586 | Ga0207644_10264882 | 3300025931 | Bacteria | 1375 |
| 587 | Ga0207706_10016752 | 3300025933 | Bacteria | 6615 |
| 588 | Ga0207706_10134079 | 3300025933 | Unclassified | 2178 |
| 589 | Ga0207706_10514399 | 3300025933 | Bacteria | 1032 |
| 590 | Ga0207686_10000351 | 3300025934 | Bacteria | 32797 |
| 591 | Ga0207686_10047597 | 3300025934 | Unclassified | 2652 |
| 592 | Ga0207686_10061703 | 3300025934 | Unclassified | 2378 |
| 593 | Ga0207686_10283639 | 3300025934 | Bacteria | 1224 |
| 594 | Ga0207709_10000003 | 3300025935 | Bacteria | 1050072 |
| 595 | Ga0207670_10037057 | 3300025936 | Bacteria | 3176 |
| 596 | Ga0207670_10099674 | 3300025936 | Unclassified | 2073 |
| 597 | Ga0207670_10115899 | 3300025936 | Bacteria | 1939 |
| 598 | Ga0207670_10129313 | 3300025936 | Bacteria | 1847 |
| 599 | Ga0207670_10182545 | 3300025936 | Bacteria | 1582 |
| 600 | Ga0207670_10220248 | 3300025936 | Bacteria | 1452 |
| 601 | Ga0207670_10254124 | 3300025936 | Bacteria | 1359 |
| 602 | Ga0207670_10393430 | 3300025936 | Unclassified | 1106 |
| 603 | Ga0207669_10071014 | 3300025937 | Bacteria | 2186 |
| 604 | Ga0207704_10033662 | 3300025938 | Unclassified | 2917 |
| 605 | Ga0207691_10003442 | 3300025940 | Bacteria | 15396 |
| 606 | Ga0207691_10021838 | 3300025940 | Bacteria | 6041 |
| 607 | Ga0207691_10026518 | 3300025940 | Bacteria | 5436 |
| 608 | Ga0207691_10033672 | 3300025940 | Unclassified | 4771 |
| 609 | Ga0207691_10212977 | 3300025940 | Bacteria | 1678 |
| 610 | Ga0207691_10348895 | 3300025940 | Bacteria | 1266 |
| 611 | Ga0207691_10363671 | 3300025940 | Bacteria | 1237 |
| 612 | Ga0207689_10000466 | 3300025942 | Bacteria | 37961 |
| 613 | Ga0207689_10016155 | 3300025942 | Bacteria | 6321 |
| 614 | Ga0207689_10020450 | 3300025942 | Bacteria | 5570 |
| 615 | Ga0207689_10032891 | 3300025942 | Bacteria | 4310 |
| 616 | Ga0207689_10078416 | 3300025942 | Unclassified | 2715 |
| 617 | Ga0207689_10200678 | 3300025942 | Bacteria | 1646 |
| 618 | Ga0207689_10271421 | 3300025942 | Bacteria | 1404 |
| 619 | Ga0207661_10019688 | 3300025944 | Bacteria | 5037 |
| 620 | Ga0207661_10057726 | 3300025944 | Unclassified | 3122 |
| 621 | Ga0207661_10584836 | 3300025944 | Unclassified | 1024 |
| 622 | Ga0207679_10042698 | 3300025945 | Bacteria | 3261 |
| 623 | Ga0207679_10222463 | 3300025945 | Unclassified | 1589 |
| 624 | Ga0207667_10057093 | 3300025949 | Bacteria | 4099 |
| 625 | Ga0207667_10091730 | 3300025949 | Bacteria | 3138 |
| 626 | Ga0207667_10098902 | 3300025949 | Bacteria | 3010 |
| 627 | Ga0207667_10277793 | 3300025949 | Bacteria | 1712 |
| 628 | Ga0207667_10412417 | 3300025949 | Bacteria | 1375 |
| 629 | Ga0207667_10980036 | 3300025949 | Bacteria | 834 |
| 630 | Ga0207651_10074605 | 3300025960 | Bacteria | 2416 |
| 631 | Ga0207651_10119412 | 3300025960 | Bacteria | 1996 |
| 632 | Ga0207651_10188565 | 3300025960 | Bacteria | 1643 |
| 633 | Ga0207712_10002030 | 3300025961 | Bacteria | 13283 |
| 634 | Ga0207712_10008088 | 3300025961 | Bacteria | 6652 |
| 635 | Ga0207712_10018788 | 3300025961 | Bacteria | 4507 |
| 636 | Ga0207712_10072899 | 3300025961 | Bacteria | 2474 |
| 637 | Ga0207712_10090966 | 3300025961 | Bacteria | 2247 |
| 638 | Ga0207712_10168440 | 3300025961 | Bacteria | 1710 |
| 639 | Ga0207712_10443845 | 3300025961 | Bacteria | 1099 |
| 640 | Ga0207668_10039606 | 3300025972 | Bacteria | 3174 |
| 641 | Ga0207668_10105333 | 3300025972 | Unclassified | 2105 |
| 642 | Ga0207640_10384150 | 3300025981 | Bacteria | 1139 |
| 643 | Ga0207658_10020456 | 3300025986 | Bacteria | 4582 |
| 644 | Ga0207658_10024814 | 3300025986 | Unclassified | 4196 |
| 645 | Ga0207658_10119658 | 3300025986 | Bacteria | 2097 |
| 646 | Ga0207658_10145173 | 3300025986 | Unclassified | 1926 |
| 647 | Ga0207658_10200657 | 3300025986 | Unclassified | 1665 |
| 648 | Ga0207658_10282990 | 3300025986 | Bacteria | 1422 |
| 649 | Ga0207658_10337142 | 3300025986 | Bacteria | 1310 |
| 650 | Ga0207677_10388378 | 3300026023 | Unclassified | 1180 |
| 651 | Ga0207677_10667397 | 3300026023 | Unclassified | 919 |
| 652 | Ga0207703_10019810 | 3300026035 | Bacteria | 5258 |
| 653 | Ga0207703_10278326 | 3300026035 | Bacteria | 1519 |
| 654 | Ga0207703_10383490 | 3300026035 | Bacteria | 1300 |
| 655 | Ga0207639_10101786 | 3300026041 | Bacteria | 2324 |
| 656 | Ga0207639_10238454 | 3300026041 | Bacteria | 1580 |
| 657 | Ga0207639_10266326 | 3300026041 | Bacteria | 1501 |
| 658 | Ga0207639_10511791 | 3300026041 | Bacteria | 1098 |
| 659 | Ga0207678_10129022 | 3300026067 | Bacteria | 2156 |
| 660 | Ga0207708_10007230 | 3300026075 | Bacteria | 8209 |
| 661 | Ga0207708_10103243 | 3300026075 | Bacteria | 2208 |
| 662 | Ga0207708_10195412 | 3300026075 | Bacteria | 1612 |
| 663 | Ga0207702_11045364 | 3300026078 | Unclassified | 810 |
| 664 | Ga0207641_10000191 | 3300026088 | Bacteria | 84147 |
| 665 | Ga0207641_10000377 | 3300026088 | Bacteria | 53065 |
| 666 | Ga0207641_10106293 | 3300026088 | Bacteria | 2480 |
| 667 | Ga0207641_10175113 | 3300026088 | Bacteria | 1961 |
| 668 | Ga0207641_10207456 | 3300026088 | Bacteria | 1810 |
| 669 | Ga0207641_10276044 | 3300026088 | Bacteria | 1579 |
| 670 | Ga0207641_10345770 | 3300026088 | Bacteria | 1416 |
| 671 | Ga0207641_10411366 | 3300026088 | Bacteria | 1301 |
| 672 | Ga0207641_10553306 | 3300026088 | Bacteria | 1122 |
| 673 | Ga0207641_10795338 | 3300026088 | Bacteria | 935 |
| 674 | Ga0207648_10003831 | 3300026089 | Bacteria | 15710 |
| 675 | Ga0207648_10010349 | 3300026089 | Bacteria | 8845 |
| 676 | Ga0207648_10026591 | 3300026089 | Bacteria | 5140 |
| 677 | Ga0207648_10091570 | 3300026089 | Unclassified | 2658 |
| 678 | Ga0207648_10229172 | 3300026089 | Unclassified | 1652 |
| 679 | Ga0207648_10679017 | 3300026089 | Bacteria | 953 |
| 680 | Ga0207676_10063799 | 3300026095 | Bacteria | 2927 |
| 681 | Ga0207676_10260949 | 3300026095 | Bacteria | 1564 |
| 682 | Ga0207676_10424122 | 3300026095 | Bacteria | 1248 |
| 683 | Ga0207676_10470416 | 3300026095 | Unclassified | 1188 |
| 684 | Ga0207676_10539429 | 3300026095 | Unclassified | 1113 |
| 685 | Ga0207676_10673083 | 3300026095 | Unclassified | 1000 |
| 686 | Ga0207674_10210346 | 3300026116 | Bacteria | 1894 |
| 687 | Ga0207674_10294481 | 3300026116 | Bacteria | 1572 |
| 688 | Ga0207674_10453707 | 3300026116 | Unclassified | 1239 |
| 689 | Ga0207675_100010785 | 3300026118 | Bacteria | 8562 |
| 690 | Ga0207675_100012127 | 3300026118 | Bacteria | 8051 |
| 691 | Ga0207675_100043581 | 3300026118 | Bacteria | 4190 |
| 692 | Ga0207675_100305019 | 3300026118 | Bacteria | 1552 |
| 693 | Ga0207683_10012032 | 3300026121 | Bacteria | 7387 |
| 694 | Ga0207683_10192381 | 3300026121 | Bacteria | 1853 |
| 695 | Ga0207683_10511944 | 3300026121 | Bacteria | 1109 |
| 696 | Ga0207698_10038499 | 3300026142 | Bacteria | 3534 |
| 697 | Ga0207698_10100407 | 3300026142 | Bacteria | 2397 |
| 698 | Ga0207698_10148024 | 3300026142 | Bacteria | 2034 |
| 699 | Ga0207698_10156004 | 3300026142 | Unclassified | 1989 |
| 700 | Ga0207698_10190523 | 3300026142 | Bacteria | 1826 |
| 701 | Ga0207698_10293362 | 3300026142 | Bacteria | 1510 |
| 702 | Ga0209995_1001603 | 3300027471 | Bacteria | 3509 |
| 703 | Ga0207428_10496084 | 3300027907 | Bacteria | 887 |
| 704 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 705 | Ga0268266_10000070 | 3300028379 | Bacteria | 235423 |
| 706 | Ga0268266_10313865 | 3300028379 | Bacteria | 1465 |
| 707 | Ga0268265_10012408 | 3300028380 | Bacteria | 5774 |
| 708 | Ga0268265_10219797 | 3300028380 | Bacteria | 1661 |
| 709 | Ga0268265_10460478 | 3300028380 | Bacteria | 1190 |
| 710 | Ga0268264_10016393 | 3300028381 | Bacteria | 6065 |
| 711 | Ga0268264_10025036 | 3300028381 | Unclassified | 4876 |
| 712 | Ga0268264_10124820 | 3300028381 | Bacteria | 2273 |
| 713 | Ga0268264_10142323 | 3300028381 | Unclassified | 2140 |
| 714 | Ga0268264_10157801 | 3300028381 | Bacteria | 2040 |
| 715 | Ga0268264_10205192 | 3300028381 | Bacteria | 1806 |
| 716 | Ga0268264_10319615 | 3300028381 | Unclassified | 1467 |
| 717 | Ga0268264_10363248 | 3300028381 | Unclassified | 1382 |
| 718 | Ga0268264_10652979 | 3300028381 | Bacteria | 1041 |
| 719 | Ga0265336_10028594 | 3300028666 | Bacteria | 1742 |
| 720 | Ga0307517_10011996 | 3300028786 | Bacteria | 11955 |
| 721 | Ga0307517_10193999 | 3300028786 | Bacteria | 1283 |
| 722 | Ga0307515_10000251 | 3300028794 | Bacteria | 132970 |
| 723 | Ga0307515_10000479 | 3300028794 | Bacteria | 95197 |
| 724 | Ga0307515_10009312 | 3300028794 | Bacteria | 19000 |
| 725 | Ga0307515_10106040 | 3300028794 | Bacteria | 3339 |
| 726 | Ga0316179_1035183 | 3300030734 | Bacteria | 2407 |
| 727 | Ga0265327_10000073 | 3300031251 | Bacteria | 214772 |
| 728 | Ga0265327_10001129 | 3300031251 | Bacteria | 36728 |
| 729 | Ga0265327_10001423 | 3300031251 | Bacteria | 30459 |
| 730 | Ga0265327_10043350 | 3300031251 | Bacteria | 2408 |
| 731 | Ga0265327_10092761 | 3300031251 | Bacteria | 1470 |
| 732 | Ga0307513_10077090 | 3300031456 | Bacteria | 3454 |
| 733 | Ga0307513_10361649 | 3300031456 | Bacteria | 1196 |
| 734 | Ga0307509_10025664 | 3300031507 | Bacteria | 6578 |
| 735 | Ga0307509_10138196 | 3300031507 | Unclassified | 2378 |
| 736 | Ga0307509_10155728 | 3300031507 | Bacteria | 2191 |
| 737 | Ga0307408_100000261 | 3300031548 | Bacteria | 53515 |
| 738 | Ga0307408_100000947 | 3300031548 | Bacteria | 22518 |
| 739 | Ga0307408_100059395 | 3300031548 | Bacteria | 2783 |
| 740 | Ga0307508_10000969 | 3300031616 | Bacteria | 33410 |
| 741 | Ga0316576_10392479 | 3300031727 | Bacteria | 1029 |
| 742 | Ga0307405_10000008 | 3300031731 | Bacteria | 264953 |
| 743 | Ga0307405_10379220 | 3300031731 | Bacteria | 1100 |
| 744 | Ga0307413_10096748 | 3300031824 | Bacteria | 1939 |
| 745 | Ga0307410_10007044 | 3300031852 | Bacteria | 6124 |
| 746 | Ga0307406_10000287 | 3300031901 | Bacteria | 29607 |
| 747 | Ga0307407_10000785 | 3300031903 | Bacteria | 10496 |
| 748 | Ga0307407_10058688 | 3300031903 | Bacteria | 2238 |
| 749 | Ga0307412_10002921 | 3300031911 | Bacteria | 9482 |
| 750 | Ga0307412_10040897 | 3300031911 | Bacteria | 3001 |
| 751 | Ga0307412_10228158 | 3300031911 | Unclassified | 1432 |
| 752 | Ga0307412_10247868 | 3300031911 | Bacteria | 1381 |
| 753 | Ga0307416_100102620 | 3300032002 | Bacteria | 2494 |
| 754 | Ga0307414_10000005 | 3300032004 | Bacteria | 452161 |
| 755 | Ga0307414_10000574 | 3300032004 | Bacteria | 19147 |
| 756 | Ga0307414_10103564 | 3300032004 | Bacteria | 2148 |
| 757 | Ga0307414_10536299 | 3300032004 | Bacteria | 1041 |
| 758 | Ga0307415_100125907 | 3300032126 | Bacteria | 1931 |
| 759 | Ga0307510_10017440 | 3300033180 | Bacteria | 8467 |
| 760 | Ga0373955_0027088 | 3300035172 | Bacteria | 2959 |
| 761 | Ga0373935_0226057 | 3300035692 | Bacteria | 1302 |
| 762 | Ga0373933_0038641 | 3300035724 | Bacteria | 2805 |
| 763 | Ga0373937_0009021 | 3300036401 | Bacteria | 8656 |
| 764 | Ga0373937_0110657 | 3300036401 | Bacteria | 2555 |
| 765 | Ga0373937_0461137 | 3300036401 | Bacteria | 1207 |
| 766 | Ga0373937_0504689 | 3300036401 | Unclassified | 1149 |
| 767 | Ga0373937_0587534 | 3300036401 | Unclassified | 1057 |
| 768 | Ga0373925_0156848 | 3300037068 | Bacteria | 1791 |
| 769 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 770 | Ga0395899_0002759 | 3300037312 | Bacteria | 14170 |
| 771 | Ga0395899_0173061 | 3300037312 | Unclassified | 1519 |
| 772 | Ga0395900_0007814 | 3300037418 | Bacteria | 11023 |
| 773 | Ga0395900_0467044 | 3300037418 | Bacteria | 1216 |
| 774 | Ga0395898_0006869 | 3300037466 | Bacteria | 12105 |
| 775 | Ga0395898_0153074 | 3300037466 | Bacteria | 2206 |
| 776 | Ga0395905_0041473 | 3300037471 | Bacteria | 4319 |
| 777 | Ga0395901_0006235 | 3300038443 | Bacteria | 12089 |
| 778 | Ga0400483_036718 | 3300039062 | Bacteria | 1091 |
| 779 | Ga0400483_085096 | 3300039062 | Bacteria | 22135 |
| 780 | Ga0400483_131968 | 3300039062 | Bacteria | 1665 |
| 781 | Ga0400483_156766 | 3300039062 | Bacteria | 1197 |
| 782 | Ga0400483_185962 | 3300039062 | Bacteria | 60212 |
| 783 | Ga0436365_1031676 | 3300039437 | Bacteria | 1652 |
| 784 | Ga0436365_1622828 | 3300039437 | Bacteria | 27494 |
| 785 | Ga0436361_1171170 | 3300039447 | Bacteria | 1882 |
| 786 | Ga0439466_0031994 | 3300041411 | Bacteria | 1796 |
| 787 | Ga0451798_0297405 | 3300041458 | Bacteria | 949 |
| 788 | Ga0451807_0096103 | 3300041486 | Bacteria | 1039 |
| 789 | Ga0451855_1823717 | 3300041511 | Bacteria | 1211 |
| 790 | Ga0451853_0411948 | 3300041512 | Bacteria | 917 |
| 791 | Ga0451853_2161633 | 3300041512 | Unclassified | 1870 |
| 792 | Ga0439441_008694 | 3300042001 | Bacteria | 1665 |
| 793 | Ga0439449_0028648 | 3300042007 | Bacteria | 2076 |
| 794 | Ga0439449_0083402 | 3300042007 | Bacteria | 1179 |
| 795 | Ga0439457_011920 | 3300042014 | Unclassified | 1965 |
| 796 | Ga0450898_028749 | 3300042134 | Bacteria | 1011 |
| 797 | Ga0439460_0060285 | 3300042461 | Bacteria | 1157 |
| 798 | Ga0451577_0000030 | 3300042876 | Bacteria | 391423 |
| 799 | Ga0451577_0000066 | 3300042876 | Bacteria | 257650 |
| 800 | Ga0451577_0003571 | 3300042876 | Bacteria | 17138 |
| 801 | Ga0451577_0010709 | 3300042876 | Bacteria | 8731 |
| 802 | Ga0451577_0066957 | 3300042876 | Bacteria | 3203 |
| 803 | Ga0451577_0079256 | 3300042876 | Unclassified | 2928 |
| 804 | Ga0451577_0192273 | 3300042876 | Bacteria | 1841 |
| 805 | Ga0451577_0229120 | 3300042876 | Bacteria | 1680 |
| 806 | Ga0451577_0266104 | 3300042876 | Bacteria | 1552 |
| 807 | Ga0451577_0336172 | 3300042876 | Bacteria | 1370 |
| 808 | Ga0451577_0368554 | 3300042876 | Unclassified | 1303 |
| 809 | Ga0451577_0376778 | 3300042876 | Bacteria | 1287 |
| 810 | Ga0451577_0377632 | 3300042876 | Bacteria | 1286 |
| 811 | Ga0451577_0396117 | 3300042876 | Bacteria | 1253 |
| 812 | Ga0451577_0457930 | 3300042876 | Unclassified | 1158 |
| 813 | Ga0451577_0764229 | 3300042876 | Unclassified | 874 |
| 814 | Ga0466972_0000015 | 3300044658 | Bacteria | 210687 |
| 815 | Ga0466972_0000024 | 3300044658 | Bacteria | 187985 |
| 816 | Ga0466972_0000027 | 3300044658 | Bacteria | 174082 |
| 817 | Ga0466972_0002328 | 3300044658 | Bacteria | 9355 |
| 818 | Ga0466972_0177502 | 3300044658 | Bacteria | 999 |
| 819 | Ga0453683_0000022 | 3300044673 | Bacteria | 269593 |
| 820 | Ga0453683_0000112 | 3300044673 | Bacteria | 121330 |
| 821 | Ga0453683_0000329 | 3300044673 | Bacteria | 58367 |
| 822 | Ga0453683_0002791 | 3300044673 | Bacteria | 13286 |
| 823 | Ga0453683_0009620 | 3300044673 | Bacteria | 6445 |
| 824 | Ga0453683_0022796 | 3300044673 | Bacteria | 3992 |
| 825 | Ga0453683_0023532 | 3300044673 | Bacteria | 3926 |
| 826 | Ga0453683_0045522 | 3300044673 | Bacteria | 2751 |
| 827 | Ga0453683_0097063 | 3300044673 | Bacteria | 1849 |
| 828 | Ga0453683_0195091 | 3300044673 | Bacteria | 1285 |
| 829 | Ga0453683_0291355 | 3300044673 | Bacteria | 1043 |
| 830 | Ga0453684_0000051 | 3300044712 | Bacteria | 551033 |
| 831 | Ga0453684_0000206 | 3300044712 | Bacteria | 257650 |
| 832 | Ga0453684_0000260 | 3300044712 | Bacteria | 227076 |
| 833 | Ga0453684_0001207 | 3300044712 | Bacteria | 79602 |
| 834 | Ga0453684_0002151 | 3300044712 | Bacteria | 49340 |
| 835 | Ga0453684_0010954 | 3300044712 | Bacteria | 15328 |
| 836 | Ga0453684_0015660 | 3300044712 | Bacteria | 11953 |
| 837 | Ga0453684_0018383 | 3300044712 | Bacteria | 10729 |
| 838 | Ga0453684_0025910 | 3300044712 | Bacteria | 8491 |
| 839 | Ga0453684_0030168 | 3300044712 | Bacteria | 7668 |
| 840 | Ga0453684_0058021 | 3300044712 | Bacteria | 5002 |
| 841 | Ga0453684_0109194 | 3300044712 | Unclassified | 3365 |
| 842 | Ga0453684_0134820 | 3300044712 | Bacteria | 2958 |
| 843 | Ga0453684_0140459 | 3300044712 | Bacteria | 2885 |
| 844 | Ga0453684_0146361 | 3300044712 | Bacteria | 2813 |
| 845 | Ga0453684_0177372 | 3300044712 | Bacteria | 2504 |
| 846 | Ga0453684_0195770 | 3300044712 | Bacteria | 2361 |
| 847 | Ga0453684_0280276 | 3300044712 | Bacteria | 1901 |
| 848 | Ga0453684_0328350 | 3300044712 | Unclassified | 1730 |
| 849 | Ga0453684_0333713 | 3300044712 | Bacteria | 1714 |
| 850 | Ga0453684_0449951 | 3300044712 | Bacteria | 1434 |
| 851 | Ga0453684_0525383 | 3300044712 | Unclassified | 1307 |
| 852 | Ga0453684_0585335 | 3300044712 | Bacteria | 1225 |
| 853 | Ga0453684_0698513 | 3300044712 | Bacteria | 1102 |
| 854 | Ga0453684_1062071 | 3300044712 | Bacteria | 858 |
| 855 | Ga0466970_0001866 | 3300044765 | Bacteria | 10187 |
| 856 | Ga0466970_0004459 | 3300044765 | Bacteria | 6901 |
| 857 | Ga0466957_0005893 | 3300044842 | Bacteria | 6909 |
| 858 | Ga0466957_0063074 | 3300044842 | Bacteria | 2277 |
| 859 | Ga0466957_0108799 | 3300044842 | Unclassified | 1756 |
| 860 | Ga0466957_0265578 | 3300044842 | Bacteria | 1145 |
| 861 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 862 | Ga0451576_0000072 | 3300045051 | Bacteria | 257650 |
| 863 | Ga0451576_0000103 | 3300045051 | Bacteria | 217967 |
| 864 | Ga0451576_0002639 | 3300045051 | Bacteria | 26206 |
| 865 | Ga0451576_0012627 | 3300045051 | Bacteria | 9482 |
| 866 | Ga0451576_0029708 | 3300045051 | Bacteria | 5847 |
| 867 | Ga0451576_0034004 | 3300045051 | Bacteria | 5416 |
| 868 | Ga0451576_0057828 | 3300045051 | Bacteria | 4053 |
| 869 | Ga0451576_0071073 | 3300045051 | Unclassified | 3622 |
| 870 | Ga0451576_0086893 | 3300045051 | Bacteria | 3253 |
| 871 | Ga0451576_0115965 | 3300045051 | Bacteria | 2788 |
| 872 | Ga0451576_0208997 | 3300045051 | Bacteria | 2038 |
| 873 | Ga0451576_0388447 | 3300045051 | Bacteria | 1463 |
| 874 | Ga0495592_0080635 | 3300046454 | Bacteria | 2354 |
| 875 | Ga0495629_0019970 | 3300046459 | Bacteria | 4781 |
| 876 | Ga0495629_0098988 | 3300046459 | Bacteria | 2035 |
| 877 | Ga0495638_0000005 | 3300046460 | Bacteria | 680627 |
| 878 | Ga0495638_0000015 | 3300046460 | Bacteria | 414645 |
| 879 | Ga0495638_0037364 | 3300046460 | Bacteria | 3089 |
| 880 | Ga0495638_0167419 | 3300046460 | Unclassified | 1263 |
| 881 | Ga0495580_0032933 | 3300046472 | Bacteria | 3735 |
| 882 | Ga0495580_0132391 | 3300046472 | Bacteria | 1729 |
| 883 | Ga0495580_0139573 | 3300046472 | Bacteria | 1680 |
| 884 | Ga0495580_0265776 | 3300046472 | Bacteria | 1173 |
| 885 | Ga0495582_0113336 | 3300046473 | Unclassified | 1524 |
| 886 | Ga0495585_0004232 | 3300046492 | Bacteria | 9360 |
| 887 | Ga0495594_0123316 | 3300046499 | Bacteria | 1465 |
| 888 | Ga0495606_0000100 | 3300046507 | Bacteria | 147592 |
| 889 | Ga0495606_0003289 | 3300046507 | Bacteria | 17293 |
| 890 | Ga0495606_0011306 | 3300046507 | Bacteria | 7293 |
| 891 | Ga0495606_0011360 | 3300046507 | Bacteria | 7271 |
| 892 | Ga0495606_0029217 | 3300046507 | Unclassified | 3876 |
| 893 | Ga0495606_0236657 | 3300046507 | Bacteria | 1020 |
| 894 | Ga0495616_0006946 | 3300046513 | Bacteria | 6816 |
| 895 | Ga0495616_0007179 | 3300046513 | Bacteria | 6678 |
| 896 | Ga0495616_0152375 | 3300046513 | Bacteria | 1045 |
| 897 | Ga0495618_0061110 | 3300046514 | Bacteria | 2390 |
| 898 | Ga0495628_0129609 | 3300046516 | Bacteria | 1930 |
| 899 | Ga0495630_0035374 | 3300046517 | Bacteria | 3733 |
| 900 | Ga0495631_0062010 | 3300046518 | Bacteria | 1621 |
| 901 | Ga0495632_0001210 | 3300046519 | Bacteria | 21930 |
| 902 | Ga0495637_0065093 | 3300046520 | Bacteria | 1485 |
| 903 | Ga0495643_0000596 | 3300046522 | Bacteria | 43864 |
| 904 | Ga0495648_0003814 | 3300046524 | Bacteria | 13094 |
| 905 | Ga0495648_0009384 | 3300046524 | Bacteria | 7593 |
| 906 | Ga0495648_0025243 | 3300046524 | Bacteria | 4027 |
| 907 | Ga0495648_0167449 | 3300046524 | Unclassified | 1130 |
| 908 | Ga0495652_0032026 | 3300046529 | Bacteria | 4600 |
| 909 | Ga0495652_0137447 | 3300046529 | Bacteria | 1926 |
| 910 | Ga0495652_0323784 | 3300046529 | Bacteria | 1113 |
| 911 | Ga0495586_0080270 | 3300046535 | Bacteria | 1792 |
| 912 | Ga0495598_0016928 | 3300046537 | Bacteria | 1870 |
| 913 | Ga0495609_0003828 | 3300046538 | Bacteria | 8464 |
| 914 | Ga0495621_0013481 | 3300046539 | Bacteria | 2570 |
| 915 | Ga0495621_0044062 | 3300046539 | Bacteria | 1576 |
| 916 | Ga0495633_0000002 | 3300046558 | Bacteria | 488754 |
| 917 | Ga0495633_0000067 | 3300046558 | Bacteria | 139122 |
| 918 | Ga0495668_0000009 | 3300046616 | Bacteria | 492623 |
| 919 | Ga0495634_0018697 | 3300046642 | Unclassified | 4930 |
| 920 | Ga0495611_0120853 | 3300046648 | Bacteria | 1221 |
| 921 | Ga0495625_0000144 | 3300046660 | Bacteria | 109247 |
| 922 | Ga0495625_0001749 | 3300046660 | Bacteria | 25117 |
| 923 | Ga0495625_0007755 | 3300046660 | Bacteria | 9270 |
| 924 | Ga0495625_0028526 | 3300046660 | Bacteria | 4186 |
| 925 | Ga0495625_0155301 | 3300046660 | Bacteria | 1536 |
| 926 | Ga0495661_0000114 | 3300046665 | Bacteria | 95935 |
| 927 | Ga0495658_0006551 | 3300046683 | Bacteria | 5721 |
| 928 | Ga0495658_0068490 | 3300046683 | Bacteria | 2055 |
| 929 | Ga0495658_0101063 | 3300046683 | Bacteria | 1721 |
| 930 | Ga0495670_0152549 | 3300046691 | Unclassified | 1212 |
| 931 | Ga0495649_0000112 | 3300046694 | Bacteria | 71657 |
| 932 | Ga0495600_0044433 | 3300046809 | Bacteria | 2899 |
| 933 | Ga0495600_0188304 | 3300046809 | Bacteria | 1328 |
| 934 | Ga0495660_0017439 | 3300046810 | Bacteria | 4134 |
| 935 | Ga0495660_0024633 | 3300046810 | Unclassified | 3427 |
| 936 | Ga0495660_0034191 | 3300046810 | Bacteria | 2846 |
| 937 | Ga0495581_0035024 | 3300047315 | Bacteria | 2905 |
| 938 | Ga0495604_0389047 | 3300047317 | Bacteria | 920 |
| 939 | Ga0495604_0413721 | 3300047317 | Bacteria | 886 |
| 940 | Ga0495674_0028918 | 3300047319 | Bacteria | 5049 |
| 941 | Ga0495674_0186293 | 3300047319 | Bacteria | 1727 |
| 942 | Ga0495672_0039736 | 3300047320 | Unclassified | 2859 |
| 943 | Ga0495676_0029247 | 3300047321 | Bacteria | 4693 |
| 944 | Ga0495676_0309077 | 3300047321 | Bacteria | 1064 |
| 945 | Ga0495687_000006 | 3300047443 | Bacteria | 571936 |
| 946 | Ga0495684_0261104 | 3300047471 | Unclassified | 1256 |
| 947 | Ga0495686_0051377 | 3300047472 | Bacteria | 2587 |
| 948 | Ga0495614_0048477 | 3300048089 | Bacteria | 1821 |
| 949 | Ga0496100_0670016 | 3300048903 | Unclassified | 809 |
| 950 | Ga0496104_0391855 | 3300048907 | Bacteria | 1301 |
| 951 | Ga0496110_0470567 | 3300048913 | Unclassified | 1145 |
| 952 | Ga0496116_0000002 | 3300048919 | Bacteria | 920291 |
| 953 | Ga0496116_0022382 | 3300048919 | Bacteria | 4736 |
| 954 | Ga0496117_0006510 | 3300048920 | Bacteria | 11776 |
| 955 | Ga0496118_0025785 | 3300048921 | Bacteria | 5029 |
| 956 | Ga0496118_0201570 | 3300048921 | Bacteria | 1178 |
| 957 | Ga0496122_0078960 | 3300048925 | Bacteria | 2302 |
| 958 | Ga0496124_0016379 | 3300048927 | Bacteria | 7051 |
| 959 | Ga0496125_0000007 | 3300048928 | Bacteria | 715355 |
| 960 | Ga0496126_0068377 | 3300048929 | Bacteria | 3171 |
| 961 | Ga0495682_0014555 | 3300049460 | Bacteria | 2982 |
| 962 | Ga0501290_009895 | 3300049513 | Bacteria | 1216 |
| 963 | Ga0501033_0026491 | 3300049570 | Bacteria | 4363 |
| 964 | Ga0501034_0062200 | 3300049571 | Bacteria | 3748 |
| 965 | Ga0501034_0660540 | 3300049571 | Bacteria | 946 |
| 966 | Ga0501037_0337864 | 3300049573 | Bacteria | 1041 |
| 967 | Ga0501047_0020221 | 3300049581 | Bacteria | 6393 |
| 968 | Ga0501047_0216992 | 3300049581 | Bacteria | 1770 |
| 969 | Ga0501199_004813 | 3300049650 | Bacteria | 1342 |
| 970 | Ga0501206_047472 | 3300049653 | Bacteria | 676 |
| 971 | Ga0501224_000714 | 3300049664 | Bacteria | 4165 |
| 972 | Ga0501238_000120 | 3300049671 | Bacteria | 12227 |
| 973 | Ga0501242_000211 | 3300049674 | Bacteria | 4522 |
| 974 | Ga0501252_024044 | 3300049682 | Bacteria | 813 |
| 975 | Ga0501257_002012 | 3300049686 | Bacteria | 4235 |
| 976 | Ga0501257_019077 | 3300049686 | Bacteria | 1603 |
| 977 | Ga0501259_042052 | 3300049688 | Bacteria | 902 |
| 978 | Ga0501225_0000665 | 3300049705 | Bacteria | 10702 |
| 979 | Ga0501225_0002947 | 3300049705 | Bacteria | 5215 |
| 980 | Ga0501225_0020336 | 3300049705 | Bacteria | 1835 |
| 981 | Ga0501080_0151799 | 3300049742 | Bacteria | 2141 |
| 982 | Ga0501080_0635023 | 3300049742 | Bacteria | 946 |
| 983 | Ga0501241_002088 | 3300049758 | Bacteria | 3916 |
| 984 | Ga0501241_051264 | 3300049758 | Bacteria | 816 |
| 985 | Ga0501280_000875 | 3300049776 | Bacteria | 6470 |
| 986 | Ga0501035_0326638 | 3300049822 | Bacteria | 1288 |
| 987 | Ga0501044_0036903 | 3300049823 | Bacteria | 5111 |
| 988 | Ga0501044_0055830 | 3300049823 | Bacteria | 4055 |
| 989 | Ga0501044_0280509 | 3300049823 | Bacteria | 1600 |
| 990 | nmdc:mga0k408_255503_c1 | 3300050493 | Bacteria | 1046 |
| 991 | nmdc:mga0k408_377960_c1 | 3300050493 | Bacteria | 844 |
| 992 | nmdc:mga0k408_43005_c1 | 3300050493 | Bacteria | 2602 |
| 993 | nmdc:mga09592_110384_c1 | 3300050508 | Bacteria | 2359 |
| 994 | nmdc:mga09592_20613_c1 | 3300050508 | Bacteria | 5423 |
| 995 | nmdc:mga09592_25320_c1 | 3300050508 | Bacteria | 4911 |
| 996 | nmdc:mga09592_32604_c1 | 3300050508 | Bacteria | 4343 |
| 997 | nmdc:mga09592_6481_c1 | 3300050508 | Bacteria | 9534 |
| 998 | nmdc:mga09592_68914_c1 | 3300050508 | Bacteria | 3001 |
| 999 | nmdc:mga0qj67_22434_c1 | 3300050509 | Bacteria | 4849 |
| 1000 | nmdc:mga0qj67_333355_c1 | 3300050509 | Bacteria | 1227 |
| 1001 | nmdc:mga06r32_307059_c1 | 3300050510 | Bacteria | 1572 |
| 1002 | nmdc:mga06r32_560092_c1 | 3300050510 | Bacteria | 1116 |
| 1003 | nmdc:mga08y16_280328_c1 | 3300050511 | Bacteria | 1719 |
| 1004 | nmdc:mga08y16_304676_c1 | 3300050511 | Unclassified | 1641 |
| 1005 | nmdc:mga08y16_48805_c1 | 3300050511 | Bacteria | 4430 |
| 1006 | nmdc:mga08y16_499714_c1 | 3300050511 | Unclassified | 1236 |
| 1007 | nmdc:mga08y16_581473_c1 | 3300050511 | Bacteria | 1131 |
| 1008 | nmdc:mga08y16_723317_c1 | 3300050511 | Unclassified | 993 |
| 1009 | nmdc:mga08y16_99108_c1 | 3300050511 | Bacteria | 3034 |
| 1010 | nmdc:mga08y16_991352_c1 | 3300050511 | Bacteria | 821 |
| 1011 | nmdc:mga0n895_323834_c1 | 3300050512 | Bacteria | 1562 |
| 1012 | nmdc:mga0rr50_499487_c1 | 3300050513 | Bacteria | 1034 |
| 1013 | Ga0495619_0160716 | 3300053085 | Bacteria | 1552 |
| 1014 | Ga0500646_0052912 | 3300053090 | Bacteria | 1176 |
| 1015 | Ga0500583_0000030 | 3300053092 | Bacteria | 105809 |
| 1016 | Ga0500583_0000215 | 3300053092 | Bacteria | 21565 |
| 1017 | Ga0500583_0005514 | 3300053092 | Bacteria | 4251 |
| 1018 | Ga0500583_0009892 | 3300053092 | Bacteria | 3509 |
| 1019 | Ga0500583_0152666 | 3300053092 | Unclassified | 1150 |
| 1020 | Ga0500651_0000485 | 3300053093 | Bacteria | 20743 |
| 1021 | Ga0500651_0073389 | 3300053093 | Bacteria | 2127 |
| 1022 | Ga0500641_0013408 | 3300053096 | Unclassified | 3011 |
| 1023 | Ga0500562_020810 | 3300053108 | Bacteria | 1704 |
| 1024 | Ga0500608_000292 | 3300053122 | Bacteria | 19418 |
| 1025 | Ga0500608_007141 | 3300053122 | Bacteria | 4598 |
| 1026 | Ga0500608_010579 | 3300053122 | Bacteria | 3966 |
| 1027 | Ga0500614_131886 | 3300053123 | Bacteria | 742 |
| 1028 | Ga0500618_000148 | 3300053125 | Bacteria | 58264 |
| 1029 | Ga0500642_0016675 | 3300053130 | Unclassified | 2797 |
| 1030 | Ga0500642_0022291 | 3300053130 | Bacteria | 2525 |
| 1031 | Ga0500561_0064035 | 3300053137 | Bacteria | 1037 |
| 1032 | Ga0500568_0013513 | 3300053139 | Bacteria | 3720 |
| 1033 | Ga0500568_0018116 | 3300053139 | Bacteria | 3091 |
| 1034 | Ga0500568_0042061 | 3300053139 | Bacteria | 1833 |
| 1035 | Ga0500588_0000359 | 3300053146 | Bacteria | 6993 |
| 1036 | Ga0500589_071911 | 3300053147 | Bacteria | 1563 |
| 1037 | Ga0500604_0005834 | 3300053151 | Unclassified | 3255 |
| 1038 | Ga0500604_0072938 | 3300053151 | Unclassified | 1098 |
| 1039 | Ga0500616_0000003 | 3300053153 | Bacteria | 1220687 |
| 1040 | Ga0500616_0008489 | 3300053153 | Bacteria | 6372 |
| 1041 | Ga0500616_0026551 | 3300053153 | Bacteria | 3204 |
| 1042 | Ga0500616_0044311 | 3300053153 | Bacteria | 2374 |
| 1043 | Ga0500616_0052611 | 3300053153 | Bacteria | 2141 |
| 1044 | Ga0500616_0071849 | 3300053153 | Bacteria | 1761 |
| 1045 | Ga0500622_0000017 | 3300053156 | Bacteria | 332114 |
| 1046 | Ga0500622_0000058 | 3300053156 | Bacteria | 134237 |
| 1047 | Ga0500622_0000786 | 3300053156 | Bacteria | 27529 |
| 1048 | Ga0500622_0001315 | 3300053156 | Bacteria | 20207 |
| 1049 | Ga0500622_0001463 | 3300053156 | Bacteria | 18819 |
| 1050 | Ga0500622_0065034 | 3300053156 | Bacteria | 1854 |
| 1051 | Ga0500622_0076405 | 3300053156 | Bacteria | 1684 |
| 1052 | Ga0500636_0032141 | 3300053177 | Bacteria | 3106 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_0291355 | Ga0453683_0291355_415_1017 | 179 |
| 2 | 3300013100 | Ga0157373_10000076 | Ga0157373_1000007646 | 183 |
| 3 | 3300013104 | Ga0157370_10001337 | Ga0157370_1000133719 | 183 |
| 4 | 3300015261 | Ga0182006_1001215 | Ga0182006_10012159 | 183 |
| 5 | 3300025919 | Ga0207657_10524382 | Ga0207657_105243822 | 186 |
| 6 | 3300036401 | Ga0373937_0461137 | Ga0373937_0461137_568_1161 | 186 |
| 7 | 3300036401 | Ga0373937_0587534 | Ga0373937_0587534_66_659 | 186 |
| 8 | 3300041512 | Ga0451853_2161633 | Ga0451853_2161633_21_635 | 186 |
| 9 | 3300046535 | Ga0495586_0080270 | Ga0495586_0080270_29_643 | 186 |
| 10 | 3300046809 | Ga0495600_0188304 | Ga0495600_0188304_671_1285 | 186 |
| 11 | 3300047317 | Ga0495604_0413721 | Ga0495604_0413721_29_622 | 186 |
| 12 | 3300049653 | Ga0501206_047472 | Ga0501206_047472_41_661 | 193 |
| 13 | 3300025961 | Ga0207712_10018788 | Ga0207712_100187882 | 194 |
| 14 | 3300046558 | Ga0495633_0000067 | Ga0495633_0000067_93147_93797 | 195 |
| 15 | 3300028379 | Ga0268266_10313865 | Ga0268266_103138653 | 196 |
| 16 | 3300003316 | rootH1_10152184 | rootH1_101521842 | 197 |
| 17 | 3300003322 | rootL2_10206605 | rootL2_102066053 | 197 |
| 18 | 3300046507 | Ga0495606_0029217 | Ga0495606_0029217_3213_3845 | 197 |
| 19 | 3300050508 | nmdc:mga09592_20613_c1 | nmdc:mga09592_20613_c1_25_720 | 198 |
| 20 | 3300009553 | Ga0105249_10032078 | Ga0105249_100320782 | 200 |
| 21 | 3300017792 | Ga0163161_10000095 | Ga0163161_1000009540 | 200 |
| 22 | 3300041512 | Ga0451853_0411948 | Ga0451853_0411948_140_856 | 200 |
| 23 | 3300002738 | JGI25154J39366_1000001 | JGI25154J39366_1000001424 | 202 |
| 24 | 3300002741 | JGI25157J39369_1004584 | JGI25157J39369_10045842 | 202 |
| 25 | 3300003215 | JGI25153J46596_10005860 | JGI25153J46596_100058603 | 202 |
| 26 | 3300003323 | rootH1_10008757 | rootH1_100087574 | 202 |
| 27 | 3300003354 | JGI25160J50197_1003397 | JGI25160J50197_10033972 | 202 |
| 28 | 3300003354 | JGI25160J50197_1004076 | JGI25160J50197_10040762 | 202 |
| 29 | 3300013102 | Ga0157371_10012850 | Ga0157371_100128501 | 202 |
| 30 | 3300013104 | Ga0157370_10006123 | Ga0157370_100061232 | 202 |
| 31 | 3300013105 | Ga0157369_10068104 | Ga0157369_100681045 | 202 |
| 32 | 3300015261 | Ga0182006_1042607 | Ga0182006_10426073 | 202 |
| 33 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002421 | 202 |
| 34 | 3300025250 | Ga0209026_1000218 | Ga0209026_100021813 | 202 |
| 35 | 3300025297 | Ga0209758_1024663 | Ga0209758_10246633 | 202 |
| 36 | 3300025302 | Ga0207426_1000502 | Ga0207426_10005026 | 202 |
| 37 | 3300048919 | Ga0496116_0000002 | Ga0496116_0000002_127081_127797 | 202 |
| 38 | 3300048921 | Ga0496118_0025785 | Ga0496118_0025785_1553_2269 | 202 |
| 39 | 3300048927 | Ga0496124_0016379 | Ga0496124_0016379_1356_2072 | 202 |
| 40 | 3300048928 | Ga0496125_0000007 | Ga0496125_0000007_128073_128789 | 202 |
| 41 | 3300048929 | Ga0496126_0068377 | Ga0496126_0068377_411_1127 | 202 |
| 42 | 3300003323 | rootH1_10243959 | rootH1_102439592 | 203 |
| 43 | 3300005329 | Ga0070683_100023042 | Ga0070683_1000230424 | 203 |
| 44 | 3300005535 | Ga0070684_100016467 | Ga0070684_1000164673 | 203 |
| 45 | 3300013100 | Ga0157373_10000115 | Ga0157373_1000011535 | 203 |
| 46 | 3300013307 | Ga0157372_10010784 | Ga0157372_100107849 | 203 |
| 47 | 3300030734 | Ga0316179_1035183 | Ga0316179_10351833 | 203 |
| 48 | 3300031548 | Ga0307408_100000947 | Ga0307408_10000094718 | 203 |
| 49 | 3300031731 | Ga0307405_10379220 | Ga0307405_103792202 | 203 |
| 50 | 3300031852 | Ga0307410_10007044 | Ga0307410_100070444 | 203 |
| 51 | 3300031901 | Ga0307406_10000287 | Ga0307406_100002872 | 203 |
| 52 | 3300031903 | Ga0307407_10000785 | Ga0307407_100007856 | 203 |
| 53 | 3300031911 | Ga0307412_10247868 | Ga0307412_102478682 | 203 |
| 54 | 3300032004 | Ga0307414_10000005 | Ga0307414_10000005338 | 203 |
| 55 | 3300049664 | Ga0501224_000714 | Ga0501224_000714_2238_2954 | 203 |
| 56 | 3300049671 | Ga0501238_000120 | Ga0501238_000120_8369_9085 | 203 |
| 57 | 3300049758 | Ga0501241_051264 | Ga0501241_051264_49_765 | 203 |
| 58 | 3300049776 | Ga0501280_000875 | Ga0501280_000875_1299_2015 | 203 |
| 59 | 3300053153 | Ga0500616_0008489 | Ga0500616_0008489_1182_1913 | 203 |
| 60 | 3300028794 | Ga0307515_10106040 | Ga0307515_101060404 | 204 |
| 61 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_1555452_1556168 | 204 |
| 62 | 3300053123 | Ga0500614_131886 | Ga0500614_131886_43_723 | 205 |
| 63 | 3300005288 | Ga0065714_10022017 | Ga0065714_100220171 | 206 |
| 64 | 3300050493 | nmdc:mga0k408_377960_c1 | nmdc:mga0k408_377960_c1_160_831 | 206 |
| 65 | 3300003323 | rootH1_10209779 | rootH1_102097792 | 207 |
| 66 | 3300041486 | Ga0451807_0096103 | Ga0451807_0096103_166_882 | 207 |
| 67 | 3300005262 | Ga0065165_1014272 | Ga0065165_10142723 | 208 |
| 68 | 3300013308 | Ga0157375_10009146 | Ga0157375_100091467 | 209 |
| 69 | 3300041411 | Ga0439466_0031994 | Ga0439466_0031994_480_1196 | 209 |
| 70 | 3300025899 | Ga0207642_10238725 | Ga0207642_102387252 | 210 |
| 71 | 3300025934 | Ga0207686_10283639 | Ga0207686_102836391 | 210 |
| 72 | 3300031727 | Ga0316576_10392479 | Ga0316576_103924792 | 210 |
| 73 | iso_pu_bacteria | 2904445276 | 2904447469 | 210 |
| 74 | 3300003322 | rootL2_10107136 | rootL2_101071362 | 211 |
| 75 | 3300014326 | Ga0157380_10265446 | Ga0157380_102654462 | 211 |
| 76 | 3300050511 | nmdc:mga08y16_48805_c1 | nmdc:mga08y16_48805_c1_959_1663 | 211 |
| 77 | iso_pu_bacteria | 2839989709 | 2839991946 | 211 |
| 78 | iso_pu_bacteria | 2929921140 | 2929923137 | 211 |
| 79 | iso_pu_bacteria | 8003151029 | 8003155972 | 211 |
| 80 | 3300013102 | Ga0157371_10104283 | Ga0157371_101042832 | 212 |
| 81 | 3300042014 | Ga0439457_011920 | Ga0439457_011920_1007_1738 | 212 |
| 82 | 3300013102 | Ga0157371_10017042 | Ga0157371_100170425 | 213 |
| 83 | 3300013307 | Ga0157372_10062986 | Ga0157372_100629862 | 213 |
| 84 | 3300039062 | Ga0400483_131968 | Ga0400483_131968_66_773 | 213 |
| 85 | 3300046472 | Ga0495580_0139573 | Ga0495580_0139573_791_1510 | 213 |
| 86 | 3300046507 | Ga0495606_0011360 | Ga0495606_0011360_5993_6712 | 213 |
| 87 | 3300003323 | rootH1_10374623 | rootH1_103746231 | 214 |
| 88 | 3300005288 | Ga0065714_10064431 | Ga0065714_1006443125 | 214 |
| 89 | 3300005329 | Ga0070683_100039199 | Ga0070683_1000391992 | 214 |
| 90 | 3300005338 | Ga0068868_100108996 | Ga0068868_1001089962 | 214 |
| 91 | 3300005355 | Ga0070671_100107854 | Ga0070671_1001078542 | 214 |
| 92 | 3300005459 | Ga0068867_100003722 | Ga0068867_1000037222 | 214 |
| 93 | 3300005563 | Ga0068855_101094636 | Ga0068855_1010946361 | 214 |
| 94 | 3300005616 | Ga0068852_100503675 | Ga0068852_1005036752 | 214 |
| 95 | 3300005618 | Ga0068864_100102913 | Ga0068864_1001029132 | 214 |
| 96 | 3300005843 | Ga0068860_100854471 | Ga0068860_1008544712 | 214 |
| 97 | 3300006237 | Ga0097621_100193831 | Ga0097621_1001938311 | 214 |
| 98 | 3300006358 | Ga0068871_100205853 | Ga0068871_1002058532 | 214 |
| 99 | 3300006881 | Ga0068865_100018914 | Ga0068865_1000189142 | 214 |
| 100 | 3300009036 | Ga0105244_10131388 | Ga0105244_101313882 | 214 |
| 101 | 3300009094 | Ga0111539_10011626 | Ga0111539_100116265 | 214 |
| 102 | 3300009176 | Ga0105242_10044485 | Ga0105242_100444852 | 214 |
| 103 | 3300009176 | Ga0105242_10293334 | Ga0105242_102933342 | 214 |
| 104 | 3300013296 | Ga0157374_10342448 | Ga0157374_103424482 | 214 |
| 105 | 3300013297 | Ga0157378_10040141 | Ga0157378_100401412 | 214 |
| 106 | 3300013306 | Ga0163162_10045607 | Ga0163162_100456072 | 214 |
| 107 | 3300014325 | Ga0163163_10329397 | Ga0163163_103293971 | 214 |
| 108 | 3300014326 | Ga0157380_10004552 | Ga0157380_100045523 | 214 |
| 109 | 3300015261 | Ga0182006_1000094 | Ga0182006_100009429 | 214 |
| 110 | 3300025905 | Ga0207685_10214742 | Ga0207685_102147421 | 214 |
| 111 | 3300025907 | Ga0207645_10068466 | Ga0207645_100684662 | 214 |
| 112 | 3300025931 | Ga0207644_10210817 | Ga0207644_102108172 | 214 |
| 113 | 3300025944 | Ga0207661_10584836 | Ga0207661_105848362 | 214 |
| 114 | 3300025949 | Ga0207667_10980036 | Ga0207667_109800361 | 214 |
| 115 | 3300026088 | Ga0207641_10276044 | Ga0207641_102760442 | 214 |
| 116 | 3300026089 | Ga0207648_10003831 | Ga0207648_100038317 | 214 |
| 117 | 3300026095 | Ga0207676_10539429 | Ga0207676_105394292 | 214 |
| 118 | 3300035172 | Ga0373955_0027088 | Ga0373955_0027088_884_1588 | 214 |
| 119 | 3300035724 | Ga0373933_0038641 | Ga0373933_0038641_1826_2530 | 214 |
| 120 | 3300036401 | Ga0373937_0009021 | Ga0373937_0009021_3620_4324 | 214 |
| 121 | 3300037068 | Ga0373925_0156848 | Ga0373925_0156848_565_1266 | 214 |
| 122 | 3300046454 | Ga0495592_0080635 | Ga0495592_0080635_1085_1789 | 214 |
| 123 | 3300046472 | Ga0495580_0265776 | Ga0495580_0265776_138_839 | 214 |
| 124 | 3300046514 | Ga0495618_0061110 | Ga0495618_0061110_1456_2160 | 214 |
| 125 | 3300046516 | Ga0495628_0129609 | Ga0495628_0129609_1126_1830 | 214 |
| 126 | 3300046642 | Ga0495634_0018697 | Ga0495634_0018697_3863_4567 | 214 |
| 127 | 3300047317 | Ga0495604_0389047 | Ga0495604_0389047_105_809 | 214 |
| 128 | 3300047319 | Ga0495674_0186293 | Ga0495674_0186293_509_1213 | 214 |
| 129 | 3300047321 | Ga0495676_0309077 | Ga0495676_0309077_83_784 | 214 |
| 130 | iso_pu_bacteria | 2721755487 | 2722729589 | 214 |
| 131 | 3300001979 | JGI24740J21852_10003050 | JGI24740J21852_100030503 | 215 |
| 132 | 3300001989 | JGI24739J22299_10000854 | JGI24739J22299_100008549 | 215 |
| 133 | 3300003320 | rootH2_10016087 | rootH2_100160872 | 215 |
| 134 | 3300003322 | rootL2_10352985 | rootL2_103529852 | 215 |
| 135 | 3300003323 | rootH1_10209329 | rootH1_102093295 | 215 |
| 136 | 3300003354 | JGI25160J50197_1015650 | JGI25160J50197_10156502 | 215 |
| 137 | 3300003354 | JGI25160J50197_1034227 | JGI25160J50197_10342271 | 215 |
| 138 | 3300003771 | Ga0055526_1014997 | Ga0055526_10149971 | 215 |
| 139 | 3300003771 | Ga0055526_1015094 | Ga0055526_10150941 | 215 |
| 140 | 3300003790 | Ga0055528_1000278 | Ga0055528_100027831 | 215 |
| 141 | 3300003791 | Ga0055530_10003481 | Ga0055530_100034815 | 215 |
| 142 | 3300003794 | Ga0055531_10016402 | Ga0055531_100164023 | 215 |
| 143 | 3300005262 | Ga0065165_1000010 | Ga0065165_100001018 | 215 |
| 144 | 3300005841 | Ga0068863_100001267 | Ga0068863_1000012673 | 215 |
| 145 | 3300006195 | Ga0075366_10156423 | Ga0075366_101564231 | 215 |
| 146 | 3300013104 | Ga0157370_10054900 | Ga0157370_100549003 | 215 |
| 147 | 3300013104 | Ga0157370_10244746 | Ga0157370_102447462 | 215 |
| 148 | 3300025273 | Ga0209673_1000082 | Ga0209673_10000822 | 215 |
| 149 | 3300025273 | Ga0209673_1055161 | Ga0209673_10551612 | 215 |
| 150 | 3300025295 | Ga0209564_1007986 | Ga0209564_10079862 | 215 |
| 151 | 3300025295 | Ga0209564_1012344 | Ga0209564_10123442 | 215 |
| 152 | 3300025297 | Ga0209758_1015100 | Ga0209758_10151004 | 215 |
| 153 | 3300025298 | Ga0209050_1000577 | Ga0209050_100057753 | 215 |
| 154 | 3300025302 | Ga0207426_1007377 | Ga0207426_10073774 | 215 |
| 155 | 3300025304 | Ga0209257_1004063 | Ga0209257_10040638 | 215 |
| 156 | 3300025904 | Ga0207647_10134190 | Ga0207647_101341902 | 215 |
| 157 | 3300026088 | Ga0207641_10000377 | Ga0207641_1000037733 | 215 |
| 158 | 3300031251 | Ga0265327_10000073 | Ga0265327_10000073151 | 215 |
| 159 | 3300049823 | Ga0501044_0280509 | Ga0501044_0280509_206_934 | 215 |
| 160 | 3300050493 | nmdc:mga0k408_255503_c1 | nmdc:mga0k408_255503_c1_266_964 | 215 |
| 161 | 3300053139 | Ga0500568_0018116 | Ga0500568_0018116_2184_2909 | 215 |
| 162 | 3300005365 | Ga0070688_100049537 | Ga0070688_1000495372 | 216 |
| 163 | 3300005466 | Ga0070685_10084911 | Ga0070685_100849112 | 216 |
| 164 | 3300005618 | Ga0068864_100437777 | Ga0068864_1004377771 | 216 |
| 165 | 3300005985 | Ga0081539_10077544 | Ga0081539_100775442 | 216 |
| 166 | 3300006358 | Ga0068871_100634437 | Ga0068871_1006344371 | 216 |
| 167 | 3300006844 | Ga0075428_100147774 | Ga0075428_1001477742 | 216 |
| 168 | 3300006846 | Ga0075430_100058156 | Ga0075430_1000581562 | 216 |
| 169 | 3300006847 | Ga0075431_100075499 | Ga0075431_1000754992 | 216 |
| 170 | 3300009093 | Ga0105240_10000547 | Ga0105240_1000054721 | 216 |
| 171 | 3300013306 | Ga0163162_10074637 | Ga0163162_100746373 | 216 |
| 172 | 3300014325 | Ga0163163_10012157 | Ga0163163_100121577 | 216 |
| 173 | 3300014326 | Ga0157380_10000002 | Ga0157380_1000000217 | 216 |
| 174 | 3300025913 | Ga0207695_10000067 | Ga0207695_10000067207 | 216 |
| 175 | 3300025931 | Ga0207644_10264882 | Ga0207644_102648822 | 216 |
| 176 | 3300025936 | Ga0207670_10115899 | Ga0207670_101158992 | 216 |
| 177 | 3300026095 | Ga0207676_10424122 | Ga0207676_104241221 | 216 |
| 178 | 3300028381 | Ga0268264_10016393 | Ga0268264_100163934 | 216 |
| 179 | 3300042876 | Ga0451577_0079256 | Ga0451577_0079256_939_1646 | 216 |
| 180 | 3300042876 | Ga0451577_0192273 | Ga0451577_0192273_893_1600 | 216 |
| 181 | 3300044712 | Ga0453684_0134820 | Ga0453684_0134820_1019_1726 | 216 |
| 182 | 3300044712 | Ga0453684_0449951 | Ga0453684_0449951_693_1400 | 216 |
| 183 | 3300045051 | Ga0451576_0086893 | Ga0451576_0086893_1926_2633 | 216 |
| 184 | 3300045051 | Ga0451576_0388447 | Ga0451576_0388447_368_1075 | 216 |
| 185 | 3300047315 | Ga0495581_0035024 | Ga0495581_0035024_981_1664 | 216 |
| 186 | 3300050508 | nmdc:mga09592_25320_c1 | nmdc:mga09592_25320_c1_1370_2119 | 216 |
| 187 | 3300050509 | nmdc:mga0qj67_22434_c1 | nmdc:mga0qj67_22434_c1_432_1181 | 216 |
| 188 | 3300050510 | nmdc:mga06r32_307059_c1 | nmdc:mga06r32_307059_c1_612_1361 | 216 |
| 189 | 3300053122 | Ga0500608_007141 | Ga0500608_007141_1482_2195 | 216 |
| 190 | 3300053153 | Ga0500616_0026551 | Ga0500616_0026551_1861_2586 | 216 |
| 191 | iso_pu_bacteria | 2904780799 | 2904781205 | 216 |
| 192 | iso_pu_bacteria | 2919177583 | 2919178808 | 216 |
| 193 | 3300005336 | Ga0070680_100355947 | Ga0070680_1003559472 | 217 |
| 194 | 3300005347 | Ga0070668_100146819 | Ga0070668_1001468192 | 217 |
| 195 | 3300005367 | Ga0070667_100070796 | Ga0070667_1000707963 | 217 |
| 196 | 3300005539 | Ga0068853_100118647 | Ga0068853_1001186471 | 217 |
| 197 | 3300005563 | Ga0068855_100404142 | Ga0068855_1004041422 | 217 |
| 198 | 3300005614 | Ga0068856_100613680 | Ga0068856_1006136801 | 217 |
| 199 | 3300005841 | Ga0068863_100451788 | Ga0068863_1004517882 | 217 |
| 200 | 3300006358 | Ga0068871_100118650 | Ga0068871_1001186502 | 217 |
| 201 | 3300009093 | Ga0105240_10038286 | Ga0105240_100382865 | 217 |
| 202 | 3300009174 | Ga0105241_10030828 | Ga0105241_100308283 | 217 |
| 203 | 3300009174 | Ga0105241_10082299 | Ga0105241_100822993 | 217 |
| 204 | 3300009545 | Ga0105237_10013011 | Ga0105237_100130113 | 217 |
| 205 | 3300009545 | Ga0105237_10026340 | Ga0105237_100263404 | 217 |
| 206 | 3300010375 | Ga0105239_10000004 | Ga0105239_1000000424 | 217 |
| 207 | 3300010375 | Ga0105239_10000016 | Ga0105239_10000016187 | 217 |
| 208 | 3300010375 | Ga0105239_10004803 | Ga0105239_100048034 | 217 |
| 209 | 3300013104 | Ga0157370_10009531 | Ga0157370_100095313 | 217 |
| 210 | 3300013307 | Ga0157372_10344993 | Ga0157372_103449932 | 217 |
| 211 | 3300014497 | Ga0182008_10000081 | Ga0182008_1000008129 | 217 |
| 212 | 3300025909 | Ga0207705_10372739 | Ga0207705_103727392 | 217 |
| 213 | 3300025911 | Ga0207654_10039283 | Ga0207654_100392834 | 217 |
| 214 | 3300025913 | Ga0207695_10026583 | Ga0207695_100265832 | 217 |
| 215 | 3300025913 | Ga0207695_10509493 | Ga0207695_105094931 | 217 |
| 216 | 3300025914 | Ga0207671_10005696 | Ga0207671_100056967 | 217 |
| 217 | 3300025914 | Ga0207671_10059616 | Ga0207671_100596161 | 217 |
| 218 | 3300025949 | Ga0207667_10412417 | Ga0207667_104124172 | 217 |
| 219 | 3300025986 | Ga0207658_10020456 | Ga0207658_100204565 | 217 |
| 220 | 3300026041 | Ga0207639_10101786 | Ga0207639_101017862 | 217 |
| 221 | 3300026078 | Ga0207702_11045364 | Ga0207702_110453641 | 217 |
| 222 | 3300026088 | Ga0207641_10411366 | Ga0207641_104113662 | 217 |
| 223 | 3300031251 | Ga0265327_10001129 | Ga0265327_1000112929 | 217 |
| 224 | 3300031731 | Ga0307405_10000008 | Ga0307405_1000000817 | 217 |
| 225 | 3300032004 | Ga0307414_10000574 | Ga0307414_1000057420 | 217 |
| 226 | 3300039062 | Ga0400483_036718 | Ga0400483_036718_69_770 | 217 |
| 227 | 3300042876 | Ga0451577_0066957 | Ga0451577_0066957_1325_2035 | 217 |
| 228 | 3300044658 | Ga0466972_0177502 | Ga0466972_0177502_211_909 | 217 |
| 229 | 3300044712 | Ga0453684_0177372 | Ga0453684_0177372_1150_1875 | 217 |
| 230 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_1319276_1319980 | 217 |
| 231 | 3300046507 | Ga0495606_0011306 | Ga0495606_0011306_6006_6719 | 217 |
| 232 | 3300046529 | Ga0495652_0137447 | Ga0495652_0137447_1015_1731 | 217 |
| 233 | 3300048919 | Ga0496116_0022382 | Ga0496116_0022382_605_1294 | 217 |
| 234 | 3300048920 | Ga0496117_0006510 | Ga0496117_0006510_1108_1797 | 217 |
| 235 | 3300048921 | Ga0496118_0201570 | Ga0496118_0201570_259_948 | 217 |
| 236 | 3300048925 | Ga0496122_0078960 | Ga0496122_0078960_204_893 | 217 |
| 237 | 3300049758 | Ga0501241_002088 | Ga0501241_002088_1403_2113 | 217 |
| 238 | iso_pu_bacteria | 2643221600 | 2644010698 | 217 |
| 239 | iso_pu_bacteria | 2643221725 | 2644684226 | 217 |
| 240 | iso_pu_bacteria | 2802428842 | 2802651880 | 217 |
| 241 | iso_pu_bacteria | 2857613821 | 2857615275 | 217 |
| 242 | iso_pu_bacteria | 2881359912 | 2881360230 | 217 |
| 243 | iso_pu_bacteria | 2904419702 | 2904423949 | 217 |
| 244 | iso_pu_bacteria | 2904555929 | 2904560411 | 217 |
| 245 | iso_pu_bacteria | 2919683626 | 2919684774 | 217 |
| 246 | iso_pu_bacteria | 2977268062 | 2977268624 | 217 |
| 247 | 3300003215 | JGI25153J46596_10072175 | JGI25153J46596_100721751 | 218 |
| 248 | 3300003316 | rootH1_10035387 | rootH1_100353872 | 218 |
| 249 | 3300003316 | rootH1_10171005 | rootH1_101710052 | 218 |
| 250 | 3300003322 | rootL2_10084252 | rootL2_100842522 | 218 |
| 251 | 3300005336 | Ga0070680_100053462 | Ga0070680_1000534623 | 218 |
| 252 | 3300005336 | Ga0070680_100429040 | Ga0070680_1004290401 | 218 |
| 253 | 3300005337 | Ga0070682_100049572 | Ga0070682_1000495722 | 218 |
| 254 | 3300005458 | Ga0070681_10036122 | Ga0070681_100361223 | 218 |
| 255 | 3300005530 | Ga0070679_100011937 | Ga0070679_1000119373 | 218 |
| 256 | 3300005530 | Ga0070679_100106752 | Ga0070679_1001067523 | 218 |
| 257 | 3300005539 | Ga0068853_100083133 | Ga0068853_1000831334 | 218 |
| 258 | 3300005563 | Ga0068855_100042540 | Ga0068855_1000425405 | 218 |
| 259 | 3300005564 | Ga0070664_100400340 | Ga0070664_1004003402 | 218 |
| 260 | 3300005614 | Ga0068856_100026045 | Ga0068856_1000260451 | 218 |
| 261 | 3300005616 | Ga0068852_100032145 | Ga0068852_1000321452 | 218 |
| 262 | 3300006844 | Ga0075428_100022380 | Ga0075428_1000223807 | 218 |
| 263 | 3300009093 | Ga0105240_10000390 | Ga0105240_1000039023 | 218 |
| 264 | 3300009174 | Ga0105241_10031464 | Ga0105241_100314643 | 218 |
| 265 | 3300009545 | Ga0105237_10441695 | Ga0105237_104416952 | 218 |
| 266 | 3300010375 | Ga0105239_10000184 | Ga0105239_1000018445 | 218 |
| 267 | 3300013100 | Ga0157373_10002170 | Ga0157373_100021708 | 218 |
| 268 | 3300013102 | Ga0157371_10290466 | Ga0157371_102904662 | 218 |
| 269 | 3300013296 | Ga0157374_10262274 | Ga0157374_102622742 | 218 |
| 270 | 3300014325 | Ga0163163_10000129 | Ga0163163_1000012947 | 218 |
| 271 | 3300025295 | Ga0209564_1028609 | Ga0209564_10286091 | 218 |
| 272 | 3300025297 | Ga0209758_1082446 | Ga0209758_10824462 | 218 |
| 273 | 3300025911 | Ga0207654_10045585 | Ga0207654_100455852 | 218 |
| 274 | 3300025912 | Ga0207707_10124522 | Ga0207707_101245223 | 218 |
| 275 | 3300025913 | Ga0207695_10000020 | Ga0207695_1000002084 | 218 |
| 276 | 3300025913 | Ga0207695_10039570 | Ga0207695_100395702 | 218 |
| 277 | 3300025917 | Ga0207660_10015857 | Ga0207660_100158575 | 218 |
| 278 | 3300025921 | Ga0207652_10008396 | Ga0207652_100083963 | 218 |
| 279 | 3300025921 | Ga0207652_10115321 | Ga0207652_101153211 | 218 |
| 280 | 3300028786 | Ga0307517_10011996 | Ga0307517_1001199611 | 218 |
| 281 | 3300031507 | Ga0307509_10138196 | Ga0307509_101381962 | 218 |
| 282 | 3300031548 | Ga0307408_100059395 | Ga0307408_1000593952 | 218 |
| 283 | 3300031824 | Ga0307413_10096748 | Ga0307413_100967483 | 218 |
| 284 | 3300031903 | Ga0307407_10058688 | Ga0307407_100586883 | 218 |
| 285 | 3300032002 | Ga0307416_100102620 | Ga0307416_1001026203 | 218 |
| 286 | 3300032126 | Ga0307415_100125907 | Ga0307415_1001259073 | 218 |
| 287 | 3300039062 | Ga0400483_156766 | Ga0400483_156766_230_952 | 218 |
| 288 | 3300042876 | Ga0451577_0266104 | Ga0451577_0266104_280_1002 | 218 |
| 289 | 3300044658 | Ga0466972_0000027 | Ga0466972_0000027_92586_93317 | 218 |
| 290 | 3300044673 | Ga0453683_0045522 | Ga0453683_0045522_869_1570 | 218 |
| 291 | 3300044712 | Ga0453684_0195770 | Ga0453684_0195770_794_1495 | 218 |
| 292 | 3300044765 | Ga0466970_0001866 | Ga0466970_0001866_8913_9644 | 218 |
| 293 | 3300045051 | Ga0451576_0034004 | Ga0451576_0034004_2842_3543 | 218 |
| 294 | 3300045051 | Ga0451576_0057828 | Ga0451576_0057828_2192_2914 | 218 |
| 295 | 3300046524 | Ga0495648_0167449 | Ga0495648_0167449_172_885 | 218 |
| 296 | 3300047320 | Ga0495672_0039736 | Ga0495672_0039736_960_1676 | 218 |
| 297 | 3300053153 | Ga0500616_0044311 | Ga0500616_0044311_744_1448 | 218 |
| 298 | iso_pu_bacteria | 2738541278 | 2738728145 | 218 |
| 299 | iso_pu_bacteria | 2911138879 | 2911143717 | 218 |
| 300 | 3300003794 | Ga0055531_10002422 | Ga0055531_100024226 | 219 |
| 301 | 3300005289 | Ga0065704_10073560 | Ga0065704_100735604 | 219 |
| 302 | 3300005356 | Ga0070674_100061294 | Ga0070674_1000612942 | 219 |
| 303 | 3300005367 | Ga0070667_100178140 | Ga0070667_1001781402 | 219 |
| 304 | 3300005539 | Ga0068853_100017196 | Ga0068853_1000171962 | 219 |
| 305 | 3300005548 | Ga0070665_100000052 | Ga0070665_100000052127 | 219 |
| 306 | 3300005563 | Ga0068855_100106839 | Ga0068855_1001068393 | 219 |
| 307 | 3300009148 | Ga0105243_10000002 | Ga0105243_10000002666 | 219 |
| 308 | 3300013100 | Ga0157373_10004999 | Ga0157373_1000499910 | 219 |
| 309 | 3300013102 | Ga0157371_10036888 | Ga0157371_100368883 | 219 |
| 310 | 3300013104 | Ga0157370_10233542 | Ga0157370_102335422 | 219 |
| 311 | 3300013296 | Ga0157374_10077932 | Ga0157374_100779323 | 219 |
| 312 | 3300013307 | Ga0157372_10121838 | Ga0157372_101218385 | 219 |
| 313 | 3300017792 | Ga0163161_10000230 | Ga0163161_1000023023 | 219 |
| 314 | 3300025298 | Ga0209050_1006924 | Ga0209050_10069242 | 219 |
| 315 | 3300025304 | Ga0209257_1000007 | Ga0209257_10000071290 | 219 |
| 316 | 3300025935 | Ga0207709_10000003 | Ga0207709_10000003673 | 219 |
| 317 | 3300025986 | Ga0207658_10337142 | Ga0207658_103371422 | 219 |
| 318 | 3300028379 | Ga0268266_10000070 | Ga0268266_1000007054 | 219 |
| 319 | 3300028786 | Ga0307517_10193999 | Ga0307517_101939992 | 219 |
| 320 | 3300031548 | Ga0307408_100000261 | Ga0307408_1000002615 | 219 |
| 321 | 3300031911 | Ga0307412_10002921 | Ga0307412_100029213 | 219 |
| 322 | 3300032004 | Ga0307414_10536299 | Ga0307414_105362991 | 219 |
| 323 | 3300037312 | Ga0395899_0002759 | Ga0395899_0002759_3356_4069 | 219 |
| 324 | 3300037418 | Ga0395900_0007814 | Ga0395900_0007814_8004_8717 | 219 |
| 325 | 3300037466 | Ga0395898_0006869 | Ga0395898_0006869_4174_4887 | 219 |
| 326 | 3300037466 | Ga0395898_0153074 | Ga0395898_0153074_1482_2195 | 219 |
| 327 | 3300038443 | Ga0395901_0006235 | Ga0395901_0006235_3671_4384 | 219 |
| 328 | 3300039062 | Ga0400483_085096 | Ga0400483_085096_252_1001 | 219 |
| 329 | 3300039062 | Ga0400483_185962 | Ga0400483_185962_6767_7516 | 219 |
| 330 | 3300042134 | Ga0450898_028749 | Ga0450898_028749_142_861 | 219 |
| 331 | 3300042876 | Ga0451577_0000030 | Ga0451577_0000030_48651_49370 | 219 |
| 332 | 3300042876 | Ga0451577_0000066 | Ga0451577_0000066_159773_160489 | 219 |
| 333 | 3300042876 | Ga0451577_0003571 | Ga0451577_0003571_5647_6363 | 219 |
| 334 | 3300042876 | Ga0451577_0010709 | Ga0451577_0010709_3675_4391 | 219 |
| 335 | 3300042876 | Ga0451577_0229120 | Ga0451577_0229120_609_1328 | 219 |
| 336 | 3300042876 | Ga0451577_0336172 | Ga0451577_0336172_212_928 | 219 |
| 337 | 3300042876 | Ga0451577_0376778 | Ga0451577_0376778_421_1137 | 219 |
| 338 | 3300042876 | Ga0451577_0377632 | Ga0451577_0377632_109_822 | 219 |
| 339 | 3300042876 | Ga0451577_0396117 | Ga0451577_0396117_255_971 | 219 |
| 340 | 3300042876 | Ga0451577_0764229 | Ga0451577_0764229_88_804 | 219 |
| 341 | 3300044658 | Ga0466972_0000024 | Ga0466972_0000024_24465_25169 | 219 |
| 342 | 3300044673 | Ga0453683_0000022 | Ga0453683_0000022_69268_69984 | 219 |
| 343 | 3300044673 | Ga0453683_0000112 | Ga0453683_0000112_97104_97820 | 219 |
| 344 | 3300044673 | Ga0453683_0000329 | Ga0453683_0000329_25988_26704 | 219 |
| 345 | 3300044673 | Ga0453683_0002791 | Ga0453683_0002791_5063_5779 | 219 |
| 346 | 3300044673 | Ga0453683_0009620 | Ga0453683_0009620_2489_3205 | 219 |
| 347 | 3300044673 | Ga0453683_0023532 | Ga0453683_0023532_170_883 | 219 |
| 348 | 3300044673 | Ga0453683_0097063 | Ga0453683_0097063_1043_1762 | 219 |
| 349 | 3300044673 | Ga0453683_0195091 | Ga0453683_0195091_189_905 | 219 |
| 350 | 3300044712 | Ga0453684_0000051 | Ga0453684_0000051_507909_508625 | 219 |
| 351 | 3300044712 | Ga0453684_0000206 | Ga0453684_0000206_97162_97878 | 219 |
| 352 | 3300044712 | Ga0453684_0000260 | Ga0453684_0000260_49108_49827 | 219 |
| 353 | 3300044712 | Ga0453684_0001207 | Ga0453684_0001207_14524_15240 | 219 |
| 354 | 3300044712 | Ga0453684_0002151 | Ga0453684_0002151_14739_15458 | 219 |
| 355 | 3300044712 | Ga0453684_0010954 | Ga0453684_0010954_8911_9624 | 219 |
| 356 | 3300044712 | Ga0453684_0015660 | Ga0453684_0015660_4014_4727 | 219 |
| 357 | 3300044712 | Ga0453684_0018383 | Ga0453684_0018383_1928_2644 | 219 |
| 358 | 3300044712 | Ga0453684_0025910 | Ga0453684_0025910_5848_6564 | 219 |
| 359 | 3300044712 | Ga0453684_0058021 | Ga0453684_0058021_1035_1745 | 219 |
| 360 | 3300044712 | Ga0453684_0140459 | Ga0453684_0140459_234_947 | 219 |
| 361 | 3300044712 | Ga0453684_0146361 | Ga0453684_0146361_1877_2593 | 219 |
| 362 | 3300044712 | Ga0453684_0280276 | Ga0453684_0280276_609_1319 | 219 |
| 363 | 3300044712 | Ga0453684_0328350 | Ga0453684_0328350_835_1545 | 219 |
| 364 | 3300044712 | Ga0453684_0585335 | Ga0453684_0585335_250_966 | 219 |
| 365 | 3300044712 | Ga0453684_0698513 | Ga0453684_0698513_130_846 | 219 |
| 366 | 3300044712 | Ga0453684_1062071 | Ga0453684_1062071_80_796 | 219 |
| 367 | 3300044765 | Ga0466970_0004459 | Ga0466970_0004459_925_1629 | 219 |
| 368 | 3300044842 | Ga0466957_0108799 | Ga0466957_0108799_425_1129 | 219 |
| 369 | 3300044842 | Ga0466957_0265578 | Ga0466957_0265578_101_814 | 219 |
| 370 | 3300045051 | Ga0451576_0000072 | Ga0451576_0000072_97162_97878 | 219 |
| 371 | 3300045051 | Ga0451576_0000103 | Ga0451576_0000103_37610_38329 | 219 |
| 372 | 3300045051 | Ga0451576_0002639 | Ga0451576_0002639_20556_21272 | 219 |
| 373 | 3300045051 | Ga0451576_0012627 | Ga0451576_0012627_5558_6274 | 219 |
| 374 | 3300045051 | Ga0451576_0029708 | Ga0451576_0029708_108_824 | 219 |
| 375 | 3300045051 | Ga0451576_0071073 | Ga0451576_0071073_1855_2571 | 219 |
| 376 | 3300045051 | Ga0451576_0208997 | Ga0451576_0208997_733_1449 | 219 |
| 377 | 3300046460 | Ga0495638_0000015 | Ga0495638_0000015_79766_80473 | 219 |
| 378 | 3300046460 | Ga0495638_0037364 | Ga0495638_0037364_1854_2546 | 219 |
| 379 | 3300046524 | Ga0495648_0003814 | Ga0495648_0003814_354_1046 | 219 |
| 380 | 3300046648 | Ga0495611_0120853 | Ga0495611_0120853_361_1053 | 219 |
| 381 | 3300047443 | Ga0495687_000006 | Ga0495687_000006_314862_315554 | 219 |
| 382 | 3300049822 | Ga0501035_0326638 | Ga0501035_0326638_38_751 | 219 |
| 383 | 3300053090 | Ga0500646_0052912 | Ga0500646_0052912_424_1116 | 219 |
| 384 | 3300053092 | Ga0500583_0009892 | Ga0500583_0009892_359_1051 | 219 |
| 385 | 3300053130 | Ga0500642_0022291 | Ga0500642_0022291_701_1393 | 219 |
| 386 | 3300053139 | Ga0500568_0013513 | Ga0500568_0013513_2713_3405 | 219 |
| 387 | 3300053151 | Ga0500604_0072938 | Ga0500604_0072938_83_802 | 219 |
| 388 | iso_pu_bacteria | 2599185184 | 2599480907 | 219 |
| 389 | iso_pu_bacteria | 2919186247 | 2919187625 | 219 |
| 390 | iso_pu_bacteria | 2928078545 | 2928080824 | 219 |
| 391 | iso_pu_bacteria | 2928147474 | 2928151045 | 219 |
| 392 | iso_pu_bacteria | 2932082852 | 2932087600 | 219 |
| 393 | iso_pu_bacteria | 2939664404 | 2939665109 | 219 |
| 394 | 3300003320 | rootH2_10024764 | rootH2_1002476410 | 220 |
| 395 | 3300003323 | rootH1_10000976 | rootH1_100009767 | 220 |
| 396 | 3300005330 | Ga0070690_100008412 | Ga0070690_1000084124 | 220 |
| 397 | 3300005333 | Ga0070677_10185258 | Ga0070677_101852582 | 220 |
| 398 | 3300005334 | Ga0068869_100004357 | Ga0068869_1000043575 | 220 |
| 399 | 3300005335 | Ga0070666_10031661 | Ga0070666_100316614 | 220 |
| 400 | 3300005335 | Ga0070666_10037322 | Ga0070666_100373222 | 220 |
| 401 | 3300005355 | Ga0070671_100035739 | Ga0070671_1000357392 | 220 |
| 402 | 3300005364 | Ga0070673_100200682 | Ga0070673_1002006822 | 220 |
| 403 | 3300005367 | Ga0070667_100797971 | Ga0070667_1007979711 | 220 |
| 404 | 3300005457 | Ga0070662_100016718 | Ga0070662_1000167184 | 220 |
| 405 | 3300005458 | Ga0070681_10730906 | Ga0070681_107309061 | 220 |
| 406 | 3300005544 | Ga0070686_100008748 | Ga0070686_1000087482 | 220 |
| 407 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001724 | 220 |
| 408 | 3300005564 | Ga0070664_100586448 | Ga0070664_1005864481 | 220 |
| 409 | 3300005578 | Ga0068854_100086243 | Ga0068854_1000862432 | 220 |
| 410 | 3300005616 | Ga0068852_100029713 | Ga0068852_1000297134 | 220 |
| 411 | 3300005616 | Ga0068852_101028232 | Ga0068852_1010282321 | 220 |
| 412 | 3300005618 | Ga0068864_100156435 | Ga0068864_1001564352 | 220 |
| 413 | 3300005840 | Ga0068870_10062898 | Ga0068870_100628982 | 220 |
| 414 | 3300005843 | Ga0068860_100616658 | Ga0068860_1006166582 | 220 |
| 415 | 3300005985 | Ga0081539_10099800 | Ga0081539_100998002 | 220 |
| 416 | 3300006237 | Ga0097621_100007184 | Ga0097621_1000071842 | 220 |
| 417 | 3300006237 | Ga0097621_100369999 | Ga0097621_1003699991 | 220 |
| 418 | 3300006358 | Ga0068871_100074511 | Ga0068871_1000745113 | 220 |
| 419 | 3300006358 | Ga0068871_100310920 | Ga0068871_1003109201 | 220 |
| 420 | 3300006844 | Ga0075428_100190031 | Ga0075428_1001900312 | 220 |
| 421 | 3300009093 | Ga0105240_10000072 | Ga0105240_1000007237 | 220 |
| 422 | 3300009093 | Ga0105240_10076543 | Ga0105240_100765433 | 220 |
| 423 | 3300009147 | Ga0114129_10002413 | Ga0114129_100024132 | 220 |
| 424 | 3300009174 | Ga0105241_10364129 | Ga0105241_103641292 | 220 |
| 425 | 3300009176 | Ga0105242_10007760 | Ga0105242_100077608 | 220 |
| 426 | 3300009545 | Ga0105237_10002078 | Ga0105237_100020782 | 220 |
| 427 | 3300009545 | Ga0105237_10043859 | Ga0105237_100438594 | 220 |
| 428 | 3300009553 | Ga0105249_10162612 | Ga0105249_101626122 | 220 |
| 429 | 3300010375 | Ga0105239_10003592 | Ga0105239_1000359215 | 220 |
| 430 | 3300013104 | Ga0157370_10004435 | Ga0157370_100044358 | 220 |
| 431 | 3300013296 | Ga0157374_10003994 | Ga0157374_100039947 | 220 |
| 432 | 3300013297 | Ga0157378_10148384 | Ga0157378_101483842 | 220 |
| 433 | 3300013297 | Ga0157378_10425086 | Ga0157378_104250862 | 220 |
| 434 | 3300013306 | Ga0163162_10009325 | Ga0163162_100093252 | 220 |
| 435 | 3300013306 | Ga0163162_10016895 | Ga0163162_100168957 | 220 |
| 436 | 3300013308 | Ga0157375_10008461 | Ga0157375_100084614 | 220 |
| 437 | 3300014325 | Ga0163163_10035414 | Ga0163163_100354145 | 220 |
| 438 | 3300014969 | Ga0157376_10002014 | Ga0157376_100020145 | 220 |
| 439 | 3300025903 | Ga0207680_10089346 | Ga0207680_100893462 | 220 |
| 440 | 3300025903 | Ga0207680_10094534 | Ga0207680_100945342 | 220 |
| 441 | 3300025913 | Ga0207695_10000067 | Ga0207695_1000006778 | 220 |
| 442 | 3300025913 | Ga0207695_10119054 | Ga0207695_101190543 | 220 |
| 443 | 3300025914 | Ga0207671_10011524 | Ga0207671_100115242 | 220 |
| 444 | 3300025914 | Ga0207671_10025795 | Ga0207671_100257952 | 220 |
| 445 | 3300025931 | Ga0207644_10166818 | Ga0207644_101668182 | 220 |
| 446 | 3300025933 | Ga0207706_10016752 | Ga0207706_100167525 | 220 |
| 447 | 3300025942 | Ga0207689_10020450 | Ga0207689_100204502 | 220 |
| 448 | 3300026023 | Ga0207677_10388378 | Ga0207677_103883782 | 220 |
| 449 | 3300026121 | Ga0207683_10012032 | Ga0207683_100120326 | 220 |
| 450 | 3300026142 | Ga0207698_10038499 | Ga0207698_100384992 | 220 |
| 451 | 3300026142 | Ga0207698_10148024 | Ga0207698_101480241 | 220 |
| 452 | 3300028379 | Ga0268266_10000049 | Ga0268266_1000004985 | 220 |
| 453 | 3300028666 | Ga0265336_10028594 | Ga0265336_100285941 | 220 |
| 454 | 3300031616 | Ga0307508_10000969 | Ga0307508_1000096925 | 220 |
| 455 | 3300044712 | Ga0453684_0525383 | Ga0453684_0525383_456_1187 | 220 |
| 456 | 3300044842 | Ga0466957_0063074 | Ga0466957_0063074_408_1130 | 220 |
| 457 | 3300046460 | Ga0495638_0167419 | Ga0495638_0167419_89_817 | 220 |
| 458 | 3300046524 | Ga0495648_0025243 | Ga0495648_0025243_1090_1818 | 220 |
| 459 | 3300046810 | Ga0495660_0034191 | Ga0495660_0034191_1252_1968 | 220 |
| 460 | 3300049581 | Ga0501047_0216992 | Ga0501047_0216992_115_837 | 220 |
| 461 | 3300049682 | Ga0501252_024044 | Ga0501252_024044_28_756 | 220 |
| 462 | 3300049823 | Ga0501044_0036903 | Ga0501044_0036903_3830_4552 | 220 |
| 463 | 3300050509 | nmdc:mga0qj67_333355_c1 | nmdc:mga0qj67_333355_c1_326_1033 | 220 |
| 464 | 3300053092 | Ga0500583_0005514 | Ga0500583_0005514_722_1450 | 220 |
| 465 | 3300053096 | Ga0500641_0013408 | Ga0500641_0013408_1226_1945 | 220 |
| 466 | 3300053125 | Ga0500618_000148 | Ga0500618_000148_45676_46401 | 220 |
| 467 | 3300053130 | Ga0500642_0016675 | Ga0500642_0016675_597_1325 | 220 |
| 468 | 3300053139 | Ga0500568_0042061 | Ga0500568_0042061_121_849 | 220 |
| 469 | 3300053146 | Ga0500588_0000359 | Ga0500588_0000359_2204_2926 | 220 |
| 470 | 3300053156 | Ga0500622_0001463 | Ga0500622_0001463_6193_6921 | 220 |
| 471 | iso_pu_bacteria | 2945924605 | 2945926182 | 220 |
| 472 | iso_pu_bacteria | 2977243572 | 2977245162 | 220 |
| 473 | 3300002459 | JGI24751J29686_10012501 | JGI24751J29686_100125012 | 221 |
| 474 | 3300005288 | Ga0065714_10007502 | Ga0065714_100075023 | 221 |
| 475 | 3300005290 | Ga0065712_10027579 | Ga0065712_100275792 | 221 |
| 476 | 3300005290 | Ga0065712_10069410 | Ga0065712_100694103 | 221 |
| 477 | 3300005290 | Ga0065712_10069552 | Ga0065712_100695524 | 221 |
| 478 | 3300005290 | Ga0065712_10236413 | Ga0065712_102364132 | 221 |
| 479 | 3300005293 | Ga0065715_10116182 | Ga0065715_101161823 | 221 |
| 480 | 3300005295 | Ga0065707_10126201 | Ga0065707_101262012 | 221 |
| 481 | 3300005329 | Ga0070683_100005303 | Ga0070683_1000053037 | 221 |
| 482 | 3300005329 | Ga0070683_100010600 | Ga0070683_1000106004 | 221 |
| 483 | 3300005331 | Ga0070670_100005179 | Ga0070670_1000051795 | 221 |
| 484 | 3300005331 | Ga0070670_100010624 | Ga0070670_1000106245 | 221 |
| 485 | 3300005331 | Ga0070670_100021066 | Ga0070670_1000210664 | 221 |
| 486 | 3300005331 | Ga0070670_100027115 | Ga0070670_1000271154 | 221 |
| 487 | 3300005331 | Ga0070670_100101770 | Ga0070670_1001017702 | 221 |
| 488 | 3300005333 | Ga0070677_10076581 | Ga0070677_100765811 | 221 |
| 489 | 3300005334 | Ga0068869_100059516 | Ga0068869_1000595162 | 221 |
| 490 | 3300005334 | Ga0068869_100299674 | Ga0068869_1002996742 | 221 |
| 491 | 3300005334 | Ga0068869_100406633 | Ga0068869_1004066332 | 221 |
| 492 | 3300005336 | Ga0070680_100333483 | Ga0070680_1003334831 | 221 |
| 493 | 3300005339 | Ga0070660_100000519 | Ga0070660_10000051918 | 221 |
| 494 | 3300005340 | Ga0070689_100022207 | Ga0070689_1000222074 | 221 |
| 495 | 3300005340 | Ga0070689_100033280 | Ga0070689_1000332802 | 221 |
| 496 | 3300005340 | Ga0070689_100141592 | Ga0070689_1001415922 | 221 |
| 497 | 3300005340 | Ga0070689_100280994 | Ga0070689_1002809941 | 221 |
| 498 | 3300005340 | Ga0070689_100316251 | Ga0070689_1003162511 | 221 |
| 499 | 3300005340 | Ga0070689_100660105 | Ga0070689_1006601051 | 221 |
| 500 | 3300005343 | Ga0070687_100025075 | Ga0070687_1000250753 | 221 |
| 501 | 3300005343 | Ga0070687_100168757 | Ga0070687_1001687572 | 221 |
| 502 | 3300005344 | Ga0070661_100037377 | Ga0070661_1000373772 | 221 |
| 503 | 3300005344 | Ga0070661_100076665 | Ga0070661_1000766652 | 221 |
| 504 | 3300005345 | Ga0070692_10076047 | Ga0070692_100760472 | 221 |
| 505 | 3300005347 | Ga0070668_100128182 | Ga0070668_1001281822 | 221 |
| 506 | 3300005347 | Ga0070668_100210811 | Ga0070668_1002108112 | 221 |
| 507 | 3300005353 | Ga0070669_100296295 | Ga0070669_1002962952 | 221 |
| 508 | 3300005354 | Ga0070675_100180486 | Ga0070675_1001804862 | 221 |
| 509 | 3300005354 | Ga0070675_100183207 | Ga0070675_1001832072 | 221 |
| 510 | 3300005354 | Ga0070675_100375560 | Ga0070675_1003755602 | 221 |
| 511 | 3300005355 | Ga0070671_100062198 | Ga0070671_1000621983 | 221 |
| 512 | 3300005355 | Ga0070671_100359829 | Ga0070671_1003598291 | 221 |
| 513 | 3300005356 | Ga0070674_100073427 | Ga0070674_1000734273 | 221 |
| 514 | 3300005364 | Ga0070673_100015208 | Ga0070673_1000152084 | 221 |
| 515 | 3300005364 | Ga0070673_100215003 | Ga0070673_1002150032 | 221 |
| 516 | 3300005364 | Ga0070673_100231825 | Ga0070673_1002318252 | 221 |
| 517 | 3300005365 | Ga0070688_100012275 | Ga0070688_1000122753 | 221 |
| 518 | 3300005367 | Ga0070667_100056492 | Ga0070667_1000564923 | 221 |
| 519 | 3300005367 | Ga0070667_100235187 | Ga0070667_1002351872 | 221 |
| 520 | 3300005441 | Ga0070700_100077071 | Ga0070700_1000770711 | 221 |
| 521 | 3300005441 | Ga0070700_100230312 | Ga0070700_1002303121 | 221 |
| 522 | 3300005458 | Ga0070681_10118004 | Ga0070681_101180041 | 221 |
| 523 | 3300005458 | Ga0070681_10348521 | Ga0070681_103485211 | 221 |
| 524 | 3300005459 | Ga0068867_100122941 | Ga0068867_1001229412 | 221 |
| 525 | 3300005459 | Ga0068867_100140091 | Ga0068867_1001400912 | 221 |
| 526 | 3300005466 | Ga0070685_10263973 | Ga0070685_102639732 | 221 |
| 527 | 3300005471 | Ga0070698_100008374 | Ga0070698_10000837410 | 221 |
| 528 | 3300005518 | Ga0070699_100131640 | Ga0070699_1001316402 | 221 |
| 529 | 3300005530 | Ga0070679_100064943 | Ga0070679_1000649432 | 221 |
| 530 | 3300005530 | Ga0070679_100084235 | Ga0070679_1000842352 | 221 |
| 531 | 3300005535 | Ga0070684_100022390 | Ga0070684_1000223903 | 221 |
| 532 | 3300005535 | Ga0070684_100024874 | Ga0070684_1000248743 | 221 |
| 533 | 3300005536 | Ga0070697_100477518 | Ga0070697_1004775182 | 221 |
| 534 | 3300005539 | Ga0068853_100218350 | Ga0068853_1002183502 | 221 |
| 535 | 3300005543 | Ga0070672_100328596 | Ga0070672_1003285962 | 221 |
| 536 | 3300005543 | Ga0070672_100366204 | Ga0070672_1003662041 | 221 |
| 537 | 3300005544 | Ga0070686_100029580 | Ga0070686_1000295803 | 221 |
| 538 | 3300005563 | Ga0068855_100071060 | Ga0068855_1000710602 | 221 |
| 539 | 3300005563 | Ga0068855_100071573 | Ga0068855_1000715732 | 221 |
| 540 | 3300005563 | Ga0068855_100171360 | Ga0068855_1001713602 | 221 |
| 541 | 3300005564 | Ga0070664_100004539 | Ga0070664_10000453911 | 221 |
| 542 | 3300005577 | Ga0068857_100254525 | Ga0068857_1002545252 | 221 |
| 543 | 3300005577 | Ga0068857_100377317 | Ga0068857_1003773172 | 221 |
| 544 | 3300005615 | Ga0070702_100541167 | Ga0070702_1005411671 | 221 |
| 545 | 3300005616 | Ga0068852_100041480 | Ga0068852_1000414801 | 221 |
| 546 | 3300005616 | Ga0068852_100150676 | Ga0068852_1001506762 | 221 |
| 547 | 3300005616 | Ga0068852_100594771 | Ga0068852_1005947712 | 221 |
| 548 | 3300005617 | Ga0068859_100017085 | Ga0068859_1000170852 | 221 |
| 549 | 3300005617 | Ga0068859_100030941 | Ga0068859_1000309416 | 221 |
| 550 | 3300005617 | Ga0068859_100087099 | Ga0068859_1000870992 | 221 |
| 551 | 3300005617 | Ga0068859_100163375 | Ga0068859_1001633752 | 221 |
| 552 | 3300005617 | Ga0068859_100417252 | Ga0068859_1004172522 | 221 |
| 553 | 3300005617 | Ga0068859_100561765 | Ga0068859_1005617651 | 221 |
| 554 | 3300005617 | Ga0068859_100833121 | Ga0068859_1008331211 | 221 |
| 555 | 3300005618 | Ga0068864_100076708 | Ga0068864_1000767082 | 221 |
| 556 | 3300005618 | Ga0068864_100270505 | Ga0068864_1002705052 | 221 |
| 557 | 3300005719 | Ga0068861_100014998 | Ga0068861_1000149986 | 221 |
| 558 | 3300005719 | Ga0068861_100368564 | Ga0068861_1003685642 | 221 |
| 559 | 3300005719 | Ga0068861_100453628 | Ga0068861_1004536281 | 221 |
| 560 | 3300005834 | Ga0068851_10212408 | Ga0068851_102124081 | 221 |
| 561 | 3300005841 | Ga0068863_100001267 | Ga0068863_10000126711 | 221 |
| 562 | 3300005841 | Ga0068863_100005658 | Ga0068863_10000565811 | 221 |
| 563 | 3300005841 | Ga0068863_100225021 | Ga0068863_1002250212 | 221 |
| 564 | 3300005841 | Ga0068863_100407345 | Ga0068863_1004073452 | 221 |
| 565 | 3300005842 | Ga0068858_100244438 | Ga0068858_1002444382 | 221 |
| 566 | 3300005843 | Ga0068860_100002275 | Ga0068860_10000227511 | 221 |
| 567 | 3300005843 | Ga0068860_100067089 | Ga0068860_1000670893 | 221 |
| 568 | 3300005843 | Ga0068860_100241604 | Ga0068860_1002416042 | 221 |
| 569 | 3300005844 | Ga0068862_100005444 | Ga0068862_1000054448 | 221 |
| 570 | 3300005844 | Ga0068862_100390073 | Ga0068862_1003900731 | 221 |
| 571 | 3300006163 | Ga0070715_10006279 | Ga0070715_100062793 | 221 |
| 572 | 3300006195 | Ga0075366_10327363 | Ga0075366_103273632 | 221 |
| 573 | 3300006237 | Ga0097621_100004872 | Ga0097621_1000048722 | 221 |
| 574 | 3300006237 | Ga0097621_100075262 | Ga0097621_1000752622 | 221 |
| 575 | 3300006237 | Ga0097621_100165697 | Ga0097621_1001656972 | 221 |
| 576 | 3300006237 | Ga0097621_100745031 | Ga0097621_1007450311 | 221 |
| 577 | 3300006358 | Ga0068871_100049163 | Ga0068871_1000491633 | 221 |
| 578 | 3300006844 | Ga0075428_100019483 | Ga0075428_1000194832 | 221 |
| 579 | 3300006844 | Ga0075428_100042483 | Ga0075428_1000424834 | 221 |
| 580 | 3300006844 | Ga0075428_100107372 | Ga0075428_1001073722 | 221 |
| 581 | 3300006844 | Ga0075428_100778056 | Ga0075428_1007780561 | 221 |
| 582 | 3300006847 | Ga0075431_100317440 | Ga0075431_1003174402 | 221 |
| 583 | 3300006871 | Ga0075434_100312680 | Ga0075434_1003126802 | 221 |
| 584 | 3300006880 | Ga0075429_100002169 | Ga0075429_1000021699 | 221 |
| 585 | 3300006880 | Ga0075429_100004571 | Ga0075429_10000457110 | 221 |
| 586 | 3300006880 | Ga0075429_100007858 | Ga0075429_1000078584 | 221 |
| 587 | 3300006880 | Ga0075429_100141752 | Ga0075429_1001417522 | 221 |
| 588 | 3300006880 | Ga0075429_100276982 | Ga0075429_1002769821 | 221 |
| 589 | 3300006881 | Ga0068865_100566514 | Ga0068865_1005665142 | 221 |
| 590 | 3300006931 | Ga0097620_100017084 | Ga0097620_1000170842 | 221 |
| 591 | 3300006931 | Ga0097620_100030940 | Ga0097620_1000309402 | 221 |
| 592 | 3300006931 | Ga0097620_100087106 | Ga0097620_1000871063 | 221 |
| 593 | 3300006931 | Ga0097620_100163374 | Ga0097620_1001633742 | 221 |
| 594 | 3300006931 | Ga0097620_100417262 | Ga0097620_1004172622 | 221 |
| 595 | 3300006931 | Ga0097620_100561753 | Ga0097620_1005617531 | 221 |
| 596 | 3300006931 | Ga0097620_100833177 | Ga0097620_1008331771 | 221 |
| 597 | 3300009093 | Ga0105240_10027343 | Ga0105240_100273434 | 221 |
| 598 | 3300009093 | Ga0105240_10136825 | Ga0105240_101368253 | 221 |
| 599 | 3300009094 | Ga0111539_10058706 | Ga0111539_100587062 | 221 |
| 600 | 3300009094 | Ga0111539_10266393 | Ga0111539_102663932 | 221 |
| 601 | 3300009094 | Ga0111539_10287143 | Ga0111539_102871432 | 221 |
| 602 | 3300009094 | Ga0111539_10474745 | Ga0111539_104747452 | 221 |
| 603 | 3300009094 | Ga0111539_10497107 | Ga0111539_104971072 | 221 |
| 604 | 3300009094 | Ga0111539_10759943 | Ga0111539_107599432 | 221 |
| 605 | 3300009094 | Ga0111539_11014893 | Ga0111539_110148931 | 221 |
| 606 | 3300009147 | Ga0114129_10262423 | Ga0114129_102624233 | 221 |
| 607 | 3300009176 | Ga0105242_10038005 | Ga0105242_100380053 | 221 |
| 608 | 3300009176 | Ga0105242_10056701 | Ga0105242_100567012 | 221 |
| 609 | 3300009177 | Ga0105248_10071249 | Ga0105248_100712493 | 221 |
| 610 | 3300009177 | Ga0105248_10416786 | Ga0105248_104167862 | 221 |
| 611 | 3300009545 | Ga0105237_10032433 | Ga0105237_100324332 | 221 |
| 612 | 3300009545 | Ga0105237_10231604 | Ga0105237_102316042 | 221 |
| 613 | 3300009553 | Ga0105249_10012432 | Ga0105249_100124326 | 221 |
| 614 | 3300009553 | Ga0105249_10037077 | Ga0105249_100370772 | 221 |
| 615 | 3300009553 | Ga0105249_10128076 | Ga0105249_101280762 | 221 |
| 616 | 3300009553 | Ga0105249_10211671 | Ga0105249_102116712 | 221 |
| 617 | 3300009553 | Ga0105249_10469646 | Ga0105249_104696462 | 221 |
| 618 | 3300009553 | Ga0105249_10821094 | Ga0105249_108210941 | 221 |
| 619 | 3300009553 | Ga0105249_11002978 | Ga0105249_110029781 | 221 |
| 620 | 3300009553 | Ga0105249_11012651 | Ga0105249_110126511 | 221 |
| 621 | 3300010375 | Ga0105239_10013420 | Ga0105239_100134206 | 221 |
| 622 | 3300010375 | Ga0105239_10453908 | Ga0105239_104539082 | 221 |
| 623 | 3300010375 | Ga0105239_10590492 | Ga0105239_105904922 | 221 |
| 624 | 3300011119 | Ga0105246_10003431 | Ga0105246_100034315 | 221 |
| 625 | 3300013100 | Ga0157373_10006670 | Ga0157373_100066706 | 221 |
| 626 | 3300013102 | Ga0157371_10467637 | Ga0157371_104676371 | 221 |
| 627 | 3300013104 | Ga0157370_10001568 | Ga0157370_1000156812 | 221 |
| 628 | 3300013104 | Ga0157370_10011412 | Ga0157370_100114123 | 221 |
| 629 | 3300013104 | Ga0157370_10162775 | Ga0157370_101627752 | 221 |
| 630 | 3300013104 | Ga0157370_10168523 | Ga0157370_101685232 | 221 |
| 631 | 3300013104 | Ga0157370_10324294 | Ga0157370_103242942 | 221 |
| 632 | 3300013296 | Ga0157374_10000007 | Ga0157374_10000007286 | 221 |
| 633 | 3300013296 | Ga0157374_10077624 | Ga0157374_100776242 | 221 |
| 634 | 3300013296 | Ga0157374_10155651 | Ga0157374_101556513 | 221 |
| 635 | 3300013297 | Ga0157378_10028280 | Ga0157378_100282802 | 221 |
| 636 | 3300013297 | Ga0157378_10323871 | Ga0157378_103238712 | 221 |
| 637 | 3300013306 | Ga0163162_10054666 | Ga0163162_100546662 | 221 |
| 638 | 3300013306 | Ga0163162_10090243 | Ga0163162_100902432 | 221 |
| 639 | 3300013306 | Ga0163162_10092864 | Ga0163162_100928641 | 221 |
| 640 | 3300013306 | Ga0163162_10635222 | Ga0163162_106352222 | 221 |
| 641 | 3300013307 | Ga0157372_10465685 | Ga0157372_104656851 | 221 |
| 642 | 3300013308 | Ga0157375_10019607 | Ga0157375_100196075 | 221 |
| 643 | 3300013308 | Ga0157375_10034920 | Ga0157375_100349205 | 221 |
| 644 | 3300013308 | Ga0157375_10082855 | Ga0157375_100828552 | 221 |
| 645 | 3300013308 | Ga0157375_10090980 | Ga0157375_100909802 | 221 |
| 646 | 3300013308 | Ga0157375_10481662 | Ga0157375_104816622 | 221 |
| 647 | 3300013308 | Ga0157375_10615358 | Ga0157375_106153582 | 221 |
| 648 | 3300013308 | Ga0157375_10991351 | Ga0157375_109913512 | 221 |
| 649 | 3300014325 | Ga0163163_10032538 | Ga0163163_100325384 | 221 |
| 650 | 3300014325 | Ga0163163_10382263 | Ga0163163_103822631 | 221 |
| 651 | 3300014326 | Ga0157380_10021105 | Ga0157380_100211055 | 221 |
| 652 | 3300014326 | Ga0157380_10063986 | Ga0157380_100639862 | 221 |
| 653 | 3300014326 | Ga0157380_10123349 | Ga0157380_101233492 | 221 |
| 654 | 3300014326 | Ga0157380_10143094 | Ga0157380_101430942 | 221 |
| 655 | 3300014326 | Ga0157380_10256015 | Ga0157380_102560152 | 221 |
| 656 | 3300014326 | Ga0157380_10455386 | Ga0157380_104553862 | 221 |
| 657 | 3300014326 | Ga0157380_10800115 | Ga0157380_108001151 | 221 |
| 658 | 3300014745 | Ga0157377_10008940 | Ga0157377_100089402 | 221 |
| 659 | 3300014745 | Ga0157377_10023994 | Ga0157377_100239942 | 221 |
| 660 | 3300014968 | Ga0157379_10123016 | Ga0157379_101230162 | 221 |
| 661 | 3300014968 | Ga0157379_10135382 | Ga0157379_101353822 | 221 |
| 662 | 3300014968 | Ga0157379_10342781 | Ga0157379_103427812 | 221 |
| 663 | 3300014969 | Ga0157376_10023367 | Ga0157376_100233673 | 221 |
| 664 | 3300014969 | Ga0157376_10491456 | Ga0157376_104914562 | 221 |
| 665 | 3300017792 | Ga0163161_10002240 | Ga0163161_1000224011 | 221 |
| 666 | 3300017792 | Ga0163161_10003268 | Ga0163161_100032686 | 221 |
| 667 | 3300017792 | Ga0163161_10056319 | Ga0163161_100563193 | 221 |
| 668 | 3300017792 | Ga0163161_10185167 | Ga0163161_101851672 | 221 |
| 669 | 3300017792 | Ga0163161_10215605 | Ga0163161_102156051 | 221 |
| 670 | 3300017792 | Ga0163161_10309295 | Ga0163161_103092951 | 221 |
| 671 | 3300025271 | Ga0207666_1005654 | Ga0207666_10056542 | 221 |
| 672 | 3300025271 | Ga0207666_1016817 | Ga0207666_10168171 | 221 |
| 673 | 3300025893 | Ga0207682_10048820 | Ga0207682_100488202 | 221 |
| 674 | 3300025900 | Ga0207710_10001409 | Ga0207710_100014095 | 221 |
| 675 | 3300025908 | Ga0207643_10042769 | Ga0207643_100427692 | 221 |
| 676 | 3300025908 | Ga0207643_10045817 | Ga0207643_100458172 | 221 |
| 677 | 3300025909 | Ga0207705_10045650 | Ga0207705_100456503 | 221 |
| 678 | 3300025913 | Ga0207695_10092622 | Ga0207695_100926222 | 221 |
| 679 | 3300025914 | Ga0207671_10187785 | Ga0207671_101877852 | 221 |
| 680 | 3300025917 | Ga0207660_10112529 | Ga0207660_101125292 | 221 |
| 681 | 3300025918 | Ga0207662_10022459 | Ga0207662_100224592 | 221 |
| 682 | 3300025918 | Ga0207662_10071706 | Ga0207662_100717062 | 221 |
| 683 | 3300025918 | Ga0207662_10131734 | Ga0207662_101317342 | 221 |
| 684 | 3300025919 | Ga0207657_10002923 | Ga0207657_1000292319 | 221 |
| 685 | 3300025920 | Ga0207649_10024388 | Ga0207649_100243882 | 221 |
| 686 | 3300025921 | Ga0207652_10019917 | Ga0207652_100199174 | 221 |
| 687 | 3300025923 | Ga0207681_10073547 | Ga0207681_100735472 | 221 |
| 688 | 3300025923 | Ga0207681_10089067 | Ga0207681_100890673 | 221 |
| 689 | 3300025925 | Ga0207650_10000926 | Ga0207650_1000092616 | 221 |
| 690 | 3300025925 | Ga0207650_10003183 | Ga0207650_100031834 | 221 |
| 691 | 3300025925 | Ga0207650_10007080 | Ga0207650_100070803 | 221 |
| 692 | 3300025925 | Ga0207650_10205380 | Ga0207650_102053803 | 221 |
| 693 | 3300025925 | Ga0207650_10210857 | Ga0207650_102108572 | 221 |
| 694 | 3300025926 | Ga0207659_10151219 | Ga0207659_101512193 | 221 |
| 695 | 3300025926 | Ga0207659_10171952 | Ga0207659_101719522 | 221 |
| 696 | 3300025926 | Ga0207659_10198729 | Ga0207659_101987292 | 221 |
| 697 | 3300025931 | Ga0207644_10177590 | Ga0207644_101775902 | 221 |
| 698 | 3300025934 | Ga0207686_10000351 | Ga0207686_1000035113 | 221 |
| 699 | 3300025934 | Ga0207686_10047597 | Ga0207686_100475972 | 221 |
| 700 | 3300025936 | Ga0207670_10037057 | Ga0207670_100370572 | 221 |
| 701 | 3300025936 | Ga0207670_10099674 | Ga0207670_100996742 | 221 |
| 702 | 3300025936 | Ga0207670_10129313 | Ga0207670_101293131 | 221 |
| 703 | 3300025936 | Ga0207670_10182545 | Ga0207670_101825451 | 221 |
| 704 | 3300025936 | Ga0207670_10220248 | Ga0207670_102202481 | 221 |
| 705 | 3300025936 | Ga0207670_10254124 | Ga0207670_102541242 | 221 |
| 706 | 3300025937 | Ga0207669_10071014 | Ga0207669_100710141 | 221 |
| 707 | 3300025940 | Ga0207691_10021838 | Ga0207691_100218382 | 221 |
| 708 | 3300025940 | Ga0207691_10026518 | Ga0207691_100265185 | 221 |
| 709 | 3300025940 | Ga0207691_10212977 | Ga0207691_102129772 | 221 |
| 710 | 3300025940 | Ga0207691_10348895 | Ga0207691_103488952 | 221 |
| 711 | 3300025940 | Ga0207691_10363671 | Ga0207691_103636712 | 221 |
| 712 | 3300025942 | Ga0207689_10016155 | Ga0207689_100161554 | 221 |
| 713 | 3300025942 | Ga0207689_10032891 | Ga0207689_100328913 | 221 |
| 714 | 3300025942 | Ga0207689_10078416 | Ga0207689_100784161 | 221 |
| 715 | 3300025942 | Ga0207689_10200678 | Ga0207689_102006782 | 221 |
| 716 | 3300025944 | Ga0207661_10019688 | Ga0207661_100196883 | 221 |
| 717 | 3300025944 | Ga0207661_10057726 | Ga0207661_100577262 | 221 |
| 718 | 3300025945 | Ga0207679_10042698 | Ga0207679_100426983 | 221 |
| 719 | 3300025945 | Ga0207679_10222463 | Ga0207679_102224632 | 221 |
| 720 | 3300025949 | Ga0207667_10057093 | Ga0207667_100570932 | 221 |
| 721 | 3300025949 | Ga0207667_10098902 | Ga0207667_100989022 | 221 |
| 722 | 3300025949 | Ga0207667_10277793 | Ga0207667_102777932 | 221 |
| 723 | 3300025960 | Ga0207651_10074605 | Ga0207651_100746052 | 221 |
| 724 | 3300025960 | Ga0207651_10119412 | Ga0207651_101194121 | 221 |
| 725 | 3300025961 | Ga0207712_10002030 | Ga0207712_100020306 | 221 |
| 726 | 3300025961 | Ga0207712_10008088 | Ga0207712_100080882 | 221 |
| 727 | 3300025961 | Ga0207712_10072899 | Ga0207712_100728992 | 221 |
| 728 | 3300025961 | Ga0207712_10090966 | Ga0207712_100909663 | 221 |
| 729 | 3300025961 | Ga0207712_10168440 | Ga0207712_101684402 | 221 |
| 730 | 3300025961 | Ga0207712_10443845 | Ga0207712_104438452 | 221 |
| 731 | 3300025972 | Ga0207668_10105333 | Ga0207668_101053332 | 221 |
| 732 | 3300025981 | Ga0207640_10384150 | Ga0207640_103841502 | 221 |
| 733 | 3300025986 | Ga0207658_10024814 | Ga0207658_100248143 | 221 |
| 734 | 3300025986 | Ga0207658_10145173 | Ga0207658_101451732 | 221 |
| 735 | 3300025986 | Ga0207658_10200657 | Ga0207658_102006572 | 221 |
| 736 | 3300025986 | Ga0207658_10282990 | Ga0207658_102829901 | 221 |
| 737 | 3300026035 | Ga0207703_10019810 | Ga0207703_100198103 | 221 |
| 738 | 3300026035 | Ga0207703_10383490 | Ga0207703_103834901 | 221 |
| 739 | 3300026041 | Ga0207639_10238454 | Ga0207639_102384542 | 221 |
| 740 | 3300026041 | Ga0207639_10266326 | Ga0207639_102663262 | 221 |
| 741 | 3300026041 | Ga0207639_10511791 | Ga0207639_105117912 | 221 |
| 742 | 3300026075 | Ga0207708_10007230 | Ga0207708_100072305 | 221 |
| 743 | 3300026075 | Ga0207708_10103243 | Ga0207708_101032432 | 221 |
| 744 | 3300026075 | Ga0207708_10195412 | Ga0207708_101954123 | 221 |
| 745 | 3300026088 | Ga0207641_10000191 | Ga0207641_1000019146 | 221 |
| 746 | 3300026088 | Ga0207641_10000377 | Ga0207641_1000037726 | 221 |
| 747 | 3300026088 | Ga0207641_10106293 | Ga0207641_101062931 | 221 |
| 748 | 3300026088 | Ga0207641_10175113 | Ga0207641_101751132 | 221 |
| 749 | 3300026088 | Ga0207641_10207456 | Ga0207641_102074561 | 221 |
| 750 | 3300026088 | Ga0207641_10553306 | Ga0207641_105533062 | 221 |
| 751 | 3300026088 | Ga0207641_10795338 | Ga0207641_107953381 | 221 |
| 752 | 3300026089 | Ga0207648_10026591 | Ga0207648_100265913 | 221 |
| 753 | 3300026089 | Ga0207648_10229172 | Ga0207648_102291722 | 221 |
| 754 | 3300026095 | Ga0207676_10063799 | Ga0207676_100637992 | 221 |
| 755 | 3300026095 | Ga0207676_10260949 | Ga0207676_102609492 | 221 |
| 756 | 3300026095 | Ga0207676_10673083 | Ga0207676_106730832 | 221 |
| 757 | 3300026116 | Ga0207674_10453707 | Ga0207674_104537071 | 221 |
| 758 | 3300026118 | Ga0207675_100010785 | Ga0207675_1000107852 | 221 |
| 759 | 3300026118 | Ga0207675_100012127 | Ga0207675_1000121274 | 221 |
| 760 | 3300026121 | Ga0207683_10511944 | Ga0207683_105119442 | 221 |
| 761 | 3300026142 | Ga0207698_10100407 | Ga0207698_101004072 | 221 |
| 762 | 3300026142 | Ga0207698_10156004 | Ga0207698_101560042 | 221 |
| 763 | 3300026142 | Ga0207698_10293362 | Ga0207698_102933622 | 221 |
| 764 | 3300027471 | Ga0209995_1001603 | Ga0209995_10016033 | 221 |
| 765 | 3300027907 | Ga0207428_10496084 | Ga0207428_104960841 | 221 |
| 766 | 3300028380 | Ga0268265_10012408 | Ga0268265_100124083 | 221 |
| 767 | 3300028380 | Ga0268265_10219797 | Ga0268265_102197972 | 221 |
| 768 | 3300028380 | Ga0268265_10460478 | Ga0268265_104604782 | 221 |
| 769 | 3300028381 | Ga0268264_10205192 | Ga0268264_102051922 | 221 |
| 770 | 3300028381 | Ga0268264_10319615 | Ga0268264_103196152 | 221 |
| 771 | 3300028381 | Ga0268264_10652979 | Ga0268264_106529792 | 221 |
| 772 | 3300028794 | Ga0307515_10000251 | Ga0307515_1000025155 | 221 |
| 773 | 3300031251 | Ga0265327_10092761 | Ga0265327_100927612 | 221 |
| 774 | 3300031507 | Ga0307509_10025664 | Ga0307509_100256646 | 221 |
| 775 | 3300032004 | Ga0307414_10103564 | Ga0307414_101035642 | 221 |
| 776 | 3300035692 | Ga0373935_0226057 | Ga0373935_0226057_97_840 | 221 |
| 777 | 3300036401 | Ga0373937_0110657 | Ga0373937_0110657_1391_2161 | 221 |
| 778 | 3300036401 | Ga0373937_0504689 | Ga0373937_0504689_345_1109 | 221 |
| 779 | 3300037312 | Ga0395899_0173061 | Ga0395899_0173061_47_850 | 221 |
| 780 | 3300037471 | Ga0395905_0041473 | Ga0395905_0041473_3176_3895 | 221 |
| 781 | 3300041511 | Ga0451855_1823717 | Ga0451855_1823717_474_1193 | 221 |
| 782 | 3300042001 | Ga0439441_008694 | Ga0439441_008694_452_1237 | 221 |
| 783 | 3300042007 | Ga0439449_0028648 | Ga0439449_0028648_150_875 | 221 |
| 784 | 3300042461 | Ga0439460_0060285 | Ga0439460_0060285_209_994 | 221 |
| 785 | 3300042876 | Ga0451577_0368554 | Ga0451577_0368554_42_779 | 221 |
| 786 | 3300042876 | Ga0451577_0457930 | Ga0451577_0457930_155_886 | 221 |
| 787 | 3300044658 | Ga0466972_0002328 | Ga0466972_0002328_8032_8736 | 221 |
| 788 | 3300044673 | Ga0453683_0022796 | Ga0453683_0022796_2934_3665 | 221 |
| 789 | 3300044712 | Ga0453684_0030168 | Ga0453684_0030168_4121_4852 | 221 |
| 790 | 3300044712 | Ga0453684_0333713 | Ga0453684_0333713_584_1306 | 221 |
| 791 | 3300045051 | Ga0451576_0115965 | Ga0451576_0115965_1024_1761 | 221 |
| 792 | 3300046459 | Ga0495629_0098988 | Ga0495629_0098988_824_1555 | 221 |
| 793 | 3300046472 | Ga0495580_0132391 | Ga0495580_0132391_837_1607 | 221 |
| 794 | 3300046492 | Ga0495585_0004232 | Ga0495585_0004232_7269_8000 | 221 |
| 795 | 3300046499 | Ga0495594_0123316 | Ga0495594_0123316_95_835 | 221 |
| 796 | 3300046507 | Ga0495606_0003289 | Ga0495606_0003289_4785_5516 | 221 |
| 797 | 3300046513 | Ga0495616_0006946 | Ga0495616_0006946_4409_5146 | 221 |
| 798 | 3300046513 | Ga0495616_0152375 | Ga0495616_0152375_197_928 | 221 |
| 799 | 3300046518 | Ga0495631_0062010 | Ga0495631_0062010_771_1502 | 221 |
| 800 | 3300046524 | Ga0495648_0009384 | Ga0495648_0009384_4989_5720 | 221 |
| 801 | 3300046537 | Ga0495598_0016928 | Ga0495598_0016928_94_876 | 221 |
| 802 | 3300046538 | Ga0495609_0003828 | Ga0495609_0003828_5679_6410 | 221 |
| 803 | 3300046539 | Ga0495621_0013481 | Ga0495621_0013481_655_1443 | 221 |
| 804 | 3300046616 | Ga0495668_0000009 | Ga0495668_0000009_132095_132826 | 221 |
| 805 | 3300046660 | Ga0495625_0000144 | Ga0495625_0000144_87807_88544 | 221 |
| 806 | 3300046660 | Ga0495625_0001749 | Ga0495625_0001749_4668_5399 | 221 |
| 807 | 3300046660 | Ga0495625_0155301 | Ga0495625_0155301_75_806 | 221 |
| 808 | 3300046665 | Ga0495661_0000114 | Ga0495661_0000114_77093_77821 | 221 |
| 809 | 3300046683 | Ga0495658_0068490 | Ga0495658_0068490_1202_1972 | 221 |
| 810 | 3300046683 | Ga0495658_0101063 | Ga0495658_0101063_293_1024 | 221 |
| 811 | 3300046691 | Ga0495670_0152549 | Ga0495670_0152549_311_1039 | 221 |
| 812 | 3300046694 | Ga0495649_0000112 | Ga0495649_0000112_50232_50969 | 221 |
| 813 | 3300046809 | Ga0495600_0044433 | Ga0495600_0044433_1904_2635 | 221 |
| 814 | 3300046810 | Ga0495660_0017439 | Ga0495660_0017439_2533_3267 | 221 |
| 815 | 3300047471 | Ga0495684_0261104 | Ga0495684_0261104_187_957 | 221 |
| 816 | 3300047472 | Ga0495686_0051377 | Ga0495686_0051377_455_1189 | 221 |
| 817 | 3300048089 | Ga0495614_0048477 | Ga0495614_0048477_788_1519 | 221 |
| 818 | 3300049460 | Ga0495682_0014555 | Ga0495682_0014555_1320_2051 | 221 |
| 819 | 3300049686 | Ga0501257_019077 | Ga0501257_019077_583_1311 | 221 |
| 820 | 3300049688 | Ga0501259_042052 | Ga0501259_042052_134_874 | 221 |
| 821 | 3300050508 | nmdc:mga09592_110384_c1 | nmdc:mga09592_110384_c1_1466_2257 | 221 |
| 822 | 3300050508 | nmdc:mga09592_32604_c1 | nmdc:mga09592_32604_c1_745_1485 | 221 |
| 823 | 3300050508 | nmdc:mga09592_6481_c1 | nmdc:mga09592_6481_c1_1277_2086 | 221 |
| 824 | 3300050508 | nmdc:mga09592_68914_c1 | nmdc:mga09592_68914_c1_1999_2739 | 221 |
| 825 | 3300050510 | nmdc:mga06r32_560092_c1 | nmdc:mga06r32_560092_c1_93_803 | 221 |
| 826 | 3300050511 | nmdc:mga08y16_280328_c1 | nmdc:mga08y16_280328_c1_106_897 | 221 |
| 827 | 3300050511 | nmdc:mga08y16_304676_c1 | nmdc:mga08y16_304676_c1_143_919 | 221 |
| 828 | 3300050511 | nmdc:mga08y16_499714_c1 | nmdc:mga08y16_499714_c1_305_1087 | 221 |
| 829 | 3300050511 | nmdc:mga08y16_581473_c1 | nmdc:mga08y16_581473_c1_306_1016 | 221 |
| 830 | 3300050511 | nmdc:mga08y16_99108_c1 | nmdc:mga08y16_99108_c1_1669_2469 | 221 |
| 831 | 3300050511 | nmdc:mga08y16_991352_c1 | nmdc:mga08y16_991352_c1_19_798 | 221 |
| 832 | 3300050512 | nmdc:mga0n895_323834_c1 | nmdc:mga0n895_323834_c1_351_1160 | 221 |
| 833 | 3300053085 | Ga0495619_0160716 | Ga0495619_0160716_502_1272 | 221 |
| 834 | 3300053122 | Ga0500608_010579 | Ga0500608_010579_1033_1761 | 221 |
| 835 | 3300053156 | Ga0500622_0000786 | Ga0500622_0000786_17606_18337 | 221 |
| 836 | iso_pu_bacteria | 2739367663 | 2739648244 | 221 |
| 837 | iso_pu_bacteria | 2929154850 | 2929158377 | 221 |
| 838 | 3300001989 | JGI24739J22299_10041297 | JGI24739J22299_100412972 | 222 |
| 839 | 3300001989 | JGI24739J22299_10048706 | JGI24739J22299_100487062 | 222 |
| 840 | 3300002067 | JGI24735J21928_10000004 | JGI24735J21928_10000004315 | 222 |
| 841 | 3300002739 | JGI25158J39367_1008471 | JGI25158J39367_10084712 | 222 |
| 842 | 3300003316 | rootH1_10089594 | rootH1_100895942 | 222 |
| 843 | 3300003320 | rootH2_10097190 | rootH2_100971903 | 222 |
| 844 | 3300003322 | rootL2_10056586 | rootL2_100565866 | 222 |
| 845 | 3300003322 | rootL2_10171357 | rootL2_101713573 | 222 |
| 846 | 3300003323 | rootH1_10000759 | rootH1_1000075919 | 222 |
| 847 | 3300003794 | Ga0055531_10000148 | Ga0055531_100001488 | 222 |
| 848 | 3300005328 | Ga0070676_10238440 | Ga0070676_102384402 | 222 |
| 849 | 3300005330 | Ga0070690_100375635 | Ga0070690_1003756351 | 222 |
| 850 | 3300005331 | Ga0070670_100019943 | Ga0070670_1000199432 | 222 |
| 851 | 3300005331 | Ga0070670_100285043 | Ga0070670_1002850432 | 222 |
| 852 | 3300005334 | Ga0068869_100063547 | Ga0068869_1000635472 | 222 |
| 853 | 3300005334 | Ga0068869_100642772 | Ga0068869_1006427721 | 222 |
| 854 | 3300005335 | Ga0070666_10071460 | Ga0070666_100714603 | 222 |
| 855 | 3300005335 | Ga0070666_10216582 | Ga0070666_102165822 | 222 |
| 856 | 3300005338 | Ga0068868_100070337 | Ga0068868_1000703371 | 222 |
| 857 | 3300005338 | Ga0068868_100298576 | Ga0068868_1002985761 | 222 |
| 858 | 3300005338 | Ga0068868_100411187 | Ga0068868_1004111872 | 222 |
| 859 | 3300005347 | Ga0070668_100040034 | Ga0070668_1000400344 | 222 |
| 860 | 3300005347 | Ga0070668_100063469 | Ga0070668_1000634693 | 222 |
| 861 | 3300005353 | Ga0070669_100074078 | Ga0070669_1000740783 | 222 |
| 862 | 3300005353 | Ga0070669_100359962 | Ga0070669_1003599621 | 222 |
| 863 | 3300005354 | Ga0070675_100033260 | Ga0070675_1000332603 | 222 |
| 864 | 3300005355 | Ga0070671_100318746 | Ga0070671_1003187461 | 222 |
| 865 | 3300005355 | Ga0070671_100387078 | Ga0070671_1003870782 | 222 |
| 866 | 3300005356 | Ga0070674_100303210 | Ga0070674_1003032102 | 222 |
| 867 | 3300005364 | Ga0070673_100012549 | Ga0070673_1000125492 | 222 |
| 868 | 3300005364 | Ga0070673_100195777 | Ga0070673_1001957772 | 222 |
| 869 | 3300005365 | Ga0070688_100239052 | Ga0070688_1002390522 | 222 |
| 870 | 3300005367 | Ga0070667_100116847 | Ga0070667_1001168473 | 222 |
| 871 | 3300005367 | Ga0070667_100441188 | Ga0070667_1004411882 | 222 |
| 872 | 3300005456 | Ga0070678_100433016 | Ga0070678_1004330162 | 222 |
| 873 | 3300005459 | Ga0068867_100268680 | Ga0068867_1002686802 | 222 |
| 874 | 3300005459 | Ga0068867_100529416 | Ga0068867_1005294161 | 222 |
| 875 | 3300005471 | Ga0070698_100157042 | Ga0070698_1001570422 | 222 |
| 876 | 3300005518 | Ga0070699_100416452 | Ga0070699_1004164521 | 222 |
| 877 | 3300005539 | Ga0068853_100044306 | Ga0068853_1000443066 | 222 |
| 878 | 3300005543 | Ga0070672_100120391 | Ga0070672_1001203912 | 222 |
| 879 | 3300005548 | Ga0070665_100260871 | Ga0070665_1002608712 | 222 |
| 880 | 3300005563 | Ga0068855_100113035 | Ga0068855_1001130353 | 222 |
| 881 | 3300005564 | Ga0070664_100434391 | Ga0070664_1004343912 | 222 |
| 882 | 3300005614 | Ga0068856_100157672 | Ga0068856_1001576722 | 222 |
| 883 | 3300005616 | Ga0068852_100573908 | Ga0068852_1005739081 | 222 |
| 884 | 3300005617 | Ga0068859_100135036 | Ga0068859_1001350362 | 222 |
| 885 | 3300005618 | Ga0068864_100109277 | Ga0068864_1001092772 | 222 |
| 886 | 3300005718 | Ga0068866_10027937 | Ga0068866_100279372 | 222 |
| 887 | 3300005719 | Ga0068861_100127720 | Ga0068861_1001277202 | 222 |
| 888 | 3300005834 | Ga0068851_10082297 | Ga0068851_100822972 | 222 |
| 889 | 3300005841 | Ga0068863_100284251 | Ga0068863_1002842512 | 222 |
| 890 | 3300005843 | Ga0068860_100002698 | Ga0068860_1000026984 | 222 |
| 891 | 3300005843 | Ga0068860_100004510 | Ga0068860_10000451014 | 222 |
| 892 | 3300005843 | Ga0068860_100040606 | Ga0068860_1000406064 | 222 |
| 893 | 3300006195 | Ga0075366_10150932 | Ga0075366_101509322 | 222 |
| 894 | 3300006237 | Ga0097621_100015835 | Ga0097621_1000158357 | 222 |
| 895 | 3300006237 | Ga0097621_100165949 | Ga0097621_1001659492 | 222 |
| 896 | 3300006358 | Ga0068871_100090845 | Ga0068871_1000908453 | 222 |
| 897 | 3300006881 | Ga0068865_100009188 | Ga0068865_1000091886 | 222 |
| 898 | 3300006931 | Ga0097620_100135041 | Ga0097620_1001350412 | 222 |
| 899 | 3300009094 | Ga0111539_10249013 | Ga0111539_102490132 | 222 |
| 900 | 3300009174 | Ga0105241_10052619 | Ga0105241_100526193 | 222 |
| 901 | 3300009174 | Ga0105241_10321964 | Ga0105241_103219642 | 222 |
| 902 | 3300009553 | Ga0105249_10368536 | Ga0105249_103685362 | 222 |
| 903 | 3300009553 | Ga0105249_10669945 | Ga0105249_106699451 | 222 |
| 904 | 3300011119 | Ga0105246_10086442 | Ga0105246_100864422 | 222 |
| 905 | 3300011119 | Ga0105246_10297078 | Ga0105246_102970781 | 222 |
| 906 | 3300013102 | Ga0157371_10030564 | Ga0157371_100305643 | 222 |
| 907 | 3300013104 | Ga0157370_10270379 | Ga0157370_102703792 | 222 |
| 908 | 3300013105 | Ga0157369_10035509 | Ga0157369_100355094 | 222 |
| 909 | 3300013296 | Ga0157374_10128713 | Ga0157374_101287133 | 222 |
| 910 | 3300013296 | Ga0157374_10305340 | Ga0157374_103053402 | 222 |
| 911 | 3300013306 | Ga0163162_10000306 | Ga0163162_1000030612 | 222 |
| 912 | 3300013307 | Ga0157372_10002566 | Ga0157372_100025663 | 222 |
| 913 | 3300013307 | Ga0157372_10453950 | Ga0157372_104539502 | 222 |
| 914 | 3300013307 | Ga0157372_10719070 | Ga0157372_107190702 | 222 |
| 915 | 3300013308 | Ga0157375_10248050 | Ga0157375_102480502 | 222 |
| 916 | 3300013308 | Ga0157375_10404441 | Ga0157375_104044411 | 222 |
| 917 | 3300013308 | Ga0157375_10623401 | Ga0157375_106234012 | 222 |
| 918 | 3300014326 | Ga0157380_10822296 | Ga0157380_108222961 | 222 |
| 919 | 3300014745 | Ga0157377_10191200 | Ga0157377_101912002 | 222 |
| 920 | 3300014968 | Ga0157379_10198766 | Ga0157379_101987661 | 222 |
| 921 | 3300014968 | Ga0157379_10317238 | Ga0157379_103172381 | 222 |
| 922 | 3300014968 | Ga0157379_10417862 | Ga0157379_104178621 | 222 |
| 923 | 3300014969 | Ga0157376_10257831 | Ga0157376_102578312 | 222 |
| 924 | 3300025208 | Ga0209436_101495 | Ga0209436_1014952 | 222 |
| 925 | 3300025298 | Ga0209050_1025306 | Ga0209050_10253061 | 222 |
| 926 | 3300025302 | Ga0207426_1044041 | Ga0207426_10440412 | 222 |
| 927 | 3300025304 | Ga0209257_1000006 | Ga0209257_10000061285 | 222 |
| 928 | 3300025304 | Ga0209257_1068589 | Ga0209257_10685891 | 222 |
| 929 | 3300025899 | Ga0207642_10012892 | Ga0207642_100128922 | 222 |
| 930 | 3300025901 | Ga0207688_10015186 | Ga0207688_100151863 | 222 |
| 931 | 3300025907 | Ga0207645_10000545 | Ga0207645_1000054518 | 222 |
| 932 | 3300025908 | Ga0207643_10080008 | Ga0207643_100800082 | 222 |
| 933 | 3300025911 | Ga0207654_10109797 | Ga0207654_101097972 | 222 |
| 934 | 3300025911 | Ga0207654_10335224 | Ga0207654_103352242 | 222 |
| 935 | 3300025923 | Ga0207681_10079873 | Ga0207681_100798733 | 222 |
| 936 | 3300025925 | Ga0207650_10134530 | Ga0207650_101345302 | 222 |
| 937 | 3300025925 | Ga0207650_10220389 | Ga0207650_102203892 | 222 |
| 938 | 3300025926 | Ga0207659_10120144 | Ga0207659_101201442 | 222 |
| 939 | 3300025926 | Ga0207659_10189170 | Ga0207659_101891702 | 222 |
| 940 | 3300025926 | Ga0207659_10572235 | Ga0207659_105722352 | 222 |
| 941 | 3300025933 | Ga0207706_10134079 | Ga0207706_101340792 | 222 |
| 942 | 3300025933 | Ga0207706_10514399 | Ga0207706_105143992 | 222 |
| 943 | 3300025934 | Ga0207686_10061703 | Ga0207686_100617033 | 222 |
| 944 | 3300025936 | Ga0207670_10393430 | Ga0207670_103934301 | 222 |
| 945 | 3300025938 | Ga0207704_10033662 | Ga0207704_100336622 | 222 |
| 946 | 3300025940 | Ga0207691_10003442 | Ga0207691_1000344213 | 222 |
| 947 | 3300025940 | Ga0207691_10033672 | Ga0207691_100336723 | 222 |
| 948 | 3300025942 | Ga0207689_10000466 | Ga0207689_1000046614 | 222 |
| 949 | 3300025942 | Ga0207689_10271421 | Ga0207689_102714212 | 222 |
| 950 | 3300025949 | Ga0207667_10091730 | Ga0207667_100917303 | 222 |
| 951 | 3300025960 | Ga0207651_10188565 | Ga0207651_101885652 | 222 |
| 952 | 3300025972 | Ga0207668_10039606 | Ga0207668_100396065 | 222 |
| 953 | 3300025986 | Ga0207658_10119658 | Ga0207658_101196583 | 222 |
| 954 | 3300026023 | Ga0207677_10667397 | Ga0207677_106673971 | 222 |
| 955 | 3300026035 | Ga0207703_10278326 | Ga0207703_102783262 | 222 |
| 956 | 3300026067 | Ga0207678_10129022 | Ga0207678_101290222 | 222 |
| 957 | 3300026088 | Ga0207641_10345770 | Ga0207641_103457702 | 222 |
| 958 | 3300026089 | Ga0207648_10010349 | Ga0207648_100103493 | 222 |
| 959 | 3300026089 | Ga0207648_10091570 | Ga0207648_100915702 | 222 |
| 960 | 3300026095 | Ga0207676_10470416 | Ga0207676_104704162 | 222 |
| 961 | 3300026116 | Ga0207674_10210346 | Ga0207674_102103462 | 222 |
| 962 | 3300026116 | Ga0207674_10294481 | Ga0207674_102944812 | 222 |
| 963 | 3300026118 | Ga0207675_100043581 | Ga0207675_1000435813 | 222 |
| 964 | 3300026118 | Ga0207675_100305019 | Ga0207675_1003050192 | 222 |
| 965 | 3300026121 | Ga0207683_10192381 | Ga0207683_101923811 | 222 |
| 966 | 3300026142 | Ga0207698_10190523 | Ga0207698_101905232 | 222 |
| 967 | 3300028381 | Ga0268264_10025036 | Ga0268264_100250364 | 222 |
| 968 | 3300028381 | Ga0268264_10124820 | Ga0268264_101248202 | 222 |
| 969 | 3300028381 | Ga0268264_10142323 | Ga0268264_101423232 | 222 |
| 970 | 3300028381 | Ga0268264_10157801 | Ga0268264_101578012 | 222 |
| 971 | 3300028381 | Ga0268264_10363248 | Ga0268264_103632482 | 222 |
| 972 | 3300028794 | Ga0307515_10000479 | Ga0307515_1000047920 | 222 |
| 973 | 3300028794 | Ga0307515_10009312 | Ga0307515_1000931219 | 222 |
| 974 | 3300031456 | Ga0307513_10077090 | Ga0307513_100770902 | 222 |
| 975 | 3300031456 | Ga0307513_10361649 | Ga0307513_103616491 | 222 |
| 976 | 3300031507 | Ga0307509_10155728 | Ga0307509_101557282 | 222 |
| 977 | 3300031911 | Ga0307412_10040897 | Ga0307412_100408972 | 222 |
| 978 | 3300033180 | Ga0307510_10017440 | Ga0307510_100174404 | 222 |
| 979 | 3300041458 | Ga0451798_0297405 | Ga0451798_0297405_167_874 | 222 |
| 980 | 3300042007 | Ga0439449_0083402 | Ga0439449_0083402_118_825 | 222 |
| 981 | 3300044658 | Ga0466972_0000015 | Ga0466972_0000015_199457_200164 | 222 |
| 982 | 3300044842 | Ga0466957_0005893 | Ga0466957_0005893_2421_3125 | 222 |
| 983 | 3300046459 | Ga0495629_0019970 | Ga0495629_0019970_4002_4703 | 222 |
| 984 | 3300046460 | Ga0495638_0000005 | Ga0495638_0000005_319643_320356 | 222 |
| 985 | 3300046472 | Ga0495580_0032933 | Ga0495580_0032933_975_1676 | 222 |
| 986 | 3300046473 | Ga0495582_0113336 | Ga0495582_0113336_105_806 | 222 |
| 987 | 3300046507 | Ga0495606_0236657 | Ga0495606_0236657_151_876 | 222 |
| 988 | 3300046513 | Ga0495616_0007179 | Ga0495616_0007179_2199_2930 | 222 |
| 989 | 3300046517 | Ga0495630_0035374 | Ga0495630_0035374_2615_3316 | 222 |
| 990 | 3300046519 | Ga0495632_0001210 | Ga0495632_0001210_7695_8417 | 222 |
| 991 | 3300046522 | Ga0495643_0000596 | Ga0495643_0000596_10086_10817 | 222 |
| 992 | 3300046529 | Ga0495652_0323784 | Ga0495652_0323784_200_901 | 222 |
| 993 | 3300046539 | Ga0495621_0044062 | Ga0495621_0044062_25_774 | 222 |
| 994 | 3300046558 | Ga0495633_0000002 | Ga0495633_0000002_258369_259091 | 222 |
| 995 | 3300046660 | Ga0495625_0007755 | Ga0495625_0007755_8162_8893 | 222 |
| 996 | 3300046660 | Ga0495625_0028526 | Ga0495625_0028526_3398_4147 | 222 |
| 997 | 3300046683 | Ga0495658_0006551 | Ga0495658_0006551_1329_2030 | 222 |
| 998 | 3300047319 | Ga0495674_0028918 | Ga0495674_0028918_2236_2937 | 222 |
| 999 | 3300047321 | Ga0495676_0029247 | Ga0495676_0029247_1113_1814 | 222 |
| 1000 | 3300048903 | Ga0496100_0670016 | Ga0496100_0670016_23_772 | 222 |
| 1001 | 3300048907 | Ga0496104_0391855 | Ga0496104_0391855_435_1136 | 222 |
| 1002 | 3300048913 | Ga0496110_0470567 | Ga0496110_0470567_316_1065 | 222 |
| 1003 | 3300049581 | Ga0501047_0020221 | Ga0501047_0020221_82_789 | 222 |
| 1004 | 3300049705 | Ga0501225_0000665 | Ga0501225_0000665_3169_3867 | 222 |
| 1005 | 3300049705 | Ga0501225_0002947 | Ga0501225_0002947_1501_2208 | 222 |
| 1006 | 3300049823 | Ga0501044_0055830 | Ga0501044_0055830_2300_3007 | 222 |
| 1007 | 3300050493 | nmdc:mga0k408_43005_c1 | nmdc:mga0k408_43005_c1_98_841 | 222 |
| 1008 | 3300050511 | nmdc:mga08y16_723317_c1 | nmdc:mga08y16_723317_c1_135_884 | 222 |
| 1009 | 3300050513 | nmdc:mga0rr50_499487_c1 | nmdc:mga0rr50_499487_c1_310_1017 | 222 |
| 1010 | 3300053092 | Ga0500583_0000030 | Ga0500583_0000030_20116_20823 | 222 |
| 1011 | 3300053092 | Ga0500583_0000215 | Ga0500583_0000215_6561_7268 | 222 |
| 1012 | 3300053093 | Ga0500651_0000485 | Ga0500651_0000485_12875_13630 | 222 |
| 1013 | 3300053093 | Ga0500651_0073389 | Ga0500651_0073389_379_1089 | 222 |
| 1014 | 3300053108 | Ga0500562_020810 | Ga0500562_020810_52_768 | 222 |
| 1015 | 3300053122 | Ga0500608_000292 | Ga0500608_000292_1741_2496 | 222 |
| 1016 | 3300053137 | Ga0500561_0064035 | Ga0500561_0064035_221_928 | 222 |
| 1017 | 3300053147 | Ga0500589_071911 | Ga0500589_071911_154_861 | 222 |
| 1018 | 3300053151 | Ga0500604_0005834 | Ga0500604_0005834_91_807 | 222 |
| 1019 | 3300053153 | Ga0500616_0000003 | Ga0500616_0000003_854106_854819 | 222 |
| 1020 | 3300053153 | Ga0500616_0052611 | Ga0500616_0052611_511_1230 | 222 |
| 1021 | 3300053153 | Ga0500616_0071849 | Ga0500616_0071849_981_1688 | 222 |
| 1022 | 3300053156 | Ga0500622_0000017 | Ga0500622_0000017_63263_63979 | 222 |
| 1023 | 3300053156 | Ga0500622_0000058 | Ga0500622_0000058_116742_117458 | 222 |
| 1024 | 3300053156 | Ga0500622_0001315 | Ga0500622_0001315_3257_4006 | 222 |
| 1025 | 3300053156 | Ga0500622_0065034 | Ga0500622_0065034_646_1353 | 222 |
| 1026 | 3300053156 | Ga0500622_0076405 | Ga0500622_0076405_401_1108 | 222 |
| 1027 | 3300053177 | Ga0500636_0032141 | Ga0500636_0032141_59_766 | 222 |
| 1028 | 3300002741 | JGI25157J39369_1005924 | JGI25157J39369_10059241 | 223 |
| 1029 | 3300005289 | Ga0065704_10148664 | Ga0065704_101486642 | 223 |
| 1030 | 3300005327 | Ga0070658_10050583 | Ga0070658_100505833 | 223 |
| 1031 | 3300005335 | Ga0070666_10377066 | Ga0070666_103770662 | 223 |
| 1032 | 3300005530 | Ga0070679_100171751 | Ga0070679_1001717512 | 223 |
| 1033 | 3300005564 | Ga0070664_100282206 | Ga0070664_1002822062 | 223 |
| 1034 | 3300009093 | Ga0105240_10723326 | Ga0105240_107233262 | 223 |
| 1035 | 3300012485 | Ga0157325_1001948 | Ga0157325_10019481 | 223 |
| 1036 | 3300013102 | Ga0157371_10083626 | Ga0157371_100836262 | 223 |
| 1037 | 3300013104 | Ga0157370_10075619 | Ga0157370_100756194 | 223 |
| 1038 | 3300013307 | Ga0157372_10202223 | Ga0157372_102022231 | 223 |
| 1039 | 3300025893 | Ga0207682_10160512 | Ga0207682_101605122 | 223 |
| 1040 | 3300025920 | Ga0207649_10173702 | Ga0207649_101737022 | 223 |
| 1041 | 3300025921 | Ga0207652_10146009 | Ga0207652_101460091 | 223 |
| 1042 | 3300037418 | Ga0395900_0467044 | Ga0395900_0467044_266_1018 | 223 |
| 1043 | 3300044712 | Ga0453684_0109194 | Ga0453684_0109194_1183_1899 | 223 |
| 1044 | 3300046529 | Ga0495652_0032026 | Ga0495652_0032026_2325_3032 | 223 |
| 1045 | 3300049513 | Ga0501290_009895 | Ga0501290_009895_40_774 | 223 |
| 1046 | 3300049650 | Ga0501199_004813 | Ga0501199_004813_377_1111 | 223 |
| 1047 | 3300049674 | Ga0501242_000211 | Ga0501242_000211_710_1444 | 223 |
| 1048 | 3300049686 | Ga0501257_002012 | Ga0501257_002012_296_1030 | 223 |
| 1049 | 3300049705 | Ga0501225_0020336 | Ga0501225_0020336_789_1523 | 223 |
| 1050 | 3300003781 | Ga0055536_1014199 | Ga0055536_10141992 | 224 |
| 1051 | 3300005262 | Ga0065165_1001093 | Ga0065165_10010937 | 224 |
| 1052 | 3300005329 | Ga0070683_100006292 | Ga0070683_1000062922 | 224 |
| 1053 | 3300009093 | Ga0105240_10002124 | Ga0105240_1000212423 | 224 |
| 1054 | 3300013100 | Ga0157373_10000271 | Ga0157373_100002712 | 224 |
| 1055 | 3300013104 | Ga0157370_10025346 | Ga0157370_100253465 | 224 |
| 1056 | 3300013307 | Ga0157372_10009642 | Ga0157372_100096423 | 224 |
| 1057 | 3300025250 | Ga0209026_1000502 | Ga0209026_100050222 | 224 |
| 1058 | 3300025292 | Ga0209676_1000321 | Ga0209676_100032130 | 224 |
| 1059 | 3300025913 | Ga0207695_10001914 | Ga0207695_1000191423 | 224 |
| 1060 | 3300026089 | Ga0207648_10679017 | Ga0207648_106790172 | 224 |
| 1061 | 3300031251 | Ga0265327_10001423 | Ga0265327_100014237 | 224 |
| 1062 | 3300031911 | Ga0307412_10228158 | Ga0307412_102281582 | 224 |
| 1063 | 3300046810 | Ga0495660_0024633 | Ga0495660_0024633_2646_3359 | 224 |
| 1064 | 3300053092 | Ga0500583_0152666 | Ga0500583_0152666_347_1069 | 224 |
| 1065 | 3300013306 | Ga0163162_10193458 | Ga0163162_101934582 | 225 |
| 1066 | 3300046507 | Ga0495606_0000100 | Ga0495606_0000100_76586_77302 | 225 |
| 1067 | 3300046520 | Ga0495637_0065093 | Ga0495637_0065093_577_1293 | 225 |
| 1068 | 3300009098 | Ga0105245_10294354 | Ga0105245_102943542 | 226 |
| 1069 | 3300013306 | Ga0163162_10069227 | Ga0163162_100692272 | 226 |
| 1070 | 3300021384 | Ga0213876_10190854 | Ga0213876_101908542 | 226 |
| 1071 | 3300021384 | Ga0213876_10253201 | Ga0213876_102532011 | 226 |
| 1072 | 3300031251 | Ga0265327_10043350 | Ga0265327_100433502 | 226 |
| 1073 | 3300039437 | Ga0436365_1031676 | Ga0436365_1031676_245_943 | 226 |
| 1074 | 3300039437 | Ga0436365_1622828 | Ga0436365_1622828_1725_2423 | 226 |
| 1075 | 3300039447 | Ga0436361_1171170 | Ga0436361_1171170_978_1676 | 226 |
| 1076 | 3300049570 | Ga0501033_0026491 | Ga0501033_0026491_929_1627 | 226 |
| 1077 | 3300049571 | Ga0501034_0062200 | Ga0501034_0062200_2664_3362 | 226 |
| 1078 | 3300049571 | Ga0501034_0660540 | Ga0501034_0660540_166_864 | 226 |
| 1079 | 3300049573 | Ga0501037_0337864 | Ga0501037_0337864_160_858 | 226 |
| 1080 | 3300049742 | Ga0501080_0151799 | Ga0501080_0151799_998_1696 | 226 |
| 1081 | 3300049742 | Ga0501080_0635023 | Ga0501080_0635023_48_746 | 226 |
| 1082 | 2162886007 | SwRhRL2b_contig_1761633 | SwRhRL2b_0391.00006210 | 227 |
| 1083 | 3300005289 | Ga0065704_10000195 | Ga0065704_1000019593 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qv0-assembly1.cif.gz_A | crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae | 0.9256 | 3 | 119 |
| 7od9-assembly1.cif.gz_B | crystal structure of activated chey fused to the c-terminal domain of chef | 0.9169 | 1 | 112 |
| 6m8o-assembly1.cif.gz_A | crystal structure of the receiver domain of lytr from staphylococcus aureus | 0.9139 | 3 | 113 |
| 6swf-assembly1.cif.gz_A | selenomethionine derivative of the rec domain of arat, a response regulator from geobacillus stearothermophilus | 0.9016 | 2 | 121 |
| 6zix-assembly1.cif.gz_B | structure of rcsb from salmonella enterica serovar typhimurium bound to promoter p1flhdc in the presence of phosphomimetic bef3- | 0.8997 | 2 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qv0B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9218 | 3 | 119 | 3.40.50.2300 |
| af_A0A0P0W8Y3_12_90_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9206 | 2 | 67 | 3.40.50.2300 |
| af_P0AFT5_1_126_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9168 | 1 | 114 | 3.40.50.2300 |
| 6m8oA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9139 | 3 | 113 | 3.40.50.2300 |
| af_P60611_135_244_2.40.50.1020 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain | 0.9139 | 125 | 225 | 2.40.50.1020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520C3L2-F1-model_v4 | Response regulator | 0.9759 | 3 | 100 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A1G7PZ04-F1-model_v4 | Response regulator receiver domain-containing protein | 0.9732 | 1 | 108 |
GO:0000156
GO:0003677 GO:0005737 |
| AF-A0A256WLE8-F1-model_v4 | Response regulatory domain-containing protein | 0.9678 | 2 | 106 |
GO:0000156
GO:0003677 GO:0005737 |
| AF-A0A2M8AEV0-F1-model_v4 | DNA-binding response regulator | 0.9642 | 3 | 120 |
GO:0000156
GO:0003677 GO:0005737 |
| AF-A0A4Q8QFW8-F1-model_v4 | Response regulator | 0.962 | 1 | 122 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar