F489731

General Info

Members Datasets Scaffolds Average Seq Length
1083 384 1064 298

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0004980|Ga0500568_0004980_4001_5035
Length 344
Sequence VTNSDASASVIHFPLVDADAFGVEAGAGIPILAFIIFSAEGGRMEPVTQQRFGTIAVVGAPNAGKSTLVNALVGQKVAIVSPKAQTTRTRLMGIAMLGTSQILLTDTPGIFEPKRRLDRAMVAAAWGSAQDVDLIALIVDASTGLKRGVTELLDRLKDRPEPKLLILNKVDLVKKEVLLALITQFDGRADFEQIYMISASTGDGVEELKAALAARVPEGPWHFPEDQVSDATDRMMAAEITREQLYHQLHAELPYASAIETEKYEERKDGSVVIHQQILVGRDTQKAIVLGKGGTRIKQIGESARKELTEALGRKVHLFLHVKVNPKWEEDRGLYREIGLDWVE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
6 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
7 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
8 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
9 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
10 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
11 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
12 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
13 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
14 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
15 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
16 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
17 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
18 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
19 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
20 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
21 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
22 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
29 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
45 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
148 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
235 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
236 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
237 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
257 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
258 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
259 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
262 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
263 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
264 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
265 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
266 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
295 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
307 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
308 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
309 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
310 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
311 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
320 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
342 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
343 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
344 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
345 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
346 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
347 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
348 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
349 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
360 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
364 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
365 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
366 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
367 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
368 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
369 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
370 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
371 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
372 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
373 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
374 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
375 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
379 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
380 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
381 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
382 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.18
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 10.16
Nodule 0
Rhizoplane 1.11
Rhizosphere 83.29
Stem 0
Stem Tuber 0
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1751179 2162886007 Bacteria 2521
2 SwRhRL2b_contig_3930390 2162886007 Bacteria 2521
3 ARcpr5yngRDRAFT_c001989 3300000043 Bacteria 2178
4 JGI24736J21556_1006943 3300001904 Bacteria 1907
5 JGI24736J21556_1011073 3300001904 Bacteria 1469
6 JGI24741J21665_1000004 3300001915 Bacteria 51710
7 JGI24740J21852_10001550 3300001979 Bacteria 10564
8 JGI24740J21852_10013368 3300001979 Bacteria 3063
9 JGI24740J21852_10066055 3300001979 Bacteria 983
10 JGI24739J22299_10000714 3300001989 Bacteria 12040
11 JGI24739J22299_10001469 3300001989 Bacteria 8892
12 JGI24739J22299_10004008 3300001989 Bacteria 5635
13 JGI24739J22299_10004251 3300001989 Bacteria 5483
14 JGI24739J22299_10010073 3300001989 Bacteria 3513
15 JGI24739J22299_10024985 3300001989 Bacteria 2102
16 JGI24739J22299_10029529 3300001989 Bacteria 1906
17 JGI24737J22298_10000293 3300001990 Bacteria 16594
18 JGI24737J22298_10000584 3300001990 Bacteria 12798
19 JGI24737J22298_10001100 3300001990 Bacteria 9504
20 JGI24737J22298_10001195 3300001990 Bacteria 9156
21 JGI24737J22298_10017771 3300001990 Bacteria 2288
22 JGI24737J22298_10029109 3300001990 Bacteria 1733
23 JGI24737J22298_10070569 3300001990 Bacteria 1043
24 JGI24735J21928_10008752 3300002067 Bacteria 3266
25 JGI24735J21928_10009901 3300002067 Bacteria 3053
26 JGI24735J21928_10015899 3300002067 Bacteria 2343
27 JGI24735J21928_10016482 3300002067 Bacteria 2291
28 JGI24735J21928_10022352 3300002067 Bacteria 1926
29 JGI24735J21928_10027960 3300002067 Bacteria 1686
30 JGI24735J21928_10039234 3300002067 Bacteria 1385
31 JGI24735J21928_10059668 3300002067 Bacteria 1096
32 JGI24738J21930_10000814 3300002075 Bacteria 8931
33 JGI24738J21930_10001002 3300002075 Bacteria 8087
34 JGI24738J21930_10005507 3300002075 Bacteria 3028
35 JGI24744J21845_10005272 3300002077 Bacteria 2675
36 JGI24742J22300_10006052 3300002244 Bacteria 1994
37 JGI24742J22300_10031262 3300002244 Bacteria 931
38 JGI25165J46597_1000165 3300003214 Bacteria 104009
39 JGI25153J46596_10000007 3300003215 Bacteria 377573
40 JGI25153J46596_10000032 3300003215 Bacteria 196732
41 JGI25153J46596_10025950 3300003215 Bacteria 2084
42 Ga0055525_1000096 3300003759 Bacteria 137836
43 Ga0055542_1000012 3300003762 Bacteria 391808
44 Ga0055529_1000002 3300003763 Bacteria 537914
45 Ga0055529_1000021 3300003763 Bacteria 321484
46 Ga0055537_1000357 3300003773 Bacteria 31036
47 Ga0055524_1000361 3300003775 Bacteria 40768
48 Ga0055536_1015678 3300003781 Bacteria 2577
49 Ga0055530_10022189 3300003791 Bacteria 1852
50 Ga0055540_1005045 3300003792 Bacteria 5723
51 Ga0055531_10000100 3300003794 Bacteria 93692
52 Ga0055531_10003757 3300003794 Bacteria 9533
53 Ga0055531_10025182 3300003794 Bacteria 2170
54 JGI25405J52794_10007653 3300003911 Bacteria 1997
55 Ga0055543_1020161 3300004625 Bacteria 1228
56 Ga0065165_1001356 3300005262 Bacteria 27042
57 Ga0065165_1002875 3300005262 Bacteria 13257
58 Ga0065165_1021348 3300005262 Bacteria 2252
59 Ga0065165_1056879 3300005262 Bacteria 1085
60 Ga0065704_10006098 3300005289 Bacteria 4341
61 Ga0065704_10208631 3300005289 Bacteria 1117
62 Ga0065712_10152329 3300005290 Bacteria 1352
63 Ga0065707_10082626 3300005295 Bacteria 13216
64 Ga0070658_10000001 3300005327 Bacteria 856789
65 Ga0070658_10000062 3300005327 Bacteria 107844
66 Ga0070658_10000612 3300005327 Bacteria 30912
67 Ga0070658_10000691 3300005327 Bacteria 29223
68 Ga0070658_10005123 3300005327 Bacteria 10669
69 Ga0070658_10008207 3300005327 Bacteria 8396
70 Ga0070658_10036686 3300005327 Bacteria 3951
71 Ga0070658_10091850 3300005327 Bacteria 2502
72 Ga0070658_10092146 3300005327 Bacteria 2498
73 Ga0070676_10000999 3300005328 Bacteria 14039
74 Ga0070676_10004996 3300005328 Bacteria 7025
75 Ga0070676_10149291 3300005328 Bacteria 1495
76 Ga0070683_100060925 3300005329 Bacteria 3508
77 Ga0070683_100365320 3300005329 Bacteria 1374
78 Ga0070670_100018265 3300005331 Bacteria 6016
79 Ga0070670_100040431 3300005331 Bacteria 4009
80 Ga0070670_100065316 3300005331 Bacteria 3122
81 Ga0070670_100070931 3300005331 Bacteria 2991
82 Ga0070670_100374967 3300005331 Bacteria 1253
83 Ga0070670_100454313 3300005331 Bacteria 1136
84 Ga0070677_10000059 3300005333 Bacteria 34210
85 Ga0068869_100000094 3300005334 Bacteria 41359
86 Ga0068869_100000225 3300005334 Bacteria 29577
87 Ga0068869_100448860 3300005334 Bacteria 1069
88 Ga0070666_10000342 3300005335 Bacteria 29324
89 Ga0070666_10017178 3300005335 Bacteria 4636
90 Ga0070666_10149578 3300005335 Bacteria 1629
91 Ga0070666_10507389 3300005335 Bacteria 875
92 Ga0070680_100000295 3300005336 Bacteria 33407
93 Ga0070680_100343924 3300005336 Bacteria 1268
94 Ga0070682_100052195 3300005337 Bacteria 2558
95 Ga0068868_100000007 3300005338 Bacteria 123028
96 Ga0068868_100000013 3300005338 Bacteria 110536
97 Ga0068868_100000113 3300005338 Bacteria 50799
98 Ga0068868_100002389 3300005338 Bacteria 12993
99 Ga0068868_100184873 3300005338 Bacteria 1731
100 Ga0070660_100000377 3300005339 Bacteria 29678
101 Ga0070660_100001392 3300005339 Bacteria 16462
102 Ga0070660_100001509 3300005339 Bacteria 15957
103 Ga0070660_100002789 3300005339 Bacteria 12001
104 Ga0070660_100004887 3300005339 Bacteria 9264
105 Ga0070660_100017709 3300005339 Bacteria 5195
106 Ga0070660_100041042 3300005339 Bacteria 3525
107 Ga0070660_100041201 3300005339 Bacteria 3519
108 Ga0070660_100083027 3300005339 Bacteria 2516
109 Ga0070691_10002318 3300005341 Bacteria 8431
110 Ga0070661_100000001 3300005344 Bacteria 424830
111 Ga0070661_100002510 3300005344 Bacteria 12572
112 Ga0070661_100012399 3300005344 Bacteria 5963
113 Ga0070661_100064473 3300005344 Bacteria 2692
114 Ga0070668_100002775 3300005347 Bacteria 12873
115 Ga0070668_100011115 3300005347 Bacteria 6701
116 Ga0070668_100024681 3300005347 Bacteria 4556
117 Ga0070669_100000155 3300005353 Bacteria 61710
118 Ga0070669_100039822 3300005353 Bacteria 3415
119 Ga0070669_100065653 3300005353 Bacteria 2673
120 Ga0070669_100132388 3300005353 Bacteria 1915
121 Ga0070669_100384601 3300005353 Bacteria 1145
122 Ga0070669_100425099 3300005353 Bacteria 1091
123 Ga0070675_100302853 3300005354 Bacteria 1408
124 Ga0070671_100019672 3300005355 Bacteria 5498
125 Ga0070671_100031754 3300005355 Bacteria 4365
126 Ga0070671_100048588 3300005355 Bacteria 3529
127 Ga0070671_100077802 3300005355 Bacteria 2772
128 Ga0070674_100005255 3300005356 Bacteria 7455
129 Ga0070674_100005285 3300005356 Bacteria 7438
130 Ga0070674_100007950 3300005356 Bacteria 6280
131 Ga0070674_100014858 3300005356 Bacteria 4846
132 Ga0070674_100019554 3300005356 Bacteria 4304
133 Ga0070674_100054157 3300005356 Bacteria 2773
134 Ga0070673_100000002 3300005364 Bacteria 225084
135 Ga0070673_100001756 3300005364 Bacteria 12927
136 Ga0070673_100007485 3300005364 Bacteria 7207
137 Ga0070673_100024388 3300005364 Bacteria 4435
138 Ga0070673_100034497 3300005364 Bacteria 3830
139 Ga0070673_100050349 3300005364 Bacteria 3257
140 Ga0070673_100065260 3300005364 Bacteria 2903
141 Ga0070688_100161926 3300005365 Bacteria 1538
142 Ga0070659_100000004 3300005366 Bacteria 267958
143 Ga0070659_100000305 3300005366 Bacteria 38108
144 Ga0070659_100003359 3300005366 Bacteria 11387
145 Ga0070659_100009411 3300005366 Bacteria 7173
146 Ga0070659_100011569 3300005366 Bacteria 6531
147 Ga0070659_100022212 3300005366 Bacteria 4840
148 Ga0070659_100040630 3300005366 Bacteria 3635
149 Ga0070659_100075534 3300005366 Bacteria 2686
150 Ga0070659_100111678 3300005366 Bacteria 2207
151 Ga0070659_100115687 3300005366 Bacteria 2168
152 Ga0070659_100147357 3300005366 Bacteria 1918
153 Ga0070667_100000656 3300005367 Bacteria 33607
154 Ga0070667_100003284 3300005367 Bacteria 13815
155 Ga0070667_100023180 3300005367 Bacteria 5150
156 Ga0070667_100064562 3300005367 Bacteria 3106
157 Ga0070714_100050966 3300005435 Bacteria 3529
158 Ga0070713_100103909 3300005436 Bacteria 2466
159 Ga0070708_100327768 3300005445 Bacteria 1442
160 Ga0070663_100015825 3300005455 Bacteria 4880
161 Ga0070663_100036161 3300005455 Bacteria 3430
162 Ga0070663_100040999 3300005455 Bacteria 3244
163 Ga0070663_100055140 3300005455 Bacteria 2843
164 Ga0070663_100062435 3300005455 Bacteria 2686
165 Ga0070663_100098890 3300005455 Bacteria 2174
166 Ga0070678_100000055 3300005456 Bacteria 40348
167 Ga0070678_100409993 3300005456 Bacteria 1179
168 Ga0070662_100024764 3300005457 Bacteria 4138
169 Ga0070662_100026033 3300005457 Bacteria 4047
170 Ga0070662_100041566 3300005457 Bacteria 3280
171 Ga0070662_100155667 3300005457 Bacteria 1784
172 Ga0070681_10006314 3300005458 Bacteria 11525
173 Ga0070681_10010156 3300005458 Bacteria 9285
174 Ga0070681_10063724 3300005458 Bacteria 3658
175 Ga0068867_100000012 3300005459 Bacteria 118831
176 Ga0068867_100001817 3300005459 Bacteria 14865
177 Ga0068867_100003846 3300005459 Bacteria 10552
178 Ga0068867_100010918 3300005459 Bacteria 6405
179 Ga0068867_100013901 3300005459 Bacteria 5698
180 Ga0070706_100022961 3300005467 Bacteria 5745
181 Ga0070698_100005702 3300005471 Bacteria 13628
182 Ga0070679_100000017 3300005530 Bacteria 129377
183 Ga0070679_100033401 3300005530 Bacteria 5094
184 Ga0070679_100260778 3300005530 Bacteria 1688
185 Ga0070684_100027100 3300005535 Bacteria 4833
186 Ga0070684_100389020 3300005535 Bacteria 1285
187 Ga0068853_100005924 3300005539 Bacteria 9651
188 Ga0068853_100007016 3300005539 Bacteria 9004
189 Ga0068853_100008695 3300005539 Bacteria 8166
190 Ga0068853_100046194 3300005539 Bacteria 3733
191 Ga0068853_100288759 3300005539 Bacteria 1514
192 Ga0068853_100494545 3300005539 Bacteria 1154
193 Ga0070672_100000710 3300005543 Bacteria 19719
194 Ga0070672_100033346 3300005543 Bacteria 3899
195 Ga0070672_100135004 3300005543 Bacteria 2032
196 Ga0070686_100000338 3300005544 Bacteria 30239
197 Ga0070686_100142419 3300005544 Bacteria 1670
198 Ga0070665_100000043 3300005548 Bacteria 279774
199 Ga0070665_100000495 3300005548 Bacteria 56309
200 Ga0070665_100000995 3300005548 Bacteria 35932
201 Ga0070665_100004318 3300005548 Bacteria 14944
202 Ga0070665_100014710 3300005548 Bacteria 7850
203 Ga0070665_100066271 3300005548 Bacteria 3622
204 Ga0070665_100121024 3300005548 Bacteria 2619
205 Ga0070665_100338978 3300005548 Bacteria 1508
206 Ga0068855_100000095 3300005563 Bacteria 106561
207 Ga0068855_100001110 3300005563 Bacteria 33477
208 Ga0068855_100012722 3300005563 Bacteria 10148
209 Ga0068855_100038147 3300005563 Bacteria 5709
210 Ga0068855_100053334 3300005563 Bacteria 4758
211 Ga0068855_100066469 3300005563 Bacteria 4203
212 Ga0068855_100372096 3300005563 Bacteria 1570
213 Ga0068855_100393588 3300005563 Bacteria 1519
214 Ga0068855_100590007 3300005563 Bacteria 1199
215 Ga0070664_100003720 3300005564 Bacteria 12293
216 Ga0070664_100006800 3300005564 Bacteria 9220
217 Ga0070664_100030014 3300005564 Bacteria 4534
218 Ga0070664_100042361 3300005564 Bacteria 3844
219 Ga0068857_100004853 3300005577 Bacteria 11402
220 Ga0068857_100007710 3300005577 Bacteria 9274
221 Ga0068857_100012795 3300005577 Bacteria 7313
222 Ga0068857_100017141 3300005577 Bacteria 6345
223 Ga0068857_100048509 3300005577 Bacteria 3770
224 Ga0068857_100053395 3300005577 Bacteria 3585
225 Ga0068857_100068383 3300005577 Bacteria 3161
226 Ga0068857_100078386 3300005577 Bacteria 2949
227 Ga0068857_100168788 3300005577 Bacteria 1988
228 Ga0068857_100175331 3300005577 Bacteria 1950
229 Ga0068857_100318299 3300005577 Bacteria 1436
230 Ga0068854_100000206 3300005578 Bacteria 39747
231 Ga0068854_100000265 3300005578 Bacteria 35689
232 Ga0068854_100004418 3300005578 Bacteria 8876
233 Ga0068854_100020435 3300005578 Bacteria 4480
234 Ga0068854_100021215 3300005578 Bacteria 4405
235 Ga0068854_100028258 3300005578 Bacteria 3874
236 Ga0068854_100040701 3300005578 Bacteria 3280
237 Ga0068854_100065856 3300005578 Bacteria 2635
238 Ga0068854_100079015 3300005578 Bacteria 2425
239 Ga0068854_100113994 3300005578 Bacteria 2043
240 Ga0068854_100369455 3300005578 Bacteria 1179
241 Ga0068856_100003848 3300005614 Bacteria 15059
242 Ga0068852_100002924 3300005616 Bacteria 11864
243 Ga0068852_100004651 3300005616 Bacteria 9731
244 Ga0068852_100044876 3300005616 Bacteria 3757
245 Ga0068852_100070015 3300005616 Bacteria 3076
246 Ga0068852_100431322 3300005616 Bacteria 1302
247 Ga0068852_100565172 3300005616 Bacteria 1139
248 Ga0068859_100000682 3300005617 Bacteria 34086
249 Ga0068859_100007995 3300005617 Bacteria 10722
250 Ga0068859_100049241 3300005617 Bacteria 4232
251 Ga0068864_100000428 3300005618 Bacteria 36392
252 Ga0068864_100115414 3300005618 Bacteria 2395
253 Ga0068866_10109373 3300005718 Bacteria 1539
254 Ga0068861_100319791 3300005719 Bacteria 1351
255 Ga0068851_10008531 3300005834 Bacteria 4741
256 Ga0068851_10028720 3300005834 Bacteria 2748
257 Ga0068870_10083700 3300005840 Bacteria 1769
258 Ga0068863_100000634 3300005841 Bacteria 35566
259 Ga0068863_100010310 3300005841 Bacteria 9081
260 Ga0068863_100097556 3300005841 Bacteria 2791
261 Ga0068858_100000482 3300005842 Bacteria 41597
262 Ga0068858_100001980 3300005842 Bacteria 20919
263 Ga0068858_100009525 3300005842 Bacteria 9266
264 Ga0068858_100143470 3300005842 Bacteria 2242
265 Ga0068858_100274295 3300005842 Bacteria 1605
266 Ga0068860_100002325 3300005843 Bacteria 19958
267 Ga0068860_100003691 3300005843 Bacteria 15765
268 Ga0068860_100040396 3300005843 Bacteria 4459
269 Ga0068860_100050945 3300005843 Bacteria 3941
270 Ga0068860_100137815 3300005843 Bacteria 2344
271 Ga0068862_100012603 3300005844 Bacteria 6999
272 Ga0068862_100036890 3300005844 Bacteria 4143
273 Ga0068862_100041178 3300005844 Bacteria 3930
274 Ga0068862_100511119 3300005844 Bacteria 1142
275 Ga0081455_10000395 3300005937 Bacteria 57467
276 Ga0081455_10001457 3300005937 Bacteria 29274
277 Ga0081455_10002932 3300005937 Bacteria 19999
278 Ga0081539_10001300 3300005985 Bacteria 43786
279 Ga0081539_10015064 3300005985 Bacteria 5662
280 Ga0081539_10064432 3300005985 Bacteria 1994
281 Ga0075365_10073461 3300006038 Bacteria 2305
282 Ga0075362_10026145 3300006177 Bacteria 2490
283 Ga0075362_10048194 3300006177 Bacteria 1900
284 Ga0075367_10049571 3300006178 Bacteria 2475
285 Ga0075369_10000420 3300006186 Bacteria 12842
286 Ga0075369_10017179 3300006186 Bacteria 2929
287 Ga0097621_100014631 3300006237 Bacteria 5879
288 Ga0097621_100168773 3300006237 Bacteria 1885
289 Ga0097621_100328388 3300006237 Bacteria 1356
290 Ga0068871_100108920 3300006358 Bacteria 2329
291 Ga0075431_100175904 3300006847 Bacteria 2198
292 Ga0075433_10025955 3300006852 Bacteria 4956
293 Ga0075434_100057873 3300006871 Bacteria 3852
294 Ga0068865_100000004 3300006881 Bacteria 226236
295 Ga0068865_100029233 3300006881 Bacteria 3654
296 Ga0075436_100181547 3300006914 Bacteria 1487
297 Ga0097620_100000682 3300006931 Bacteria 34086
298 Ga0097620_100007995 3300006931 Bacteria 10722
299 Ga0097620_100049240 3300006931 Bacteria 4232
300 Ga0105240_10018988 3300009093 Bacteria 9204
301 Ga0105240_10062248 3300009093 Bacteria 4646
302 Ga0105240_10104302 3300009093 Bacteria 3443
303 Ga0105240_10771042 3300009093 Bacteria 1044
304 Ga0111539_10181217 3300009094 Bacteria 2460
305 Ga0105245_10000195 3300009098 Bacteria 57594
306 Ga0105245_10000620 3300009098 Bacteria 32174
307 Ga0105245_10008689 3300009098 Bacteria 8858
308 Ga0105245_10319433 3300009098 Bacteria 1529
309 Ga0105245_10377976 3300009098 Bacteria 1410
310 Ga0114129_10080446 3300009147 Bacteria 4529
311 Ga0105243_10000146 3300009148 Bacteria 81008
312 Ga0105243_10000227 3300009148 Bacteria 64901
313 Ga0105243_10060551 3300009148 Bacteria 3024
314 Ga0105243_10190486 3300009148 Bacteria 1791
315 Ga0105243_10238195 3300009148 Bacteria 1618
316 Ga0105243_10471344 3300009148 Bacteria 1183
317 Ga0105241_10001135 3300009174 Bacteria 20278
318 Ga0105241_10006348 3300009174 Bacteria 8715
319 Ga0105241_10041561 3300009174 Bacteria 3474
320 Ga0105241_10161430 3300009174 Bacteria 1843
321 Ga0105242_10007987 3300009176 Bacteria 8152
322 Ga0105242_10062392 3300009176 Bacteria 3067
323 Ga0105242_10082968 3300009176 Bacteria 2683
324 Ga0105242_10374307 3300009176 Bacteria 1322
325 Ga0105248_10000824 3300009177 Bacteria 34827
326 Ga0105248_10001472 3300009177 Bacteria 26219
327 Ga0105248_10015827 3300009177 Bacteria 8313
328 Ga0105248_10031200 3300009177 Bacteria 5956
329 Ga0105248_10080171 3300009177 Bacteria 3669
330 Ga0105248_10208305 3300009177 Bacteria 2203
331 Ga0105248_10251176 3300009177 Bacteria 1991
332 Ga0105248_10292142 3300009177 Bacteria 1835
333 Ga0105237_10091788 3300009545 Bacteria 3027
334 Ga0105237_10231725 3300009545 Bacteria 1848
335 Ga0105238_10030863 3300009551 Bacteria 5454
336 Ga0105238_10031422 3300009551 Bacteria 5405
337 Ga0105238_10032552 3300009551 Bacteria 5306
338 Ga0105238_10070437 3300009551 Bacteria 3496
339 Ga0105238_10107856 3300009551 Bacteria 2766
340 Ga0105249_10035540 3300009553 Bacteria 4519
341 Ga0105249_10323481 3300009553 Bacteria 1554
342 Ga0105239_10229587 3300010375 Bacteria 2082
343 Ga0105239_10479106 3300010375 Bacteria 1414
344 Ga0105239_10653171 3300010375 Bacteria 1201
345 Ga0105246_10002081 3300011119 Bacteria 12059
346 Ga0105246_10033675 3300011119 Bacteria 3408
347 Ga0105246_10340701 3300011119 Bacteria 1225
348 Ga0105246_10575611 3300011119 Bacteria 969
349 Ga0157373_10002262 3300013100 Bacteria 14594
350 Ga0157373_10017492 3300013100 Bacteria 5221
351 Ga0157373_10028733 3300013100 Bacteria 4010
352 Ga0157373_10123932 3300013100 Bacteria 1817
353 Ga0157371_10000094 3300013102 Bacteria 139074
354 Ga0157371_10002300 3300013102 Bacteria 18396
355 Ga0157371_10032088 3300013102 Bacteria 3781
356 Ga0157371_10256567 3300013102 Bacteria 1260
357 Ga0157371_10316019 3300013102 Bacteria 1133
358 Ga0157370_10002033 3300013104 Bacteria 24869
359 Ga0157370_10006332 3300013104 Bacteria 13079
360 Ga0157370_10014466 3300013104 Bacteria 8066
361 Ga0157370_10039775 3300013104 Bacteria 4543
362 Ga0157369_10189836 3300013105 Bacteria 2159
363 Ga0157369_10190642 3300013105 Bacteria 2154
364 Ga0157374_10001738 3300013296 Bacteria 18262
365 Ga0157378_10000408 3300013297 Bacteria 42491
366 Ga0157378_10001977 3300013297 Bacteria 18333
367 Ga0157378_10009310 3300013297 Bacteria 8556
368 Ga0157378_10131186 3300013297 Bacteria 2319
369 Ga0157378_10237536 3300013297 Bacteria 1740
370 Ga0163162_10023769 3300013306 Bacteria 6049
371 Ga0163162_10177052 3300013306 Bacteria 2258
372 Ga0163162_10741874 3300013306 Bacteria 1102
373 Ga0157372_10302408 3300013307 Bacteria 1861
374 Ga0157372_10406797 3300013307 Bacteria 1586
375 Ga0157372_10442943 3300013307 Bacteria 1514
376 Ga0157375_10007814 3300013308 Bacteria 9358
377 Ga0157375_10009852 3300013308 Bacteria 8403
378 Ga0157375_10059996 3300013308 Bacteria 3770
379 Ga0157375_10442007 3300013308 Bacteria 1466
380 Ga0157375_10707668 3300013308 Bacteria 1161
381 Ga0157380_10022797 3300014326 Bacteria 4721
382 Ga0157380_10030260 3300014326 Bacteria 4145
383 Ga0157380_10185993 3300014326 Bacteria 1829
384 Ga0157377_10048205 3300014745 Bacteria 2389
385 Ga0157379_10385122 3300014968 Bacteria 1287
386 Ga0157376_10000131 3300014969 Bacteria 51790
387 Ga0163161_10057115 3300017792 Bacteria 2836
388 Ga0206356_11001459 3300020070 Bacteria 2525
389 Ga0206353_11750927 3300020082 Bacteria 2535
390 Ga0213873_10000027 3300021358 Bacteria 73909
391 Ga0213872_10000056 3300021361 Bacteria 101365
392 Ga0213876_10000004 3300021384 Bacteria 943822
393 Ga0213876_10000873 3300021384 Bacteria 20190
394 Ga0213876_10003321 3300021384 Bacteria 9217
395 Ga0213876_10005484 3300021384 Bacteria 6966
396 Ga0213876_10070156 3300021384 Bacteria 1851
397 Ga0213876_10083380 3300021384 Bacteria 1691
398 Ga0213871_10000912 3300021441 Bacteria 4538
399 Ga0209674_103207 3300025226 Bacteria 3096
400 Ga0209563_100058 3300025230 Bacteria 302571
401 Ga0209437_105644 3300025233 Bacteria 2122
402 Ga0207425_1000025 3300025245 Bacteria 321872
403 Ga0207425_1006442 3300025245 Bacteria 3208
404 Ga0209677_109339 3300025253 Bacteria 1773
405 Ga0209148_1000008 3300025254 Bacteria 1504371
406 Ga0209148_1000074 3300025254 Bacteria 314356
407 Ga0209129_1000671 3300025258 Bacteria 22663
408 Ga0209233_1000164 3300025261 Bacteria 152430
409 Ga0209565_1000011 3300025263 Bacteria 637062
410 Ga0209565_1000306 3300025263 Bacteria 45881
411 Ga0209455_1000002 3300025272 Bacteria 1505459
412 Ga0209455_1000767 3300025272 Bacteria 18024
413 Ga0209673_1002201 3300025273 Bacteria 14286
414 Ga0209673_1008882 3300025273 Bacteria 4421
415 Ga0209675_1008549 3300025291 Bacteria 3743
416 Ga0209676_1000276 3300025292 Bacteria 106867
417 Ga0209025_1000663 3300025294 Bacteria 59620
418 Ga0209758_1000002 3300025297 Bacteria 1400310
419 Ga0209758_1000017 3300025297 Bacteria 754393
420 Ga0209758_1005550 3300025297 Bacteria 9619
421 Ga0209050_1000001 3300025298 Bacteria 3563507
422 Ga0209050_1000071 3300025298 Bacteria 295478
423 Ga0209050_1000823 3300025298 Bacteria 43253
424 Ga0209050_1005347 3300025298 Bacteria 8131
425 Ga0209050_1014947 3300025298 Bacteria 3301
426 Ga0209256_1000016 3300025299 Bacteria 599092
427 Ga0207426_1026337 3300025302 Bacteria 1949
428 Ga0209051_1000689 3300025303 Bacteria 37393
429 Ga0209257_1000027 3300025304 Bacteria 703541
430 Ga0209257_1000695 3300025304 Bacteria 52248
431 Ga0209257_1005113 3300025304 Bacteria 9506
432 Ga0209257_1012649 3300025304 Bacteria 3868
433 Ga0209257_1012697 3300025304 Bacteria 3854
434 Ga0209257_1014104 3300025304 Bacteria 3471
435 Ga0207697_10000109 3300025315 Bacteria 38398
436 Ga0207697_10013441 3300025315 Bacteria 3416
437 Ga0207656_10005154 3300025321 Bacteria 4595
438 Ga0207656_10020691 3300025321 Bacteria 2618
439 Ga0207682_10001908 3300025893 Bacteria 9464
440 Ga0207642_10002992 3300025899 Bacteria 5292
441 Ga0207688_10147536 3300025901 Bacteria 1387
442 Ga0207680_10001510 3300025903 Bacteria 10959
443 Ga0207680_10013148 3300025903 Bacteria 4242
444 Ga0207680_10116490 3300025903 Bacteria 1741
445 Ga0207647_10000446 3300025904 Bacteria 33539
446 Ga0207647_10001428 3300025904 Bacteria 18307
447 Ga0207647_10001494 3300025904 Bacteria 17967
448 Ga0207647_10007151 3300025904 Bacteria 8094
449 Ga0207647_10015410 3300025904 Bacteria 5241
450 Ga0207647_10021613 3300025904 Bacteria 4294
451 Ga0207647_10037408 3300025904 Bacteria 3078
452 Ga0207647_10051647 3300025904 Bacteria 2540
453 Ga0207645_10002620 3300025907 Bacteria 14026
454 Ga0207645_10022319 3300025907 Bacteria 4120
455 Ga0207643_10022846 3300025908 Bacteria 3446
456 Ga0207705_10000002 3300025909 Bacteria 2046852
457 Ga0207705_10000055 3300025909 Bacteria 160436
458 Ga0207705_10000179 3300025909 Bacteria 66765
459 Ga0207705_10001170 3300025909 Bacteria 21351
460 Ga0207705_10006076 3300025909 Bacteria 8986
461 Ga0207705_10023934 3300025909 Bacteria 4358
462 Ga0207705_10071722 3300025909 Bacteria 2511
463 Ga0207705_10294663 3300025909 Bacteria 1243
464 Ga0207654_10000020 3300025911 Bacteria 167053
465 Ga0207654_10018258 3300025911 Bacteria 3678
466 Ga0207707_10010908 3300025912 Bacteria 7901
467 Ga0207707_10020730 3300025912 Bacteria 5742
468 Ga0207707_10357865 3300025912 Bacteria 1257
469 Ga0207695_10011332 3300025913 Bacteria 10807
470 Ga0207695_10020535 3300025913 Bacteria 7562
471 Ga0207695_10028820 3300025913 Bacteria 6147
472 Ga0207695_10063852 3300025913 Bacteria 3794
473 Ga0207695_10193423 3300025913 Bacteria 1951
474 Ga0207671_10004616 3300025914 Bacteria 13070
475 Ga0207671_10013921 3300025914 Bacteria 6385
476 Ga0207671_10014334 3300025914 Bacteria 6272
477 Ga0207660_10000048 3300025917 Bacteria 60104
478 Ga0207660_10004472 3300025917 Bacteria 9113
479 Ga0207660_10102214 3300025917 Bacteria 2142
480 Ga0207662_10041631 3300025918 Bacteria 2705
481 Ga0207662_10075972 3300025918 Bacteria 2041
482 Ga0207657_10000791 3300025919 Bacteria 33627
483 Ga0207657_10002553 3300025919 Bacteria 19693
484 Ga0207657_10004781 3300025919 Bacteria 14283
485 Ga0207657_10005726 3300025919 Bacteria 12962
486 Ga0207657_10008671 3300025919 Bacteria 10295
487 Ga0207657_10008888 3300025919 Bacteria 10161
488 Ga0207657_10013847 3300025919 Bacteria 7892
489 Ga0207657_10020682 3300025919 Bacteria 6213
490 Ga0207657_10023951 3300025919 Bacteria 5668
491 Ga0207657_10065903 3300025919 Bacteria 3085
492 Ga0207657_10076413 3300025919 Bacteria 2825
493 Ga0207657_10146230 3300025919 Bacteria 1928
494 Ga0207649_10000018 3300025920 Bacteria 225137
495 Ga0207649_10000130 3300025920 Bacteria 64246
496 Ga0207649_10034508 3300025920 Bacteria 3032
497 Ga0207649_10042330 3300025920 Bacteria 2778
498 Ga0207649_10046233 3300025920 Bacteria 2673
499 Ga0207649_10096375 3300025920 Bacteria 1949
500 Ga0207652_10000001 3300025921 Bacteria 1006643
501 Ga0207652_10009263 3300025921 Bacteria 7917
502 Ga0207652_10391557 3300025921 Bacteria 1254
503 Ga0207646_10046302 3300025922 Bacteria 3902
504 Ga0207681_10001626 3300025923 Bacteria 14490
505 Ga0207681_10028973 3300025923 Bacteria 3590
506 Ga0207681_10067923 3300025923 Bacteria 2473
507 Ga0207694_10018991 3300025924 Bacteria 5196
508 Ga0207694_10034835 3300025924 Bacteria 3861
509 Ga0207694_10047352 3300025924 Bacteria 3326
510 Ga0207694_10048056 3300025924 Bacteria 3301
511 Ga0207650_10007235 3300025925 Bacteria 7559
512 Ga0207650_10056691 3300025925 Bacteria 2912
513 Ga0207650_10088181 3300025925 Bacteria 2365
514 Ga0207650_10191833 3300025925 Bacteria 1633
515 Ga0207650_10286751 3300025925 Bacteria 1342
516 Ga0207659_10024872 3300025926 Bacteria 4019
517 Ga0207659_10108461 3300025926 Bacteria 2106
518 Ga0207659_10270936 3300025926 Bacteria 1385
519 Ga0207687_10002087 3300025927 Bacteria 13658
520 Ga0207687_10011298 3300025927 Bacteria 5837
521 Ga0207687_10020101 3300025927 Bacteria 4429
522 Ga0207687_10149302 3300025927 Bacteria 1781
523 Ga0207664_10061578 3300025929 Bacteria 2994
524 Ga0207644_10001832 3300025931 Bacteria 13807
525 Ga0207644_10002824 3300025931 Bacteria 11190
526 Ga0207644_10014341 3300025931 Bacteria 5301
527 Ga0207644_10025155 3300025931 Bacteria 4092
528 Ga0207644_10041358 3300025931 Bacteria 3260
529 Ga0207644_10064136 3300025931 Bacteria 2669
530 Ga0207644_10080205 3300025931 Bacteria 2410
531 Ga0207690_10000001 3300025932 Bacteria 807539
532 Ga0207690_10000002 3300025932 Bacteria 807473
533 Ga0207690_10000003 3300025932 Bacteria 783011
534 Ga0207690_10000004 3300025932 Bacteria 746138
535 Ga0207690_10000063 3300025932 Bacteria 95620
536 Ga0207690_10007315 3300025932 Bacteria 6555
537 Ga0207690_10009895 3300025932 Bacteria 5663
538 Ga0207690_10063498 3300025932 Bacteria 2518
539 Ga0207690_10102030 3300025932 Bacteria 2051
540 Ga0207690_10177260 3300025932 Bacteria 1602
541 Ga0207706_10000300 3300025933 Bacteria 53727
542 Ga0207706_10006908 3300025933 Bacteria 10497
543 Ga0207706_10011966 3300025933 Bacteria 7901
544 Ga0207706_10027233 3300025933 Bacteria 5112
545 Ga0207706_10040050 3300025933 Bacteria 4153
546 Ga0207706_10045683 3300025933 Bacteria 3879
547 Ga0207706_10057532 3300025933 Bacteria 3425
548 Ga0207706_10081224 3300025933 Bacteria 2849
549 Ga0207686_10000999 3300025934 Bacteria 16788
550 Ga0207709_10000093 3300025935 Bacteria 139110
551 Ga0207709_10000314 3300025935 Bacteria 52842
552 Ga0207709_10204658 3300025935 Bacteria 1412
553 Ga0207669_10000086 3300025937 Bacteria 46934
554 Ga0207669_10001266 3300025937 Bacteria 10718
555 Ga0207669_10020553 3300025937 Bacteria 3466
556 Ga0207669_10035517 3300025937 Bacteria 2837
557 Ga0207669_10041981 3300025937 Bacteria 2666
558 Ga0207669_10079239 3300025937 Bacteria 2096
559 Ga0207669_10110758 3300025937 Bacteria 1839
560 Ga0207669_10115466 3300025937 Bacteria 1810
561 Ga0207669_10160698 3300025937 Bacteria 1587
562 Ga0207704_10000005 3300025938 Bacteria 225353
563 Ga0207704_10048331 3300025938 Bacteria 2550
564 Ga0207704_10286816 3300025938 Bacteria 1254
565 Ga0207704_10294814 3300025938 Bacteria 1239
566 Ga0207691_10000294 3300025940 Bacteria 49457
567 Ga0207691_10025393 3300025940 Bacteria 5564
568 Ga0207691_10040577 3300025940 Bacteria 4299
569 Ga0207691_10051372 3300025940 Bacteria 3769
570 Ga0207691_10105501 3300025940 Bacteria 2510
571 Ga0207691_10121346 3300025940 Bacteria 2316
572 Ga0207691_10129700 3300025940 Bacteria 2228
573 Ga0207711_10003143 3300025941 Bacteria 14401
574 Ga0207711_10011392 3300025941 Bacteria 7391
575 Ga0207711_10022434 3300025941 Bacteria 5279
576 Ga0207711_10032269 3300025941 Bacteria 4428
577 Ga0207711_10103754 3300025941 Bacteria 2518
578 Ga0207711_10126582 3300025941 Bacteria 2286
579 Ga0207689_10000043 3300025942 Bacteria 93054
580 Ga0207689_10000064 3300025942 Bacteria 84222
581 Ga0207689_10030619 3300025942 Bacteria 4484
582 Ga0207689_10071243 3300025942 Bacteria 2855
583 Ga0207679_10016813 3300025945 Bacteria 4864
584 Ga0207679_10016870 3300025945 Bacteria 4856
585 Ga0207679_10033341 3300025945 Bacteria 3622
586 Ga0207679_10049858 3300025945 Bacteria 3056
587 Ga0207679_10056602 3300025945 Bacteria 2896
588 Ga0207679_10121026 3300025945 Bacteria 2083
589 Ga0207679_10571384 3300025945 Bacteria 1016
590 Ga0207667_10000006 3300025949 Bacteria 679876
591 Ga0207667_10000016 3300025949 Bacteria 391466
592 Ga0207667_10002740 3300025949 Bacteria 21785
593 Ga0207667_10020043 3300025949 Bacteria 7447
594 Ga0207667_10151404 3300025949 Bacteria 2387
595 Ga0207667_10340567 3300025949 Bacteria 1530
596 Ga0207651_10000007 3300025960 Bacteria 225286
597 Ga0207651_10000355 3300025960 Bacteria 19400
598 Ga0207651_10006669 3300025960 Bacteria 6075
599 Ga0207651_10008089 3300025960 Bacteria 5650
600 Ga0207651_10039113 3300025960 Bacteria 3124
601 Ga0207651_10315291 3300025960 Bacteria 1305
602 Ga0207668_10000021 3300025972 Bacteria 137592
603 Ga0207668_10000632 3300025972 Bacteria 21688
604 Ga0207668_10193417 3300025972 Bacteria 1614
605 Ga0207640_10000139 3300025981 Bacteria 53517
606 Ga0207640_10001142 3300025981 Bacteria 14572
607 Ga0207640_10002525 3300025981 Bacteria 9806
608 Ga0207640_10008156 3300025981 Bacteria 5802
609 Ga0207640_10011805 3300025981 Bacteria 4957
610 Ga0207640_10023138 3300025981 Bacteria 3731
611 Ga0207640_10084258 3300025981 Bacteria 2182
612 Ga0207640_10115426 3300025981 Bacteria 1912
613 Ga0207640_10152945 3300025981 Bacteria 1697
614 Ga0207640_10179802 3300025981 Bacteria 1585
615 Ga0207640_10275839 3300025981 Bacteria 1318
616 Ga0207658_10004936 3300025986 Bacteria 9201
617 Ga0207658_10005047 3300025986 Bacteria 9087
618 Ga0207658_10007088 3300025986 Bacteria 7637
619 Ga0207658_10013277 3300025986 Bacteria 5625
620 Ga0207658_10021107 3300025986 Bacteria 4516
621 Ga0207677_10000014 3300026023 Bacteria 181712
622 Ga0207677_10000085 3300026023 Bacteria 78393
623 Ga0207677_10006963 3300026023 Bacteria 6218
624 Ga0207677_10452899 3300026023 Bacteria 1100
625 Ga0207677_10475689 3300026023 Bacteria 1075
626 Ga0207703_10000142 3300026035 Bacteria 84567
627 Ga0207703_10000254 3300026035 Bacteria 60234
628 Ga0207703_10001455 3300026035 Bacteria 21592
629 Ga0207703_10006195 3300026035 Bacteria 9572
630 Ga0207703_10008809 3300026035 Bacteria 7955
631 Ga0207703_10054466 3300026035 Bacteria 3253
632 Ga0207703_10351393 3300026035 Bacteria 1357
633 Ga0207703_10413948 3300026035 Bacteria 1253
634 Ga0207639_10001668 3300026041 Bacteria 14964
635 Ga0207639_10001919 3300026041 Bacteria 13963
636 Ga0207639_10002219 3300026041 Bacteria 13079
637 Ga0207639_10003835 3300026041 Bacteria 10133
638 Ga0207639_10006063 3300026041 Bacteria 8205
639 Ga0207639_10006448 3300026041 Bacteria 7980
640 Ga0207639_10027203 3300026041 Bacteria 4163
641 Ga0207639_10160692 3300026041 Bacteria 1893
642 Ga0207639_10222570 3300026041 Bacteria 1631
643 Ga0207639_10457969 3300026041 Bacteria 1159
644 Ga0207678_10000072 3300026067 Bacteria 81033
645 Ga0207678_10000972 3300026067 Bacteria 26111
646 Ga0207678_10002415 3300026067 Bacteria 16979
647 Ga0207678_10003727 3300026067 Bacteria 13709
648 Ga0207678_10004478 3300026067 Bacteria 12563
649 Ga0207678_10004783 3300026067 Bacteria 12153
650 Ga0207678_10081355 3300026067 Bacteria 2772
651 Ga0207678_10091429 3300026067 Bacteria 2601
652 Ga0207678_10091554 3300026067 Bacteria 2599
653 Ga0207678_10117340 3300026067 Bacteria 2271
654 Ga0207678_10133243 3300026067 Bacteria 2120
655 Ga0207678_10344385 3300026067 Bacteria 1285
656 Ga0207702_10002032 3300026078 Bacteria 19607
657 Ga0207702_10013111 3300026078 Bacteria 6891
658 Ga0207702_10038212 3300026078 Bacteria 4020
659 Ga0207702_10058372 3300026078 Bacteria 3284
660 Ga0207702_10400581 3300026078 Bacteria 1323
661 Ga0207702_10440943 3300026078 Bacteria 1262
662 Ga0207641_10013104 3300026088 Bacteria 6799
663 Ga0207641_10016059 3300026088 Bacteria 6132
664 Ga0207641_10064470 3300026088 Bacteria 3131
665 Ga0207641_10431942 3300026088 Bacteria 1270
666 Ga0207648_10000005 3300026089 Bacteria 225083
667 Ga0207648_10001537 3300026089 Bacteria 25401
668 Ga0207648_10004112 3300026089 Bacteria 15062
669 Ga0207648_10008749 3300026089 Bacteria 9757
670 Ga0207648_10014658 3300026089 Bacteria 7237
671 Ga0207648_10165026 3300026089 Bacteria 1957
672 Ga0207676_10000331 3300026095 Bacteria 40710
673 Ga0207676_10004949 3300026095 Bacteria 9443
674 Ga0207674_10000814 3300026116 Bacteria 40536
675 Ga0207674_10008433 3300026116 Bacteria 11906
676 Ga0207674_10015150 3300026116 Bacteria 8484
677 Ga0207674_10019142 3300026116 Bacteria 7422
678 Ga0207674_10021242 3300026116 Bacteria 6996
679 Ga0207674_10036234 3300026116 Bacteria 5143
680 Ga0207674_10040826 3300026116 Bacteria 4803
681 Ga0207674_10047233 3300026116 Bacteria 4415
682 Ga0207674_10056963 3300026116 Bacteria 3965
683 Ga0207674_10064391 3300026116 Bacteria 3698
684 Ga0207674_10083489 3300026116 Bacteria 3194
685 Ga0207675_100001943 3300026118 Bacteria 20638
686 Ga0207675_100119346 3300026118 Bacteria 2494
687 Ga0207675_100306769 3300026118 Bacteria 1547
688 Ga0207683_10000181 3300026121 Bacteria 54142
689 Ga0207683_10010651 3300026121 Bacteria 7838
690 Ga0207683_10020351 3300026121 Bacteria 5674
691 Ga0207683_10192584 3300026121 Bacteria 1851
692 Ga0207683_10411685 3300026121 Bacteria 1244
693 Ga0207698_10010153 3300026142 Bacteria 6033
694 Ga0207698_10012830 3300026142 Bacteria 5504
695 Ga0207698_10026229 3300026142 Bacteria 4119
696 Ga0207698_10068966 3300026142 Bacteria 2794
697 Ga0207698_10092206 3300026142 Bacteria 2482
698 Ga0209967_1009977 3300027364 Bacteria 1320
699 Ga0209974_10007473 3300027876 Bacteria 3765
700 Ga0209974_10014975 3300027876 Bacteria 2575
701 Ga0268266_10000002 3300028379 Bacteria 3059047
702 Ga0268266_10000318 3300028379 Bacteria 76400
703 Ga0268266_10003762 3300028379 Bacteria 14885
704 Ga0268266_10006216 3300028379 Bacteria 10970
705 Ga0268266_10024360 3300028379 Bacteria 5148
706 Ga0268266_10088217 3300028379 Bacteria 2714
707 Ga0268266_10144969 3300028379 Bacteria 2134
708 Ga0268266_10331890 3300028379 Bacteria 1425
709 Ga0268266_10652999 3300028379 Bacteria 1012
710 Ga0268265_10000789 3300028380 Bacteria 30232
711 Ga0268265_10026131 3300028380 Bacteria 4151
712 Ga0268265_10256334 3300028380 Bacteria 1552
713 Ga0268264_10002322 3300028381 Bacteria 16822
714 Ga0268264_10018939 3300028381 Bacteria 5628
715 Ga0268264_10042335 3300028381 Bacteria 3770
716 Ga0268264_10429695 3300028381 Bacteria 1275
717 Ga0307517_10009945 3300028786 Bacteria 13395
718 Ga0307517_10011892 3300028786 Bacteria 12017
719 Ga0265338_10053043 3300028800 Bacteria 3632
720 Ga0265340_10015248 3300031247 Bacteria 3998
721 Ga0307408_100011716 3300031548 Bacteria 5798
722 Ga0307408_100016395 3300031548 Bacteria 4944
723 Ga0307408_100059266 3300031548 Bacteria 2786
724 Ga0307408_100216729 3300031548 Bacteria 1559
725 Ga0307408_100396766 3300031548 Bacteria 1183
726 Ga0307508_10002203 3300031616 Bacteria 20787
727 Ga0265314_10054163 3300031711 Bacteria 2777
728 Ga0307405_10045849 3300031731 Bacteria 2681
729 Ga0307405_10060893 3300031731 Bacteria 2383
730 Ga0307405_10126124 3300031731 Bacteria 1760
731 Ga0307405_10143520 3300031731 Bacteria 1668
732 Ga0307405_10199937 3300031731 Bacteria 1450
733 Ga0307405_10233591 3300031731 Bacteria 1357
734 Ga0307413_10010607 3300031824 Bacteria 4482
735 Ga0307413_10080578 3300031824 Bacteria 2085
736 Ga0307413_10095823 3300031824 Bacteria 1946
737 Ga0307413_10119634 3300031824 Bacteria 1781
738 Ga0307413_10153354 3300031824 Bacteria 1608
739 Ga0307413_10173023 3300031824 Bacteria 1530
740 Ga0307410_10001711 3300031852 Bacteria 10120
741 Ga0307410_10063922 3300031852 Bacteria 2526
742 Ga0307410_10121780 3300031852 Bacteria 1903
743 Ga0307406_10028909 3300031901 Bacteria 3352
744 Ga0307406_10031864 3300031901 Bacteria 3213
745 Ga0307406_10110373 3300031901 Bacteria 1892
746 Ga0307406_10111203 3300031901 Bacteria 1886
747 Ga0307406_10213899 3300031901 Bacteria 1428
748 Ga0307407_10042853 3300031903 Bacteria 2541
749 Ga0307412_10005140 3300031911 Bacteria 7326
750 Ga0307412_10042238 3300031911 Bacteria 2961
751 Ga0307412_10089533 3300031911 Bacteria 2149
752 Ga0307412_10110118 3300031911 Bacteria 1964
753 Ga0307412_10166831 3300031911 Bacteria 1642
754 Ga0307412_10210810 3300031911 Bacteria 1482
755 Ga0307412_10306474 3300031911 Bacteria 1257
756 Ga0307412_10311991 3300031911 Bacteria 1247
757 Ga0307409_100003478 3300031995 Bacteria 8561
758 Ga0307409_100016750 3300031995 Bacteria 4862
759 Ga0307409_100341322 3300031995 Bacteria 1409
760 Ga0307409_100529843 3300031995 Bacteria 1152
761 Ga0307416_100015921 3300032002 Bacteria 5209
762 Ga0307416_100025055 3300032002 Bacteria 4366
763 Ga0307416_100146606 3300032002 Bacteria 2156
764 Ga0307416_100147262 3300032002 Bacteria 2152
765 Ga0307416_100206292 3300032002 Bacteria 1870
766 Ga0307414_10002151 3300032004 Bacteria 10286
767 Ga0307414_10014045 3300032004 Bacteria 4786
768 Ga0307414_10038104 3300032004 Bacteria 3225
769 Ga0307414_10048367 3300032004 Bacteria 2933
770 Ga0307414_10079800 3300032004 Bacteria 2390
771 Ga0307414_10085270 3300032004 Bacteria 2326
772 Ga0307414_10122390 3300032004 Bacteria 2003
773 Ga0307414_10269530 3300032004 Bacteria 1425
774 Ga0307414_10334196 3300032004 Bacteria 1294
775 Ga0307414_10429377 3300032004 Bacteria 1154
776 Ga0307411_10049862 3300032005 Bacteria 2723
777 Ga0307411_10055208 3300032005 Bacteria 2612
778 Ga0307411_10217865 3300032005 Bacteria 1479
779 Ga0307411_10229289 3300032005 Bacteria 1446
780 Ga0307411_10504986 3300032005 Bacteria 1023
781 Ga0307415_100045438 3300032126 Bacteria 2944
782 Ga0307415_100087862 3300032126 Bacteria 2241
783 Ga0307415_100390762 3300032126 Bacteria 1184
784 Ga0307510_10034948 3300033180 Bacteria 5618
785 Ga0307510_10066196 3300033180 Bacteria 3651
786 Ga0373931_0028431 3300035691 Bacteria 2863
787 Ga0373925_0290818 3300037068 Bacteria 1317
788 Ga0395899_0128664 3300037312 Bacteria 1810
789 Ga0395900_0002008 3300037418 Bacteria 22966
790 Ga0395900_0002613 3300037418 Bacteria 19679
791 Ga0395900_0004765 3300037418 Bacteria 14296
792 Ga0395900_0033362 3300037418 Bacteria 5298
793 Ga0395900_0047992 3300037418 Bacteria 4398
794 Ga0395900_0119069 3300037418 Bacteria 2710
795 Ga0395900_0317625 3300037418 Bacteria 1539
796 Ga0395898_0006213 3300037466 Bacteria 12795
797 Ga0395898_0007898 3300037466 Bacteria 11291
798 Ga0395898_0024226 3300037466 Bacteria 6122
799 Ga0395898_0030071 3300037466 Bacteria 5439
800 Ga0395898_0124061 3300037466 Bacteria 2474
801 Ga0395905_0000218 3300037471 Bacteria 87745
802 Ga0395905_0000688 3300037471 Bacteria 44764
803 Ga0395905_0014317 3300037471 Bacteria 7580
804 Ga0395905_0017192 3300037471 Bacteria 6870
805 Ga0395905_0125168 3300037471 Bacteria 2417
806 Ga0395905_0140258 3300037471 Bacteria 2274
807 Ga0395905_0175341 3300037471 Bacteria 2013
808 Ga0395905_0344010 3300037471 Bacteria 1383
809 Ga0395901_0002884 3300038443 Bacteria 17345
810 Ga0395901_0019988 3300038443 Bacteria 6850
811 Ga0395901_0058836 3300038443 Bacteria 3998
812 Ga0395901_0071197 3300038443 Bacteria 3623
813 Ga0395901_0074595 3300038443 Bacteria 3539
814 Ga0395901_0296589 3300038443 Bacteria 1676
815 Ga0436365_0122535 3300039437 Bacteria 5701
816 Ga0436365_0695503 3300039437 Bacteria 11620
817 Ga0436365_0758923 3300039437 Bacteria 1597
818 Ga0436365_1205090 3300039437 Bacteria 128002
819 Ga0436365_1268241 3300039437 Bacteria 8581
820 Ga0436360_0428998 3300039438 Bacteria 19607
821 Ga0436361_0012467 3300039447 Bacteria 129952
822 Ga0436361_0692291 3300039447 Bacteria 9881
823 Ga0436363_1350835 3300039450 Bacteria 2465
824 Ga0436362_0251358 3300039453 Bacteria 1088
825 Ga0439436_0023454 3300041404 Bacteria 1825
826 Ga0439439_0011720 3300041406 Bacteria 2113
827 Ga0439465_0000784 3300041413 Bacteria 9908
828 Ga0451853_2025836 3300041512 Bacteria 1707
829 Ga0439431_0000151 3300041997 Bacteria 12684
830 Ga0439431_0025523 3300041997 Bacteria 1443
831 Ga0439448_0002886 3300042005 Bacteria 4709
832 Ga0439432_001267 3300042006 Bacteria 9551
833 Ga0439455_0000097 3300042012 Bacteria 8524
834 Ga0439462_0001229 3300042015 Bacteria 5612
835 Ga0439446_0010555 3300042156 Bacteria 2490
836 Ga0439458_0001639 3300042157 Bacteria 5587
837 Ga0439434_0000358 3300042435 Bacteria 13106
838 Ga0439434_0025664 3300042435 Bacteria 1779
839 Ga0466972_0002157 3300044658 Bacteria 9673
840 Ga0466961_0034126 3300044693 Bacteria 3267
841 Ga0466963_0010040 3300044694 Bacteria 5724
842 Ga0466963_0023344 3300044694 Bacteria 3926
843 Ga0466971_0060519 3300044719 Bacteria 1711
844 Ga0466968_0068784 3300044735 Bacteria 1538
845 Ga0466970_0004756 3300044765 Bacteria 6707
846 Ga0466957_0007537 3300044842 Bacteria 6150
847 Ga0466957_0047567 3300044842 Bacteria 2606
848 Ga0466959_0097360 3300045049 Bacteria 2109
849 Ga0466958_0004137 3300045836 Bacteria 7618
850 Ga0466958_0020218 3300045836 Bacteria 3881
851 Ga0466958_0169885 3300045836 Bacteria 1380
852 Ga0466967_0015827 3300045976 Bacteria 5927
853 Ga0495638_0000249 3300046460 Bacteria 73312
854 Ga0495638_0000266 3300046460 Bacteria 70490
855 Ga0495638_0014466 3300046460 Bacteria 5331
856 Ga0495650_0000367 3300046471 Bacteria 78952
857 Ga0495650_0040743 3300046471 Bacteria 1991
858 Ga0495585_0001411 3300046492 Bacteria 18902
859 Ga0495585_0043957 3300046492 Bacteria 2497
860 Ga0495596_0004692 3300046500 Bacteria 6611
861 Ga0495583_0000175 3300046506 Bacteria 108912
862 Ga0495583_0000262 3300046506 Bacteria 86241
863 Ga0495583_0000879 3300046506 Bacteria 36366
864 Ga0495583_0004900 3300046506 Bacteria 9316
865 Ga0495583_0020752 3300046506 Bacteria 3394
866 Ga0495606_0000071 3300046507 Bacteria 175933
867 Ga0495632_0001780 3300046519 Bacteria 17376
868 Ga0495637_0000886 3300046520 Bacteria 19335
869 Ga0495643_0000053 3300046522 Bacteria 202031
870 Ga0495643_0000824 3300046522 Bacteria 33778
871 Ga0495643_0002434 3300046522 Bacteria 14783
872 Ga0495643_0008133 3300046522 Bacteria 6677
873 Ga0495643_0107803 3300046522 Bacteria 1419
874 Ga0495648_0000015 3300046524 Bacteria 285838
875 Ga0495648_0000132 3300046524 Bacteria 88064
876 Ga0495648_0046973 3300046524 Bacteria 2673
877 Ga0495648_0068485 3300046524 Bacteria 2070
878 Ga0495648_0075450 3300046524 Bacteria 1939
879 Ga0495663_0000020 3300046525 Bacteria 124560
880 Ga0495663_0004296 3300046525 Bacteria 4016
881 Ga0495663_0008361 3300046525 Bacteria 2866
882 Ga0495663_0077844 3300046525 Bacteria 1064
883 Ga0495642_0015818 3300046528 Bacteria 2937
884 Ga0495654_0000264 3300046530 Bacteria 47686
885 Ga0495586_0135428 3300046535 Bacteria 1381
886 Ga0495587_0271263 3300046536 Bacteria 952
887 Ga0495621_0000168 3300046539 Bacteria 14780
888 Ga0495621_0003418 3300046539 Bacteria 4386
889 Ga0495621_0013025 3300046539 Bacteria 2606
890 Ga0495597_0075618 3300046542 Bacteria 1445
891 Ga0495633_0001251 3300046558 Bacteria 20233
892 Ga0495633_0001282 3300046558 Bacteria 19932
893 Ga0495633_0007590 3300046558 Bacteria 6216
894 Ga0495633_0107886 3300046558 Bacteria 1291
895 Ga0495668_0000013 3300046616 Bacteria 452938
896 Ga0495668_0080252 3300046616 Bacteria 1790
897 Ga0495611_0025321 3300046648 Bacteria 2585
898 Ga0495611_0041640 3300046648 Bacteria 2049
899 Ga0495611_0053434 3300046648 Bacteria 1823
900 Ga0495625_0000758 3300046660 Bacteria 45114
901 Ga0495625_0002253 3300046660 Bacteria 21209
902 Ga0495625_0005444 3300046660 Bacteria 11607
903 Ga0495625_0014698 3300046660 Bacteria 6235
904 Ga0495625_0037437 3300046660 Bacteria 3560
905 Ga0495625_0047242 3300046660 Bacteria 3104
906 Ga0495625_0083277 3300046660 Bacteria 2224
907 Ga0495625_0127241 3300046660 Bacteria 1728
908 Ga0495659_0010446 3300046664 Bacteria 2979
909 Ga0495661_0043833 3300046665 Bacteria 2747
910 Ga0495661_0161134 3300046665 Bacteria 1204
911 Ga0495669_0000023 3300046684 Bacteria 117158
912 Ga0495669_0020183 3300046684 Bacteria 2882
913 Ga0495670_0000010 3300046691 Bacteria 174071
914 Ga0495670_0127892 3300046691 Bacteria 1323
915 Ga0495671_0000031 3300046692 Bacteria 202030
916 Ga0495671_0000084 3300046692 Bacteria 89406
917 Ga0495671_0061568 3300046692 Bacteria 1851
918 Ga0495649_0007386 3300046694 Bacteria 6709
919 Ga0495660_0074046 3300046810 Bacteria 1800
920 Ga0495683_0013556 3300047323 Bacteria 4260
921 Ga0495687_000076 3300047443 Bacteria 149259
922 Ga0495687_000080 3300047443 Bacteria 147467
923 Ga0495673_0000206 3300047469 Bacteria 89432
924 Ga0495681_0008207 3300047470 Bacteria 6567
925 Ga0495681_0042262 3300047470 Bacteria 2207
926 Ga0495681_0049049 3300047470 Bacteria 1998
927 Ga0495681_0075327 3300047470 Bacteria 1519
928 Ga0495686_0000072 3300047472 Bacteria 216371
929 Ga0495686_0000962 3300047472 Bacteria 35471
930 Ga0495686_0002307 3300047472 Bacteria 18248
931 Ga0495686_0008799 3300047472 Bacteria 7353
932 Ga0495686_0032256 3300047472 Bacteria 3391
933 Ga0495686_0128192 3300047472 Bacteria 1507
934 Ga0496102_0189171 3300048905 Bacteria 1940
935 Ga0496102_0359455 3300048905 Bacteria 1371
936 Ga0496103_0172222 3300048906 Bacteria 1390
937 Ga0496107_0107019 3300048910 Bacteria 2054
938 Ga0496108_0006481 3300048911 Bacteria 9494
939 Ga0496108_0421565 3300048911 Bacteria 1166
940 Ga0496110_0054021 3300048913 Bacteria 3533
941 Ga0496110_0407099 3300048913 Bacteria 1240
942 Ga0496111_0095883 3300048914 Bacteria 2177
943 Ga0496112_0078396 3300048915 Bacteria 3267
944 Ga0496116_0068160 3300048919 Bacteria 2268
945 Ga0496117_0003631 3300048920 Bacteria 17769
946 Ga0496117_0050916 3300048920 Bacteria 2932
947 Ga0496117_0080500 3300048920 Bacteria 2142
948 Ga0496118_0000162 3300048921 Bacteria 119635
949 Ga0496118_0011572 3300048921 Bacteria 8594
950 Ga0496118_0086363 3300048921 Bacteria 2180
951 Ga0496120_0159902 3300048923 Bacteria 1124
952 Ga0496121_0001861 3300048924 Bacteria 33858
953 Ga0496121_0002939 3300048924 Bacteria 24918
954 Ga0496121_0002997 3300048924 Bacteria 24524
955 Ga0496121_0087804 3300048924 Bacteria 2440
956 Ga0496122_0008044 3300048925 Bacteria 11506
957 Ga0496122_0010853 3300048925 Bacteria 9326
958 Ga0496122_0013101 3300048925 Bacteria 8161
959 Ga0496122_0067654 3300048925 Bacteria 2571
960 Ga0496122_0189030 3300048925 Bacteria 1218
961 Ga0496123_0000643 3300048926 Bacteria 58206
962 Ga0496123_0000804 3300048926 Bacteria 50773
963 Ga0496123_0003112 3300048926 Bacteria 19028
964 Ga0496123_0017852 3300048926 Bacteria 5682
965 Ga0496123_0025967 3300048926 Bacteria 4401
966 Ga0496123_0102046 3300048926 Bacteria 1666
967 Ga0496123_0115362 3300048926 Bacteria 1524
968 Ga0496124_0000830 3300048927 Bacteria 50338
969 Ga0496124_0006400 3300048927 Bacteria 12839
970 Ga0496124_0007019 3300048927 Bacteria 12068
971 Ga0496124_0049666 3300048927 Bacteria 3577
972 Ga0496124_0132784 3300048927 Bacteria 1976
973 Ga0496125_0000335 3300048928 Bacteria 90043
974 Ga0496125_0006144 3300048928 Bacteria 13095
975 Ga0496125_0007778 3300048928 Bacteria 11339
976 Ga0496125_0009669 3300048928 Bacteria 9855
977 Ga0496125_0020332 3300048928 Bacteria 6231
978 Ga0496125_0020675 3300048928 Bacteria 6174
979 Ga0501300_004127 3300049523 Bacteria 2159
980 Ga0501032_0016697 3300049569 Bacteria 5159
981 Ga0501033_0118730 3300049570 Bacteria 1920
982 Ga0501034_0002878 3300049571 Bacteria 20010
983 Ga0501034_0004118 3300049571 Bacteria 16299
984 Ga0501034_0126968 3300049571 Bacteria 2535
985 Ga0501034_0162907 3300049571 Bacteria 2200
986 Ga0501036_0005868 3300049572 Bacteria 9947
987 Ga0501037_0054790 3300049573 Bacteria 2916
988 Ga0501038_0194414 3300049574 Bacteria 1631
989 Ga0501038_0212364 3300049574 Bacteria 1547
990 Ga0501039_0032064 3300049575 Bacteria 4050
991 Ga0501046_0029514 3300049580 Bacteria 4458
992 Ga0501046_0192311 3300049580 Bacteria 1522
993 Ga0501047_0110882 3300049581 Bacteria 2626
994 Ga0501047_0159672 3300049581 Bacteria 2126
995 Ga0501047_0301658 3300049581 Bacteria 1444
996 Ga0501068_0009942 3300049584 Bacteria 5332
997 Ga0501069_0008799 3300049585 Bacteria 5319
998 Ga0501070_0042512 3300049586 Bacteria 3785
999 Ga0501070_0133612 3300049586 Bacteria 2049
1000 Ga0501217_013236 3300049661 Bacteria 1850
1001 Ga0501223_000082 3300049663 Bacteria 28639
1002 Ga0501223_002015 3300049663 Bacteria 4556
1003 Ga0501257_000074 3300049686 Bacteria 25196
1004 Ga0501225_0000059 3300049705 Bacteria 36394
1005 Ga0501225_0005861 3300049705 Bacteria 3596
1006 Ga0501225_0007744 3300049705 Bacteria 3105
1007 Ga0501245_023059 3300049708 Bacteria 986
1008 Ga0501241_000565 3300049758 Bacteria 7945
1009 Ga0501268_002046 3300049765 Bacteria 2604
1010 Ga0501270_000579 3300049767 Bacteria 3172
1011 Ga0501280_014312 3300049776 Bacteria 1128
1012 Ga0501035_0025664 3300049822 Bacteria 5401
1013 nmdc:mga0yw44_168075_c1 3300050492 Bacteria 1439
1014 nmdc:mga06z11_34258_c1 3300050494 Bacteria 2491
1015 nmdc:mga06z11_37633_c1 3300050494 Bacteria 2397
1016 nmdc:mga06z11_40934_c1 3300050494 Bacteria 2315
1017 nmdc:mga07m45_38635_c1 3300050496 Bacteria 2664
1018 nmdc:mga09592_287644_c1 3300050508 Bacteria 1425
1019 nmdc:mga06r32_8778_c1 3300050510 Bacteria 9108
1020 nmdc:mga0n895_65333_c1 3300050512 Bacteria 3601
1021 nmdc:mga0a205_2308_c1 3300050515 Bacteria 16838
1022 nmdc:mga0sz30_148_c1 3300050516 Bacteria 26288
1023 nmdc:mga0sz30_7134_c1 3300050516 Bacteria 4181
1024 Ga0500610_0010169 3300053079 Bacteria 4218
1025 Ga0500643_000115 3300053087 Bacteria 84126
1026 Ga0500643_000203 3300053087 Bacteria 56433
1027 Ga0500643_001426 3300053087 Bacteria 13787
1028 Ga0500643_003506 3300053087 Bacteria 7514
1029 Ga0500643_069194 3300053087 Bacteria 981
1030 Ga0500566_0001654 3300053094 Bacteria 13076
1031 Ga0500566_0184295 3300053094 Bacteria 1068
1032 Ga0500641_0001530 3300053096 Bacteria 8258
1033 Ga0500650_0022660 3300053098 Bacteria 2782
1034 Ga0500555_002637 3300053103 Bacteria 5163
1035 Ga0500556_0000013 3300053104 Bacteria 243797
1036 Ga0500557_046688 3300053105 Bacteria 1376
1037 Ga0500592_000019 3300053116 Bacteria 57900
1038 Ga0500595_000322 3300053119 Bacteria 31502
1039 Ga0500595_001189 3300053119 Bacteria 14368
1040 Ga0500608_059154 3300053122 Bacteria 1834
1041 Ga0500642_0000002 3300053130 Bacteria 795093
1042 Ga0500642_0002968 3300053130 Bacteria 5057
1043 Ga0500658_0001557 3300053134 Bacteria 9161
1044 Ga0500658_0004819 3300053134 Bacteria 5032
1045 Ga0500559_0025686 3300053136 Bacteria 2507
1046 Ga0500559_0108698 3300053136 Bacteria 1283
1047 Ga0500568_0004980 3300053139 Bacteria 6968
1048 Ga0500568_0047570 3300053139 Bacteria 1699
1049 Ga0500577_0018894 3300053142 Bacteria 2225
1050 Ga0500604_0000018 3300053151 Bacteria 78699
1051 Ga0500604_0008220 3300053151 Bacteria 2766
1052 Ga0500604_0048228 3300053151 Bacteria 1307
1053 Ga0500616_0001491 3300053153 Bacteria 22149
1054 Ga0500616_0002249 3300053153 Bacteria 16476
1055 Ga0500622_0045229 3300053156 Bacteria 2280
1056 Ga0500624_000024 3300053157 Bacteria 114404
1057 Ga0500627_0000131 3300053158 Bacteria 22423
1058 Ga0500627_0000188 3300053158 Bacteria 18122
1059 Ga0500645_000003 3300053730 Bacteria 305887
1060 Ga0500645_001222 3300053730 Bacteria 13538
1061 Ga0500645_001904 3300053730 Bacteria 9924
1062 Ga0500552_000111 3300053733 Bacteria 6919
1063 Ga0500596_003051 3300053735 Bacteria 3225
1064 Ga0466962_0000873 3300061719 Bacteria 13668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025937 Ga0207669_10115466 Ga0207669_101154663 246
2 3300005335 Ga0070666_10507389 Ga0070666_105073891 256
3 3300049708 Ga0501245_023059 Ga0501245_023059_145_975 276
4 3300001904 JGI24736J21556_1006943 JGI24736J21556_10069432 278
5 3300001989 JGI24739J22299_10024985 JGI24739J22299_100249852 278
6 3300001989 JGI24739J22299_10029529 JGI24739J22299_100295292 278
7 3300001990 JGI24737J22298_10029109 JGI24737J22298_100291092 278
8 3300002067 JGI24735J21928_10022352 JGI24735J21928_100223522 278
9 3300002075 JGI24738J21930_10001002 JGI24738J21930_100010022 278
10 3300005457 Ga0070662_100041566 Ga0070662_1000415662 278
11 3300005577 Ga0068857_100318299 Ga0068857_1003182992 278
12 3300005616 Ga0068852_100070015 Ga0068852_1000700152 278
13 3300005834 Ga0068851_10028720 Ga0068851_100287202 278
14 3300009174 Ga0105241_10041561 Ga0105241_100415612 278
15 3300009545 Ga0105237_10091788 Ga0105237_100917882 278
16 3300013104 Ga0157370_10014466 Ga0157370_100144668 278
17 3300013105 Ga0157369_10190642 Ga0157369_101906422 278
18 3300025321 Ga0207656_10020691 Ga0207656_100206913 278
19 3300025911 Ga0207654_10018258 Ga0207654_100182583 278
20 3300025913 Ga0207695_10028820 Ga0207695_100288205 278
21 3300025914 Ga0207671_10004616 Ga0207671_100046166 278
22 3300025924 Ga0207694_10047352 Ga0207694_100473524 278
23 3300025981 Ga0207640_10084258 Ga0207640_100842583 278
24 3300026041 Ga0207639_10027203 Ga0207639_100272035 278
25 3300026067 Ga0207678_10344385 Ga0207678_103443852 278
26 3300026078 Ga0207702_10038212 Ga0207702_100382123 278
27 3300026142 Ga0207698_10068966 Ga0207698_100689664 278
28 3300009148 Ga0105243_10238195 Ga0105243_102381952 279
29 3300005435 Ga0070714_100050966 Ga0070714_1000509664 282
30 3300025929 Ga0207664_10061578 Ga0207664_100615784 282
31 3300049586 Ga0501070_0133612 Ga0501070_0133612_700_1644 283
32 3300046535 Ga0495586_0135428 Ga0495586_0135428_94_981 286
33 3300025931 Ga0207644_10002824 Ga0207644_100028249 290
34 3300037466 Ga0395898_0007898 Ga0395898_0007898_99_992 290
35 3300048905 Ga0496102_0189171 Ga0496102_0189171_350_1222 290
36 3300053087 Ga0500643_000115 Ga0500643_000115_51108_51980 290
37 3300053116 Ga0500592_000019 Ga0500592_000019_10690_11562 290
38 3300053151 Ga0500604_0048228 Ga0500604_0048228_187_1059 290
39 3300053158 Ga0500627_0000131 Ga0500627_0000131_7141_8013 290
40 3300001990 JGI24737J22298_10070569 JGI24737J22298_100705692 291
41 3300005327 Ga0070658_10036686 Ga0070658_100366862 291
42 3300005339 Ga0070660_100001509 Ga0070660_1000015099 291
43 3300005366 Ga0070659_100022212 Ga0070659_1000222122 291
44 3300005455 Ga0070663_100062435 Ga0070663_1000624353 291
45 3300005564 Ga0070664_100042361 Ga0070664_1000423612 291
46 3300011119 Ga0105246_10575611 Ga0105246_105756111 291
47 3300025919 Ga0207657_10076413 Ga0207657_100764134 291
48 3300025933 Ga0207706_10057532 Ga0207706_100575325 291
49 3300026067 Ga0207678_10081355 Ga0207678_100813553 291
50 3300049574 Ga0501038_0194414 Ga0501038_0194414_10_885 291
51 3300053087 Ga0500643_003506 Ga0500643_003506_3229_4104 291
52 3300053122 Ga0500608_059154 Ga0500608_059154_234_1109 291
53 3300053130 Ga0500642_0000002 Ga0500642_0000002_239823_240698 291
54 3300053730 Ga0500645_001904 Ga0500645_001904_7080_7955 291
55 3300044694 Ga0466963_0023344 Ga0466963_0023344_2596_3483 292
56 3300045836 Ga0466958_0169885 Ga0466958_0169885_255_1142 292
57 3300005328 Ga0070676_10149291 Ga0070676_101492911 293
58 3300005334 Ga0068869_100448860 Ga0068869_1004488601 293
59 3300005347 Ga0070668_100024681 Ga0070668_1000246813 293
60 3300005364 Ga0070673_100024388 Ga0070673_1000243887 293
61 3300005367 Ga0070667_100023180 Ga0070667_1000231801 293
62 3300005459 Ga0068867_100003846 Ga0068867_1000038469 293
63 3300005543 Ga0070672_100135004 Ga0070672_1001350042 293
64 3300006358 Ga0068871_100108920 Ga0068871_1001089203 293
65 3300025899 Ga0207642_10002992 Ga0207642_100029925 293
66 3300025923 Ga0207681_10067923 Ga0207681_100679233 293
67 3300025940 Ga0207691_10105501 Ga0207691_101055013 293
68 3300025942 Ga0207689_10071243 Ga0207689_100712433 293
69 3300025972 Ga0207668_10000021 Ga0207668_1000002169 293
70 3300025986 Ga0207658_10013277 Ga0207658_100132779 293
71 3300026067 Ga0207678_10091429 Ga0207678_100914292 293
72 3300026089 Ga0207648_10004112 Ga0207648_1000411214 293
73 3300026121 Ga0207683_10010651 Ga0207683_100106518 293
74 iso_pu_bacteria 2852680915 2852680931 293
75 iso_pu_bacteria 8057101203 8057101878 293
76 3300001904 JGI24736J21556_1011073 JGI24736J21556_10110732 294
77 3300001979 JGI24740J21852_10001550 JGI24740J21852_1000155010 294
78 3300001979 JGI24740J21852_10013368 JGI24740J21852_100133681 294
79 3300001989 JGI24739J22299_10001469 JGI24739J22299_100014698 294
80 3300001989 JGI24739J22299_10004251 JGI24739J22299_100042514 294
81 3300001989 JGI24739J22299_10010073 JGI24739J22299_100100733 294
82 3300001990 JGI24737J22298_10000293 JGI24737J22298_100002935 294
83 3300001990 JGI24737J22298_10017771 JGI24737J22298_100177713 294
84 3300002075 JGI24738J21930_10000814 JGI24738J21930_100008142 294
85 3300002077 JGI24744J21845_10005272 JGI24744J21845_100052722 294
86 3300005327 Ga0070658_10091850 Ga0070658_100918503 294
87 3300005328 Ga0070676_10004996 Ga0070676_100049966 294
88 3300005329 Ga0070683_100060925 Ga0070683_1000609252 294
89 3300005331 Ga0070670_100018265 Ga0070670_1000182652 294
90 3300005331 Ga0070670_100040431 Ga0070670_1000404315 294
91 3300005331 Ga0070670_100065316 Ga0070670_1000653162 294
92 3300005331 Ga0070670_100070931 Ga0070670_1000709312 294
93 3300005331 Ga0070670_100374967 Ga0070670_1003749672 294
94 3300005331 Ga0070670_100454313 Ga0070670_1004543131 294
95 3300005334 Ga0068869_100000094 Ga0068869_10000009420 294
96 3300005335 Ga0070666_10000342 Ga0070666_1000034210 294
97 3300005335 Ga0070666_10017178 Ga0070666_100171785 294
98 3300005335 Ga0070666_10149578 Ga0070666_101495782 294
99 3300005336 Ga0070680_100343924 Ga0070680_1003439242 294
100 3300005337 Ga0070682_100052195 Ga0070682_1000521952 294
101 3300005338 Ga0068868_100000113 Ga0068868_10000011310 294
102 3300005338 Ga0068868_100002389 Ga0068868_1000023897 294
103 3300005338 Ga0068868_100184873 Ga0068868_1001848731 294
104 3300005339 Ga0070660_100041042 Ga0070660_1000410422 294
105 3300005339 Ga0070660_100041201 Ga0070660_1000412012 294
106 3300005339 Ga0070660_100083027 Ga0070660_1000830273 294
107 3300005344 Ga0070661_100012399 Ga0070661_1000123993 294
108 3300005344 Ga0070661_100064473 Ga0070661_1000644732 294
109 3300005347 Ga0070668_100002775 Ga0070668_1000027754 294
110 3300005353 Ga0070669_100000155 Ga0070669_10000015520 294
111 3300005353 Ga0070669_100039822 Ga0070669_1000398223 294
112 3300005353 Ga0070669_100065653 Ga0070669_1000656532 294
113 3300005353 Ga0070669_100132388 Ga0070669_1001323882 294
114 3300005354 Ga0070675_100302853 Ga0070675_1003028531 294
115 3300005355 Ga0070671_100019672 Ga0070671_1000196726 294
116 3300005355 Ga0070671_100031754 Ga0070671_1000317543 294
117 3300005356 Ga0070674_100005255 Ga0070674_1000052559 294
118 3300005356 Ga0070674_100019554 Ga0070674_1000195543 294
119 3300005356 Ga0070674_100054157 Ga0070674_1000541574 294
120 3300005364 Ga0070673_100001756 Ga0070673_10000175610 294
121 3300005364 Ga0070673_100034497 Ga0070673_1000344975 294
122 3300005364 Ga0070673_100050349 Ga0070673_1000503493 294
123 3300005364 Ga0070673_100065260 Ga0070673_1000652603 294
124 3300005365 Ga0070688_100161926 Ga0070688_1001619262 294
125 3300005366 Ga0070659_100000305 Ga0070659_10000030525 294
126 3300005366 Ga0070659_100075534 Ga0070659_1000755343 294
127 3300005366 Ga0070659_100111678 Ga0070659_1001116782 294
128 3300005366 Ga0070659_100147357 Ga0070659_1001473572 294
129 3300005367 Ga0070667_100000656 Ga0070667_10000065615 294
130 3300005367 Ga0070667_100003284 Ga0070667_1000032844 294
131 3300005455 Ga0070663_100015825 Ga0070663_1000158255 294
132 3300005455 Ga0070663_100055140 Ga0070663_1000551402 294
133 3300005455 Ga0070663_100098890 Ga0070663_1000988902 294
134 3300005457 Ga0070662_100024764 Ga0070662_1000247643 294
135 3300005457 Ga0070662_100026033 Ga0070662_1000260335 294
136 3300005457 Ga0070662_100155667 Ga0070662_1001556672 294
137 3300005459 Ga0068867_100001817 Ga0068867_10000181717 294
138 3300005459 Ga0068867_100010918 Ga0068867_1000109184 294
139 3300005535 Ga0070684_100389020 Ga0070684_1003890202 294
140 3300005539 Ga0068853_100005924 Ga0068853_1000059246 294
141 3300005539 Ga0068853_100046194 Ga0068853_1000461942 294
142 3300005543 Ga0070672_100000710 Ga0070672_10000071011 294
143 3300005543 Ga0070672_100033346 Ga0070672_1000333465 294
144 3300005544 Ga0070686_100142419 Ga0070686_1001424191 294
145 3300005548 Ga0070665_100000995 Ga0070665_10000099521 294
146 3300005548 Ga0070665_100014710 Ga0070665_1000147107 294
147 3300005548 Ga0070665_100121024 Ga0070665_1001210243 294
148 3300005548 Ga0070665_100338978 Ga0070665_1003389782 294
149 3300005563 Ga0068855_100038147 Ga0068855_1000381474 294
150 3300005563 Ga0068855_100372096 Ga0068855_1003720962 294
151 3300005564 Ga0070664_100003720 Ga0070664_1000037206 294
152 3300005564 Ga0070664_100006800 Ga0070664_1000068009 294
153 3300005564 Ga0070664_100030014 Ga0070664_1000300142 294
154 3300005577 Ga0068857_100004853 Ga0068857_10000485311 294
155 3300005577 Ga0068857_100007710 Ga0068857_1000077108 294
156 3300005577 Ga0068857_100053395 Ga0068857_1000533952 294
157 3300005578 Ga0068854_100000206 Ga0068854_10000020634 294
158 3300005578 Ga0068854_100020435 Ga0068854_1000204353 294
159 3300005578 Ga0068854_100021215 Ga0068854_1000212154 294
160 3300005578 Ga0068854_100028258 Ga0068854_1000282584 294
161 3300005578 Ga0068854_100040701 Ga0068854_1000407012 294
162 3300005578 Ga0068854_100079015 Ga0068854_1000790152 294
163 3300005578 Ga0068854_100369455 Ga0068854_1003694552 294
164 3300005616 Ga0068852_100002924 Ga0068852_1000029247 294
165 3300005616 Ga0068852_100044876 Ga0068852_1000448761 294
166 3300005617 Ga0068859_100007995 Ga0068859_1000079954 294
167 3300005617 Ga0068859_100049241 Ga0068859_1000492414 294
168 3300005618 Ga0068864_100000428 Ga0068864_10000042842 294
169 3300005618 Ga0068864_100115414 Ga0068864_1001154143 294
170 3300005718 Ga0068866_10109373 Ga0068866_101093732 294
171 3300005834 Ga0068851_10008531 Ga0068851_100085312 294
172 3300005840 Ga0068870_10083700 Ga0068870_100837002 294
173 3300005841 Ga0068863_100000634 Ga0068863_10000063416 294
174 3300005842 Ga0068858_100001980 Ga0068858_10000198013 294
175 3300005842 Ga0068858_100009525 Ga0068858_1000095256 294
176 3300005842 Ga0068858_100143470 Ga0068858_1001434702 294
177 3300005843 Ga0068860_100003691 Ga0068860_10000369116 294
178 3300005843 Ga0068860_100050945 Ga0068860_1000509454 294
179 3300005843 Ga0068860_100137815 Ga0068860_1001378153 294
180 3300005844 Ga0068862_100036890 Ga0068862_1000368904 294
181 3300005844 Ga0068862_100041178 Ga0068862_1000411782 294
182 3300005844 Ga0068862_100511119 Ga0068862_1005111191 294
183 3300006237 Ga0097621_100328388 Ga0097621_1003283882 294
184 3300006881 Ga0068865_100029233 Ga0068865_1000292332 294
185 3300006931 Ga0097620_100007995 Ga0097620_10000799510 294
186 3300006931 Ga0097620_100049240 Ga0097620_1000492403 294
187 3300009093 Ga0105240_10062248 Ga0105240_100622483 294
188 3300009093 Ga0105240_10771042 Ga0105240_107710422 294
189 3300009098 Ga0105245_10008689 Ga0105245_100086892 294
190 3300009098 Ga0105245_10377976 Ga0105245_103779762 294
191 3300009148 Ga0105243_10190486 Ga0105243_101904862 294
192 3300009148 Ga0105243_10471344 Ga0105243_104713442 294
193 3300009174 Ga0105241_10161430 Ga0105241_101614302 294
194 3300009176 Ga0105242_10062392 Ga0105242_100623923 294
195 3300009176 Ga0105242_10082968 Ga0105242_100829683 294
196 3300009176 Ga0105242_10374307 Ga0105242_103743071 294
197 3300009177 Ga0105248_10001472 Ga0105248_100014728 294
198 3300009177 Ga0105248_10251176 Ga0105248_102511762 294
199 3300009177 Ga0105248_10292142 Ga0105248_102921423 294
200 3300009551 Ga0105238_10031422 Ga0105238_100314225 294
201 3300009551 Ga0105238_10070437 Ga0105238_100704372 294
202 3300009553 Ga0105249_10035540 Ga0105249_100355404 294
203 3300011119 Ga0105246_10033675 Ga0105246_100336754 294
204 3300013100 Ga0157373_10002262 Ga0157373_100022629 294
205 3300013100 Ga0157373_10028733 Ga0157373_100287334 294
206 3300013100 Ga0157373_10123932 Ga0157373_101239322 294
207 3300013102 Ga0157371_10002300 Ga0157371_1000230010 294
208 3300013102 Ga0157371_10256567 Ga0157371_102565671 294
209 3300013102 Ga0157371_10316019 Ga0157371_103160191 294
210 3300013297 Ga0157378_10001977 Ga0157378_100019776 294
211 3300013297 Ga0157378_10009310 Ga0157378_100093105 294
212 3300013306 Ga0163162_10023769 Ga0163162_100237694 294
213 3300013306 Ga0163162_10741874 Ga0163162_107418742 294
214 3300013307 Ga0157372_10302408 Ga0157372_103024082 294
215 3300013307 Ga0157372_10442943 Ga0157372_104429432 294
216 3300013308 Ga0157375_10059996 Ga0157375_100599964 294
217 3300013308 Ga0157375_10442007 Ga0157375_104420072 294
218 3300013308 Ga0157375_10707668 Ga0157375_107076682 294
219 3300021384 Ga0213876_10005484 Ga0213876_100054846 294
220 3300025302 Ga0207426_1026337 Ga0207426_10263372 294
221 3300025315 Ga0207697_10000109 Ga0207697_1000010910 294
222 3300025315 Ga0207697_10013441 Ga0207697_100134412 294
223 3300025321 Ga0207656_10005154 Ga0207656_100051542 294
224 3300025903 Ga0207680_10001510 Ga0207680_100015102 294
225 3300025903 Ga0207680_10013148 Ga0207680_100131482 294
226 3300025903 Ga0207680_10116490 Ga0207680_101164901 294
227 3300025904 Ga0207647_10000446 Ga0207647_1000044618 294
228 3300025904 Ga0207647_10015410 Ga0207647_100154103 294
229 3300025904 Ga0207647_10051647 Ga0207647_100516472 294
230 3300025907 Ga0207645_10022319 Ga0207645_100223193 294
231 3300025908 Ga0207643_10022846 Ga0207643_100228462 294
232 3300025909 Ga0207705_10071722 Ga0207705_100717222 294
233 3300025909 Ga0207705_10294663 Ga0207705_102946632 294
234 3300025912 Ga0207707_10357865 Ga0207707_103578652 294
235 3300025913 Ga0207695_10193423 Ga0207695_101934232 294
236 3300025918 Ga0207662_10041631 Ga0207662_100416312 294
237 3300025918 Ga0207662_10075972 Ga0207662_100759724 294
238 3300025919 Ga0207657_10002553 Ga0207657_1000255323 294
239 3300025919 Ga0207657_10004781 Ga0207657_1000478111 294
240 3300025919 Ga0207657_10146230 Ga0207657_101462302 294
241 3300025920 Ga0207649_10034508 Ga0207649_100345083 294
242 3300025920 Ga0207649_10042330 Ga0207649_100423302 294
243 3300025920 Ga0207649_10046233 Ga0207649_100462334 294
244 3300025923 Ga0207681_10001626 Ga0207681_1000162617 294
245 3300025923 Ga0207681_10028973 Ga0207681_100289733 294
246 3300025924 Ga0207694_10048056 Ga0207694_100480562 294
247 3300025925 Ga0207650_10007235 Ga0207650_100072355 294
248 3300025925 Ga0207650_10056691 Ga0207650_100566913 294
249 3300025927 Ga0207687_10020101 Ga0207687_100201012 294
250 3300025931 Ga0207644_10001832 Ga0207644_1000183210 294
251 3300025931 Ga0207644_10014341 Ga0207644_100143412 294
252 3300025931 Ga0207644_10080205 Ga0207644_100802053 294
253 3300025932 Ga0207690_10063498 Ga0207690_100634983 294
254 3300025933 Ga0207706_10000300 Ga0207706_1000030052 294
255 3300025933 Ga0207706_10006908 Ga0207706_100069085 294
256 3300025933 Ga0207706_10081224 Ga0207706_100812243 294
257 3300025937 Ga0207669_10035517 Ga0207669_100355174 294
258 3300025937 Ga0207669_10041981 Ga0207669_100419812 294
259 3300025937 Ga0207669_10079239 Ga0207669_100792392 294
260 3300025938 Ga0207704_10048331 Ga0207704_100483311 294
261 3300025938 Ga0207704_10286816 Ga0207704_102868162 294
262 3300025938 Ga0207704_10294814 Ga0207704_102948142 294
263 3300025940 Ga0207691_10000294 Ga0207691_1000029411 294
264 3300025940 Ga0207691_10040577 Ga0207691_100405772 294
265 3300025940 Ga0207691_10051372 Ga0207691_100513721 294
266 3300025940 Ga0207691_10121346 Ga0207691_101213462 294
267 3300025941 Ga0207711_10003143 Ga0207711_100031438 294
268 3300025941 Ga0207711_10011392 Ga0207711_100113924 294
269 3300025941 Ga0207711_10126582 Ga0207711_101265823 294
270 3300025942 Ga0207689_10000064 Ga0207689_1000006420 294
271 3300025942 Ga0207689_10030619 Ga0207689_100306192 294
272 3300025945 Ga0207679_10016870 Ga0207679_100168702 294
273 3300025945 Ga0207679_10033341 Ga0207679_100333412 294
274 3300025945 Ga0207679_10049858 Ga0207679_100498584 294
275 3300025945 Ga0207679_10056602 Ga0207679_100566023 294
276 3300025945 Ga0207679_10121026 Ga0207679_101210262 294
277 3300025949 Ga0207667_10020043 Ga0207667_100200437 294
278 3300025949 Ga0207667_10340567 Ga0207667_103405672 294
279 3300025960 Ga0207651_10000355 Ga0207651_1000035519 294
280 3300025960 Ga0207651_10006669 Ga0207651_100066695 294
281 3300025960 Ga0207651_10039113 Ga0207651_100391133 294
282 3300025960 Ga0207651_10315291 Ga0207651_103152912 294
283 3300025981 Ga0207640_10001142 Ga0207640_100011428 294
284 3300025981 Ga0207640_10002525 Ga0207640_100025252 294
285 3300025981 Ga0207640_10011805 Ga0207640_100118054 294
286 3300025981 Ga0207640_10023138 Ga0207640_100231382 294
287 3300025981 Ga0207640_10115426 Ga0207640_101154262 294
288 3300025981 Ga0207640_10152945 Ga0207640_101529452 294
289 3300025981 Ga0207640_10275839 Ga0207640_102758392 294
290 3300025986 Ga0207658_10004936 Ga0207658_100049362 294
291 3300025986 Ga0207658_10007088 Ga0207658_100070886 294
292 3300025986 Ga0207658_10021107 Ga0207658_100211071 294
293 3300026023 Ga0207677_10006963 Ga0207677_100069636 294
294 3300026023 Ga0207677_10452899 Ga0207677_104528991 294
295 3300026023 Ga0207677_10475689 Ga0207677_104756891 294
296 3300026035 Ga0207703_10001455 Ga0207703_1000145515 294
297 3300026035 Ga0207703_10006195 Ga0207703_100061956 294
298 3300026035 Ga0207703_10008809 Ga0207703_100088095 294
299 3300026035 Ga0207703_10413948 Ga0207703_104139482 294
300 3300026041 Ga0207639_10006448 Ga0207639_100064482 294
301 3300026067 Ga0207678_10002415 Ga0207678_100024159 294
302 3300026067 Ga0207678_10003727 Ga0207678_1000372711 294
303 3300026067 Ga0207678_10004478 Ga0207678_100044783 294
304 3300026067 Ga0207678_10091554 Ga0207678_100915544 294
305 3300026067 Ga0207678_10117340 Ga0207678_101173402 294
306 3300026067 Ga0207678_10133243 Ga0207678_101332432 294
307 3300026078 Ga0207702_10013111 Ga0207702_100131117 294
308 3300026078 Ga0207702_10058372 Ga0207702_100583722 294
309 3300026088 Ga0207641_10016059 Ga0207641_100160593 294
310 3300026088 Ga0207641_10064470 Ga0207641_100644704 294
311 3300026089 Ga0207648_10001537 Ga0207648_1000153729 294
312 3300026089 Ga0207648_10008749 Ga0207648_1000874912 294
313 3300026095 Ga0207676_10004949 Ga0207676_100049493 294
314 3300026116 Ga0207674_10000814 Ga0207674_1000081413 294
315 3300026116 Ga0207674_10008433 Ga0207674_100084334 294
316 3300026116 Ga0207674_10021242 Ga0207674_100212425 294
317 3300026116 Ga0207674_10056963 Ga0207674_100569632 294
318 3300026118 Ga0207675_100119346 Ga0207675_1001193462 294
319 3300026121 Ga0207683_10020351 Ga0207683_100203518 294
320 3300026142 Ga0207698_10010153 Ga0207698_100101533 294
321 3300026142 Ga0207698_10012830 Ga0207698_100128303 294
322 3300028379 Ga0268266_10000318 Ga0268266_1000031821 294
323 3300028379 Ga0268266_10024360 Ga0268266_100243602 294
324 3300028379 Ga0268266_10088217 Ga0268266_100882172 294
325 3300028379 Ga0268266_10331890 Ga0268266_103318902 294
326 3300028379 Ga0268266_10652999 Ga0268266_106529992 294
327 3300028380 Ga0268265_10026131 Ga0268265_100261313 294
328 3300028380 Ga0268265_10256334 Ga0268265_102563342 294
329 3300028381 Ga0268264_10018939 Ga0268264_100189394 294
330 3300028381 Ga0268264_10429695 Ga0268264_104296952 294
331 3300031548 Ga0307408_100011716 Ga0307408_1000117165 294
332 3300031901 Ga0307406_10031864 Ga0307406_100318642 294
333 3300035691 Ga0373931_0028431 Ga0373931_0028431_621_1535 294
334 3300037418 Ga0395900_0002613 Ga0395900_0002613_6589_7482 294
335 3300037418 Ga0395900_0004765 Ga0395900_0004765_10536_11450 294
336 3300037418 Ga0395900_0033362 Ga0395900_0033362_1875_2801 294
337 3300037418 Ga0395900_0119069 Ga0395900_0119069_1070_1957 294
338 3300037418 Ga0395900_0317625 Ga0395900_0317625_445_1338 294
339 3300037466 Ga0395898_0006213 Ga0395898_0006213_9035_9949 294
340 3300037466 Ga0395898_0030071 Ga0395898_0030071_3486_4379 294
341 3300037466 Ga0395898_0124061 Ga0395898_0124061_78_971 294
342 3300037471 Ga0395905_0000688 Ga0395905_0000688_25854_26747 294
343 3300037471 Ga0395905_0014317 Ga0395905_0014317_2836_3750 294
344 3300037471 Ga0395905_0125168 Ga0395905_0125168_1459_2352 294
345 3300037471 Ga0395905_0140258 Ga0395905_0140258_745_1632 294
346 3300037471 Ga0395905_0175341 Ga0395905_0175341_629_1525 294
347 3300037471 Ga0395905_0344010 Ga0395905_0344010_261_1154 294
348 3300038443 Ga0395901_0058836 Ga0395901_0058836_426_1319 294
349 3300038443 Ga0395901_0071197 Ga0395901_0071197_951_1877 294
350 3300038443 Ga0395901_0074595 Ga0395901_0074595_2546_3439 294
351 3300038443 Ga0395901_0296589 Ga0395901_0296589_15_908 294
352 3300039437 Ga0436365_1268241 Ga0436365_1268241_3065_3958 294
353 3300039450 Ga0436363_1350835 Ga0436363_1350835_804_1697 294
354 3300042005 Ga0439448_0002886 Ga0439448_0002886_3408_4334 294
355 3300046539 Ga0495621_0003418 Ga0495621_0003418_448_1338 294
356 3300048905 Ga0496102_0359455 Ga0496102_0359455_325_1218 294
357 3300048906 Ga0496103_0172222 Ga0496103_0172222_67_960 294
358 3300048910 Ga0496107_0107019 Ga0496107_0107019_943_1839 294
359 3300048911 Ga0496108_0421565 Ga0496108_0421565_28_912 294
360 3300048915 Ga0496112_0078396 Ga0496112_0078396_1686_2579 294
361 3300049571 Ga0501034_0002878 Ga0501034_0002878_17914_18825 294
362 3300049571 Ga0501034_0004118 Ga0501034_0004118_4979_5890 294
363 3300049584 Ga0501068_0009942 Ga0501068_0009942_1161_2072 294
364 iso_pu_bacteria 2599185354 2600203337 294
365 iso_pu_bacteria 2751185897 2753765860 294
366 iso_pu_bacteria 2993693658 2993693759 294
367 3300005367 Ga0070667_100064562 Ga0070667_1000645623 295
368 3300005841 Ga0068863_100097556 Ga0068863_1000975562 295
369 3300005843 Ga0068860_100002325 Ga0068860_10000232518 295
370 3300005844 Ga0068862_100012603 Ga0068862_1000126032 295
371 3300006852 Ga0075433_10025955 Ga0075433_100259555 295
372 3300009177 Ga0105248_10031200 Ga0105248_100312005 295
373 3300013308 Ga0157375_10009852 Ga0157375_100098523 295
374 3300021361 Ga0213872_10000056 Ga0213872_1000005681 295
375 3300025941 Ga0207711_10103754 Ga0207711_101037543 295
376 3300025986 Ga0207658_10005047 Ga0207658_1000504710 295
377 3300028380 Ga0268265_10000789 Ga0268265_1000078919 295
378 3300028381 Ga0268264_10002322 Ga0268264_1000232217 295
379 3300039447 Ga0436361_0012467 Ga0436361_0012467_109106_110161 295
380 3300049705 Ga0501225_0005861 Ga0501225_0005861_851_1738 295
381 3300050515 nmdc:mga0a205_2308_c1 nmdc:mga0a205_2308_c1_11175_12071 295
382 3300005290 Ga0065712_10152329 Ga0065712_101523291 296
383 3300005456 Ga0070678_100409993 Ga0070678_1004099932 296
384 3300005544 Ga0070686_100000338 Ga0070686_10000033830 296
385 3300005616 Ga0068852_100565172 Ga0068852_1005651722 296
386 3300006847 Ga0075431_100175904 Ga0075431_1001759042 296
387 3300009148 Ga0105243_10060551 Ga0105243_100605513 296
388 3300009177 Ga0105248_10208305 Ga0105248_102083052 296
389 3300014326 Ga0157380_10022797 Ga0157380_100227974 296
390 3300020082 Ga0206353_11750927 Ga0206353_117509272 296
391 3300021384 Ga0213876_10003321 Ga0213876_100033213 296
392 3300026121 Ga0207683_10411685 Ga0207683_104116852 296
393 3300028800 Ga0265338_10053043 Ga0265338_100530435 296
394 3300031548 Ga0307408_100216729 Ga0307408_1002167292 296
395 3300031824 Ga0307413_10173023 Ga0307413_101730232 296
396 3300031852 Ga0307410_10001711 Ga0307410_100017114 296
397 3300031995 Ga0307409_100529843 Ga0307409_1005298432 296
398 3300032002 Ga0307416_100025055 Ga0307416_1000250552 296
399 3300032002 Ga0307416_100206292 Ga0307416_1002062923 296
400 3300032005 Ga0307411_10055208 Ga0307411_100552082 296
401 3300032126 Ga0307415_100390762 Ga0307415_1003907622 296
402 3300039437 Ga0436365_0695503 Ga0436365_0695503_9007_9897 296
403 3300046525 Ga0495663_0008361 Ga0495663_0008361_1599_2489 296
404 3300046525 Ga0495663_0077844 Ga0495663_0077844_78_968 296
405 3300046539 Ga0495621_0000168 Ga0495621_0000168_10797_11687 296
406 3300046539 Ga0495621_0013025 Ga0495621_0013025_790_1680 296
407 3300046558 Ga0495633_0107886 Ga0495633_0107886_179_1069 296
408 3300046664 Ga0495659_0010446 Ga0495659_0010446_997_1887 296
409 3300046684 Ga0495669_0020183 Ga0495669_0020183_686_1576 296
410 3300049661 Ga0501217_013236 Ga0501217_013236_869_1759 296
411 3300049705 Ga0501225_0007744 Ga0501225_0007744_1919_2809 296
412 3300049767 Ga0501270_000579 Ga0501270_000579_2129_3019 296
413 3300050510 nmdc:mga06r32_8778_c1 nmdc:mga06r32_8778_c1_574_1464 296
414 3300053094 Ga0500566_0184295 Ga0500566_0184295_130_1020 296
415 3300053730 Ga0500645_001222 Ga0500645_001222_8584_9474 296
416 3300001979 JGI24740J21852_10066055 JGI24740J21852_100660551 297
417 3300001989 JGI24739J22299_10004008 JGI24739J22299_100040084 297
418 3300001990 JGI24737J22298_10001195 JGI24737J22298_100011958 297
419 3300002067 JGI24735J21928_10008752 JGI24735J21928_100087523 297
420 3300002067 JGI24735J21928_10015899 JGI24735J21928_100158993 297
421 3300002067 JGI24735J21928_10016482 JGI24735J21928_100164823 297
422 3300002067 JGI24735J21928_10027960 JGI24735J21928_100279602 297
423 3300002067 JGI24735J21928_10039234 JGI24735J21928_100392342 297
424 3300002067 JGI24735J21928_10059668 JGI24735J21928_100596681 297
425 3300002075 JGI24738J21930_10005507 JGI24738J21930_100055073 297
426 3300002244 JGI24742J22300_10006052 JGI24742J22300_100060521 297
427 3300002244 JGI24742J22300_10031262 JGI24742J22300_100312621 297
428 3300003214 JGI25165J46597_1000165 JGI25165J46597_100016537 297
429 3300003215 JGI25153J46596_10000007 JGI25153J46596_10000007141 297
430 3300003794 Ga0055531_10025182 Ga0055531_100251823 297
431 3300003911 JGI25405J52794_10007653 JGI25405J52794_100076532 297
432 3300005289 Ga0065704_10208631 Ga0065704_102086311 297
433 3300005295 Ga0065707_10082626 Ga0065707_100826265 297
434 3300005327 Ga0070658_10000001 Ga0070658_10000001708 297
435 3300005327 Ga0070658_10000062 Ga0070658_1000006275 297
436 3300005327 Ga0070658_10000612 Ga0070658_1000061213 297
437 3300005327 Ga0070658_10000691 Ga0070658_1000069114 297
438 3300005327 Ga0070658_10008207 Ga0070658_1000820711 297
439 3300005327 Ga0070658_10092146 Ga0070658_100921463 297
440 3300005328 Ga0070676_10000999 Ga0070676_1000099911 297
441 3300005329 Ga0070683_100365320 Ga0070683_1003653202 297
442 3300005333 Ga0070677_10000059 Ga0070677_100000598 297
443 3300005334 Ga0068869_100000225 Ga0068869_10000022526 297
444 3300005336 Ga0070680_100000295 Ga0070680_10000029534 297
445 3300005338 Ga0068868_100000007 Ga0068868_10000000769 297
446 3300005338 Ga0068868_100000013 Ga0068868_10000001333 297
447 3300005339 Ga0070660_100000377 Ga0070660_10000037726 297
448 3300005339 Ga0070660_100001392 Ga0070660_10000139216 297
449 3300005339 Ga0070660_100002789 Ga0070660_10000278914 297
450 3300005339 Ga0070660_100004887 Ga0070660_1000048876 297
451 3300005339 Ga0070660_100017709 Ga0070660_1000177095 297
452 3300005341 Ga0070691_10002318 Ga0070691_100023183 297
453 3300005347 Ga0070668_100011115 Ga0070668_1000111156 297
454 3300005353 Ga0070669_100384601 Ga0070669_1003846012 297
455 3300005353 Ga0070669_100425099 Ga0070669_1004250991 297
456 3300005355 Ga0070671_100048588 Ga0070671_1000485882 297
457 3300005356 Ga0070674_100005285 Ga0070674_1000052854 297
458 3300005356 Ga0070674_100007950 Ga0070674_1000079506 297
459 3300005356 Ga0070674_100014858 Ga0070674_1000148584 297
460 3300005364 Ga0070673_100000002 Ga0070673_100000002165 297
461 3300005364 Ga0070673_100007485 Ga0070673_1000074856 297
462 3300005366 Ga0070659_100000004 Ga0070659_100000004172 297
463 3300005366 Ga0070659_100003359 Ga0070659_1000033593 297
464 3300005366 Ga0070659_100009411 Ga0070659_1000094113 297
465 3300005366 Ga0070659_100011569 Ga0070659_1000115694 297
466 3300005366 Ga0070659_100040630 Ga0070659_1000406304 297
467 3300005366 Ga0070659_100115687 Ga0070659_1001156872 297
468 3300005436 Ga0070713_100103909 Ga0070713_1001039092 297
469 3300005445 Ga0070708_100327768 Ga0070708_1003277682 297
470 3300005455 Ga0070663_100036161 Ga0070663_1000361615 297
471 3300005456 Ga0070678_100000055 Ga0070678_10000005519 297
472 3300005458 Ga0070681_10006314 Ga0070681_1000631413 297
473 3300005458 Ga0070681_10010156 Ga0070681_100101563 297
474 3300005458 Ga0070681_10063724 Ga0070681_100637242 297
475 3300005459 Ga0068867_100000012 Ga0068867_10000001249 297
476 3300005459 Ga0068867_100013901 Ga0068867_1000139014 297
477 3300005467 Ga0070706_100022961 Ga0070706_1000229615 297
478 3300005471 Ga0070698_100005702 Ga0070698_1000057027 297
479 3300005530 Ga0070679_100000017 Ga0070679_100000017107 297
480 3300005530 Ga0070679_100033401 Ga0070679_1000334015 297
481 3300005530 Ga0070679_100260778 Ga0070679_1002607781 297
482 3300005539 Ga0068853_100007016 Ga0068853_1000070166 297
483 3300005539 Ga0068853_100008695 Ga0068853_1000086953 297
484 3300005539 Ga0068853_100288759 Ga0068853_1002887592 297
485 3300005539 Ga0068853_100494545 Ga0068853_1004945451 297
486 3300005548 Ga0070665_100000495 Ga0070665_10000049515 297
487 3300005548 Ga0070665_100004318 Ga0070665_10000431813 297
488 3300005563 Ga0068855_100000095 Ga0068855_10000009525 297
489 3300005563 Ga0068855_100001110 Ga0068855_10000111030 297
490 3300005563 Ga0068855_100012722 Ga0068855_1000127223 297
491 3300005563 Ga0068855_100053334 Ga0068855_1000533343 297
492 3300005563 Ga0068855_100066469 Ga0068855_1000664693 297
493 3300005577 Ga0068857_100012795 Ga0068857_1000127955 297
494 3300005577 Ga0068857_100048509 Ga0068857_1000485094 297
495 3300005577 Ga0068857_100168788 Ga0068857_1001687882 297
496 3300005578 Ga0068854_100000265 Ga0068854_10000026537 297
497 3300005578 Ga0068854_100004418 Ga0068854_1000044186 297
498 3300005578 Ga0068854_100113994 Ga0068854_1001139942 297
499 3300005616 Ga0068852_100004651 Ga0068852_1000046514 297
500 3300005616 Ga0068852_100431322 Ga0068852_1004313222 297
501 3300005841 Ga0068863_100010310 Ga0068863_1000103106 297
502 3300005842 Ga0068858_100274295 Ga0068858_1002742952 297
503 3300005843 Ga0068860_100040396 Ga0068860_1000403964 297
504 3300005937 Ga0081455_10000395 Ga0081455_1000039511 297
505 3300005937 Ga0081455_10001457 Ga0081455_1000145719 297
506 3300005937 Ga0081455_10002932 Ga0081455_100029322 297
507 3300005985 Ga0081539_10001300 Ga0081539_100013005 297
508 3300005985 Ga0081539_10015064 Ga0081539_100150643 297
509 3300005985 Ga0081539_10064432 Ga0081539_100644323 297
510 3300006177 Ga0075362_10026145 Ga0075362_100261452 297
511 3300006177 Ga0075362_10048194 Ga0075362_100481942 297
512 3300006178 Ga0075367_10049571 Ga0075367_100495713 297
513 3300006186 Ga0075369_10000420 Ga0075369_1000042010 297
514 3300006186 Ga0075369_10017179 Ga0075369_100171792 297
515 3300006237 Ga0097621_100014631 Ga0097621_1000146312 297
516 3300006237 Ga0097621_100168773 Ga0097621_1001687732 297
517 3300006871 Ga0075434_100057873 Ga0075434_1000578733 297
518 3300006881 Ga0068865_100000004 Ga0068865_100000004165 297
519 3300006914 Ga0075436_100181547 Ga0075436_1001815471 297
520 3300009093 Ga0105240_10018988 Ga0105240_100189882 297
521 3300009093 Ga0105240_10104302 Ga0105240_101043022 297
522 3300009094 Ga0111539_10181217 Ga0111539_101812173 297
523 3300009098 Ga0105245_10000195 Ga0105245_1000019562 297
524 3300009098 Ga0105245_10000620 Ga0105245_1000062029 297
525 3300009098 Ga0105245_10319433 Ga0105245_103194332 297
526 3300009148 Ga0105243_10000146 Ga0105243_1000014646 297
527 3300009148 Ga0105243_10000227 Ga0105243_1000022723 297
528 3300009176 Ga0105242_10007987 Ga0105242_100079873 297
529 3300009177 Ga0105248_10080171 Ga0105248_100801717 297
530 3300009551 Ga0105238_10030863 Ga0105238_100308634 297
531 3300009551 Ga0105238_10032552 Ga0105238_100325523 297
532 3300009551 Ga0105238_10107856 Ga0105238_101078562 297
533 3300010375 Ga0105239_10229587 Ga0105239_102295872 297
534 3300010375 Ga0105239_10479106 Ga0105239_104791062 297
535 3300010375 Ga0105239_10653171 Ga0105239_106531711 297
536 3300011119 Ga0105246_10002081 Ga0105246_100020815 297
537 3300011119 Ga0105246_10340701 Ga0105246_103407012 297
538 3300013100 Ga0157373_10017492 Ga0157373_100174923 297
539 3300013102 Ga0157371_10032088 Ga0157371_100320884 297
540 3300013104 Ga0157370_10002033 Ga0157370_100020336 297
541 3300013104 Ga0157370_10006332 Ga0157370_100063324 297
542 3300013105 Ga0157369_10189836 Ga0157369_101898362 297
543 3300013296 Ga0157374_10001738 Ga0157374_1000173821 297
544 3300013297 Ga0157378_10000408 Ga0157378_100004085 297
545 3300013297 Ga0157378_10131186 Ga0157378_101311863 297
546 3300013306 Ga0163162_10177052 Ga0163162_101770521 297
547 3300013307 Ga0157372_10406797 Ga0157372_104067972 297
548 3300013308 Ga0157375_10007814 Ga0157375_1000781411 297
549 3300014326 Ga0157380_10030260 Ga0157380_100302602 297
550 3300014326 Ga0157380_10185993 Ga0157380_101859931 297
551 3300014745 Ga0157377_10048205 Ga0157377_100482052 297
552 3300014969 Ga0157376_10000131 Ga0157376_1000013111 297
553 3300020070 Ga0206356_11001459 Ga0206356_110014593 297
554 3300021358 Ga0213873_10000027 Ga0213873_1000002779 297
555 3300021384 Ga0213876_10000004 Ga0213876_10000004394 297
556 3300021384 Ga0213876_10000873 Ga0213876_1000087319 297
557 3300021384 Ga0213876_10070156 Ga0213876_100701562 297
558 3300021384 Ga0213876_10083380 Ga0213876_100833802 297
559 3300021441 Ga0213871_10000912 Ga0213871_100009124 297
560 3300025233 Ga0209437_105644 Ga0209437_1056443 297
561 3300025254 Ga0209148_1000074 Ga0209148_1000074241 297
562 3300025261 Ga0209233_1000164 Ga0209233_100016440 297
563 3300025272 Ga0209455_1000767 Ga0209455_100076725 297
564 3300025292 Ga0209676_1000276 Ga0209676_100027652 297
565 3300025297 Ga0209758_1000017 Ga0209758_1000017142 297
566 3300025304 Ga0209257_1000695 Ga0209257_100069540 297
567 3300025893 Ga0207682_10001908 Ga0207682_100019084 297
568 3300025901 Ga0207688_10147536 Ga0207688_101475362 297
569 3300025904 Ga0207647_10001428 Ga0207647_100014282 297
570 3300025904 Ga0207647_10001494 Ga0207647_100014947 297
571 3300025904 Ga0207647_10007151 Ga0207647_100071515 297
572 3300025904 Ga0207647_10037408 Ga0207647_100374081 297
573 3300025907 Ga0207645_10002620 Ga0207645_100026205 297
574 3300025909 Ga0207705_10000002 Ga0207705_100000021174 297
575 3300025909 Ga0207705_10000055 Ga0207705_10000055114 297
576 3300025909 Ga0207705_10000179 Ga0207705_1000017940 297
577 3300025909 Ga0207705_10006076 Ga0207705_100060765 297
578 3300025909 Ga0207705_10023934 Ga0207705_100239342 297
579 3300025912 Ga0207707_10010908 Ga0207707_100109083 297
580 3300025912 Ga0207707_10020730 Ga0207707_100207303 297
581 3300025913 Ga0207695_10011332 Ga0207695_100113327 297
582 3300025913 Ga0207695_10063852 Ga0207695_100638522 297
583 3300025917 Ga0207660_10000048 Ga0207660_1000004834 297
584 3300025917 Ga0207660_10004472 Ga0207660_100044729 297
585 3300025917 Ga0207660_10102214 Ga0207660_101022143 297
586 3300025919 Ga0207657_10000791 Ga0207657_1000079125 297
587 3300025919 Ga0207657_10005726 Ga0207657_1000572613 297
588 3300025919 Ga0207657_10008671 Ga0207657_100086714 297
589 3300025919 Ga0207657_10008888 Ga0207657_1000888814 297
590 3300025919 Ga0207657_10013847 Ga0207657_100138472 297
591 3300025919 Ga0207657_10020682 Ga0207657_100206824 297
592 3300025919 Ga0207657_10065903 Ga0207657_100659033 297
593 3300025920 Ga0207649_10096375 Ga0207649_100963752 297
594 3300025921 Ga0207652_10000001 Ga0207652_10000001957 297
595 3300025921 Ga0207652_10009263 Ga0207652_100092639 297
596 3300025921 Ga0207652_10391557 Ga0207652_103915572 297
597 3300025922 Ga0207646_10046302 Ga0207646_100463022 297
598 3300025924 Ga0207694_10018991 Ga0207694_100189916 297
599 3300025924 Ga0207694_10034835 Ga0207694_100348352 297
600 3300025925 Ga0207650_10191833 Ga0207650_101918332 297
601 3300025925 Ga0207650_10286751 Ga0207650_102867512 297
602 3300025926 Ga0207659_10024872 Ga0207659_100248724 297
603 3300025926 Ga0207659_10108461 Ga0207659_101084612 297
604 3300025926 Ga0207659_10270936 Ga0207659_102709361 297
605 3300025927 Ga0207687_10002087 Ga0207687_1000208714 297
606 3300025927 Ga0207687_10011298 Ga0207687_100112984 297
607 3300025927 Ga0207687_10149302 Ga0207687_101493023 297
608 3300025931 Ga0207644_10041358 Ga0207644_100413582 297
609 3300025932 Ga0207690_10000001 Ga0207690_10000001413 297
610 3300025932 Ga0207690_10000002 Ga0207690_10000002413 297
611 3300025932 Ga0207690_10000003 Ga0207690_10000003413 297
612 3300025932 Ga0207690_10000004 Ga0207690_10000004413 297
613 3300025932 Ga0207690_10007315 Ga0207690_100073154 297
614 3300025932 Ga0207690_10009895 Ga0207690_100098953 297
615 3300025932 Ga0207690_10102030 Ga0207690_101020302 297
616 3300025932 Ga0207690_10177260 Ga0207690_101772601 297
617 3300025933 Ga0207706_10011966 Ga0207706_100119661 297
618 3300025933 Ga0207706_10027233 Ga0207706_100272333 297
619 3300025933 Ga0207706_10045683 Ga0207706_100456834 297
620 3300025934 Ga0207686_10000999 Ga0207686_100009992 297
621 3300025935 Ga0207709_10000093 Ga0207709_1000009360 297
622 3300025935 Ga0207709_10000314 Ga0207709_1000031433 297
623 3300025935 Ga0207709_10204658 Ga0207709_102046582 297
624 3300025937 Ga0207669_10000086 Ga0207669_1000008617 297
625 3300025937 Ga0207669_10001266 Ga0207669_100012662 297
626 3300025937 Ga0207669_10020553 Ga0207669_100205533 297
627 3300025937 Ga0207669_10160698 Ga0207669_101606982 297
628 3300025938 Ga0207704_10000005 Ga0207704_1000000547 297
629 3300025940 Ga0207691_10025393 Ga0207691_100253933 297
630 3300025940 Ga0207691_10129700 Ga0207691_101297003 297
631 3300025942 Ga0207689_10000043 Ga0207689_1000004311 297
632 3300025949 Ga0207667_10000016 Ga0207667_10000016259 297
633 3300025949 Ga0207667_10002740 Ga0207667_1000274015 297
634 3300025949 Ga0207667_10151404 Ga0207667_101514043 297
635 3300025960 Ga0207651_10000007 Ga0207651_1000000747 297
636 3300025960 Ga0207651_10008089 Ga0207651_100080893 297
637 3300025972 Ga0207668_10000632 Ga0207668_100006325 297
638 3300025972 Ga0207668_10193417 Ga0207668_101934172 297
639 3300025981 Ga0207640_10000139 Ga0207640_1000013932 297
640 3300025981 Ga0207640_10179802 Ga0207640_101798022 297
641 3300026023 Ga0207677_10000014 Ga0207677_10000014163 297
642 3300026023 Ga0207677_10000085 Ga0207677_1000008536 297
643 3300026035 Ga0207703_10000142 Ga0207703_1000014228 297
644 3300026035 Ga0207703_10351393 Ga0207703_103513932 297
645 3300026041 Ga0207639_10003835 Ga0207639_100038358 297
646 3300026041 Ga0207639_10006063 Ga0207639_100060636 297
647 3300026041 Ga0207639_10160692 Ga0207639_101606921 297
648 3300026041 Ga0207639_10222570 Ga0207639_102225702 297
649 3300026041 Ga0207639_10457969 Ga0207639_104579692 297
650 3300026067 Ga0207678_10000972 Ga0207678_1000097223 297
651 3300026078 Ga0207702_10400581 Ga0207702_104005812 297
652 3300026088 Ga0207641_10013104 Ga0207641_100131044 297
653 3300026088 Ga0207641_10431942 Ga0207641_104319422 297
654 3300026089 Ga0207648_10000005 Ga0207648_1000000548 297
655 3300026089 Ga0207648_10014658 Ga0207648_100146585 297
656 3300026116 Ga0207674_10015150 Ga0207674_100151504 297
657 3300026116 Ga0207674_10083489 Ga0207674_100834894 297
658 3300026121 Ga0207683_10000181 Ga0207683_1000018136 297
659 3300026121 Ga0207683_10192584 Ga0207683_101925842 297
660 3300026142 Ga0207698_10092206 Ga0207698_100922063 297
661 3300027364 Ga0209967_1009977 Ga0209967_10099771 297
662 3300027876 Ga0209974_10014975 Ga0209974_100149753 297
663 3300028379 Ga0268266_10003762 Ga0268266_100037627 297
664 3300028379 Ga0268266_10006216 Ga0268266_100062167 297
665 3300028381 Ga0268264_10042335 Ga0268264_100423353 297
666 3300028786 Ga0307517_10009945 Ga0307517_100099456 297
667 3300028786 Ga0307517_10011892 Ga0307517_100118927 297
668 3300031247 Ga0265340_10015248 Ga0265340_100152484 297
669 3300031548 Ga0307408_100059266 Ga0307408_1000592664 297
670 3300031616 Ga0307508_10002203 Ga0307508_1000220320 297
671 3300031731 Ga0307405_10045849 Ga0307405_100458493 297
672 3300031731 Ga0307405_10126124 Ga0307405_101261242 297
673 3300031824 Ga0307413_10010607 Ga0307413_100106076 297
674 3300031824 Ga0307413_10080578 Ga0307413_100805781 297
675 3300031824 Ga0307413_10153354 Ga0307413_101533542 297
676 3300031901 Ga0307406_10028909 Ga0307406_100289094 297
677 3300031901 Ga0307406_10110373 Ga0307406_101103732 297
678 3300031901 Ga0307406_10213899 Ga0307406_102138992 297
679 3300031903 Ga0307407_10042853 Ga0307407_100428534 297
680 3300031911 Ga0307412_10042238 Ga0307412_100422383 297
681 3300031911 Ga0307412_10166831 Ga0307412_101668311 297
682 3300031911 Ga0307412_10210810 Ga0307412_102108101 297
683 3300031911 Ga0307412_10306474 Ga0307412_103064741 297
684 3300031911 Ga0307412_10311991 Ga0307412_103119912 297
685 3300031995 Ga0307409_100003478 Ga0307409_1000034784 297
686 3300031995 Ga0307409_100016750 Ga0307409_1000167502 297
687 3300032002 Ga0307416_100146606 Ga0307416_1001466062 297
688 3300032004 Ga0307414_10002151 Ga0307414_100021512 297
689 3300032004 Ga0307414_10014045 Ga0307414_100140454 297
690 3300032004 Ga0307414_10038104 Ga0307414_100381044 297
691 3300032004 Ga0307414_10048367 Ga0307414_100483672 297
692 3300032004 Ga0307414_10085270 Ga0307414_100852701 297
693 3300032004 Ga0307414_10122390 Ga0307414_101223902 297
694 3300032004 Ga0307414_10269530 Ga0307414_102695302 297
695 3300032005 Ga0307411_10049862 Ga0307411_100498623 297
696 3300032005 Ga0307411_10217865 Ga0307411_102178652 297
697 3300032005 Ga0307411_10229289 Ga0307411_102292892 297
698 3300032005 Ga0307411_10504986 Ga0307411_105049861 297
699 3300032126 Ga0307415_100087862 Ga0307415_1000878622 297
700 3300033180 Ga0307510_10066196 Ga0307510_100661962 297
701 3300037312 Ga0395899_0128664 Ga0395899_0128664_784_1677 297
702 3300037418 Ga0395900_0002008 Ga0395900_0002008_9481_10374 297
703 3300037418 Ga0395900_0047992 Ga0395900_0047992_2669_3589 297
704 3300037466 Ga0395898_0024226 Ga0395898_0024226_1398_2318 297
705 3300037471 Ga0395905_0000218 Ga0395905_0000218_3780_4673 297
706 3300037471 Ga0395905_0017192 Ga0395905_0017192_944_1846 297
707 3300038443 Ga0395901_0002884 Ga0395901_0002884_2413_3306 297
708 3300038443 Ga0395901_0019988 Ga0395901_0019988_936_1856 297
709 3300039437 Ga0436365_0122535 Ga0436365_0122535_688_1638 297
710 3300039437 Ga0436365_0758923 Ga0436365_0758923_371_1264 297
711 3300039437 Ga0436365_1205090 Ga0436365_1205090_30776_31669 297
712 3300039438 Ga0436360_0428998 Ga0436360_0428998_4930_5850 297
713 3300039447 Ga0436361_0692291 Ga0436361_0692291_5546_6466 297
714 3300039453 Ga0436362_0251358 Ga0436362_0251358_143_1036 297
715 3300041512 Ga0451853_2025836 Ga0451853_2025836_277_1170 297
716 3300042157 Ga0439458_0001639 Ga0439458_0001639_1433_2326 297
717 3300044658 Ga0466972_0002157 Ga0466972_0002157_5280_6173 297
718 3300044693 Ga0466961_0034126 Ga0466961_0034126_1025_1918 297
719 3300044694 Ga0466963_0010040 Ga0466963_0010040_3031_3924 297
720 3300044719 Ga0466971_0060519 Ga0466971_0060519_79_972 297
721 3300044735 Ga0466968_0068784 Ga0466968_0068784_229_1122 297
722 3300044765 Ga0466970_0004756 Ga0466970_0004756_4435_5328 297
723 3300044842 Ga0466957_0007537 Ga0466957_0007537_3825_4718 297
724 3300044842 Ga0466957_0047567 Ga0466957_0047567_1070_1963 297
725 3300045049 Ga0466959_0097360 Ga0466959_0097360_812_1705 297
726 3300045836 Ga0466958_0004137 Ga0466958_0004137_3068_3961 297
727 3300045836 Ga0466958_0020218 Ga0466958_0020218_189_1082 297
728 3300045976 Ga0466967_0015827 Ga0466967_0015827_3205_4098 297
729 3300046460 Ga0495638_0000249 Ga0495638_0000249_6732_7625 297
730 3300046460 Ga0495638_0000266 Ga0495638_0000266_56409_57305 297
731 3300046471 Ga0495650_0000367 Ga0495650_0000367_4044_4937 297
732 3300046471 Ga0495650_0040743 Ga0495650_0040743_639_1532 297
733 3300046492 Ga0495585_0001411 Ga0495585_0001411_12841_13734 297
734 3300046492 Ga0495585_0043957 Ga0495585_0043957_492_1394 297
735 3300046500 Ga0495596_0004692 Ga0495596_0004692_4818_5711 297
736 3300046506 Ga0495583_0000175 Ga0495583_0000175_52737_53630 297
737 3300046506 Ga0495583_0000262 Ga0495583_0000262_73439_74332 297
738 3300046506 Ga0495583_0000879 Ga0495583_0000879_11750_12643 297
739 3300046506 Ga0495583_0004900 Ga0495583_0004900_869_1762 297
740 3300046507 Ga0495606_0000071 Ga0495606_0000071_127482_128375 297
741 3300046519 Ga0495632_0001780 Ga0495632_0001780_8409_9302 297
742 3300046522 Ga0495643_0000824 Ga0495643_0000824_8524_9417 297
743 3300046522 Ga0495643_0002434 Ga0495643_0002434_4511_5404 297
744 3300046522 Ga0495643_0008133 Ga0495643_0008133_4803_5696 297
745 3300046522 Ga0495643_0107803 Ga0495643_0107803_260_1153 297
746 3300046524 Ga0495648_0000015 Ga0495648_0000015_208806_209699 297
747 3300046524 Ga0495648_0000132 Ga0495648_0000132_847_1740 297
748 3300046524 Ga0495648_0075450 Ga0495648_0075450_182_1075 297
749 3300046525 Ga0495663_0004296 Ga0495663_0004296_2191_3084 297
750 3300046528 Ga0495642_0015818 Ga0495642_0015818_480_1373 297
751 3300046536 Ga0495587_0271263 Ga0495587_0271263_34_927 297
752 3300046542 Ga0495597_0075618 Ga0495597_0075618_50_943 297
753 3300046558 Ga0495633_0007590 Ga0495633_0007590_340_1233 297
754 3300046616 Ga0495668_0000013 Ga0495668_0000013_367315_368208 297
755 3300046648 Ga0495611_0025321 Ga0495611_0025321_495_1388 297
756 3300046648 Ga0495611_0041640 Ga0495611_0041640_769_1662 297
757 3300046648 Ga0495611_0053434 Ga0495611_0053434_863_1756 297
758 3300046660 Ga0495625_0000758 Ga0495625_0000758_35836_36738 297
759 3300046660 Ga0495625_0002253 Ga0495625_0002253_10778_11671 297
760 3300046660 Ga0495625_0005444 Ga0495625_0005444_2231_3124 297
761 3300046660 Ga0495625_0037437 Ga0495625_0037437_2522_3418 297
762 3300046660 Ga0495625_0047242 Ga0495625_0047242_1588_2481 297
763 3300046660 Ga0495625_0083277 Ga0495625_0083277_1180_2073 297
764 3300046660 Ga0495625_0127241 Ga0495625_0127241_357_1250 297
765 3300046665 Ga0495661_0043833 Ga0495661_0043833_771_1664 297
766 3300046665 Ga0495661_0161134 Ga0495661_0161134_96_989 297
767 3300046684 Ga0495669_0000023 Ga0495669_0000023_10396_11289 297
768 3300046691 Ga0495670_0127892 Ga0495670_0127892_53_946 297
769 3300046692 Ga0495671_0000084 Ga0495671_0000084_73639_74532 297
770 3300046692 Ga0495671_0061568 Ga0495671_0061568_345_1238 297
771 3300046810 Ga0495660_0074046 Ga0495660_0074046_102_995 297
772 3300047323 Ga0495683_0013556 Ga0495683_0013556_2617_3510 297
773 3300047443 Ga0495687_000076 Ga0495687_000076_11806_12699 297
774 3300047469 Ga0495673_0000206 Ga0495673_0000206_14012_14905 297
775 3300047470 Ga0495681_0075327 Ga0495681_0075327_227_1120 297
776 3300047472 Ga0495686_0000072 Ga0495686_0000072_194141_195034 297
777 3300047472 Ga0495686_0000962 Ga0495686_0000962_28863_29756 297
778 3300047472 Ga0495686_0002307 Ga0495686_0002307_12315_13208 297
779 3300047472 Ga0495686_0008799 Ga0495686_0008799_1781_2674 297
780 3300047472 Ga0495686_0032256 Ga0495686_0032256_329_1225 297
781 3300047472 Ga0495686_0128192 Ga0495686_0128192_383_1276 297
782 3300048920 Ga0496117_0003631 Ga0496117_0003631_4268_5161 297
783 3300048920 Ga0496117_0050916 Ga0496117_0050916_1715_2608 297
784 3300048921 Ga0496118_0000162 Ga0496118_0000162_92623_93516 297
785 3300048921 Ga0496118_0011572 Ga0496118_0011572_5722_6615 297
786 3300048921 Ga0496118_0086363 Ga0496118_0086363_34_927 297
787 3300048923 Ga0496120_0159902 Ga0496120_0159902_17_910 297
788 3300048924 Ga0496121_0002939 Ga0496121_0002939_7087_7980 297
789 3300048924 Ga0496121_0002997 Ga0496121_0002997_8423_9316 297
790 3300048925 Ga0496122_0008044 Ga0496122_0008044_1329_2222 297
791 3300048925 Ga0496122_0010853 Ga0496122_0010853_2984_3877 297
792 3300048926 Ga0496123_0000643 Ga0496123_0000643_48336_49229 297
793 3300048926 Ga0496123_0003112 Ga0496123_0003112_813_1706 297
794 3300048927 Ga0496124_0006400 Ga0496124_0006400_4102_4995 297
795 3300048928 Ga0496125_0006144 Ga0496125_0006144_2607_3500 297
796 3300048928 Ga0496125_0020332 Ga0496125_0020332_5284_6177 297
797 3300049569 Ga0501032_0016697 Ga0501032_0016697_55_948 297
798 3300049570 Ga0501033_0118730 Ga0501033_0118730_620_1513 297
799 3300049571 Ga0501034_0126968 Ga0501034_0126968_1459_2352 297
800 3300049572 Ga0501036_0005868 Ga0501036_0005868_2288_3181 297
801 3300049573 Ga0501037_0054790 Ga0501037_0054790_1685_2578 297
802 3300049574 Ga0501038_0212364 Ga0501038_0212364_154_1047 297
803 3300049575 Ga0501039_0032064 Ga0501039_0032064_2988_3881 297
804 3300049580 Ga0501046_0029514 Ga0501046_0029514_1555_2481 297
805 3300049580 Ga0501046_0192311 Ga0501046_0192311_184_1077 297
806 3300049581 Ga0501047_0110882 Ga0501047_0110882_1436_2362 297
807 3300049581 Ga0501047_0159672 Ga0501047_0159672_1109_2002 297
808 3300049581 Ga0501047_0301658 Ga0501047_0301658_530_1423 297
809 3300049822 Ga0501035_0025664 Ga0501035_0025664_327_1220 297
810 3300050492 nmdc:mga0yw44_168075_c1 nmdc:mga0yw44_168075_c1_88_1017 297
811 3300050494 nmdc:mga06z11_34258_c1 nmdc:mga06z11_34258_c1_1263_2195 297
812 3300050494 nmdc:mga06z11_37633_c1 nmdc:mga06z11_37633_c1_579_1499 297
813 3300050494 nmdc:mga06z11_40934_c1 nmdc:mga06z11_40934_c1_634_1554 297
814 3300050496 nmdc:mga07m45_38635_c1 nmdc:mga07m45_38635_c1_397_1329 297
815 3300050508 nmdc:mga09592_287644_c1 nmdc:mga09592_287644_c1_521_1414 297
816 3300050512 nmdc:mga0n895_65333_c1 nmdc:mga0n895_65333_c1_2602_3495 297
817 3300050516 nmdc:mga0sz30_148_c1 nmdc:mga0sz30_148_c1_19677_20609 297
818 3300050516 nmdc:mga0sz30_7134_c1 nmdc:mga0sz30_7134_c1_1633_2553 297
819 3300053079 Ga0500610_0010169 Ga0500610_0010169_1726_2619 297
820 3300053087 Ga0500643_069194 Ga0500643_069194_28_921 297
821 3300053098 Ga0500650_0022660 Ga0500650_0022660_805_1698 297
822 3300053103 Ga0500555_002637 Ga0500555_002637_69_962 297
823 3300053104 Ga0500556_0000013 Ga0500556_0000013_12063_12956 297
824 3300053105 Ga0500557_046688 Ga0500557_046688_366_1259 297
825 3300053119 Ga0500595_000322 Ga0500595_000322_25042_25935 297
826 3300053130 Ga0500642_0002968 Ga0500642_0002968_1267_2160 297
827 3300053134 Ga0500658_0001557 Ga0500658_0001557_4029_4925 297
828 3300053136 Ga0500559_0025686 Ga0500559_0025686_702_1595 297
829 3300053136 Ga0500559_0108698 Ga0500559_0108698_305_1207 297
830 3300053139 Ga0500568_0047570 Ga0500568_0047570_249_1151 297
831 3300053142 Ga0500577_0018894 Ga0500577_0018894_1237_2130 297
832 3300053153 Ga0500616_0001491 Ga0500616_0001491_7963_8883 297
833 3300053156 Ga0500622_0045229 Ga0500622_0045229_1106_1999 297
834 3300053730 Ga0500645_000003 Ga0500645_000003_103858_104751 297
835 3300053733 Ga0500552_000111 Ga0500552_000111_1110_2030 297
836 3300053735 Ga0500596_003051 Ga0500596_003051_55_948 297
837 3300061719 Ga0466962_0000873 Ga0466962_0000873_9342_10235 297
838 iso_pu_bacteria 2643221622 2644125173 297
839 iso_pu_bacteria 2879163058 2879164295 297
840 iso_pu_bacteria 2885429604 2885430764 297
841 3300003215 JGI25153J46596_10025950 JGI25153J46596_100259502 298
842 3300005344 Ga0070661_100000001 Ga0070661_10000000148 298
843 3300005719 Ga0068861_100319791 Ga0068861_1003197912 298
844 3300006038 Ga0075365_10073461 Ga0075365_100734612 298
845 3300013297 Ga0157378_10237536 Ga0157378_102375362 298
846 3300025263 Ga0209565_1000306 Ga0209565_100030617 298
847 3300025273 Ga0209673_1008882 Ga0209673_10088823 298
848 3300025920 Ga0207649_10000018 Ga0207649_1000001871 298
849 3300026118 Ga0207675_100306769 Ga0207675_1003067692 298
850 3300046524 Ga0495648_0046973 Ga0495648_0046973_381_1277 298
851 3300046530 Ga0495654_0000264 Ga0495654_0000264_40388_41284 298
852 3300046616 Ga0495668_0080252 Ga0495668_0080252_834_1730 298
853 3300046660 Ga0495625_0014698 Ga0495625_0014698_3839_4735 298
854 3300049523 Ga0501300_004127 Ga0501300_004127_28_924 298
855 3300049571 Ga0501034_0162907 Ga0501034_0162907_897_1793 298
856 3300049585 Ga0501069_0008799 Ga0501069_0008799_1199_2095 298
857 3300049586 Ga0501070_0042512 Ga0501070_0042512_2608_3504 298
858 3300049663 Ga0501223_002015 Ga0501223_002015_3328_4224 298
859 3300049686 Ga0501257_000074 Ga0501257_000074_8992_9888 298
860 3300049776 Ga0501280_014312 Ga0501280_014312_217_1113 298
861 3300053151 Ga0500604_0000018 Ga0500604_0000018_73808_74713 298
862 3300053158 Ga0500627_0000188 Ga0500627_0000188_12819_13715 298
863 iso_pu_bacteria 2512564014 2512642088 298
864 iso_pu_bacteria 2599185359 2600228046 298
865 iso_pu_bacteria 2775507255 2778124071 298
866 iso_pu_bacteria 2818991466 2819715149 298
867 iso_pu_bacteria 2919709256 2919710073 298
868 iso_pu_bacteria 2928526807 2928531163 298
869 iso_pu_bacteria 2928968154 2928972339 298
870 3300005577 Ga0068857_100017141 Ga0068857_1000171415 299
871 3300005617 Ga0068859_100000682 Ga0068859_10000068213 299
872 3300006931 Ga0097620_100000682 Ga0097620_10000068213 299
873 3300009177 Ga0105248_10000824 Ga0105248_100008244 299
874 3300025941 Ga0207711_10032269 Ga0207711_100322694 299
875 3300026041 Ga0207639_10001919 Ga0207639_100019195 299
876 3300026078 Ga0207702_10440943 Ga0207702_104409432 299
877 3300026116 Ga0207674_10047233 Ga0207674_100472333 299
878 3300037068 Ga0373925_0290818 Ga0373925_0290818_273_1223 299
879 3300005842 Ga0068858_100000482 Ga0068858_1000004825 300
880 3300009177 Ga0105248_10015827 Ga0105248_100158279 300
881 3300025941 Ga0207711_10022434 Ga0207711_100224342 300
882 3300026035 Ga0207703_10000254 Ga0207703_1000025437 300
883 3300026095 Ga0207676_10000331 Ga0207676_100003311 300
884 3300027876 Ga0209974_10007473 Ga0209974_100074735 300
885 3300031824 Ga0307413_10119634 Ga0307413_101196341 300
886 3300031911 Ga0307412_10089533 Ga0307412_100895332 300
887 3300032002 Ga0307416_100015921 Ga0307416_1000159215 300
888 3300032004 Ga0307414_10429377 Ga0307414_104293771 300
889 3300033180 Ga0307510_10034948 Ga0307510_100349481 300
890 3300046460 Ga0495638_0014466 Ga0495638_0014466_3002_3925 300
891 3300053087 Ga0500643_001426 Ga0500643_001426_5475_6377 300
892 iso_pu_bacteria 2808606401 2809063680 300
893 iso_pu_bacteria 2808606404 2809079702 300
894 iso_pu_bacteria 2808606405 2809084067 300
895 iso_pu_bacteria 2880518877 2880519390 300
896 3300000043 ARcpr5yngRDRAFT_c001989 ARcpr5yngRDRAFT_0019892 301
897 3300001990 JGI24737J22298_10000584 JGI24737J22298_100005847 301
898 3300003759 Ga0055525_1000096 Ga0055525_100009616 301
899 3300003762 Ga0055542_1000012 Ga0055542_1000012315 301
900 3300003763 Ga0055529_1000002 Ga0055529_1000002231 301
901 3300003763 Ga0055529_1000021 Ga0055529_1000021250 301
902 3300003773 Ga0055537_1000357 Ga0055537_100035724 301
903 3300003775 Ga0055524_1000361 Ga0055524_100036120 301
904 3300003794 Ga0055531_10000100 Ga0055531_10000100105 301
905 3300003794 Ga0055531_10003757 Ga0055531_100037577 301
906 3300004625 Ga0055543_1020161 Ga0055543_10201611 301
907 3300005262 Ga0065165_1001356 Ga0065165_100135623 301
908 3300005262 Ga0065165_1002875 Ga0065165_10028757 301
909 3300005262 Ga0065165_1021348 Ga0065165_10213483 301
910 3300005262 Ga0065165_1056879 Ga0065165_10568791 301
911 3300005327 Ga0070658_10005123 Ga0070658_100051232 301
912 3300005344 Ga0070661_100002510 Ga0070661_1000025107 301
913 3300005455 Ga0070663_100040999 Ga0070663_1000409992 301
914 3300005535 Ga0070684_100027100 Ga0070684_1000271004 301
915 3300005548 Ga0070665_100000043 Ga0070665_100000043144 301
916 3300005563 Ga0068855_100590007 Ga0068855_1005900071 301
917 3300005577 Ga0068857_100068383 Ga0068857_1000683831 301
918 3300009174 Ga0105241_10006348 Ga0105241_100063484 301
919 3300013102 Ga0157371_10000094 Ga0157371_1000009444 301
920 3300013104 Ga0157370_10039775 Ga0157370_100397754 301
921 3300014968 Ga0157379_10385122 Ga0157379_103851221 301
922 3300025226 Ga0209674_103207 Ga0209674_1032073 301
923 3300025230 Ga0209563_100058 Ga0209563_100058107 301
924 3300025245 Ga0207425_1006442 Ga0207425_10064423 301
925 3300025253 Ga0209677_109339 Ga0209677_1093392 301
926 3300025254 Ga0209148_1000008 Ga0209148_1000008948 301
927 3300025263 Ga0209565_1000011 Ga0209565_100001126 301
928 3300025272 Ga0209455_1000002 Ga0209455_1000002477 301
929 3300025273 Ga0209673_1002201 Ga0209673_10022014 301
930 3300025291 Ga0209675_1008549 Ga0209675_10085492 301
931 3300025297 Ga0209758_1005550 Ga0209758_10055505 301
932 3300025298 Ga0209050_1000071 Ga0209050_1000071129 301
933 3300025298 Ga0209050_1005347 Ga0209050_10053476 301
934 3300025299 Ga0209256_1000016 Ga0209256_1000016573 301
935 3300025304 Ga0209257_1000027 Ga0209257_1000027174 301
936 3300025304 Ga0209257_1005113 Ga0209257_10051134 301
937 3300025304 Ga0209257_1014104 Ga0209257_10141043 301
938 3300025909 Ga0207705_10001170 Ga0207705_100011706 301
939 3300025911 Ga0207654_10000020 Ga0207654_1000002034 301
940 3300025913 Ga0207695_10020535 Ga0207695_100205355 301
941 3300025914 Ga0207671_10014334 Ga0207671_100143345 301
942 3300025919 Ga0207657_10023951 Ga0207657_100239513 301
943 3300025920 Ga0207649_10000130 Ga0207649_1000013053 301
944 3300025931 Ga0207644_10064136 Ga0207644_100641363 301
945 3300025932 Ga0207690_10000063 Ga0207690_1000006374 301
946 3300025933 Ga0207706_10040050 Ga0207706_100400502 301
947 3300025937 Ga0207669_10110758 Ga0207669_101107582 301
948 3300025945 Ga0207679_10016813 Ga0207679_100168133 301
949 3300025949 Ga0207667_10000006 Ga0207667_1000000683 301
950 3300026035 Ga0207703_10054466 Ga0207703_100544663 301
951 3300026041 Ga0207639_10001668 Ga0207639_1000166812 301
952 3300026067 Ga0207678_10004783 Ga0207678_100047837 301
953 3300026078 Ga0207702_10002032 Ga0207702_100020322 301
954 3300026089 Ga0207648_10165026 Ga0207648_101650262 301
955 3300026116 Ga0207674_10019142 Ga0207674_100191422 301
956 3300026116 Ga0207674_10036234 Ga0207674_100362341 301
957 3300026118 Ga0207675_100001943 Ga0207675_10000194323 301
958 3300026142 Ga0207698_10026229 Ga0207698_100262292 301
959 3300028379 Ga0268266_10000002 Ga0268266_10000002446 301
960 3300031731 Ga0307405_10143520 Ga0307405_101435202 301
961 3300031731 Ga0307405_10233591 Ga0307405_102335912 301
962 3300031824 Ga0307413_10095823 Ga0307413_100958232 301
963 3300031852 Ga0307410_10063922 Ga0307410_100639222 301
964 3300031901 Ga0307406_10111203 Ga0307406_101112032 301
965 3300031911 Ga0307412_10110118 Ga0307412_101101182 301
966 3300031995 Ga0307409_100341322 Ga0307409_1003413222 301
967 3300032004 Ga0307414_10079800 Ga0307414_100798003 301
968 3300032004 Ga0307414_10334196 Ga0307414_103341962 301
969 3300032126 Ga0307415_100045438 Ga0307415_1000454384 301
970 3300041404 Ga0439436_0023454 Ga0439436_0023454_592_1497 301
971 3300041406 Ga0439439_0011720 Ga0439439_0011720_141_1046 301
972 3300041997 Ga0439431_0025523 Ga0439431_0025523_406_1311 301
973 3300042012 Ga0439455_0000097 Ga0439455_0000097_1094_2008 301
974 3300042435 Ga0439434_0025664 Ga0439434_0025664_524_1429 301
975 3300046506 Ga0495583_0020752 Ga0495583_0020752_2118_3023 301
976 3300046691 Ga0495670_0000010 Ga0495670_0000010_97826_98743 301
977 3300046694 Ga0495649_0007386 Ga0495649_0007386_3704_4609 301
978 3300047443 Ga0495687_000080 Ga0495687_000080_119104_120009 301
979 3300047470 Ga0495681_0042262 Ga0495681_0042262_951_1856 301
980 3300048919 Ga0496116_0068160 Ga0496116_0068160_566_1471 301
981 3300048925 Ga0496122_0013101 Ga0496122_0013101_354_1259 301
982 3300048926 Ga0496123_0017852 Ga0496123_0017852_4740_5645 301
983 3300048927 Ga0496124_0000830 Ga0496124_0000830_47021_47926 301
984 3300048928 Ga0496125_0007778 Ga0496125_0007778_10379_11284 301
985 3300049765 Ga0501268_002046 Ga0501268_002046_1342_2247 301
986 3300053087 Ga0500643_000203 Ga0500643_000203_51687_52613 301
987 3300053094 Ga0500566_0001654 Ga0500566_0001654_5224_6129 301
988 3300053134 Ga0500658_0004819 Ga0500658_0004819_2837_3742 301
989 2162886007 SwRhRL2b_contig_1751179 SwRhRL2b_0904.00006160 302
990 2162886007 SwRhRL2b_contig_3930390 SwRhRL2b_0982.00007710 302
991 3300001915 JGI24741J21665_1000004 JGI24741J21665_100000430 302
992 3300001989 JGI24739J22299_10000714 JGI24739J22299_1000071412 302
993 3300001990 JGI24737J22298_10001100 JGI24737J22298_100011003 302
994 3300002067 JGI24735J21928_10009901 JGI24735J21928_100099013 302
995 3300003215 JGI25153J46596_10000032 JGI25153J46596_10000032184 302
996 3300003781 Ga0055536_1015678 Ga0055536_10156783 302
997 3300003791 Ga0055530_10022189 Ga0055530_100221892 302
998 3300003792 Ga0055540_1005045 Ga0055540_10050457 302
999 3300005289 Ga0065704_10006098 Ga0065704_100060983 302
1000 3300005355 Ga0070671_100077802 Ga0070671_1000778022 302
1001 3300005548 Ga0070665_100066271 Ga0070665_1000662712 302
1002 3300005563 Ga0068855_100393588 Ga0068855_1003935882 302
1003 3300005577 Ga0068857_100078386 Ga0068857_1000783865 302
1004 3300005577 Ga0068857_100175331 Ga0068857_1001753312 302
1005 3300005578 Ga0068854_100065856 Ga0068854_1000658564 302
1006 3300005614 Ga0068856_100003848 Ga0068856_10000384811 302
1007 3300009147 Ga0114129_10080446 Ga0114129_100804464 302
1008 3300009174 Ga0105241_10001135 Ga0105241_100011356 302
1009 3300009545 Ga0105237_10231725 Ga0105237_102317251 302
1010 3300009553 Ga0105249_10323481 Ga0105249_103234812 302
1011 3300017792 Ga0163161_10057115 Ga0163161_100571152 302
1012 3300025245 Ga0207425_1000025 Ga0207425_1000025268 302
1013 3300025258 Ga0209129_1000671 Ga0209129_100067119 302
1014 3300025294 Ga0209025_1000663 Ga0209025_100066327 302
1015 3300025297 Ga0209758_1000002 Ga0209758_1000002352 302
1016 3300025298 Ga0209050_1000001 Ga0209050_1000001295 302
1017 3300025298 Ga0209050_1000823 Ga0209050_100082329 302
1018 3300025298 Ga0209050_1014947 Ga0209050_10149474 302
1019 3300025303 Ga0209051_1000689 Ga0209051_100068927 302
1020 3300025304 Ga0209257_1012649 Ga0209257_10126492 302
1021 3300025304 Ga0209257_1012697 Ga0209257_10126972 302
1022 3300025904 Ga0207647_10021613 Ga0207647_100216131 302
1023 3300025914 Ga0207671_10013921 Ga0207671_100139216 302
1024 3300025925 Ga0207650_10088181 Ga0207650_100881812 302
1025 3300025931 Ga0207644_10025155 Ga0207644_100251553 302
1026 3300025945 Ga0207679_10571384 Ga0207679_105713841 302
1027 3300025981 Ga0207640_10008156 Ga0207640_100081566 302
1028 3300026041 Ga0207639_10002219 Ga0207639_100022195 302
1029 3300026067 Ga0207678_10000072 Ga0207678_1000007218 302
1030 3300026116 Ga0207674_10040826 Ga0207674_100408263 302
1031 3300026116 Ga0207674_10064391 Ga0207674_100643916 302
1032 3300028379 Ga0268266_10144969 Ga0268266_101449692 302
1033 3300031548 Ga0307408_100016395 Ga0307408_1000163954 302
1034 3300031548 Ga0307408_100396766 Ga0307408_1003967662 302
1035 3300031711 Ga0265314_10054163 Ga0265314_100541633 302
1036 3300031731 Ga0307405_10060893 Ga0307405_100608932 302
1037 3300031731 Ga0307405_10199937 Ga0307405_101999372 302
1038 3300031852 Ga0307410_10121780 Ga0307410_101217802 302
1039 3300031911 Ga0307412_10005140 Ga0307412_100051402 302
1040 3300032002 Ga0307416_100147262 Ga0307416_1001472623 302
1041 3300041413 Ga0439465_0000784 Ga0439465_0000784_2798_3706 302
1042 3300041997 Ga0439431_0000151 Ga0439431_0000151_3647_4555 302
1043 3300042006 Ga0439432_001267 Ga0439432_001267_2332_3240 302
1044 3300042015 Ga0439462_0001229 Ga0439462_0001229_521_1429 302
1045 3300042156 Ga0439446_0010555 Ga0439446_0010555_1105_2013 302
1046 3300042435 Ga0439434_0000358 Ga0439434_0000358_677_1585 302
1047 3300046520 Ga0495637_0000886 Ga0495637_0000886_5002_5910 302
1048 3300046522 Ga0495643_0000053 Ga0495643_0000053_174736_175644 302
1049 3300046524 Ga0495648_0068485 Ga0495648_0068485_980_1903 302
1050 3300046525 Ga0495663_0000020 Ga0495663_0000020_26473_27471 302
1051 3300046558 Ga0495633_0001251 Ga0495633_0001251_3424_4422 302
1052 3300046558 Ga0495633_0001282 Ga0495633_0001282_5531_6439 302
1053 3300046692 Ga0495671_0000031 Ga0495671_0000031_26388_27296 302
1054 3300047470 Ga0495681_0008207 Ga0495681_0008207_2245_3153 302
1055 3300047470 Ga0495681_0049049 Ga0495681_0049049_519_1427 302
1056 3300048911 Ga0496108_0006481 Ga0496108_0006481_6451_7359 302
1057 3300048913 Ga0496110_0054021 Ga0496110_0054021_1035_1964 302
1058 3300048913 Ga0496110_0407099 Ga0496110_0407099_101_1009 302
1059 3300048914 Ga0496111_0095883 Ga0496111_0095883_1002_1931 302
1060 3300048920 Ga0496117_0080500 Ga0496117_0080500_181_1089 302
1061 3300048924 Ga0496121_0001861 Ga0496121_0001861_9769_10677 302
1062 3300048924 Ga0496121_0087804 Ga0496121_0087804_407_1336 302
1063 3300048925 Ga0496122_0067654 Ga0496122_0067654_62_970 302
1064 3300048925 Ga0496122_0189030 Ga0496122_0189030_203_1111 302
1065 3300048926 Ga0496123_0000804 Ga0496123_0000804_26946_27884 302
1066 3300048926 Ga0496123_0025967 Ga0496123_0025967_3467_4375 302
1067 3300048926 Ga0496123_0102046 Ga0496123_0102046_56_964 302
1068 3300048926 Ga0496123_0115362 Ga0496123_0115362_274_1203 302
1069 3300048927 Ga0496124_0007019 Ga0496124_0007019_1863_2792 302
1070 3300048927 Ga0496124_0049666 Ga0496124_0049666_1020_1928 302
1071 3300048927 Ga0496124_0132784 Ga0496124_0132784_968_1909 302
1072 3300048928 Ga0496125_0000335 Ga0496125_0000335_11438_12367 302
1073 3300048928 Ga0496125_0009669 Ga0496125_0009669_8550_9458 302
1074 3300048928 Ga0496125_0020675 Ga0496125_0020675_3996_4904 302
1075 3300049663 Ga0501223_000082 Ga0501223_000082_19617_20525 302
1076 3300049705 Ga0501225_0000059 Ga0501225_0000059_25248_26156 302
1077 3300049758 Ga0501241_000565 Ga0501241_000565_277_1185 302
1078 3300053096 Ga0500641_0001530 Ga0500641_0001530_5281_6222 302
1079 3300053119 Ga0500595_001189 Ga0500595_001189_7750_8658 302
1080 3300053139 Ga0500568_0004980 Ga0500568_0004980_4001_5035 302
1081 3300053151 Ga0500604_0008220 Ga0500604_0008220_1801_2709 302
1082 3300053153 Ga0500616_0002249 Ga0500616_0002249_6412_7446 302
1083 3300053157 Ga0500624_000024 Ga0500624_000024_58567_59517 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07650

KH_2

KH domain

252

329

0.93

PF01926

MMR_HSR1

50S ribosome-binding GTPase

54

169

0.91

PF02421

FeoB_N

Ferrous iron transport protein B

53

212

0.88

PF00009

GTP_EFTU

Elongation factor Tu GTP binding domain

50

218

0.76

PF10662

PduV-EutP

Ethanolamine utilisation - propanediol utilisation

52

214

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wf3-assembly1.cif.gz_A crystal structure of gtp-binding protein tt1341 from thermus thermophilus hb8 0.7981 8 300
4acb-assembly1.cif.gz_A crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp 0.7958 7 173
5x4b-assembly2.cif.gz_B crystal structure of n-terminal g-domain of enga from bacillus subtilis 0.7936 11 173
1wf3-assembly1.cif.gz_A crystal structure of gtp-binding protein tt1341 from thermus thermophilus hb8 0.7885 8 300
4aca-assembly1.cif.gz_A crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form 0.7801 7 176
ID Description Score Start End Superfamily
af_Q2FY06_2_183_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8698 8 187 3.40.50.300
af_P9WNK9_2_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.859 8 183 3.40.50.300
af_Q2FY06_2_183_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8564 8 187 3.40.50.300
af_Q9CZU4_341_437_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8443 195 283 3.30.300.20
af_Q8ILA6_408_504_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.844 196 283 3.30.300.20

Feature Viewer

pLDDT pTM Quality
74.04 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map