F489731
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1083 | 384 | 1064 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0004980|Ga0500568_0004980_4001_5035 |
| Length | 344 |
| Sequence | VTNSDASASVIHFPLVDADAFGVEAGAGIPILAFIIFSAEGGRMEPVTQQRFGTIAVVGAPNAGKSTLVNALVGQKVAIVSPKAQTTRTRLMGIAMLGTSQILLTDTPGIFEPKRRLDRAMVAAAWGSAQDVDLIALIVDASTGLKRGVTELLDRLKDRPEPKLLILNKVDLVKKEVLLALITQFDGRADFEQIYMISASTGDGVEELKAALAARVPEGPWHFPEDQVSDATDRMMAAEITREQLYHQLHAELPYASAIETEKYEERKDGSVVIHQQILVGRDTQKAIVLGKGGTRIKQIGESARKELTEALGRKVHLFLHVKVNPKWEEDRGLYREIGLDWVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 6 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 7 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 8 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 9 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 10 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 11 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 12 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 13 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 14 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 15 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 16 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 17 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 18 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 19 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 20 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 21 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 22 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 23 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 24 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 25 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 26 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 27 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 28 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 29 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 30 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 44 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 46 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 111 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 148 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 235 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 236 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 237 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 238 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 254 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 257 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 258 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 259 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 262 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 263 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 264 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 265 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 266 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 267 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 268 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 320 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 342 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 344 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 346 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 347 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 348 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 349 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 361 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 364 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 367 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 368 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 369 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 370 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 371 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 378 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 379 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 382 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.06 |
| Metatranscriptomes | 0.18 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 10.16 |
| Nodule | 0 |
| Rhizoplane | 1.11 |
| Rhizosphere | 83.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1751179 | 2162886007 | Bacteria | 2521 |
| 2 | SwRhRL2b_contig_3930390 | 2162886007 | Bacteria | 2521 |
| 3 | ARcpr5yngRDRAFT_c001989 | 3300000043 | Bacteria | 2178 |
| 4 | JGI24736J21556_1006943 | 3300001904 | Bacteria | 1907 |
| 5 | JGI24736J21556_1011073 | 3300001904 | Bacteria | 1469 |
| 6 | JGI24741J21665_1000004 | 3300001915 | Bacteria | 51710 |
| 7 | JGI24740J21852_10001550 | 3300001979 | Bacteria | 10564 |
| 8 | JGI24740J21852_10013368 | 3300001979 | Bacteria | 3063 |
| 9 | JGI24740J21852_10066055 | 3300001979 | Bacteria | 983 |
| 10 | JGI24739J22299_10000714 | 3300001989 | Bacteria | 12040 |
| 11 | JGI24739J22299_10001469 | 3300001989 | Bacteria | 8892 |
| 12 | JGI24739J22299_10004008 | 3300001989 | Bacteria | 5635 |
| 13 | JGI24739J22299_10004251 | 3300001989 | Bacteria | 5483 |
| 14 | JGI24739J22299_10010073 | 3300001989 | Bacteria | 3513 |
| 15 | JGI24739J22299_10024985 | 3300001989 | Bacteria | 2102 |
| 16 | JGI24739J22299_10029529 | 3300001989 | Bacteria | 1906 |
| 17 | JGI24737J22298_10000293 | 3300001990 | Bacteria | 16594 |
| 18 | JGI24737J22298_10000584 | 3300001990 | Bacteria | 12798 |
| 19 | JGI24737J22298_10001100 | 3300001990 | Bacteria | 9504 |
| 20 | JGI24737J22298_10001195 | 3300001990 | Bacteria | 9156 |
| 21 | JGI24737J22298_10017771 | 3300001990 | Bacteria | 2288 |
| 22 | JGI24737J22298_10029109 | 3300001990 | Bacteria | 1733 |
| 23 | JGI24737J22298_10070569 | 3300001990 | Bacteria | 1043 |
| 24 | JGI24735J21928_10008752 | 3300002067 | Bacteria | 3266 |
| 25 | JGI24735J21928_10009901 | 3300002067 | Bacteria | 3053 |
| 26 | JGI24735J21928_10015899 | 3300002067 | Bacteria | 2343 |
| 27 | JGI24735J21928_10016482 | 3300002067 | Bacteria | 2291 |
| 28 | JGI24735J21928_10022352 | 3300002067 | Bacteria | 1926 |
| 29 | JGI24735J21928_10027960 | 3300002067 | Bacteria | 1686 |
| 30 | JGI24735J21928_10039234 | 3300002067 | Bacteria | 1385 |
| 31 | JGI24735J21928_10059668 | 3300002067 | Bacteria | 1096 |
| 32 | JGI24738J21930_10000814 | 3300002075 | Bacteria | 8931 |
| 33 | JGI24738J21930_10001002 | 3300002075 | Bacteria | 8087 |
| 34 | JGI24738J21930_10005507 | 3300002075 | Bacteria | 3028 |
| 35 | JGI24744J21845_10005272 | 3300002077 | Bacteria | 2675 |
| 36 | JGI24742J22300_10006052 | 3300002244 | Bacteria | 1994 |
| 37 | JGI24742J22300_10031262 | 3300002244 | Bacteria | 931 |
| 38 | JGI25165J46597_1000165 | 3300003214 | Bacteria | 104009 |
| 39 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 40 | JGI25153J46596_10000032 | 3300003215 | Bacteria | 196732 |
| 41 | JGI25153J46596_10025950 | 3300003215 | Bacteria | 2084 |
| 42 | Ga0055525_1000096 | 3300003759 | Bacteria | 137836 |
| 43 | Ga0055542_1000012 | 3300003762 | Bacteria | 391808 |
| 44 | Ga0055529_1000002 | 3300003763 | Bacteria | 537914 |
| 45 | Ga0055529_1000021 | 3300003763 | Bacteria | 321484 |
| 46 | Ga0055537_1000357 | 3300003773 | Bacteria | 31036 |
| 47 | Ga0055524_1000361 | 3300003775 | Bacteria | 40768 |
| 48 | Ga0055536_1015678 | 3300003781 | Bacteria | 2577 |
| 49 | Ga0055530_10022189 | 3300003791 | Bacteria | 1852 |
| 50 | Ga0055540_1005045 | 3300003792 | Bacteria | 5723 |
| 51 | Ga0055531_10000100 | 3300003794 | Bacteria | 93692 |
| 52 | Ga0055531_10003757 | 3300003794 | Bacteria | 9533 |
| 53 | Ga0055531_10025182 | 3300003794 | Bacteria | 2170 |
| 54 | JGI25405J52794_10007653 | 3300003911 | Bacteria | 1997 |
| 55 | Ga0055543_1020161 | 3300004625 | Bacteria | 1228 |
| 56 | Ga0065165_1001356 | 3300005262 | Bacteria | 27042 |
| 57 | Ga0065165_1002875 | 3300005262 | Bacteria | 13257 |
| 58 | Ga0065165_1021348 | 3300005262 | Bacteria | 2252 |
| 59 | Ga0065165_1056879 | 3300005262 | Bacteria | 1085 |
| 60 | Ga0065704_10006098 | 3300005289 | Bacteria | 4341 |
| 61 | Ga0065704_10208631 | 3300005289 | Bacteria | 1117 |
| 62 | Ga0065712_10152329 | 3300005290 | Bacteria | 1352 |
| 63 | Ga0065707_10082626 | 3300005295 | Bacteria | 13216 |
| 64 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 65 | Ga0070658_10000062 | 3300005327 | Bacteria | 107844 |
| 66 | Ga0070658_10000612 | 3300005327 | Bacteria | 30912 |
| 67 | Ga0070658_10000691 | 3300005327 | Bacteria | 29223 |
| 68 | Ga0070658_10005123 | 3300005327 | Bacteria | 10669 |
| 69 | Ga0070658_10008207 | 3300005327 | Bacteria | 8396 |
| 70 | Ga0070658_10036686 | 3300005327 | Bacteria | 3951 |
| 71 | Ga0070658_10091850 | 3300005327 | Bacteria | 2502 |
| 72 | Ga0070658_10092146 | 3300005327 | Bacteria | 2498 |
| 73 | Ga0070676_10000999 | 3300005328 | Bacteria | 14039 |
| 74 | Ga0070676_10004996 | 3300005328 | Bacteria | 7025 |
| 75 | Ga0070676_10149291 | 3300005328 | Bacteria | 1495 |
| 76 | Ga0070683_100060925 | 3300005329 | Bacteria | 3508 |
| 77 | Ga0070683_100365320 | 3300005329 | Bacteria | 1374 |
| 78 | Ga0070670_100018265 | 3300005331 | Bacteria | 6016 |
| 79 | Ga0070670_100040431 | 3300005331 | Bacteria | 4009 |
| 80 | Ga0070670_100065316 | 3300005331 | Bacteria | 3122 |
| 81 | Ga0070670_100070931 | 3300005331 | Bacteria | 2991 |
| 82 | Ga0070670_100374967 | 3300005331 | Bacteria | 1253 |
| 83 | Ga0070670_100454313 | 3300005331 | Bacteria | 1136 |
| 84 | Ga0070677_10000059 | 3300005333 | Bacteria | 34210 |
| 85 | Ga0068869_100000094 | 3300005334 | Bacteria | 41359 |
| 86 | Ga0068869_100000225 | 3300005334 | Bacteria | 29577 |
| 87 | Ga0068869_100448860 | 3300005334 | Bacteria | 1069 |
| 88 | Ga0070666_10000342 | 3300005335 | Bacteria | 29324 |
| 89 | Ga0070666_10017178 | 3300005335 | Bacteria | 4636 |
| 90 | Ga0070666_10149578 | 3300005335 | Bacteria | 1629 |
| 91 | Ga0070666_10507389 | 3300005335 | Bacteria | 875 |
| 92 | Ga0070680_100000295 | 3300005336 | Bacteria | 33407 |
| 93 | Ga0070680_100343924 | 3300005336 | Bacteria | 1268 |
| 94 | Ga0070682_100052195 | 3300005337 | Bacteria | 2558 |
| 95 | Ga0068868_100000007 | 3300005338 | Bacteria | 123028 |
| 96 | Ga0068868_100000013 | 3300005338 | Bacteria | 110536 |
| 97 | Ga0068868_100000113 | 3300005338 | Bacteria | 50799 |
| 98 | Ga0068868_100002389 | 3300005338 | Bacteria | 12993 |
| 99 | Ga0068868_100184873 | 3300005338 | Bacteria | 1731 |
| 100 | Ga0070660_100000377 | 3300005339 | Bacteria | 29678 |
| 101 | Ga0070660_100001392 | 3300005339 | Bacteria | 16462 |
| 102 | Ga0070660_100001509 | 3300005339 | Bacteria | 15957 |
| 103 | Ga0070660_100002789 | 3300005339 | Bacteria | 12001 |
| 104 | Ga0070660_100004887 | 3300005339 | Bacteria | 9264 |
| 105 | Ga0070660_100017709 | 3300005339 | Bacteria | 5195 |
| 106 | Ga0070660_100041042 | 3300005339 | Bacteria | 3525 |
| 107 | Ga0070660_100041201 | 3300005339 | Bacteria | 3519 |
| 108 | Ga0070660_100083027 | 3300005339 | Bacteria | 2516 |
| 109 | Ga0070691_10002318 | 3300005341 | Bacteria | 8431 |
| 110 | Ga0070661_100000001 | 3300005344 | Bacteria | 424830 |
| 111 | Ga0070661_100002510 | 3300005344 | Bacteria | 12572 |
| 112 | Ga0070661_100012399 | 3300005344 | Bacteria | 5963 |
| 113 | Ga0070661_100064473 | 3300005344 | Bacteria | 2692 |
| 114 | Ga0070668_100002775 | 3300005347 | Bacteria | 12873 |
| 115 | Ga0070668_100011115 | 3300005347 | Bacteria | 6701 |
| 116 | Ga0070668_100024681 | 3300005347 | Bacteria | 4556 |
| 117 | Ga0070669_100000155 | 3300005353 | Bacteria | 61710 |
| 118 | Ga0070669_100039822 | 3300005353 | Bacteria | 3415 |
| 119 | Ga0070669_100065653 | 3300005353 | Bacteria | 2673 |
| 120 | Ga0070669_100132388 | 3300005353 | Bacteria | 1915 |
| 121 | Ga0070669_100384601 | 3300005353 | Bacteria | 1145 |
| 122 | Ga0070669_100425099 | 3300005353 | Bacteria | 1091 |
| 123 | Ga0070675_100302853 | 3300005354 | Bacteria | 1408 |
| 124 | Ga0070671_100019672 | 3300005355 | Bacteria | 5498 |
| 125 | Ga0070671_100031754 | 3300005355 | Bacteria | 4365 |
| 126 | Ga0070671_100048588 | 3300005355 | Bacteria | 3529 |
| 127 | Ga0070671_100077802 | 3300005355 | Bacteria | 2772 |
| 128 | Ga0070674_100005255 | 3300005356 | Bacteria | 7455 |
| 129 | Ga0070674_100005285 | 3300005356 | Bacteria | 7438 |
| 130 | Ga0070674_100007950 | 3300005356 | Bacteria | 6280 |
| 131 | Ga0070674_100014858 | 3300005356 | Bacteria | 4846 |
| 132 | Ga0070674_100019554 | 3300005356 | Bacteria | 4304 |
| 133 | Ga0070674_100054157 | 3300005356 | Bacteria | 2773 |
| 134 | Ga0070673_100000002 | 3300005364 | Bacteria | 225084 |
| 135 | Ga0070673_100001756 | 3300005364 | Bacteria | 12927 |
| 136 | Ga0070673_100007485 | 3300005364 | Bacteria | 7207 |
| 137 | Ga0070673_100024388 | 3300005364 | Bacteria | 4435 |
| 138 | Ga0070673_100034497 | 3300005364 | Bacteria | 3830 |
| 139 | Ga0070673_100050349 | 3300005364 | Bacteria | 3257 |
| 140 | Ga0070673_100065260 | 3300005364 | Bacteria | 2903 |
| 141 | Ga0070688_100161926 | 3300005365 | Bacteria | 1538 |
| 142 | Ga0070659_100000004 | 3300005366 | Bacteria | 267958 |
| 143 | Ga0070659_100000305 | 3300005366 | Bacteria | 38108 |
| 144 | Ga0070659_100003359 | 3300005366 | Bacteria | 11387 |
| 145 | Ga0070659_100009411 | 3300005366 | Bacteria | 7173 |
| 146 | Ga0070659_100011569 | 3300005366 | Bacteria | 6531 |
| 147 | Ga0070659_100022212 | 3300005366 | Bacteria | 4840 |
| 148 | Ga0070659_100040630 | 3300005366 | Bacteria | 3635 |
| 149 | Ga0070659_100075534 | 3300005366 | Bacteria | 2686 |
| 150 | Ga0070659_100111678 | 3300005366 | Bacteria | 2207 |
| 151 | Ga0070659_100115687 | 3300005366 | Bacteria | 2168 |
| 152 | Ga0070659_100147357 | 3300005366 | Bacteria | 1918 |
| 153 | Ga0070667_100000656 | 3300005367 | Bacteria | 33607 |
| 154 | Ga0070667_100003284 | 3300005367 | Bacteria | 13815 |
| 155 | Ga0070667_100023180 | 3300005367 | Bacteria | 5150 |
| 156 | Ga0070667_100064562 | 3300005367 | Bacteria | 3106 |
| 157 | Ga0070714_100050966 | 3300005435 | Bacteria | 3529 |
| 158 | Ga0070713_100103909 | 3300005436 | Bacteria | 2466 |
| 159 | Ga0070708_100327768 | 3300005445 | Bacteria | 1442 |
| 160 | Ga0070663_100015825 | 3300005455 | Bacteria | 4880 |
| 161 | Ga0070663_100036161 | 3300005455 | Bacteria | 3430 |
| 162 | Ga0070663_100040999 | 3300005455 | Bacteria | 3244 |
| 163 | Ga0070663_100055140 | 3300005455 | Bacteria | 2843 |
| 164 | Ga0070663_100062435 | 3300005455 | Bacteria | 2686 |
| 165 | Ga0070663_100098890 | 3300005455 | Bacteria | 2174 |
| 166 | Ga0070678_100000055 | 3300005456 | Bacteria | 40348 |
| 167 | Ga0070678_100409993 | 3300005456 | Bacteria | 1179 |
| 168 | Ga0070662_100024764 | 3300005457 | Bacteria | 4138 |
| 169 | Ga0070662_100026033 | 3300005457 | Bacteria | 4047 |
| 170 | Ga0070662_100041566 | 3300005457 | Bacteria | 3280 |
| 171 | Ga0070662_100155667 | 3300005457 | Bacteria | 1784 |
| 172 | Ga0070681_10006314 | 3300005458 | Bacteria | 11525 |
| 173 | Ga0070681_10010156 | 3300005458 | Bacteria | 9285 |
| 174 | Ga0070681_10063724 | 3300005458 | Bacteria | 3658 |
| 175 | Ga0068867_100000012 | 3300005459 | Bacteria | 118831 |
| 176 | Ga0068867_100001817 | 3300005459 | Bacteria | 14865 |
| 177 | Ga0068867_100003846 | 3300005459 | Bacteria | 10552 |
| 178 | Ga0068867_100010918 | 3300005459 | Bacteria | 6405 |
| 179 | Ga0068867_100013901 | 3300005459 | Bacteria | 5698 |
| 180 | Ga0070706_100022961 | 3300005467 | Bacteria | 5745 |
| 181 | Ga0070698_100005702 | 3300005471 | Bacteria | 13628 |
| 182 | Ga0070679_100000017 | 3300005530 | Bacteria | 129377 |
| 183 | Ga0070679_100033401 | 3300005530 | Bacteria | 5094 |
| 184 | Ga0070679_100260778 | 3300005530 | Bacteria | 1688 |
| 185 | Ga0070684_100027100 | 3300005535 | Bacteria | 4833 |
| 186 | Ga0070684_100389020 | 3300005535 | Bacteria | 1285 |
| 187 | Ga0068853_100005924 | 3300005539 | Bacteria | 9651 |
| 188 | Ga0068853_100007016 | 3300005539 | Bacteria | 9004 |
| 189 | Ga0068853_100008695 | 3300005539 | Bacteria | 8166 |
| 190 | Ga0068853_100046194 | 3300005539 | Bacteria | 3733 |
| 191 | Ga0068853_100288759 | 3300005539 | Bacteria | 1514 |
| 192 | Ga0068853_100494545 | 3300005539 | Bacteria | 1154 |
| 193 | Ga0070672_100000710 | 3300005543 | Bacteria | 19719 |
| 194 | Ga0070672_100033346 | 3300005543 | Bacteria | 3899 |
| 195 | Ga0070672_100135004 | 3300005543 | Bacteria | 2032 |
| 196 | Ga0070686_100000338 | 3300005544 | Bacteria | 30239 |
| 197 | Ga0070686_100142419 | 3300005544 | Bacteria | 1670 |
| 198 | Ga0070665_100000043 | 3300005548 | Bacteria | 279774 |
| 199 | Ga0070665_100000495 | 3300005548 | Bacteria | 56309 |
| 200 | Ga0070665_100000995 | 3300005548 | Bacteria | 35932 |
| 201 | Ga0070665_100004318 | 3300005548 | Bacteria | 14944 |
| 202 | Ga0070665_100014710 | 3300005548 | Bacteria | 7850 |
| 203 | Ga0070665_100066271 | 3300005548 | Bacteria | 3622 |
| 204 | Ga0070665_100121024 | 3300005548 | Bacteria | 2619 |
| 205 | Ga0070665_100338978 | 3300005548 | Bacteria | 1508 |
| 206 | Ga0068855_100000095 | 3300005563 | Bacteria | 106561 |
| 207 | Ga0068855_100001110 | 3300005563 | Bacteria | 33477 |
| 208 | Ga0068855_100012722 | 3300005563 | Bacteria | 10148 |
| 209 | Ga0068855_100038147 | 3300005563 | Bacteria | 5709 |
| 210 | Ga0068855_100053334 | 3300005563 | Bacteria | 4758 |
| 211 | Ga0068855_100066469 | 3300005563 | Bacteria | 4203 |
| 212 | Ga0068855_100372096 | 3300005563 | Bacteria | 1570 |
| 213 | Ga0068855_100393588 | 3300005563 | Bacteria | 1519 |
| 214 | Ga0068855_100590007 | 3300005563 | Bacteria | 1199 |
| 215 | Ga0070664_100003720 | 3300005564 | Bacteria | 12293 |
| 216 | Ga0070664_100006800 | 3300005564 | Bacteria | 9220 |
| 217 | Ga0070664_100030014 | 3300005564 | Bacteria | 4534 |
| 218 | Ga0070664_100042361 | 3300005564 | Bacteria | 3844 |
| 219 | Ga0068857_100004853 | 3300005577 | Bacteria | 11402 |
| 220 | Ga0068857_100007710 | 3300005577 | Bacteria | 9274 |
| 221 | Ga0068857_100012795 | 3300005577 | Bacteria | 7313 |
| 222 | Ga0068857_100017141 | 3300005577 | Bacteria | 6345 |
| 223 | Ga0068857_100048509 | 3300005577 | Bacteria | 3770 |
| 224 | Ga0068857_100053395 | 3300005577 | Bacteria | 3585 |
| 225 | Ga0068857_100068383 | 3300005577 | Bacteria | 3161 |
| 226 | Ga0068857_100078386 | 3300005577 | Bacteria | 2949 |
| 227 | Ga0068857_100168788 | 3300005577 | Bacteria | 1988 |
| 228 | Ga0068857_100175331 | 3300005577 | Bacteria | 1950 |
| 229 | Ga0068857_100318299 | 3300005577 | Bacteria | 1436 |
| 230 | Ga0068854_100000206 | 3300005578 | Bacteria | 39747 |
| 231 | Ga0068854_100000265 | 3300005578 | Bacteria | 35689 |
| 232 | Ga0068854_100004418 | 3300005578 | Bacteria | 8876 |
| 233 | Ga0068854_100020435 | 3300005578 | Bacteria | 4480 |
| 234 | Ga0068854_100021215 | 3300005578 | Bacteria | 4405 |
| 235 | Ga0068854_100028258 | 3300005578 | Bacteria | 3874 |
| 236 | Ga0068854_100040701 | 3300005578 | Bacteria | 3280 |
| 237 | Ga0068854_100065856 | 3300005578 | Bacteria | 2635 |
| 238 | Ga0068854_100079015 | 3300005578 | Bacteria | 2425 |
| 239 | Ga0068854_100113994 | 3300005578 | Bacteria | 2043 |
| 240 | Ga0068854_100369455 | 3300005578 | Bacteria | 1179 |
| 241 | Ga0068856_100003848 | 3300005614 | Bacteria | 15059 |
| 242 | Ga0068852_100002924 | 3300005616 | Bacteria | 11864 |
| 243 | Ga0068852_100004651 | 3300005616 | Bacteria | 9731 |
| 244 | Ga0068852_100044876 | 3300005616 | Bacteria | 3757 |
| 245 | Ga0068852_100070015 | 3300005616 | Bacteria | 3076 |
| 246 | Ga0068852_100431322 | 3300005616 | Bacteria | 1302 |
| 247 | Ga0068852_100565172 | 3300005616 | Bacteria | 1139 |
| 248 | Ga0068859_100000682 | 3300005617 | Bacteria | 34086 |
| 249 | Ga0068859_100007995 | 3300005617 | Bacteria | 10722 |
| 250 | Ga0068859_100049241 | 3300005617 | Bacteria | 4232 |
| 251 | Ga0068864_100000428 | 3300005618 | Bacteria | 36392 |
| 252 | Ga0068864_100115414 | 3300005618 | Bacteria | 2395 |
| 253 | Ga0068866_10109373 | 3300005718 | Bacteria | 1539 |
| 254 | Ga0068861_100319791 | 3300005719 | Bacteria | 1351 |
| 255 | Ga0068851_10008531 | 3300005834 | Bacteria | 4741 |
| 256 | Ga0068851_10028720 | 3300005834 | Bacteria | 2748 |
| 257 | Ga0068870_10083700 | 3300005840 | Bacteria | 1769 |
| 258 | Ga0068863_100000634 | 3300005841 | Bacteria | 35566 |
| 259 | Ga0068863_100010310 | 3300005841 | Bacteria | 9081 |
| 260 | Ga0068863_100097556 | 3300005841 | Bacteria | 2791 |
| 261 | Ga0068858_100000482 | 3300005842 | Bacteria | 41597 |
| 262 | Ga0068858_100001980 | 3300005842 | Bacteria | 20919 |
| 263 | Ga0068858_100009525 | 3300005842 | Bacteria | 9266 |
| 264 | Ga0068858_100143470 | 3300005842 | Bacteria | 2242 |
| 265 | Ga0068858_100274295 | 3300005842 | Bacteria | 1605 |
| 266 | Ga0068860_100002325 | 3300005843 | Bacteria | 19958 |
| 267 | Ga0068860_100003691 | 3300005843 | Bacteria | 15765 |
| 268 | Ga0068860_100040396 | 3300005843 | Bacteria | 4459 |
| 269 | Ga0068860_100050945 | 3300005843 | Bacteria | 3941 |
| 270 | Ga0068860_100137815 | 3300005843 | Bacteria | 2344 |
| 271 | Ga0068862_100012603 | 3300005844 | Bacteria | 6999 |
| 272 | Ga0068862_100036890 | 3300005844 | Bacteria | 4143 |
| 273 | Ga0068862_100041178 | 3300005844 | Bacteria | 3930 |
| 274 | Ga0068862_100511119 | 3300005844 | Bacteria | 1142 |
| 275 | Ga0081455_10000395 | 3300005937 | Bacteria | 57467 |
| 276 | Ga0081455_10001457 | 3300005937 | Bacteria | 29274 |
| 277 | Ga0081455_10002932 | 3300005937 | Bacteria | 19999 |
| 278 | Ga0081539_10001300 | 3300005985 | Bacteria | 43786 |
| 279 | Ga0081539_10015064 | 3300005985 | Bacteria | 5662 |
| 280 | Ga0081539_10064432 | 3300005985 | Bacteria | 1994 |
| 281 | Ga0075365_10073461 | 3300006038 | Bacteria | 2305 |
| 282 | Ga0075362_10026145 | 3300006177 | Bacteria | 2490 |
| 283 | Ga0075362_10048194 | 3300006177 | Bacteria | 1900 |
| 284 | Ga0075367_10049571 | 3300006178 | Bacteria | 2475 |
| 285 | Ga0075369_10000420 | 3300006186 | Bacteria | 12842 |
| 286 | Ga0075369_10017179 | 3300006186 | Bacteria | 2929 |
| 287 | Ga0097621_100014631 | 3300006237 | Bacteria | 5879 |
| 288 | Ga0097621_100168773 | 3300006237 | Bacteria | 1885 |
| 289 | Ga0097621_100328388 | 3300006237 | Bacteria | 1356 |
| 290 | Ga0068871_100108920 | 3300006358 | Bacteria | 2329 |
| 291 | Ga0075431_100175904 | 3300006847 | Bacteria | 2198 |
| 292 | Ga0075433_10025955 | 3300006852 | Bacteria | 4956 |
| 293 | Ga0075434_100057873 | 3300006871 | Bacteria | 3852 |
| 294 | Ga0068865_100000004 | 3300006881 | Bacteria | 226236 |
| 295 | Ga0068865_100029233 | 3300006881 | Bacteria | 3654 |
| 296 | Ga0075436_100181547 | 3300006914 | Bacteria | 1487 |
| 297 | Ga0097620_100000682 | 3300006931 | Bacteria | 34086 |
| 298 | Ga0097620_100007995 | 3300006931 | Bacteria | 10722 |
| 299 | Ga0097620_100049240 | 3300006931 | Bacteria | 4232 |
| 300 | Ga0105240_10018988 | 3300009093 | Bacteria | 9204 |
| 301 | Ga0105240_10062248 | 3300009093 | Bacteria | 4646 |
| 302 | Ga0105240_10104302 | 3300009093 | Bacteria | 3443 |
| 303 | Ga0105240_10771042 | 3300009093 | Bacteria | 1044 |
| 304 | Ga0111539_10181217 | 3300009094 | Bacteria | 2460 |
| 305 | Ga0105245_10000195 | 3300009098 | Bacteria | 57594 |
| 306 | Ga0105245_10000620 | 3300009098 | Bacteria | 32174 |
| 307 | Ga0105245_10008689 | 3300009098 | Bacteria | 8858 |
| 308 | Ga0105245_10319433 | 3300009098 | Bacteria | 1529 |
| 309 | Ga0105245_10377976 | 3300009098 | Bacteria | 1410 |
| 310 | Ga0114129_10080446 | 3300009147 | Bacteria | 4529 |
| 311 | Ga0105243_10000146 | 3300009148 | Bacteria | 81008 |
| 312 | Ga0105243_10000227 | 3300009148 | Bacteria | 64901 |
| 313 | Ga0105243_10060551 | 3300009148 | Bacteria | 3024 |
| 314 | Ga0105243_10190486 | 3300009148 | Bacteria | 1791 |
| 315 | Ga0105243_10238195 | 3300009148 | Bacteria | 1618 |
| 316 | Ga0105243_10471344 | 3300009148 | Bacteria | 1183 |
| 317 | Ga0105241_10001135 | 3300009174 | Bacteria | 20278 |
| 318 | Ga0105241_10006348 | 3300009174 | Bacteria | 8715 |
| 319 | Ga0105241_10041561 | 3300009174 | Bacteria | 3474 |
| 320 | Ga0105241_10161430 | 3300009174 | Bacteria | 1843 |
| 321 | Ga0105242_10007987 | 3300009176 | Bacteria | 8152 |
| 322 | Ga0105242_10062392 | 3300009176 | Bacteria | 3067 |
| 323 | Ga0105242_10082968 | 3300009176 | Bacteria | 2683 |
| 324 | Ga0105242_10374307 | 3300009176 | Bacteria | 1322 |
| 325 | Ga0105248_10000824 | 3300009177 | Bacteria | 34827 |
| 326 | Ga0105248_10001472 | 3300009177 | Bacteria | 26219 |
| 327 | Ga0105248_10015827 | 3300009177 | Bacteria | 8313 |
| 328 | Ga0105248_10031200 | 3300009177 | Bacteria | 5956 |
| 329 | Ga0105248_10080171 | 3300009177 | Bacteria | 3669 |
| 330 | Ga0105248_10208305 | 3300009177 | Bacteria | 2203 |
| 331 | Ga0105248_10251176 | 3300009177 | Bacteria | 1991 |
| 332 | Ga0105248_10292142 | 3300009177 | Bacteria | 1835 |
| 333 | Ga0105237_10091788 | 3300009545 | Bacteria | 3027 |
| 334 | Ga0105237_10231725 | 3300009545 | Bacteria | 1848 |
| 335 | Ga0105238_10030863 | 3300009551 | Bacteria | 5454 |
| 336 | Ga0105238_10031422 | 3300009551 | Bacteria | 5405 |
| 337 | Ga0105238_10032552 | 3300009551 | Bacteria | 5306 |
| 338 | Ga0105238_10070437 | 3300009551 | Bacteria | 3496 |
| 339 | Ga0105238_10107856 | 3300009551 | Bacteria | 2766 |
| 340 | Ga0105249_10035540 | 3300009553 | Bacteria | 4519 |
| 341 | Ga0105249_10323481 | 3300009553 | Bacteria | 1554 |
| 342 | Ga0105239_10229587 | 3300010375 | Bacteria | 2082 |
| 343 | Ga0105239_10479106 | 3300010375 | Bacteria | 1414 |
| 344 | Ga0105239_10653171 | 3300010375 | Bacteria | 1201 |
| 345 | Ga0105246_10002081 | 3300011119 | Bacteria | 12059 |
| 346 | Ga0105246_10033675 | 3300011119 | Bacteria | 3408 |
| 347 | Ga0105246_10340701 | 3300011119 | Bacteria | 1225 |
| 348 | Ga0105246_10575611 | 3300011119 | Bacteria | 969 |
| 349 | Ga0157373_10002262 | 3300013100 | Bacteria | 14594 |
| 350 | Ga0157373_10017492 | 3300013100 | Bacteria | 5221 |
| 351 | Ga0157373_10028733 | 3300013100 | Bacteria | 4010 |
| 352 | Ga0157373_10123932 | 3300013100 | Bacteria | 1817 |
| 353 | Ga0157371_10000094 | 3300013102 | Bacteria | 139074 |
| 354 | Ga0157371_10002300 | 3300013102 | Bacteria | 18396 |
| 355 | Ga0157371_10032088 | 3300013102 | Bacteria | 3781 |
| 356 | Ga0157371_10256567 | 3300013102 | Bacteria | 1260 |
| 357 | Ga0157371_10316019 | 3300013102 | Bacteria | 1133 |
| 358 | Ga0157370_10002033 | 3300013104 | Bacteria | 24869 |
| 359 | Ga0157370_10006332 | 3300013104 | Bacteria | 13079 |
| 360 | Ga0157370_10014466 | 3300013104 | Bacteria | 8066 |
| 361 | Ga0157370_10039775 | 3300013104 | Bacteria | 4543 |
| 362 | Ga0157369_10189836 | 3300013105 | Bacteria | 2159 |
| 363 | Ga0157369_10190642 | 3300013105 | Bacteria | 2154 |
| 364 | Ga0157374_10001738 | 3300013296 | Bacteria | 18262 |
| 365 | Ga0157378_10000408 | 3300013297 | Bacteria | 42491 |
| 366 | Ga0157378_10001977 | 3300013297 | Bacteria | 18333 |
| 367 | Ga0157378_10009310 | 3300013297 | Bacteria | 8556 |
| 368 | Ga0157378_10131186 | 3300013297 | Bacteria | 2319 |
| 369 | Ga0157378_10237536 | 3300013297 | Bacteria | 1740 |
| 370 | Ga0163162_10023769 | 3300013306 | Bacteria | 6049 |
| 371 | Ga0163162_10177052 | 3300013306 | Bacteria | 2258 |
| 372 | Ga0163162_10741874 | 3300013306 | Bacteria | 1102 |
| 373 | Ga0157372_10302408 | 3300013307 | Bacteria | 1861 |
| 374 | Ga0157372_10406797 | 3300013307 | Bacteria | 1586 |
| 375 | Ga0157372_10442943 | 3300013307 | Bacteria | 1514 |
| 376 | Ga0157375_10007814 | 3300013308 | Bacteria | 9358 |
| 377 | Ga0157375_10009852 | 3300013308 | Bacteria | 8403 |
| 378 | Ga0157375_10059996 | 3300013308 | Bacteria | 3770 |
| 379 | Ga0157375_10442007 | 3300013308 | Bacteria | 1466 |
| 380 | Ga0157375_10707668 | 3300013308 | Bacteria | 1161 |
| 381 | Ga0157380_10022797 | 3300014326 | Bacteria | 4721 |
| 382 | Ga0157380_10030260 | 3300014326 | Bacteria | 4145 |
| 383 | Ga0157380_10185993 | 3300014326 | Bacteria | 1829 |
| 384 | Ga0157377_10048205 | 3300014745 | Bacteria | 2389 |
| 385 | Ga0157379_10385122 | 3300014968 | Bacteria | 1287 |
| 386 | Ga0157376_10000131 | 3300014969 | Bacteria | 51790 |
| 387 | Ga0163161_10057115 | 3300017792 | Bacteria | 2836 |
| 388 | Ga0206356_11001459 | 3300020070 | Bacteria | 2525 |
| 389 | Ga0206353_11750927 | 3300020082 | Bacteria | 2535 |
| 390 | Ga0213873_10000027 | 3300021358 | Bacteria | 73909 |
| 391 | Ga0213872_10000056 | 3300021361 | Bacteria | 101365 |
| 392 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 393 | Ga0213876_10000873 | 3300021384 | Bacteria | 20190 |
| 394 | Ga0213876_10003321 | 3300021384 | Bacteria | 9217 |
| 395 | Ga0213876_10005484 | 3300021384 | Bacteria | 6966 |
| 396 | Ga0213876_10070156 | 3300021384 | Bacteria | 1851 |
| 397 | Ga0213876_10083380 | 3300021384 | Bacteria | 1691 |
| 398 | Ga0213871_10000912 | 3300021441 | Bacteria | 4538 |
| 399 | Ga0209674_103207 | 3300025226 | Bacteria | 3096 |
| 400 | Ga0209563_100058 | 3300025230 | Bacteria | 302571 |
| 401 | Ga0209437_105644 | 3300025233 | Bacteria | 2122 |
| 402 | Ga0207425_1000025 | 3300025245 | Bacteria | 321872 |
| 403 | Ga0207425_1006442 | 3300025245 | Bacteria | 3208 |
| 404 | Ga0209677_109339 | 3300025253 | Bacteria | 1773 |
| 405 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 406 | Ga0209148_1000074 | 3300025254 | Bacteria | 314356 |
| 407 | Ga0209129_1000671 | 3300025258 | Bacteria | 22663 |
| 408 | Ga0209233_1000164 | 3300025261 | Bacteria | 152430 |
| 409 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 410 | Ga0209565_1000306 | 3300025263 | Bacteria | 45881 |
| 411 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 412 | Ga0209455_1000767 | 3300025272 | Bacteria | 18024 |
| 413 | Ga0209673_1002201 | 3300025273 | Bacteria | 14286 |
| 414 | Ga0209673_1008882 | 3300025273 | Bacteria | 4421 |
| 415 | Ga0209675_1008549 | 3300025291 | Bacteria | 3743 |
| 416 | Ga0209676_1000276 | 3300025292 | Bacteria | 106867 |
| 417 | Ga0209025_1000663 | 3300025294 | Bacteria | 59620 |
| 418 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 419 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 420 | Ga0209758_1005550 | 3300025297 | Bacteria | 9619 |
| 421 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 422 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 423 | Ga0209050_1000823 | 3300025298 | Bacteria | 43253 |
| 424 | Ga0209050_1005347 | 3300025298 | Bacteria | 8131 |
| 425 | Ga0209050_1014947 | 3300025298 | Bacteria | 3301 |
| 426 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 427 | Ga0207426_1026337 | 3300025302 | Bacteria | 1949 |
| 428 | Ga0209051_1000689 | 3300025303 | Bacteria | 37393 |
| 429 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 430 | Ga0209257_1000695 | 3300025304 | Bacteria | 52248 |
| 431 | Ga0209257_1005113 | 3300025304 | Bacteria | 9506 |
| 432 | Ga0209257_1012649 | 3300025304 | Bacteria | 3868 |
| 433 | Ga0209257_1012697 | 3300025304 | Bacteria | 3854 |
| 434 | Ga0209257_1014104 | 3300025304 | Bacteria | 3471 |
| 435 | Ga0207697_10000109 | 3300025315 | Bacteria | 38398 |
| 436 | Ga0207697_10013441 | 3300025315 | Bacteria | 3416 |
| 437 | Ga0207656_10005154 | 3300025321 | Bacteria | 4595 |
| 438 | Ga0207656_10020691 | 3300025321 | Bacteria | 2618 |
| 439 | Ga0207682_10001908 | 3300025893 | Bacteria | 9464 |
| 440 | Ga0207642_10002992 | 3300025899 | Bacteria | 5292 |
| 441 | Ga0207688_10147536 | 3300025901 | Bacteria | 1387 |
| 442 | Ga0207680_10001510 | 3300025903 | Bacteria | 10959 |
| 443 | Ga0207680_10013148 | 3300025903 | Bacteria | 4242 |
| 444 | Ga0207680_10116490 | 3300025903 | Bacteria | 1741 |
| 445 | Ga0207647_10000446 | 3300025904 | Bacteria | 33539 |
| 446 | Ga0207647_10001428 | 3300025904 | Bacteria | 18307 |
| 447 | Ga0207647_10001494 | 3300025904 | Bacteria | 17967 |
| 448 | Ga0207647_10007151 | 3300025904 | Bacteria | 8094 |
| 449 | Ga0207647_10015410 | 3300025904 | Bacteria | 5241 |
| 450 | Ga0207647_10021613 | 3300025904 | Bacteria | 4294 |
| 451 | Ga0207647_10037408 | 3300025904 | Bacteria | 3078 |
| 452 | Ga0207647_10051647 | 3300025904 | Bacteria | 2540 |
| 453 | Ga0207645_10002620 | 3300025907 | Bacteria | 14026 |
| 454 | Ga0207645_10022319 | 3300025907 | Bacteria | 4120 |
| 455 | Ga0207643_10022846 | 3300025908 | Bacteria | 3446 |
| 456 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 457 | Ga0207705_10000055 | 3300025909 | Bacteria | 160436 |
| 458 | Ga0207705_10000179 | 3300025909 | Bacteria | 66765 |
| 459 | Ga0207705_10001170 | 3300025909 | Bacteria | 21351 |
| 460 | Ga0207705_10006076 | 3300025909 | Bacteria | 8986 |
| 461 | Ga0207705_10023934 | 3300025909 | Bacteria | 4358 |
| 462 | Ga0207705_10071722 | 3300025909 | Bacteria | 2511 |
| 463 | Ga0207705_10294663 | 3300025909 | Bacteria | 1243 |
| 464 | Ga0207654_10000020 | 3300025911 | Bacteria | 167053 |
| 465 | Ga0207654_10018258 | 3300025911 | Bacteria | 3678 |
| 466 | Ga0207707_10010908 | 3300025912 | Bacteria | 7901 |
| 467 | Ga0207707_10020730 | 3300025912 | Bacteria | 5742 |
| 468 | Ga0207707_10357865 | 3300025912 | Bacteria | 1257 |
| 469 | Ga0207695_10011332 | 3300025913 | Bacteria | 10807 |
| 470 | Ga0207695_10020535 | 3300025913 | Bacteria | 7562 |
| 471 | Ga0207695_10028820 | 3300025913 | Bacteria | 6147 |
| 472 | Ga0207695_10063852 | 3300025913 | Bacteria | 3794 |
| 473 | Ga0207695_10193423 | 3300025913 | Bacteria | 1951 |
| 474 | Ga0207671_10004616 | 3300025914 | Bacteria | 13070 |
| 475 | Ga0207671_10013921 | 3300025914 | Bacteria | 6385 |
| 476 | Ga0207671_10014334 | 3300025914 | Bacteria | 6272 |
| 477 | Ga0207660_10000048 | 3300025917 | Bacteria | 60104 |
| 478 | Ga0207660_10004472 | 3300025917 | Bacteria | 9113 |
| 479 | Ga0207660_10102214 | 3300025917 | Bacteria | 2142 |
| 480 | Ga0207662_10041631 | 3300025918 | Bacteria | 2705 |
| 481 | Ga0207662_10075972 | 3300025918 | Bacteria | 2041 |
| 482 | Ga0207657_10000791 | 3300025919 | Bacteria | 33627 |
| 483 | Ga0207657_10002553 | 3300025919 | Bacteria | 19693 |
| 484 | Ga0207657_10004781 | 3300025919 | Bacteria | 14283 |
| 485 | Ga0207657_10005726 | 3300025919 | Bacteria | 12962 |
| 486 | Ga0207657_10008671 | 3300025919 | Bacteria | 10295 |
| 487 | Ga0207657_10008888 | 3300025919 | Bacteria | 10161 |
| 488 | Ga0207657_10013847 | 3300025919 | Bacteria | 7892 |
| 489 | Ga0207657_10020682 | 3300025919 | Bacteria | 6213 |
| 490 | Ga0207657_10023951 | 3300025919 | Bacteria | 5668 |
| 491 | Ga0207657_10065903 | 3300025919 | Bacteria | 3085 |
| 492 | Ga0207657_10076413 | 3300025919 | Bacteria | 2825 |
| 493 | Ga0207657_10146230 | 3300025919 | Bacteria | 1928 |
| 494 | Ga0207649_10000018 | 3300025920 | Bacteria | 225137 |
| 495 | Ga0207649_10000130 | 3300025920 | Bacteria | 64246 |
| 496 | Ga0207649_10034508 | 3300025920 | Bacteria | 3032 |
| 497 | Ga0207649_10042330 | 3300025920 | Bacteria | 2778 |
| 498 | Ga0207649_10046233 | 3300025920 | Bacteria | 2673 |
| 499 | Ga0207649_10096375 | 3300025920 | Bacteria | 1949 |
| 500 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 501 | Ga0207652_10009263 | 3300025921 | Bacteria | 7917 |
| 502 | Ga0207652_10391557 | 3300025921 | Bacteria | 1254 |
| 503 | Ga0207646_10046302 | 3300025922 | Bacteria | 3902 |
| 504 | Ga0207681_10001626 | 3300025923 | Bacteria | 14490 |
| 505 | Ga0207681_10028973 | 3300025923 | Bacteria | 3590 |
| 506 | Ga0207681_10067923 | 3300025923 | Bacteria | 2473 |
| 507 | Ga0207694_10018991 | 3300025924 | Bacteria | 5196 |
| 508 | Ga0207694_10034835 | 3300025924 | Bacteria | 3861 |
| 509 | Ga0207694_10047352 | 3300025924 | Bacteria | 3326 |
| 510 | Ga0207694_10048056 | 3300025924 | Bacteria | 3301 |
| 511 | Ga0207650_10007235 | 3300025925 | Bacteria | 7559 |
| 512 | Ga0207650_10056691 | 3300025925 | Bacteria | 2912 |
| 513 | Ga0207650_10088181 | 3300025925 | Bacteria | 2365 |
| 514 | Ga0207650_10191833 | 3300025925 | Bacteria | 1633 |
| 515 | Ga0207650_10286751 | 3300025925 | Bacteria | 1342 |
| 516 | Ga0207659_10024872 | 3300025926 | Bacteria | 4019 |
| 517 | Ga0207659_10108461 | 3300025926 | Bacteria | 2106 |
| 518 | Ga0207659_10270936 | 3300025926 | Bacteria | 1385 |
| 519 | Ga0207687_10002087 | 3300025927 | Bacteria | 13658 |
| 520 | Ga0207687_10011298 | 3300025927 | Bacteria | 5837 |
| 521 | Ga0207687_10020101 | 3300025927 | Bacteria | 4429 |
| 522 | Ga0207687_10149302 | 3300025927 | Bacteria | 1781 |
| 523 | Ga0207664_10061578 | 3300025929 | Bacteria | 2994 |
| 524 | Ga0207644_10001832 | 3300025931 | Bacteria | 13807 |
| 525 | Ga0207644_10002824 | 3300025931 | Bacteria | 11190 |
| 526 | Ga0207644_10014341 | 3300025931 | Bacteria | 5301 |
| 527 | Ga0207644_10025155 | 3300025931 | Bacteria | 4092 |
| 528 | Ga0207644_10041358 | 3300025931 | Bacteria | 3260 |
| 529 | Ga0207644_10064136 | 3300025931 | Bacteria | 2669 |
| 530 | Ga0207644_10080205 | 3300025931 | Bacteria | 2410 |
| 531 | Ga0207690_10000001 | 3300025932 | Bacteria | 807539 |
| 532 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 533 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 534 | Ga0207690_10000004 | 3300025932 | Bacteria | 746138 |
| 535 | Ga0207690_10000063 | 3300025932 | Bacteria | 95620 |
| 536 | Ga0207690_10007315 | 3300025932 | Bacteria | 6555 |
| 537 | Ga0207690_10009895 | 3300025932 | Bacteria | 5663 |
| 538 | Ga0207690_10063498 | 3300025932 | Bacteria | 2518 |
| 539 | Ga0207690_10102030 | 3300025932 | Bacteria | 2051 |
| 540 | Ga0207690_10177260 | 3300025932 | Bacteria | 1602 |
| 541 | Ga0207706_10000300 | 3300025933 | Bacteria | 53727 |
| 542 | Ga0207706_10006908 | 3300025933 | Bacteria | 10497 |
| 543 | Ga0207706_10011966 | 3300025933 | Bacteria | 7901 |
| 544 | Ga0207706_10027233 | 3300025933 | Bacteria | 5112 |
| 545 | Ga0207706_10040050 | 3300025933 | Bacteria | 4153 |
| 546 | Ga0207706_10045683 | 3300025933 | Bacteria | 3879 |
| 547 | Ga0207706_10057532 | 3300025933 | Bacteria | 3425 |
| 548 | Ga0207706_10081224 | 3300025933 | Bacteria | 2849 |
| 549 | Ga0207686_10000999 | 3300025934 | Bacteria | 16788 |
| 550 | Ga0207709_10000093 | 3300025935 | Bacteria | 139110 |
| 551 | Ga0207709_10000314 | 3300025935 | Bacteria | 52842 |
| 552 | Ga0207709_10204658 | 3300025935 | Bacteria | 1412 |
| 553 | Ga0207669_10000086 | 3300025937 | Bacteria | 46934 |
| 554 | Ga0207669_10001266 | 3300025937 | Bacteria | 10718 |
| 555 | Ga0207669_10020553 | 3300025937 | Bacteria | 3466 |
| 556 | Ga0207669_10035517 | 3300025937 | Bacteria | 2837 |
| 557 | Ga0207669_10041981 | 3300025937 | Bacteria | 2666 |
| 558 | Ga0207669_10079239 | 3300025937 | Bacteria | 2096 |
| 559 | Ga0207669_10110758 | 3300025937 | Bacteria | 1839 |
| 560 | Ga0207669_10115466 | 3300025937 | Bacteria | 1810 |
| 561 | Ga0207669_10160698 | 3300025937 | Bacteria | 1587 |
| 562 | Ga0207704_10000005 | 3300025938 | Bacteria | 225353 |
| 563 | Ga0207704_10048331 | 3300025938 | Bacteria | 2550 |
| 564 | Ga0207704_10286816 | 3300025938 | Bacteria | 1254 |
| 565 | Ga0207704_10294814 | 3300025938 | Bacteria | 1239 |
| 566 | Ga0207691_10000294 | 3300025940 | Bacteria | 49457 |
| 567 | Ga0207691_10025393 | 3300025940 | Bacteria | 5564 |
| 568 | Ga0207691_10040577 | 3300025940 | Bacteria | 4299 |
| 569 | Ga0207691_10051372 | 3300025940 | Bacteria | 3769 |
| 570 | Ga0207691_10105501 | 3300025940 | Bacteria | 2510 |
| 571 | Ga0207691_10121346 | 3300025940 | Bacteria | 2316 |
| 572 | Ga0207691_10129700 | 3300025940 | Bacteria | 2228 |
| 573 | Ga0207711_10003143 | 3300025941 | Bacteria | 14401 |
| 574 | Ga0207711_10011392 | 3300025941 | Bacteria | 7391 |
| 575 | Ga0207711_10022434 | 3300025941 | Bacteria | 5279 |
| 576 | Ga0207711_10032269 | 3300025941 | Bacteria | 4428 |
| 577 | Ga0207711_10103754 | 3300025941 | Bacteria | 2518 |
| 578 | Ga0207711_10126582 | 3300025941 | Bacteria | 2286 |
| 579 | Ga0207689_10000043 | 3300025942 | Bacteria | 93054 |
| 580 | Ga0207689_10000064 | 3300025942 | Bacteria | 84222 |
| 581 | Ga0207689_10030619 | 3300025942 | Bacteria | 4484 |
| 582 | Ga0207689_10071243 | 3300025942 | Bacteria | 2855 |
| 583 | Ga0207679_10016813 | 3300025945 | Bacteria | 4864 |
| 584 | Ga0207679_10016870 | 3300025945 | Bacteria | 4856 |
| 585 | Ga0207679_10033341 | 3300025945 | Bacteria | 3622 |
| 586 | Ga0207679_10049858 | 3300025945 | Bacteria | 3056 |
| 587 | Ga0207679_10056602 | 3300025945 | Bacteria | 2896 |
| 588 | Ga0207679_10121026 | 3300025945 | Bacteria | 2083 |
| 589 | Ga0207679_10571384 | 3300025945 | Bacteria | 1016 |
| 590 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 591 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 592 | Ga0207667_10002740 | 3300025949 | Bacteria | 21785 |
| 593 | Ga0207667_10020043 | 3300025949 | Bacteria | 7447 |
| 594 | Ga0207667_10151404 | 3300025949 | Bacteria | 2387 |
| 595 | Ga0207667_10340567 | 3300025949 | Bacteria | 1530 |
| 596 | Ga0207651_10000007 | 3300025960 | Bacteria | 225286 |
| 597 | Ga0207651_10000355 | 3300025960 | Bacteria | 19400 |
| 598 | Ga0207651_10006669 | 3300025960 | Bacteria | 6075 |
| 599 | Ga0207651_10008089 | 3300025960 | Bacteria | 5650 |
| 600 | Ga0207651_10039113 | 3300025960 | Bacteria | 3124 |
| 601 | Ga0207651_10315291 | 3300025960 | Bacteria | 1305 |
| 602 | Ga0207668_10000021 | 3300025972 | Bacteria | 137592 |
| 603 | Ga0207668_10000632 | 3300025972 | Bacteria | 21688 |
| 604 | Ga0207668_10193417 | 3300025972 | Bacteria | 1614 |
| 605 | Ga0207640_10000139 | 3300025981 | Bacteria | 53517 |
| 606 | Ga0207640_10001142 | 3300025981 | Bacteria | 14572 |
| 607 | Ga0207640_10002525 | 3300025981 | Bacteria | 9806 |
| 608 | Ga0207640_10008156 | 3300025981 | Bacteria | 5802 |
| 609 | Ga0207640_10011805 | 3300025981 | Bacteria | 4957 |
| 610 | Ga0207640_10023138 | 3300025981 | Bacteria | 3731 |
| 611 | Ga0207640_10084258 | 3300025981 | Bacteria | 2182 |
| 612 | Ga0207640_10115426 | 3300025981 | Bacteria | 1912 |
| 613 | Ga0207640_10152945 | 3300025981 | Bacteria | 1697 |
| 614 | Ga0207640_10179802 | 3300025981 | Bacteria | 1585 |
| 615 | Ga0207640_10275839 | 3300025981 | Bacteria | 1318 |
| 616 | Ga0207658_10004936 | 3300025986 | Bacteria | 9201 |
| 617 | Ga0207658_10005047 | 3300025986 | Bacteria | 9087 |
| 618 | Ga0207658_10007088 | 3300025986 | Bacteria | 7637 |
| 619 | Ga0207658_10013277 | 3300025986 | Bacteria | 5625 |
| 620 | Ga0207658_10021107 | 3300025986 | Bacteria | 4516 |
| 621 | Ga0207677_10000014 | 3300026023 | Bacteria | 181712 |
| 622 | Ga0207677_10000085 | 3300026023 | Bacteria | 78393 |
| 623 | Ga0207677_10006963 | 3300026023 | Bacteria | 6218 |
| 624 | Ga0207677_10452899 | 3300026023 | Bacteria | 1100 |
| 625 | Ga0207677_10475689 | 3300026023 | Bacteria | 1075 |
| 626 | Ga0207703_10000142 | 3300026035 | Bacteria | 84567 |
| 627 | Ga0207703_10000254 | 3300026035 | Bacteria | 60234 |
| 628 | Ga0207703_10001455 | 3300026035 | Bacteria | 21592 |
| 629 | Ga0207703_10006195 | 3300026035 | Bacteria | 9572 |
| 630 | Ga0207703_10008809 | 3300026035 | Bacteria | 7955 |
| 631 | Ga0207703_10054466 | 3300026035 | Bacteria | 3253 |
| 632 | Ga0207703_10351393 | 3300026035 | Bacteria | 1357 |
| 633 | Ga0207703_10413948 | 3300026035 | Bacteria | 1253 |
| 634 | Ga0207639_10001668 | 3300026041 | Bacteria | 14964 |
| 635 | Ga0207639_10001919 | 3300026041 | Bacteria | 13963 |
| 636 | Ga0207639_10002219 | 3300026041 | Bacteria | 13079 |
| 637 | Ga0207639_10003835 | 3300026041 | Bacteria | 10133 |
| 638 | Ga0207639_10006063 | 3300026041 | Bacteria | 8205 |
| 639 | Ga0207639_10006448 | 3300026041 | Bacteria | 7980 |
| 640 | Ga0207639_10027203 | 3300026041 | Bacteria | 4163 |
| 641 | Ga0207639_10160692 | 3300026041 | Bacteria | 1893 |
| 642 | Ga0207639_10222570 | 3300026041 | Bacteria | 1631 |
| 643 | Ga0207639_10457969 | 3300026041 | Bacteria | 1159 |
| 644 | Ga0207678_10000072 | 3300026067 | Bacteria | 81033 |
| 645 | Ga0207678_10000972 | 3300026067 | Bacteria | 26111 |
| 646 | Ga0207678_10002415 | 3300026067 | Bacteria | 16979 |
| 647 | Ga0207678_10003727 | 3300026067 | Bacteria | 13709 |
| 648 | Ga0207678_10004478 | 3300026067 | Bacteria | 12563 |
| 649 | Ga0207678_10004783 | 3300026067 | Bacteria | 12153 |
| 650 | Ga0207678_10081355 | 3300026067 | Bacteria | 2772 |
| 651 | Ga0207678_10091429 | 3300026067 | Bacteria | 2601 |
| 652 | Ga0207678_10091554 | 3300026067 | Bacteria | 2599 |
| 653 | Ga0207678_10117340 | 3300026067 | Bacteria | 2271 |
| 654 | Ga0207678_10133243 | 3300026067 | Bacteria | 2120 |
| 655 | Ga0207678_10344385 | 3300026067 | Bacteria | 1285 |
| 656 | Ga0207702_10002032 | 3300026078 | Bacteria | 19607 |
| 657 | Ga0207702_10013111 | 3300026078 | Bacteria | 6891 |
| 658 | Ga0207702_10038212 | 3300026078 | Bacteria | 4020 |
| 659 | Ga0207702_10058372 | 3300026078 | Bacteria | 3284 |
| 660 | Ga0207702_10400581 | 3300026078 | Bacteria | 1323 |
| 661 | Ga0207702_10440943 | 3300026078 | Bacteria | 1262 |
| 662 | Ga0207641_10013104 | 3300026088 | Bacteria | 6799 |
| 663 | Ga0207641_10016059 | 3300026088 | Bacteria | 6132 |
| 664 | Ga0207641_10064470 | 3300026088 | Bacteria | 3131 |
| 665 | Ga0207641_10431942 | 3300026088 | Bacteria | 1270 |
| 666 | Ga0207648_10000005 | 3300026089 | Bacteria | 225083 |
| 667 | Ga0207648_10001537 | 3300026089 | Bacteria | 25401 |
| 668 | Ga0207648_10004112 | 3300026089 | Bacteria | 15062 |
| 669 | Ga0207648_10008749 | 3300026089 | Bacteria | 9757 |
| 670 | Ga0207648_10014658 | 3300026089 | Bacteria | 7237 |
| 671 | Ga0207648_10165026 | 3300026089 | Bacteria | 1957 |
| 672 | Ga0207676_10000331 | 3300026095 | Bacteria | 40710 |
| 673 | Ga0207676_10004949 | 3300026095 | Bacteria | 9443 |
| 674 | Ga0207674_10000814 | 3300026116 | Bacteria | 40536 |
| 675 | Ga0207674_10008433 | 3300026116 | Bacteria | 11906 |
| 676 | Ga0207674_10015150 | 3300026116 | Bacteria | 8484 |
| 677 | Ga0207674_10019142 | 3300026116 | Bacteria | 7422 |
| 678 | Ga0207674_10021242 | 3300026116 | Bacteria | 6996 |
| 679 | Ga0207674_10036234 | 3300026116 | Bacteria | 5143 |
| 680 | Ga0207674_10040826 | 3300026116 | Bacteria | 4803 |
| 681 | Ga0207674_10047233 | 3300026116 | Bacteria | 4415 |
| 682 | Ga0207674_10056963 | 3300026116 | Bacteria | 3965 |
| 683 | Ga0207674_10064391 | 3300026116 | Bacteria | 3698 |
| 684 | Ga0207674_10083489 | 3300026116 | Bacteria | 3194 |
| 685 | Ga0207675_100001943 | 3300026118 | Bacteria | 20638 |
| 686 | Ga0207675_100119346 | 3300026118 | Bacteria | 2494 |
| 687 | Ga0207675_100306769 | 3300026118 | Bacteria | 1547 |
| 688 | Ga0207683_10000181 | 3300026121 | Bacteria | 54142 |
| 689 | Ga0207683_10010651 | 3300026121 | Bacteria | 7838 |
| 690 | Ga0207683_10020351 | 3300026121 | Bacteria | 5674 |
| 691 | Ga0207683_10192584 | 3300026121 | Bacteria | 1851 |
| 692 | Ga0207683_10411685 | 3300026121 | Bacteria | 1244 |
| 693 | Ga0207698_10010153 | 3300026142 | Bacteria | 6033 |
| 694 | Ga0207698_10012830 | 3300026142 | Bacteria | 5504 |
| 695 | Ga0207698_10026229 | 3300026142 | Bacteria | 4119 |
| 696 | Ga0207698_10068966 | 3300026142 | Bacteria | 2794 |
| 697 | Ga0207698_10092206 | 3300026142 | Bacteria | 2482 |
| 698 | Ga0209967_1009977 | 3300027364 | Bacteria | 1320 |
| 699 | Ga0209974_10007473 | 3300027876 | Bacteria | 3765 |
| 700 | Ga0209974_10014975 | 3300027876 | Bacteria | 2575 |
| 701 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 702 | Ga0268266_10000318 | 3300028379 | Bacteria | 76400 |
| 703 | Ga0268266_10003762 | 3300028379 | Bacteria | 14885 |
| 704 | Ga0268266_10006216 | 3300028379 | Bacteria | 10970 |
| 705 | Ga0268266_10024360 | 3300028379 | Bacteria | 5148 |
| 706 | Ga0268266_10088217 | 3300028379 | Bacteria | 2714 |
| 707 | Ga0268266_10144969 | 3300028379 | Bacteria | 2134 |
| 708 | Ga0268266_10331890 | 3300028379 | Bacteria | 1425 |
| 709 | Ga0268266_10652999 | 3300028379 | Bacteria | 1012 |
| 710 | Ga0268265_10000789 | 3300028380 | Bacteria | 30232 |
| 711 | Ga0268265_10026131 | 3300028380 | Bacteria | 4151 |
| 712 | Ga0268265_10256334 | 3300028380 | Bacteria | 1552 |
| 713 | Ga0268264_10002322 | 3300028381 | Bacteria | 16822 |
| 714 | Ga0268264_10018939 | 3300028381 | Bacteria | 5628 |
| 715 | Ga0268264_10042335 | 3300028381 | Bacteria | 3770 |
| 716 | Ga0268264_10429695 | 3300028381 | Bacteria | 1275 |
| 717 | Ga0307517_10009945 | 3300028786 | Bacteria | 13395 |
| 718 | Ga0307517_10011892 | 3300028786 | Bacteria | 12017 |
| 719 | Ga0265338_10053043 | 3300028800 | Bacteria | 3632 |
| 720 | Ga0265340_10015248 | 3300031247 | Bacteria | 3998 |
| 721 | Ga0307408_100011716 | 3300031548 | Bacteria | 5798 |
| 722 | Ga0307408_100016395 | 3300031548 | Bacteria | 4944 |
| 723 | Ga0307408_100059266 | 3300031548 | Bacteria | 2786 |
| 724 | Ga0307408_100216729 | 3300031548 | Bacteria | 1559 |
| 725 | Ga0307408_100396766 | 3300031548 | Bacteria | 1183 |
| 726 | Ga0307508_10002203 | 3300031616 | Bacteria | 20787 |
| 727 | Ga0265314_10054163 | 3300031711 | Bacteria | 2777 |
| 728 | Ga0307405_10045849 | 3300031731 | Bacteria | 2681 |
| 729 | Ga0307405_10060893 | 3300031731 | Bacteria | 2383 |
| 730 | Ga0307405_10126124 | 3300031731 | Bacteria | 1760 |
| 731 | Ga0307405_10143520 | 3300031731 | Bacteria | 1668 |
| 732 | Ga0307405_10199937 | 3300031731 | Bacteria | 1450 |
| 733 | Ga0307405_10233591 | 3300031731 | Bacteria | 1357 |
| 734 | Ga0307413_10010607 | 3300031824 | Bacteria | 4482 |
| 735 | Ga0307413_10080578 | 3300031824 | Bacteria | 2085 |
| 736 | Ga0307413_10095823 | 3300031824 | Bacteria | 1946 |
| 737 | Ga0307413_10119634 | 3300031824 | Bacteria | 1781 |
| 738 | Ga0307413_10153354 | 3300031824 | Bacteria | 1608 |
| 739 | Ga0307413_10173023 | 3300031824 | Bacteria | 1530 |
| 740 | Ga0307410_10001711 | 3300031852 | Bacteria | 10120 |
| 741 | Ga0307410_10063922 | 3300031852 | Bacteria | 2526 |
| 742 | Ga0307410_10121780 | 3300031852 | Bacteria | 1903 |
| 743 | Ga0307406_10028909 | 3300031901 | Bacteria | 3352 |
| 744 | Ga0307406_10031864 | 3300031901 | Bacteria | 3213 |
| 745 | Ga0307406_10110373 | 3300031901 | Bacteria | 1892 |
| 746 | Ga0307406_10111203 | 3300031901 | Bacteria | 1886 |
| 747 | Ga0307406_10213899 | 3300031901 | Bacteria | 1428 |
| 748 | Ga0307407_10042853 | 3300031903 | Bacteria | 2541 |
| 749 | Ga0307412_10005140 | 3300031911 | Bacteria | 7326 |
| 750 | Ga0307412_10042238 | 3300031911 | Bacteria | 2961 |
| 751 | Ga0307412_10089533 | 3300031911 | Bacteria | 2149 |
| 752 | Ga0307412_10110118 | 3300031911 | Bacteria | 1964 |
| 753 | Ga0307412_10166831 | 3300031911 | Bacteria | 1642 |
| 754 | Ga0307412_10210810 | 3300031911 | Bacteria | 1482 |
| 755 | Ga0307412_10306474 | 3300031911 | Bacteria | 1257 |
| 756 | Ga0307412_10311991 | 3300031911 | Bacteria | 1247 |
| 757 | Ga0307409_100003478 | 3300031995 | Bacteria | 8561 |
| 758 | Ga0307409_100016750 | 3300031995 | Bacteria | 4862 |
| 759 | Ga0307409_100341322 | 3300031995 | Bacteria | 1409 |
| 760 | Ga0307409_100529843 | 3300031995 | Bacteria | 1152 |
| 761 | Ga0307416_100015921 | 3300032002 | Bacteria | 5209 |
| 762 | Ga0307416_100025055 | 3300032002 | Bacteria | 4366 |
| 763 | Ga0307416_100146606 | 3300032002 | Bacteria | 2156 |
| 764 | Ga0307416_100147262 | 3300032002 | Bacteria | 2152 |
| 765 | Ga0307416_100206292 | 3300032002 | Bacteria | 1870 |
| 766 | Ga0307414_10002151 | 3300032004 | Bacteria | 10286 |
| 767 | Ga0307414_10014045 | 3300032004 | Bacteria | 4786 |
| 768 | Ga0307414_10038104 | 3300032004 | Bacteria | 3225 |
| 769 | Ga0307414_10048367 | 3300032004 | Bacteria | 2933 |
| 770 | Ga0307414_10079800 | 3300032004 | Bacteria | 2390 |
| 771 | Ga0307414_10085270 | 3300032004 | Bacteria | 2326 |
| 772 | Ga0307414_10122390 | 3300032004 | Bacteria | 2003 |
| 773 | Ga0307414_10269530 | 3300032004 | Bacteria | 1425 |
| 774 | Ga0307414_10334196 | 3300032004 | Bacteria | 1294 |
| 775 | Ga0307414_10429377 | 3300032004 | Bacteria | 1154 |
| 776 | Ga0307411_10049862 | 3300032005 | Bacteria | 2723 |
| 777 | Ga0307411_10055208 | 3300032005 | Bacteria | 2612 |
| 778 | Ga0307411_10217865 | 3300032005 | Bacteria | 1479 |
| 779 | Ga0307411_10229289 | 3300032005 | Bacteria | 1446 |
| 780 | Ga0307411_10504986 | 3300032005 | Bacteria | 1023 |
| 781 | Ga0307415_100045438 | 3300032126 | Bacteria | 2944 |
| 782 | Ga0307415_100087862 | 3300032126 | Bacteria | 2241 |
| 783 | Ga0307415_100390762 | 3300032126 | Bacteria | 1184 |
| 784 | Ga0307510_10034948 | 3300033180 | Bacteria | 5618 |
| 785 | Ga0307510_10066196 | 3300033180 | Bacteria | 3651 |
| 786 | Ga0373931_0028431 | 3300035691 | Bacteria | 2863 |
| 787 | Ga0373925_0290818 | 3300037068 | Bacteria | 1317 |
| 788 | Ga0395899_0128664 | 3300037312 | Bacteria | 1810 |
| 789 | Ga0395900_0002008 | 3300037418 | Bacteria | 22966 |
| 790 | Ga0395900_0002613 | 3300037418 | Bacteria | 19679 |
| 791 | Ga0395900_0004765 | 3300037418 | Bacteria | 14296 |
| 792 | Ga0395900_0033362 | 3300037418 | Bacteria | 5298 |
| 793 | Ga0395900_0047992 | 3300037418 | Bacteria | 4398 |
| 794 | Ga0395900_0119069 | 3300037418 | Bacteria | 2710 |
| 795 | Ga0395900_0317625 | 3300037418 | Bacteria | 1539 |
| 796 | Ga0395898_0006213 | 3300037466 | Bacteria | 12795 |
| 797 | Ga0395898_0007898 | 3300037466 | Bacteria | 11291 |
| 798 | Ga0395898_0024226 | 3300037466 | Bacteria | 6122 |
| 799 | Ga0395898_0030071 | 3300037466 | Bacteria | 5439 |
| 800 | Ga0395898_0124061 | 3300037466 | Bacteria | 2474 |
| 801 | Ga0395905_0000218 | 3300037471 | Bacteria | 87745 |
| 802 | Ga0395905_0000688 | 3300037471 | Bacteria | 44764 |
| 803 | Ga0395905_0014317 | 3300037471 | Bacteria | 7580 |
| 804 | Ga0395905_0017192 | 3300037471 | Bacteria | 6870 |
| 805 | Ga0395905_0125168 | 3300037471 | Bacteria | 2417 |
| 806 | Ga0395905_0140258 | 3300037471 | Bacteria | 2274 |
| 807 | Ga0395905_0175341 | 3300037471 | Bacteria | 2013 |
| 808 | Ga0395905_0344010 | 3300037471 | Bacteria | 1383 |
| 809 | Ga0395901_0002884 | 3300038443 | Bacteria | 17345 |
| 810 | Ga0395901_0019988 | 3300038443 | Bacteria | 6850 |
| 811 | Ga0395901_0058836 | 3300038443 | Bacteria | 3998 |
| 812 | Ga0395901_0071197 | 3300038443 | Bacteria | 3623 |
| 813 | Ga0395901_0074595 | 3300038443 | Bacteria | 3539 |
| 814 | Ga0395901_0296589 | 3300038443 | Bacteria | 1676 |
| 815 | Ga0436365_0122535 | 3300039437 | Bacteria | 5701 |
| 816 | Ga0436365_0695503 | 3300039437 | Bacteria | 11620 |
| 817 | Ga0436365_0758923 | 3300039437 | Bacteria | 1597 |
| 818 | Ga0436365_1205090 | 3300039437 | Bacteria | 128002 |
| 819 | Ga0436365_1268241 | 3300039437 | Bacteria | 8581 |
| 820 | Ga0436360_0428998 | 3300039438 | Bacteria | 19607 |
| 821 | Ga0436361_0012467 | 3300039447 | Bacteria | 129952 |
| 822 | Ga0436361_0692291 | 3300039447 | Bacteria | 9881 |
| 823 | Ga0436363_1350835 | 3300039450 | Bacteria | 2465 |
| 824 | Ga0436362_0251358 | 3300039453 | Bacteria | 1088 |
| 825 | Ga0439436_0023454 | 3300041404 | Bacteria | 1825 |
| 826 | Ga0439439_0011720 | 3300041406 | Bacteria | 2113 |
| 827 | Ga0439465_0000784 | 3300041413 | Bacteria | 9908 |
| 828 | Ga0451853_2025836 | 3300041512 | Bacteria | 1707 |
| 829 | Ga0439431_0000151 | 3300041997 | Bacteria | 12684 |
| 830 | Ga0439431_0025523 | 3300041997 | Bacteria | 1443 |
| 831 | Ga0439448_0002886 | 3300042005 | Bacteria | 4709 |
| 832 | Ga0439432_001267 | 3300042006 | Bacteria | 9551 |
| 833 | Ga0439455_0000097 | 3300042012 | Bacteria | 8524 |
| 834 | Ga0439462_0001229 | 3300042015 | Bacteria | 5612 |
| 835 | Ga0439446_0010555 | 3300042156 | Bacteria | 2490 |
| 836 | Ga0439458_0001639 | 3300042157 | Bacteria | 5587 |
| 837 | Ga0439434_0000358 | 3300042435 | Bacteria | 13106 |
| 838 | Ga0439434_0025664 | 3300042435 | Bacteria | 1779 |
| 839 | Ga0466972_0002157 | 3300044658 | Bacteria | 9673 |
| 840 | Ga0466961_0034126 | 3300044693 | Bacteria | 3267 |
| 841 | Ga0466963_0010040 | 3300044694 | Bacteria | 5724 |
| 842 | Ga0466963_0023344 | 3300044694 | Bacteria | 3926 |
| 843 | Ga0466971_0060519 | 3300044719 | Bacteria | 1711 |
| 844 | Ga0466968_0068784 | 3300044735 | Bacteria | 1538 |
| 845 | Ga0466970_0004756 | 3300044765 | Bacteria | 6707 |
| 846 | Ga0466957_0007537 | 3300044842 | Bacteria | 6150 |
| 847 | Ga0466957_0047567 | 3300044842 | Bacteria | 2606 |
| 848 | Ga0466959_0097360 | 3300045049 | Bacteria | 2109 |
| 849 | Ga0466958_0004137 | 3300045836 | Bacteria | 7618 |
| 850 | Ga0466958_0020218 | 3300045836 | Bacteria | 3881 |
| 851 | Ga0466958_0169885 | 3300045836 | Bacteria | 1380 |
| 852 | Ga0466967_0015827 | 3300045976 | Bacteria | 5927 |
| 853 | Ga0495638_0000249 | 3300046460 | Bacteria | 73312 |
| 854 | Ga0495638_0000266 | 3300046460 | Bacteria | 70490 |
| 855 | Ga0495638_0014466 | 3300046460 | Bacteria | 5331 |
| 856 | Ga0495650_0000367 | 3300046471 | Bacteria | 78952 |
| 857 | Ga0495650_0040743 | 3300046471 | Bacteria | 1991 |
| 858 | Ga0495585_0001411 | 3300046492 | Bacteria | 18902 |
| 859 | Ga0495585_0043957 | 3300046492 | Bacteria | 2497 |
| 860 | Ga0495596_0004692 | 3300046500 | Bacteria | 6611 |
| 861 | Ga0495583_0000175 | 3300046506 | Bacteria | 108912 |
| 862 | Ga0495583_0000262 | 3300046506 | Bacteria | 86241 |
| 863 | Ga0495583_0000879 | 3300046506 | Bacteria | 36366 |
| 864 | Ga0495583_0004900 | 3300046506 | Bacteria | 9316 |
| 865 | Ga0495583_0020752 | 3300046506 | Bacteria | 3394 |
| 866 | Ga0495606_0000071 | 3300046507 | Bacteria | 175933 |
| 867 | Ga0495632_0001780 | 3300046519 | Bacteria | 17376 |
| 868 | Ga0495637_0000886 | 3300046520 | Bacteria | 19335 |
| 869 | Ga0495643_0000053 | 3300046522 | Bacteria | 202031 |
| 870 | Ga0495643_0000824 | 3300046522 | Bacteria | 33778 |
| 871 | Ga0495643_0002434 | 3300046522 | Bacteria | 14783 |
| 872 | Ga0495643_0008133 | 3300046522 | Bacteria | 6677 |
| 873 | Ga0495643_0107803 | 3300046522 | Bacteria | 1419 |
| 874 | Ga0495648_0000015 | 3300046524 | Bacteria | 285838 |
| 875 | Ga0495648_0000132 | 3300046524 | Bacteria | 88064 |
| 876 | Ga0495648_0046973 | 3300046524 | Bacteria | 2673 |
| 877 | Ga0495648_0068485 | 3300046524 | Bacteria | 2070 |
| 878 | Ga0495648_0075450 | 3300046524 | Bacteria | 1939 |
| 879 | Ga0495663_0000020 | 3300046525 | Bacteria | 124560 |
| 880 | Ga0495663_0004296 | 3300046525 | Bacteria | 4016 |
| 881 | Ga0495663_0008361 | 3300046525 | Bacteria | 2866 |
| 882 | Ga0495663_0077844 | 3300046525 | Bacteria | 1064 |
| 883 | Ga0495642_0015818 | 3300046528 | Bacteria | 2937 |
| 884 | Ga0495654_0000264 | 3300046530 | Bacteria | 47686 |
| 885 | Ga0495586_0135428 | 3300046535 | Bacteria | 1381 |
| 886 | Ga0495587_0271263 | 3300046536 | Bacteria | 952 |
| 887 | Ga0495621_0000168 | 3300046539 | Bacteria | 14780 |
| 888 | Ga0495621_0003418 | 3300046539 | Bacteria | 4386 |
| 889 | Ga0495621_0013025 | 3300046539 | Bacteria | 2606 |
| 890 | Ga0495597_0075618 | 3300046542 | Bacteria | 1445 |
| 891 | Ga0495633_0001251 | 3300046558 | Bacteria | 20233 |
| 892 | Ga0495633_0001282 | 3300046558 | Bacteria | 19932 |
| 893 | Ga0495633_0007590 | 3300046558 | Bacteria | 6216 |
| 894 | Ga0495633_0107886 | 3300046558 | Bacteria | 1291 |
| 895 | Ga0495668_0000013 | 3300046616 | Bacteria | 452938 |
| 896 | Ga0495668_0080252 | 3300046616 | Bacteria | 1790 |
| 897 | Ga0495611_0025321 | 3300046648 | Bacteria | 2585 |
| 898 | Ga0495611_0041640 | 3300046648 | Bacteria | 2049 |
| 899 | Ga0495611_0053434 | 3300046648 | Bacteria | 1823 |
| 900 | Ga0495625_0000758 | 3300046660 | Bacteria | 45114 |
| 901 | Ga0495625_0002253 | 3300046660 | Bacteria | 21209 |
| 902 | Ga0495625_0005444 | 3300046660 | Bacteria | 11607 |
| 903 | Ga0495625_0014698 | 3300046660 | Bacteria | 6235 |
| 904 | Ga0495625_0037437 | 3300046660 | Bacteria | 3560 |
| 905 | Ga0495625_0047242 | 3300046660 | Bacteria | 3104 |
| 906 | Ga0495625_0083277 | 3300046660 | Bacteria | 2224 |
| 907 | Ga0495625_0127241 | 3300046660 | Bacteria | 1728 |
| 908 | Ga0495659_0010446 | 3300046664 | Bacteria | 2979 |
| 909 | Ga0495661_0043833 | 3300046665 | Bacteria | 2747 |
| 910 | Ga0495661_0161134 | 3300046665 | Bacteria | 1204 |
| 911 | Ga0495669_0000023 | 3300046684 | Bacteria | 117158 |
| 912 | Ga0495669_0020183 | 3300046684 | Bacteria | 2882 |
| 913 | Ga0495670_0000010 | 3300046691 | Bacteria | 174071 |
| 914 | Ga0495670_0127892 | 3300046691 | Bacteria | 1323 |
| 915 | Ga0495671_0000031 | 3300046692 | Bacteria | 202030 |
| 916 | Ga0495671_0000084 | 3300046692 | Bacteria | 89406 |
| 917 | Ga0495671_0061568 | 3300046692 | Bacteria | 1851 |
| 918 | Ga0495649_0007386 | 3300046694 | Bacteria | 6709 |
| 919 | Ga0495660_0074046 | 3300046810 | Bacteria | 1800 |
| 920 | Ga0495683_0013556 | 3300047323 | Bacteria | 4260 |
| 921 | Ga0495687_000076 | 3300047443 | Bacteria | 149259 |
| 922 | Ga0495687_000080 | 3300047443 | Bacteria | 147467 |
| 923 | Ga0495673_0000206 | 3300047469 | Bacteria | 89432 |
| 924 | Ga0495681_0008207 | 3300047470 | Bacteria | 6567 |
| 925 | Ga0495681_0042262 | 3300047470 | Bacteria | 2207 |
| 926 | Ga0495681_0049049 | 3300047470 | Bacteria | 1998 |
| 927 | Ga0495681_0075327 | 3300047470 | Bacteria | 1519 |
| 928 | Ga0495686_0000072 | 3300047472 | Bacteria | 216371 |
| 929 | Ga0495686_0000962 | 3300047472 | Bacteria | 35471 |
| 930 | Ga0495686_0002307 | 3300047472 | Bacteria | 18248 |
| 931 | Ga0495686_0008799 | 3300047472 | Bacteria | 7353 |
| 932 | Ga0495686_0032256 | 3300047472 | Bacteria | 3391 |
| 933 | Ga0495686_0128192 | 3300047472 | Bacteria | 1507 |
| 934 | Ga0496102_0189171 | 3300048905 | Bacteria | 1940 |
| 935 | Ga0496102_0359455 | 3300048905 | Bacteria | 1371 |
| 936 | Ga0496103_0172222 | 3300048906 | Bacteria | 1390 |
| 937 | Ga0496107_0107019 | 3300048910 | Bacteria | 2054 |
| 938 | Ga0496108_0006481 | 3300048911 | Bacteria | 9494 |
| 939 | Ga0496108_0421565 | 3300048911 | Bacteria | 1166 |
| 940 | Ga0496110_0054021 | 3300048913 | Bacteria | 3533 |
| 941 | Ga0496110_0407099 | 3300048913 | Bacteria | 1240 |
| 942 | Ga0496111_0095883 | 3300048914 | Bacteria | 2177 |
| 943 | Ga0496112_0078396 | 3300048915 | Bacteria | 3267 |
| 944 | Ga0496116_0068160 | 3300048919 | Bacteria | 2268 |
| 945 | Ga0496117_0003631 | 3300048920 | Bacteria | 17769 |
| 946 | Ga0496117_0050916 | 3300048920 | Bacteria | 2932 |
| 947 | Ga0496117_0080500 | 3300048920 | Bacteria | 2142 |
| 948 | Ga0496118_0000162 | 3300048921 | Bacteria | 119635 |
| 949 | Ga0496118_0011572 | 3300048921 | Bacteria | 8594 |
| 950 | Ga0496118_0086363 | 3300048921 | Bacteria | 2180 |
| 951 | Ga0496120_0159902 | 3300048923 | Bacteria | 1124 |
| 952 | Ga0496121_0001861 | 3300048924 | Bacteria | 33858 |
| 953 | Ga0496121_0002939 | 3300048924 | Bacteria | 24918 |
| 954 | Ga0496121_0002997 | 3300048924 | Bacteria | 24524 |
| 955 | Ga0496121_0087804 | 3300048924 | Bacteria | 2440 |
| 956 | Ga0496122_0008044 | 3300048925 | Bacteria | 11506 |
| 957 | Ga0496122_0010853 | 3300048925 | Bacteria | 9326 |
| 958 | Ga0496122_0013101 | 3300048925 | Bacteria | 8161 |
| 959 | Ga0496122_0067654 | 3300048925 | Bacteria | 2571 |
| 960 | Ga0496122_0189030 | 3300048925 | Bacteria | 1218 |
| 961 | Ga0496123_0000643 | 3300048926 | Bacteria | 58206 |
| 962 | Ga0496123_0000804 | 3300048926 | Bacteria | 50773 |
| 963 | Ga0496123_0003112 | 3300048926 | Bacteria | 19028 |
| 964 | Ga0496123_0017852 | 3300048926 | Bacteria | 5682 |
| 965 | Ga0496123_0025967 | 3300048926 | Bacteria | 4401 |
| 966 | Ga0496123_0102046 | 3300048926 | Bacteria | 1666 |
| 967 | Ga0496123_0115362 | 3300048926 | Bacteria | 1524 |
| 968 | Ga0496124_0000830 | 3300048927 | Bacteria | 50338 |
| 969 | Ga0496124_0006400 | 3300048927 | Bacteria | 12839 |
| 970 | Ga0496124_0007019 | 3300048927 | Bacteria | 12068 |
| 971 | Ga0496124_0049666 | 3300048927 | Bacteria | 3577 |
| 972 | Ga0496124_0132784 | 3300048927 | Bacteria | 1976 |
| 973 | Ga0496125_0000335 | 3300048928 | Bacteria | 90043 |
| 974 | Ga0496125_0006144 | 3300048928 | Bacteria | 13095 |
| 975 | Ga0496125_0007778 | 3300048928 | Bacteria | 11339 |
| 976 | Ga0496125_0009669 | 3300048928 | Bacteria | 9855 |
| 977 | Ga0496125_0020332 | 3300048928 | Bacteria | 6231 |
| 978 | Ga0496125_0020675 | 3300048928 | Bacteria | 6174 |
| 979 | Ga0501300_004127 | 3300049523 | Bacteria | 2159 |
| 980 | Ga0501032_0016697 | 3300049569 | Bacteria | 5159 |
| 981 | Ga0501033_0118730 | 3300049570 | Bacteria | 1920 |
| 982 | Ga0501034_0002878 | 3300049571 | Bacteria | 20010 |
| 983 | Ga0501034_0004118 | 3300049571 | Bacteria | 16299 |
| 984 | Ga0501034_0126968 | 3300049571 | Bacteria | 2535 |
| 985 | Ga0501034_0162907 | 3300049571 | Bacteria | 2200 |
| 986 | Ga0501036_0005868 | 3300049572 | Bacteria | 9947 |
| 987 | Ga0501037_0054790 | 3300049573 | Bacteria | 2916 |
| 988 | Ga0501038_0194414 | 3300049574 | Bacteria | 1631 |
| 989 | Ga0501038_0212364 | 3300049574 | Bacteria | 1547 |
| 990 | Ga0501039_0032064 | 3300049575 | Bacteria | 4050 |
| 991 | Ga0501046_0029514 | 3300049580 | Bacteria | 4458 |
| 992 | Ga0501046_0192311 | 3300049580 | Bacteria | 1522 |
| 993 | Ga0501047_0110882 | 3300049581 | Bacteria | 2626 |
| 994 | Ga0501047_0159672 | 3300049581 | Bacteria | 2126 |
| 995 | Ga0501047_0301658 | 3300049581 | Bacteria | 1444 |
| 996 | Ga0501068_0009942 | 3300049584 | Bacteria | 5332 |
| 997 | Ga0501069_0008799 | 3300049585 | Bacteria | 5319 |
| 998 | Ga0501070_0042512 | 3300049586 | Bacteria | 3785 |
| 999 | Ga0501070_0133612 | 3300049586 | Bacteria | 2049 |
| 1000 | Ga0501217_013236 | 3300049661 | Bacteria | 1850 |
| 1001 | Ga0501223_000082 | 3300049663 | Bacteria | 28639 |
| 1002 | Ga0501223_002015 | 3300049663 | Bacteria | 4556 |
| 1003 | Ga0501257_000074 | 3300049686 | Bacteria | 25196 |
| 1004 | Ga0501225_0000059 | 3300049705 | Bacteria | 36394 |
| 1005 | Ga0501225_0005861 | 3300049705 | Bacteria | 3596 |
| 1006 | Ga0501225_0007744 | 3300049705 | Bacteria | 3105 |
| 1007 | Ga0501245_023059 | 3300049708 | Bacteria | 986 |
| 1008 | Ga0501241_000565 | 3300049758 | Bacteria | 7945 |
| 1009 | Ga0501268_002046 | 3300049765 | Bacteria | 2604 |
| 1010 | Ga0501270_000579 | 3300049767 | Bacteria | 3172 |
| 1011 | Ga0501280_014312 | 3300049776 | Bacteria | 1128 |
| 1012 | Ga0501035_0025664 | 3300049822 | Bacteria | 5401 |
| 1013 | nmdc:mga0yw44_168075_c1 | 3300050492 | Bacteria | 1439 |
| 1014 | nmdc:mga06z11_34258_c1 | 3300050494 | Bacteria | 2491 |
| 1015 | nmdc:mga06z11_37633_c1 | 3300050494 | Bacteria | 2397 |
| 1016 | nmdc:mga06z11_40934_c1 | 3300050494 | Bacteria | 2315 |
| 1017 | nmdc:mga07m45_38635_c1 | 3300050496 | Bacteria | 2664 |
| 1018 | nmdc:mga09592_287644_c1 | 3300050508 | Bacteria | 1425 |
| 1019 | nmdc:mga06r32_8778_c1 | 3300050510 | Bacteria | 9108 |
| 1020 | nmdc:mga0n895_65333_c1 | 3300050512 | Bacteria | 3601 |
| 1021 | nmdc:mga0a205_2308_c1 | 3300050515 | Bacteria | 16838 |
| 1022 | nmdc:mga0sz30_148_c1 | 3300050516 | Bacteria | 26288 |
| 1023 | nmdc:mga0sz30_7134_c1 | 3300050516 | Bacteria | 4181 |
| 1024 | Ga0500610_0010169 | 3300053079 | Bacteria | 4218 |
| 1025 | Ga0500643_000115 | 3300053087 | Bacteria | 84126 |
| 1026 | Ga0500643_000203 | 3300053087 | Bacteria | 56433 |
| 1027 | Ga0500643_001426 | 3300053087 | Bacteria | 13787 |
| 1028 | Ga0500643_003506 | 3300053087 | Bacteria | 7514 |
| 1029 | Ga0500643_069194 | 3300053087 | Bacteria | 981 |
| 1030 | Ga0500566_0001654 | 3300053094 | Bacteria | 13076 |
| 1031 | Ga0500566_0184295 | 3300053094 | Bacteria | 1068 |
| 1032 | Ga0500641_0001530 | 3300053096 | Bacteria | 8258 |
| 1033 | Ga0500650_0022660 | 3300053098 | Bacteria | 2782 |
| 1034 | Ga0500555_002637 | 3300053103 | Bacteria | 5163 |
| 1035 | Ga0500556_0000013 | 3300053104 | Bacteria | 243797 |
| 1036 | Ga0500557_046688 | 3300053105 | Bacteria | 1376 |
| 1037 | Ga0500592_000019 | 3300053116 | Bacteria | 57900 |
| 1038 | Ga0500595_000322 | 3300053119 | Bacteria | 31502 |
| 1039 | Ga0500595_001189 | 3300053119 | Bacteria | 14368 |
| 1040 | Ga0500608_059154 | 3300053122 | Bacteria | 1834 |
| 1041 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 1042 | Ga0500642_0002968 | 3300053130 | Bacteria | 5057 |
| 1043 | Ga0500658_0001557 | 3300053134 | Bacteria | 9161 |
| 1044 | Ga0500658_0004819 | 3300053134 | Bacteria | 5032 |
| 1045 | Ga0500559_0025686 | 3300053136 | Bacteria | 2507 |
| 1046 | Ga0500559_0108698 | 3300053136 | Bacteria | 1283 |
| 1047 | Ga0500568_0004980 | 3300053139 | Bacteria | 6968 |
| 1048 | Ga0500568_0047570 | 3300053139 | Bacteria | 1699 |
| 1049 | Ga0500577_0018894 | 3300053142 | Bacteria | 2225 |
| 1050 | Ga0500604_0000018 | 3300053151 | Bacteria | 78699 |
| 1051 | Ga0500604_0008220 | 3300053151 | Bacteria | 2766 |
| 1052 | Ga0500604_0048228 | 3300053151 | Bacteria | 1307 |
| 1053 | Ga0500616_0001491 | 3300053153 | Bacteria | 22149 |
| 1054 | Ga0500616_0002249 | 3300053153 | Bacteria | 16476 |
| 1055 | Ga0500622_0045229 | 3300053156 | Bacteria | 2280 |
| 1056 | Ga0500624_000024 | 3300053157 | Bacteria | 114404 |
| 1057 | Ga0500627_0000131 | 3300053158 | Bacteria | 22423 |
| 1058 | Ga0500627_0000188 | 3300053158 | Bacteria | 18122 |
| 1059 | Ga0500645_000003 | 3300053730 | Bacteria | 305887 |
| 1060 | Ga0500645_001222 | 3300053730 | Bacteria | 13538 |
| 1061 | Ga0500645_001904 | 3300053730 | Bacteria | 9924 |
| 1062 | Ga0500552_000111 | 3300053733 | Bacteria | 6919 |
| 1063 | Ga0500596_003051 | 3300053735 | Bacteria | 3225 |
| 1064 | Ga0466962_0000873 | 3300061719 | Bacteria | 13668 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025937 | Ga0207669_10115466 | Ga0207669_101154663 | 246 |
| 2 | 3300005335 | Ga0070666_10507389 | Ga0070666_105073891 | 256 |
| 3 | 3300049708 | Ga0501245_023059 | Ga0501245_023059_145_975 | 276 |
| 4 | 3300001904 | JGI24736J21556_1006943 | JGI24736J21556_10069432 | 278 |
| 5 | 3300001989 | JGI24739J22299_10024985 | JGI24739J22299_100249852 | 278 |
| 6 | 3300001989 | JGI24739J22299_10029529 | JGI24739J22299_100295292 | 278 |
| 7 | 3300001990 | JGI24737J22298_10029109 | JGI24737J22298_100291092 | 278 |
| 8 | 3300002067 | JGI24735J21928_10022352 | JGI24735J21928_100223522 | 278 |
| 9 | 3300002075 | JGI24738J21930_10001002 | JGI24738J21930_100010022 | 278 |
| 10 | 3300005457 | Ga0070662_100041566 | Ga0070662_1000415662 | 278 |
| 11 | 3300005577 | Ga0068857_100318299 | Ga0068857_1003182992 | 278 |
| 12 | 3300005616 | Ga0068852_100070015 | Ga0068852_1000700152 | 278 |
| 13 | 3300005834 | Ga0068851_10028720 | Ga0068851_100287202 | 278 |
| 14 | 3300009174 | Ga0105241_10041561 | Ga0105241_100415612 | 278 |
| 15 | 3300009545 | Ga0105237_10091788 | Ga0105237_100917882 | 278 |
| 16 | 3300013104 | Ga0157370_10014466 | Ga0157370_100144668 | 278 |
| 17 | 3300013105 | Ga0157369_10190642 | Ga0157369_101906422 | 278 |
| 18 | 3300025321 | Ga0207656_10020691 | Ga0207656_100206913 | 278 |
| 19 | 3300025911 | Ga0207654_10018258 | Ga0207654_100182583 | 278 |
| 20 | 3300025913 | Ga0207695_10028820 | Ga0207695_100288205 | 278 |
| 21 | 3300025914 | Ga0207671_10004616 | Ga0207671_100046166 | 278 |
| 22 | 3300025924 | Ga0207694_10047352 | Ga0207694_100473524 | 278 |
| 23 | 3300025981 | Ga0207640_10084258 | Ga0207640_100842583 | 278 |
| 24 | 3300026041 | Ga0207639_10027203 | Ga0207639_100272035 | 278 |
| 25 | 3300026067 | Ga0207678_10344385 | Ga0207678_103443852 | 278 |
| 26 | 3300026078 | Ga0207702_10038212 | Ga0207702_100382123 | 278 |
| 27 | 3300026142 | Ga0207698_10068966 | Ga0207698_100689664 | 278 |
| 28 | 3300009148 | Ga0105243_10238195 | Ga0105243_102381952 | 279 |
| 29 | 3300005435 | Ga0070714_100050966 | Ga0070714_1000509664 | 282 |
| 30 | 3300025929 | Ga0207664_10061578 | Ga0207664_100615784 | 282 |
| 31 | 3300049586 | Ga0501070_0133612 | Ga0501070_0133612_700_1644 | 283 |
| 32 | 3300046535 | Ga0495586_0135428 | Ga0495586_0135428_94_981 | 286 |
| 33 | 3300025931 | Ga0207644_10002824 | Ga0207644_100028249 | 290 |
| 34 | 3300037466 | Ga0395898_0007898 | Ga0395898_0007898_99_992 | 290 |
| 35 | 3300048905 | Ga0496102_0189171 | Ga0496102_0189171_350_1222 | 290 |
| 36 | 3300053087 | Ga0500643_000115 | Ga0500643_000115_51108_51980 | 290 |
| 37 | 3300053116 | Ga0500592_000019 | Ga0500592_000019_10690_11562 | 290 |
| 38 | 3300053151 | Ga0500604_0048228 | Ga0500604_0048228_187_1059 | 290 |
| 39 | 3300053158 | Ga0500627_0000131 | Ga0500627_0000131_7141_8013 | 290 |
| 40 | 3300001990 | JGI24737J22298_10070569 | JGI24737J22298_100705692 | 291 |
| 41 | 3300005327 | Ga0070658_10036686 | Ga0070658_100366862 | 291 |
| 42 | 3300005339 | Ga0070660_100001509 | Ga0070660_1000015099 | 291 |
| 43 | 3300005366 | Ga0070659_100022212 | Ga0070659_1000222122 | 291 |
| 44 | 3300005455 | Ga0070663_100062435 | Ga0070663_1000624353 | 291 |
| 45 | 3300005564 | Ga0070664_100042361 | Ga0070664_1000423612 | 291 |
| 46 | 3300011119 | Ga0105246_10575611 | Ga0105246_105756111 | 291 |
| 47 | 3300025919 | Ga0207657_10076413 | Ga0207657_100764134 | 291 |
| 48 | 3300025933 | Ga0207706_10057532 | Ga0207706_100575325 | 291 |
| 49 | 3300026067 | Ga0207678_10081355 | Ga0207678_100813553 | 291 |
| 50 | 3300049574 | Ga0501038_0194414 | Ga0501038_0194414_10_885 | 291 |
| 51 | 3300053087 | Ga0500643_003506 | Ga0500643_003506_3229_4104 | 291 |
| 52 | 3300053122 | Ga0500608_059154 | Ga0500608_059154_234_1109 | 291 |
| 53 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_239823_240698 | 291 |
| 54 | 3300053730 | Ga0500645_001904 | Ga0500645_001904_7080_7955 | 291 |
| 55 | 3300044694 | Ga0466963_0023344 | Ga0466963_0023344_2596_3483 | 292 |
| 56 | 3300045836 | Ga0466958_0169885 | Ga0466958_0169885_255_1142 | 292 |
| 57 | 3300005328 | Ga0070676_10149291 | Ga0070676_101492911 | 293 |
| 58 | 3300005334 | Ga0068869_100448860 | Ga0068869_1004488601 | 293 |
| 59 | 3300005347 | Ga0070668_100024681 | Ga0070668_1000246813 | 293 |
| 60 | 3300005364 | Ga0070673_100024388 | Ga0070673_1000243887 | 293 |
| 61 | 3300005367 | Ga0070667_100023180 | Ga0070667_1000231801 | 293 |
| 62 | 3300005459 | Ga0068867_100003846 | Ga0068867_1000038469 | 293 |
| 63 | 3300005543 | Ga0070672_100135004 | Ga0070672_1001350042 | 293 |
| 64 | 3300006358 | Ga0068871_100108920 | Ga0068871_1001089203 | 293 |
| 65 | 3300025899 | Ga0207642_10002992 | Ga0207642_100029925 | 293 |
| 66 | 3300025923 | Ga0207681_10067923 | Ga0207681_100679233 | 293 |
| 67 | 3300025940 | Ga0207691_10105501 | Ga0207691_101055013 | 293 |
| 68 | 3300025942 | Ga0207689_10071243 | Ga0207689_100712433 | 293 |
| 69 | 3300025972 | Ga0207668_10000021 | Ga0207668_1000002169 | 293 |
| 70 | 3300025986 | Ga0207658_10013277 | Ga0207658_100132779 | 293 |
| 71 | 3300026067 | Ga0207678_10091429 | Ga0207678_100914292 | 293 |
| 72 | 3300026089 | Ga0207648_10004112 | Ga0207648_1000411214 | 293 |
| 73 | 3300026121 | Ga0207683_10010651 | Ga0207683_100106518 | 293 |
| 74 | iso_pu_bacteria | 2852680915 | 2852680931 | 293 |
| 75 | iso_pu_bacteria | 8057101203 | 8057101878 | 293 |
| 76 | 3300001904 | JGI24736J21556_1011073 | JGI24736J21556_10110732 | 294 |
| 77 | 3300001979 | JGI24740J21852_10001550 | JGI24740J21852_1000155010 | 294 |
| 78 | 3300001979 | JGI24740J21852_10013368 | JGI24740J21852_100133681 | 294 |
| 79 | 3300001989 | JGI24739J22299_10001469 | JGI24739J22299_100014698 | 294 |
| 80 | 3300001989 | JGI24739J22299_10004251 | JGI24739J22299_100042514 | 294 |
| 81 | 3300001989 | JGI24739J22299_10010073 | JGI24739J22299_100100733 | 294 |
| 82 | 3300001990 | JGI24737J22298_10000293 | JGI24737J22298_100002935 | 294 |
| 83 | 3300001990 | JGI24737J22298_10017771 | JGI24737J22298_100177713 | 294 |
| 84 | 3300002075 | JGI24738J21930_10000814 | JGI24738J21930_100008142 | 294 |
| 85 | 3300002077 | JGI24744J21845_10005272 | JGI24744J21845_100052722 | 294 |
| 86 | 3300005327 | Ga0070658_10091850 | Ga0070658_100918503 | 294 |
| 87 | 3300005328 | Ga0070676_10004996 | Ga0070676_100049966 | 294 |
| 88 | 3300005329 | Ga0070683_100060925 | Ga0070683_1000609252 | 294 |
| 89 | 3300005331 | Ga0070670_100018265 | Ga0070670_1000182652 | 294 |
| 90 | 3300005331 | Ga0070670_100040431 | Ga0070670_1000404315 | 294 |
| 91 | 3300005331 | Ga0070670_100065316 | Ga0070670_1000653162 | 294 |
| 92 | 3300005331 | Ga0070670_100070931 | Ga0070670_1000709312 | 294 |
| 93 | 3300005331 | Ga0070670_100374967 | Ga0070670_1003749672 | 294 |
| 94 | 3300005331 | Ga0070670_100454313 | Ga0070670_1004543131 | 294 |
| 95 | 3300005334 | Ga0068869_100000094 | Ga0068869_10000009420 | 294 |
| 96 | 3300005335 | Ga0070666_10000342 | Ga0070666_1000034210 | 294 |
| 97 | 3300005335 | Ga0070666_10017178 | Ga0070666_100171785 | 294 |
| 98 | 3300005335 | Ga0070666_10149578 | Ga0070666_101495782 | 294 |
| 99 | 3300005336 | Ga0070680_100343924 | Ga0070680_1003439242 | 294 |
| 100 | 3300005337 | Ga0070682_100052195 | Ga0070682_1000521952 | 294 |
| 101 | 3300005338 | Ga0068868_100000113 | Ga0068868_10000011310 | 294 |
| 102 | 3300005338 | Ga0068868_100002389 | Ga0068868_1000023897 | 294 |
| 103 | 3300005338 | Ga0068868_100184873 | Ga0068868_1001848731 | 294 |
| 104 | 3300005339 | Ga0070660_100041042 | Ga0070660_1000410422 | 294 |
| 105 | 3300005339 | Ga0070660_100041201 | Ga0070660_1000412012 | 294 |
| 106 | 3300005339 | Ga0070660_100083027 | Ga0070660_1000830273 | 294 |
| 107 | 3300005344 | Ga0070661_100012399 | Ga0070661_1000123993 | 294 |
| 108 | 3300005344 | Ga0070661_100064473 | Ga0070661_1000644732 | 294 |
| 109 | 3300005347 | Ga0070668_100002775 | Ga0070668_1000027754 | 294 |
| 110 | 3300005353 | Ga0070669_100000155 | Ga0070669_10000015520 | 294 |
| 111 | 3300005353 | Ga0070669_100039822 | Ga0070669_1000398223 | 294 |
| 112 | 3300005353 | Ga0070669_100065653 | Ga0070669_1000656532 | 294 |
| 113 | 3300005353 | Ga0070669_100132388 | Ga0070669_1001323882 | 294 |
| 114 | 3300005354 | Ga0070675_100302853 | Ga0070675_1003028531 | 294 |
| 115 | 3300005355 | Ga0070671_100019672 | Ga0070671_1000196726 | 294 |
| 116 | 3300005355 | Ga0070671_100031754 | Ga0070671_1000317543 | 294 |
| 117 | 3300005356 | Ga0070674_100005255 | Ga0070674_1000052559 | 294 |
| 118 | 3300005356 | Ga0070674_100019554 | Ga0070674_1000195543 | 294 |
| 119 | 3300005356 | Ga0070674_100054157 | Ga0070674_1000541574 | 294 |
| 120 | 3300005364 | Ga0070673_100001756 | Ga0070673_10000175610 | 294 |
| 121 | 3300005364 | Ga0070673_100034497 | Ga0070673_1000344975 | 294 |
| 122 | 3300005364 | Ga0070673_100050349 | Ga0070673_1000503493 | 294 |
| 123 | 3300005364 | Ga0070673_100065260 | Ga0070673_1000652603 | 294 |
| 124 | 3300005365 | Ga0070688_100161926 | Ga0070688_1001619262 | 294 |
| 125 | 3300005366 | Ga0070659_100000305 | Ga0070659_10000030525 | 294 |
| 126 | 3300005366 | Ga0070659_100075534 | Ga0070659_1000755343 | 294 |
| 127 | 3300005366 | Ga0070659_100111678 | Ga0070659_1001116782 | 294 |
| 128 | 3300005366 | Ga0070659_100147357 | Ga0070659_1001473572 | 294 |
| 129 | 3300005367 | Ga0070667_100000656 | Ga0070667_10000065615 | 294 |
| 130 | 3300005367 | Ga0070667_100003284 | Ga0070667_1000032844 | 294 |
| 131 | 3300005455 | Ga0070663_100015825 | Ga0070663_1000158255 | 294 |
| 132 | 3300005455 | Ga0070663_100055140 | Ga0070663_1000551402 | 294 |
| 133 | 3300005455 | Ga0070663_100098890 | Ga0070663_1000988902 | 294 |
| 134 | 3300005457 | Ga0070662_100024764 | Ga0070662_1000247643 | 294 |
| 135 | 3300005457 | Ga0070662_100026033 | Ga0070662_1000260335 | 294 |
| 136 | 3300005457 | Ga0070662_100155667 | Ga0070662_1001556672 | 294 |
| 137 | 3300005459 | Ga0068867_100001817 | Ga0068867_10000181717 | 294 |
| 138 | 3300005459 | Ga0068867_100010918 | Ga0068867_1000109184 | 294 |
| 139 | 3300005535 | Ga0070684_100389020 | Ga0070684_1003890202 | 294 |
| 140 | 3300005539 | Ga0068853_100005924 | Ga0068853_1000059246 | 294 |
| 141 | 3300005539 | Ga0068853_100046194 | Ga0068853_1000461942 | 294 |
| 142 | 3300005543 | Ga0070672_100000710 | Ga0070672_10000071011 | 294 |
| 143 | 3300005543 | Ga0070672_100033346 | Ga0070672_1000333465 | 294 |
| 144 | 3300005544 | Ga0070686_100142419 | Ga0070686_1001424191 | 294 |
| 145 | 3300005548 | Ga0070665_100000995 | Ga0070665_10000099521 | 294 |
| 146 | 3300005548 | Ga0070665_100014710 | Ga0070665_1000147107 | 294 |
| 147 | 3300005548 | Ga0070665_100121024 | Ga0070665_1001210243 | 294 |
| 148 | 3300005548 | Ga0070665_100338978 | Ga0070665_1003389782 | 294 |
| 149 | 3300005563 | Ga0068855_100038147 | Ga0068855_1000381474 | 294 |
| 150 | 3300005563 | Ga0068855_100372096 | Ga0068855_1003720962 | 294 |
| 151 | 3300005564 | Ga0070664_100003720 | Ga0070664_1000037206 | 294 |
| 152 | 3300005564 | Ga0070664_100006800 | Ga0070664_1000068009 | 294 |
| 153 | 3300005564 | Ga0070664_100030014 | Ga0070664_1000300142 | 294 |
| 154 | 3300005577 | Ga0068857_100004853 | Ga0068857_10000485311 | 294 |
| 155 | 3300005577 | Ga0068857_100007710 | Ga0068857_1000077108 | 294 |
| 156 | 3300005577 | Ga0068857_100053395 | Ga0068857_1000533952 | 294 |
| 157 | 3300005578 | Ga0068854_100000206 | Ga0068854_10000020634 | 294 |
| 158 | 3300005578 | Ga0068854_100020435 | Ga0068854_1000204353 | 294 |
| 159 | 3300005578 | Ga0068854_100021215 | Ga0068854_1000212154 | 294 |
| 160 | 3300005578 | Ga0068854_100028258 | Ga0068854_1000282584 | 294 |
| 161 | 3300005578 | Ga0068854_100040701 | Ga0068854_1000407012 | 294 |
| 162 | 3300005578 | Ga0068854_100079015 | Ga0068854_1000790152 | 294 |
| 163 | 3300005578 | Ga0068854_100369455 | Ga0068854_1003694552 | 294 |
| 164 | 3300005616 | Ga0068852_100002924 | Ga0068852_1000029247 | 294 |
| 165 | 3300005616 | Ga0068852_100044876 | Ga0068852_1000448761 | 294 |
| 166 | 3300005617 | Ga0068859_100007995 | Ga0068859_1000079954 | 294 |
| 167 | 3300005617 | Ga0068859_100049241 | Ga0068859_1000492414 | 294 |
| 168 | 3300005618 | Ga0068864_100000428 | Ga0068864_10000042842 | 294 |
| 169 | 3300005618 | Ga0068864_100115414 | Ga0068864_1001154143 | 294 |
| 170 | 3300005718 | Ga0068866_10109373 | Ga0068866_101093732 | 294 |
| 171 | 3300005834 | Ga0068851_10008531 | Ga0068851_100085312 | 294 |
| 172 | 3300005840 | Ga0068870_10083700 | Ga0068870_100837002 | 294 |
| 173 | 3300005841 | Ga0068863_100000634 | Ga0068863_10000063416 | 294 |
| 174 | 3300005842 | Ga0068858_100001980 | Ga0068858_10000198013 | 294 |
| 175 | 3300005842 | Ga0068858_100009525 | Ga0068858_1000095256 | 294 |
| 176 | 3300005842 | Ga0068858_100143470 | Ga0068858_1001434702 | 294 |
| 177 | 3300005843 | Ga0068860_100003691 | Ga0068860_10000369116 | 294 |
| 178 | 3300005843 | Ga0068860_100050945 | Ga0068860_1000509454 | 294 |
| 179 | 3300005843 | Ga0068860_100137815 | Ga0068860_1001378153 | 294 |
| 180 | 3300005844 | Ga0068862_100036890 | Ga0068862_1000368904 | 294 |
| 181 | 3300005844 | Ga0068862_100041178 | Ga0068862_1000411782 | 294 |
| 182 | 3300005844 | Ga0068862_100511119 | Ga0068862_1005111191 | 294 |
| 183 | 3300006237 | Ga0097621_100328388 | Ga0097621_1003283882 | 294 |
| 184 | 3300006881 | Ga0068865_100029233 | Ga0068865_1000292332 | 294 |
| 185 | 3300006931 | Ga0097620_100007995 | Ga0097620_10000799510 | 294 |
| 186 | 3300006931 | Ga0097620_100049240 | Ga0097620_1000492403 | 294 |
| 187 | 3300009093 | Ga0105240_10062248 | Ga0105240_100622483 | 294 |
| 188 | 3300009093 | Ga0105240_10771042 | Ga0105240_107710422 | 294 |
| 189 | 3300009098 | Ga0105245_10008689 | Ga0105245_100086892 | 294 |
| 190 | 3300009098 | Ga0105245_10377976 | Ga0105245_103779762 | 294 |
| 191 | 3300009148 | Ga0105243_10190486 | Ga0105243_101904862 | 294 |
| 192 | 3300009148 | Ga0105243_10471344 | Ga0105243_104713442 | 294 |
| 193 | 3300009174 | Ga0105241_10161430 | Ga0105241_101614302 | 294 |
| 194 | 3300009176 | Ga0105242_10062392 | Ga0105242_100623923 | 294 |
| 195 | 3300009176 | Ga0105242_10082968 | Ga0105242_100829683 | 294 |
| 196 | 3300009176 | Ga0105242_10374307 | Ga0105242_103743071 | 294 |
| 197 | 3300009177 | Ga0105248_10001472 | Ga0105248_100014728 | 294 |
| 198 | 3300009177 | Ga0105248_10251176 | Ga0105248_102511762 | 294 |
| 199 | 3300009177 | Ga0105248_10292142 | Ga0105248_102921423 | 294 |
| 200 | 3300009551 | Ga0105238_10031422 | Ga0105238_100314225 | 294 |
| 201 | 3300009551 | Ga0105238_10070437 | Ga0105238_100704372 | 294 |
| 202 | 3300009553 | Ga0105249_10035540 | Ga0105249_100355404 | 294 |
| 203 | 3300011119 | Ga0105246_10033675 | Ga0105246_100336754 | 294 |
| 204 | 3300013100 | Ga0157373_10002262 | Ga0157373_100022629 | 294 |
| 205 | 3300013100 | Ga0157373_10028733 | Ga0157373_100287334 | 294 |
| 206 | 3300013100 | Ga0157373_10123932 | Ga0157373_101239322 | 294 |
| 207 | 3300013102 | Ga0157371_10002300 | Ga0157371_1000230010 | 294 |
| 208 | 3300013102 | Ga0157371_10256567 | Ga0157371_102565671 | 294 |
| 209 | 3300013102 | Ga0157371_10316019 | Ga0157371_103160191 | 294 |
| 210 | 3300013297 | Ga0157378_10001977 | Ga0157378_100019776 | 294 |
| 211 | 3300013297 | Ga0157378_10009310 | Ga0157378_100093105 | 294 |
| 212 | 3300013306 | Ga0163162_10023769 | Ga0163162_100237694 | 294 |
| 213 | 3300013306 | Ga0163162_10741874 | Ga0163162_107418742 | 294 |
| 214 | 3300013307 | Ga0157372_10302408 | Ga0157372_103024082 | 294 |
| 215 | 3300013307 | Ga0157372_10442943 | Ga0157372_104429432 | 294 |
| 216 | 3300013308 | Ga0157375_10059996 | Ga0157375_100599964 | 294 |
| 217 | 3300013308 | Ga0157375_10442007 | Ga0157375_104420072 | 294 |
| 218 | 3300013308 | Ga0157375_10707668 | Ga0157375_107076682 | 294 |
| 219 | 3300021384 | Ga0213876_10005484 | Ga0213876_100054846 | 294 |
| 220 | 3300025302 | Ga0207426_1026337 | Ga0207426_10263372 | 294 |
| 221 | 3300025315 | Ga0207697_10000109 | Ga0207697_1000010910 | 294 |
| 222 | 3300025315 | Ga0207697_10013441 | Ga0207697_100134412 | 294 |
| 223 | 3300025321 | Ga0207656_10005154 | Ga0207656_100051542 | 294 |
| 224 | 3300025903 | Ga0207680_10001510 | Ga0207680_100015102 | 294 |
| 225 | 3300025903 | Ga0207680_10013148 | Ga0207680_100131482 | 294 |
| 226 | 3300025903 | Ga0207680_10116490 | Ga0207680_101164901 | 294 |
| 227 | 3300025904 | Ga0207647_10000446 | Ga0207647_1000044618 | 294 |
| 228 | 3300025904 | Ga0207647_10015410 | Ga0207647_100154103 | 294 |
| 229 | 3300025904 | Ga0207647_10051647 | Ga0207647_100516472 | 294 |
| 230 | 3300025907 | Ga0207645_10022319 | Ga0207645_100223193 | 294 |
| 231 | 3300025908 | Ga0207643_10022846 | Ga0207643_100228462 | 294 |
| 232 | 3300025909 | Ga0207705_10071722 | Ga0207705_100717222 | 294 |
| 233 | 3300025909 | Ga0207705_10294663 | Ga0207705_102946632 | 294 |
| 234 | 3300025912 | Ga0207707_10357865 | Ga0207707_103578652 | 294 |
| 235 | 3300025913 | Ga0207695_10193423 | Ga0207695_101934232 | 294 |
| 236 | 3300025918 | Ga0207662_10041631 | Ga0207662_100416312 | 294 |
| 237 | 3300025918 | Ga0207662_10075972 | Ga0207662_100759724 | 294 |
| 238 | 3300025919 | Ga0207657_10002553 | Ga0207657_1000255323 | 294 |
| 239 | 3300025919 | Ga0207657_10004781 | Ga0207657_1000478111 | 294 |
| 240 | 3300025919 | Ga0207657_10146230 | Ga0207657_101462302 | 294 |
| 241 | 3300025920 | Ga0207649_10034508 | Ga0207649_100345083 | 294 |
| 242 | 3300025920 | Ga0207649_10042330 | Ga0207649_100423302 | 294 |
| 243 | 3300025920 | Ga0207649_10046233 | Ga0207649_100462334 | 294 |
| 244 | 3300025923 | Ga0207681_10001626 | Ga0207681_1000162617 | 294 |
| 245 | 3300025923 | Ga0207681_10028973 | Ga0207681_100289733 | 294 |
| 246 | 3300025924 | Ga0207694_10048056 | Ga0207694_100480562 | 294 |
| 247 | 3300025925 | Ga0207650_10007235 | Ga0207650_100072355 | 294 |
| 248 | 3300025925 | Ga0207650_10056691 | Ga0207650_100566913 | 294 |
| 249 | 3300025927 | Ga0207687_10020101 | Ga0207687_100201012 | 294 |
| 250 | 3300025931 | Ga0207644_10001832 | Ga0207644_1000183210 | 294 |
| 251 | 3300025931 | Ga0207644_10014341 | Ga0207644_100143412 | 294 |
| 252 | 3300025931 | Ga0207644_10080205 | Ga0207644_100802053 | 294 |
| 253 | 3300025932 | Ga0207690_10063498 | Ga0207690_100634983 | 294 |
| 254 | 3300025933 | Ga0207706_10000300 | Ga0207706_1000030052 | 294 |
| 255 | 3300025933 | Ga0207706_10006908 | Ga0207706_100069085 | 294 |
| 256 | 3300025933 | Ga0207706_10081224 | Ga0207706_100812243 | 294 |
| 257 | 3300025937 | Ga0207669_10035517 | Ga0207669_100355174 | 294 |
| 258 | 3300025937 | Ga0207669_10041981 | Ga0207669_100419812 | 294 |
| 259 | 3300025937 | Ga0207669_10079239 | Ga0207669_100792392 | 294 |
| 260 | 3300025938 | Ga0207704_10048331 | Ga0207704_100483311 | 294 |
| 261 | 3300025938 | Ga0207704_10286816 | Ga0207704_102868162 | 294 |
| 262 | 3300025938 | Ga0207704_10294814 | Ga0207704_102948142 | 294 |
| 263 | 3300025940 | Ga0207691_10000294 | Ga0207691_1000029411 | 294 |
| 264 | 3300025940 | Ga0207691_10040577 | Ga0207691_100405772 | 294 |
| 265 | 3300025940 | Ga0207691_10051372 | Ga0207691_100513721 | 294 |
| 266 | 3300025940 | Ga0207691_10121346 | Ga0207691_101213462 | 294 |
| 267 | 3300025941 | Ga0207711_10003143 | Ga0207711_100031438 | 294 |
| 268 | 3300025941 | Ga0207711_10011392 | Ga0207711_100113924 | 294 |
| 269 | 3300025941 | Ga0207711_10126582 | Ga0207711_101265823 | 294 |
| 270 | 3300025942 | Ga0207689_10000064 | Ga0207689_1000006420 | 294 |
| 271 | 3300025942 | Ga0207689_10030619 | Ga0207689_100306192 | 294 |
| 272 | 3300025945 | Ga0207679_10016870 | Ga0207679_100168702 | 294 |
| 273 | 3300025945 | Ga0207679_10033341 | Ga0207679_100333412 | 294 |
| 274 | 3300025945 | Ga0207679_10049858 | Ga0207679_100498584 | 294 |
| 275 | 3300025945 | Ga0207679_10056602 | Ga0207679_100566023 | 294 |
| 276 | 3300025945 | Ga0207679_10121026 | Ga0207679_101210262 | 294 |
| 277 | 3300025949 | Ga0207667_10020043 | Ga0207667_100200437 | 294 |
| 278 | 3300025949 | Ga0207667_10340567 | Ga0207667_103405672 | 294 |
| 279 | 3300025960 | Ga0207651_10000355 | Ga0207651_1000035519 | 294 |
| 280 | 3300025960 | Ga0207651_10006669 | Ga0207651_100066695 | 294 |
| 281 | 3300025960 | Ga0207651_10039113 | Ga0207651_100391133 | 294 |
| 282 | 3300025960 | Ga0207651_10315291 | Ga0207651_103152912 | 294 |
| 283 | 3300025981 | Ga0207640_10001142 | Ga0207640_100011428 | 294 |
| 284 | 3300025981 | Ga0207640_10002525 | Ga0207640_100025252 | 294 |
| 285 | 3300025981 | Ga0207640_10011805 | Ga0207640_100118054 | 294 |
| 286 | 3300025981 | Ga0207640_10023138 | Ga0207640_100231382 | 294 |
| 287 | 3300025981 | Ga0207640_10115426 | Ga0207640_101154262 | 294 |
| 288 | 3300025981 | Ga0207640_10152945 | Ga0207640_101529452 | 294 |
| 289 | 3300025981 | Ga0207640_10275839 | Ga0207640_102758392 | 294 |
| 290 | 3300025986 | Ga0207658_10004936 | Ga0207658_100049362 | 294 |
| 291 | 3300025986 | Ga0207658_10007088 | Ga0207658_100070886 | 294 |
| 292 | 3300025986 | Ga0207658_10021107 | Ga0207658_100211071 | 294 |
| 293 | 3300026023 | Ga0207677_10006963 | Ga0207677_100069636 | 294 |
| 294 | 3300026023 | Ga0207677_10452899 | Ga0207677_104528991 | 294 |
| 295 | 3300026023 | Ga0207677_10475689 | Ga0207677_104756891 | 294 |
| 296 | 3300026035 | Ga0207703_10001455 | Ga0207703_1000145515 | 294 |
| 297 | 3300026035 | Ga0207703_10006195 | Ga0207703_100061956 | 294 |
| 298 | 3300026035 | Ga0207703_10008809 | Ga0207703_100088095 | 294 |
| 299 | 3300026035 | Ga0207703_10413948 | Ga0207703_104139482 | 294 |
| 300 | 3300026041 | Ga0207639_10006448 | Ga0207639_100064482 | 294 |
| 301 | 3300026067 | Ga0207678_10002415 | Ga0207678_100024159 | 294 |
| 302 | 3300026067 | Ga0207678_10003727 | Ga0207678_1000372711 | 294 |
| 303 | 3300026067 | Ga0207678_10004478 | Ga0207678_100044783 | 294 |
| 304 | 3300026067 | Ga0207678_10091554 | Ga0207678_100915544 | 294 |
| 305 | 3300026067 | Ga0207678_10117340 | Ga0207678_101173402 | 294 |
| 306 | 3300026067 | Ga0207678_10133243 | Ga0207678_101332432 | 294 |
| 307 | 3300026078 | Ga0207702_10013111 | Ga0207702_100131117 | 294 |
| 308 | 3300026078 | Ga0207702_10058372 | Ga0207702_100583722 | 294 |
| 309 | 3300026088 | Ga0207641_10016059 | Ga0207641_100160593 | 294 |
| 310 | 3300026088 | Ga0207641_10064470 | Ga0207641_100644704 | 294 |
| 311 | 3300026089 | Ga0207648_10001537 | Ga0207648_1000153729 | 294 |
| 312 | 3300026089 | Ga0207648_10008749 | Ga0207648_1000874912 | 294 |
| 313 | 3300026095 | Ga0207676_10004949 | Ga0207676_100049493 | 294 |
| 314 | 3300026116 | Ga0207674_10000814 | Ga0207674_1000081413 | 294 |
| 315 | 3300026116 | Ga0207674_10008433 | Ga0207674_100084334 | 294 |
| 316 | 3300026116 | Ga0207674_10021242 | Ga0207674_100212425 | 294 |
| 317 | 3300026116 | Ga0207674_10056963 | Ga0207674_100569632 | 294 |
| 318 | 3300026118 | Ga0207675_100119346 | Ga0207675_1001193462 | 294 |
| 319 | 3300026121 | Ga0207683_10020351 | Ga0207683_100203518 | 294 |
| 320 | 3300026142 | Ga0207698_10010153 | Ga0207698_100101533 | 294 |
| 321 | 3300026142 | Ga0207698_10012830 | Ga0207698_100128303 | 294 |
| 322 | 3300028379 | Ga0268266_10000318 | Ga0268266_1000031821 | 294 |
| 323 | 3300028379 | Ga0268266_10024360 | Ga0268266_100243602 | 294 |
| 324 | 3300028379 | Ga0268266_10088217 | Ga0268266_100882172 | 294 |
| 325 | 3300028379 | Ga0268266_10331890 | Ga0268266_103318902 | 294 |
| 326 | 3300028379 | Ga0268266_10652999 | Ga0268266_106529992 | 294 |
| 327 | 3300028380 | Ga0268265_10026131 | Ga0268265_100261313 | 294 |
| 328 | 3300028380 | Ga0268265_10256334 | Ga0268265_102563342 | 294 |
| 329 | 3300028381 | Ga0268264_10018939 | Ga0268264_100189394 | 294 |
| 330 | 3300028381 | Ga0268264_10429695 | Ga0268264_104296952 | 294 |
| 331 | 3300031548 | Ga0307408_100011716 | Ga0307408_1000117165 | 294 |
| 332 | 3300031901 | Ga0307406_10031864 | Ga0307406_100318642 | 294 |
| 333 | 3300035691 | Ga0373931_0028431 | Ga0373931_0028431_621_1535 | 294 |
| 334 | 3300037418 | Ga0395900_0002613 | Ga0395900_0002613_6589_7482 | 294 |
| 335 | 3300037418 | Ga0395900_0004765 | Ga0395900_0004765_10536_11450 | 294 |
| 336 | 3300037418 | Ga0395900_0033362 | Ga0395900_0033362_1875_2801 | 294 |
| 337 | 3300037418 | Ga0395900_0119069 | Ga0395900_0119069_1070_1957 | 294 |
| 338 | 3300037418 | Ga0395900_0317625 | Ga0395900_0317625_445_1338 | 294 |
| 339 | 3300037466 | Ga0395898_0006213 | Ga0395898_0006213_9035_9949 | 294 |
| 340 | 3300037466 | Ga0395898_0030071 | Ga0395898_0030071_3486_4379 | 294 |
| 341 | 3300037466 | Ga0395898_0124061 | Ga0395898_0124061_78_971 | 294 |
| 342 | 3300037471 | Ga0395905_0000688 | Ga0395905_0000688_25854_26747 | 294 |
| 343 | 3300037471 | Ga0395905_0014317 | Ga0395905_0014317_2836_3750 | 294 |
| 344 | 3300037471 | Ga0395905_0125168 | Ga0395905_0125168_1459_2352 | 294 |
| 345 | 3300037471 | Ga0395905_0140258 | Ga0395905_0140258_745_1632 | 294 |
| 346 | 3300037471 | Ga0395905_0175341 | Ga0395905_0175341_629_1525 | 294 |
| 347 | 3300037471 | Ga0395905_0344010 | Ga0395905_0344010_261_1154 | 294 |
| 348 | 3300038443 | Ga0395901_0058836 | Ga0395901_0058836_426_1319 | 294 |
| 349 | 3300038443 | Ga0395901_0071197 | Ga0395901_0071197_951_1877 | 294 |
| 350 | 3300038443 | Ga0395901_0074595 | Ga0395901_0074595_2546_3439 | 294 |
| 351 | 3300038443 | Ga0395901_0296589 | Ga0395901_0296589_15_908 | 294 |
| 352 | 3300039437 | Ga0436365_1268241 | Ga0436365_1268241_3065_3958 | 294 |
| 353 | 3300039450 | Ga0436363_1350835 | Ga0436363_1350835_804_1697 | 294 |
| 354 | 3300042005 | Ga0439448_0002886 | Ga0439448_0002886_3408_4334 | 294 |
| 355 | 3300046539 | Ga0495621_0003418 | Ga0495621_0003418_448_1338 | 294 |
| 356 | 3300048905 | Ga0496102_0359455 | Ga0496102_0359455_325_1218 | 294 |
| 357 | 3300048906 | Ga0496103_0172222 | Ga0496103_0172222_67_960 | 294 |
| 358 | 3300048910 | Ga0496107_0107019 | Ga0496107_0107019_943_1839 | 294 |
| 359 | 3300048911 | Ga0496108_0421565 | Ga0496108_0421565_28_912 | 294 |
| 360 | 3300048915 | Ga0496112_0078396 | Ga0496112_0078396_1686_2579 | 294 |
| 361 | 3300049571 | Ga0501034_0002878 | Ga0501034_0002878_17914_18825 | 294 |
| 362 | 3300049571 | Ga0501034_0004118 | Ga0501034_0004118_4979_5890 | 294 |
| 363 | 3300049584 | Ga0501068_0009942 | Ga0501068_0009942_1161_2072 | 294 |
| 364 | iso_pu_bacteria | 2599185354 | 2600203337 | 294 |
| 365 | iso_pu_bacteria | 2751185897 | 2753765860 | 294 |
| 366 | iso_pu_bacteria | 2993693658 | 2993693759 | 294 |
| 367 | 3300005367 | Ga0070667_100064562 | Ga0070667_1000645623 | 295 |
| 368 | 3300005841 | Ga0068863_100097556 | Ga0068863_1000975562 | 295 |
| 369 | 3300005843 | Ga0068860_100002325 | Ga0068860_10000232518 | 295 |
| 370 | 3300005844 | Ga0068862_100012603 | Ga0068862_1000126032 | 295 |
| 371 | 3300006852 | Ga0075433_10025955 | Ga0075433_100259555 | 295 |
| 372 | 3300009177 | Ga0105248_10031200 | Ga0105248_100312005 | 295 |
| 373 | 3300013308 | Ga0157375_10009852 | Ga0157375_100098523 | 295 |
| 374 | 3300021361 | Ga0213872_10000056 | Ga0213872_1000005681 | 295 |
| 375 | 3300025941 | Ga0207711_10103754 | Ga0207711_101037543 | 295 |
| 376 | 3300025986 | Ga0207658_10005047 | Ga0207658_1000504710 | 295 |
| 377 | 3300028380 | Ga0268265_10000789 | Ga0268265_1000078919 | 295 |
| 378 | 3300028381 | Ga0268264_10002322 | Ga0268264_1000232217 | 295 |
| 379 | 3300039447 | Ga0436361_0012467 | Ga0436361_0012467_109106_110161 | 295 |
| 380 | 3300049705 | Ga0501225_0005861 | Ga0501225_0005861_851_1738 | 295 |
| 381 | 3300050515 | nmdc:mga0a205_2308_c1 | nmdc:mga0a205_2308_c1_11175_12071 | 295 |
| 382 | 3300005290 | Ga0065712_10152329 | Ga0065712_101523291 | 296 |
| 383 | 3300005456 | Ga0070678_100409993 | Ga0070678_1004099932 | 296 |
| 384 | 3300005544 | Ga0070686_100000338 | Ga0070686_10000033830 | 296 |
| 385 | 3300005616 | Ga0068852_100565172 | Ga0068852_1005651722 | 296 |
| 386 | 3300006847 | Ga0075431_100175904 | Ga0075431_1001759042 | 296 |
| 387 | 3300009148 | Ga0105243_10060551 | Ga0105243_100605513 | 296 |
| 388 | 3300009177 | Ga0105248_10208305 | Ga0105248_102083052 | 296 |
| 389 | 3300014326 | Ga0157380_10022797 | Ga0157380_100227974 | 296 |
| 390 | 3300020082 | Ga0206353_11750927 | Ga0206353_117509272 | 296 |
| 391 | 3300021384 | Ga0213876_10003321 | Ga0213876_100033213 | 296 |
| 392 | 3300026121 | Ga0207683_10411685 | Ga0207683_104116852 | 296 |
| 393 | 3300028800 | Ga0265338_10053043 | Ga0265338_100530435 | 296 |
| 394 | 3300031548 | Ga0307408_100216729 | Ga0307408_1002167292 | 296 |
| 395 | 3300031824 | Ga0307413_10173023 | Ga0307413_101730232 | 296 |
| 396 | 3300031852 | Ga0307410_10001711 | Ga0307410_100017114 | 296 |
| 397 | 3300031995 | Ga0307409_100529843 | Ga0307409_1005298432 | 296 |
| 398 | 3300032002 | Ga0307416_100025055 | Ga0307416_1000250552 | 296 |
| 399 | 3300032002 | Ga0307416_100206292 | Ga0307416_1002062923 | 296 |
| 400 | 3300032005 | Ga0307411_10055208 | Ga0307411_100552082 | 296 |
| 401 | 3300032126 | Ga0307415_100390762 | Ga0307415_1003907622 | 296 |
| 402 | 3300039437 | Ga0436365_0695503 | Ga0436365_0695503_9007_9897 | 296 |
| 403 | 3300046525 | Ga0495663_0008361 | Ga0495663_0008361_1599_2489 | 296 |
| 404 | 3300046525 | Ga0495663_0077844 | Ga0495663_0077844_78_968 | 296 |
| 405 | 3300046539 | Ga0495621_0000168 | Ga0495621_0000168_10797_11687 | 296 |
| 406 | 3300046539 | Ga0495621_0013025 | Ga0495621_0013025_790_1680 | 296 |
| 407 | 3300046558 | Ga0495633_0107886 | Ga0495633_0107886_179_1069 | 296 |
| 408 | 3300046664 | Ga0495659_0010446 | Ga0495659_0010446_997_1887 | 296 |
| 409 | 3300046684 | Ga0495669_0020183 | Ga0495669_0020183_686_1576 | 296 |
| 410 | 3300049661 | Ga0501217_013236 | Ga0501217_013236_869_1759 | 296 |
| 411 | 3300049705 | Ga0501225_0007744 | Ga0501225_0007744_1919_2809 | 296 |
| 412 | 3300049767 | Ga0501270_000579 | Ga0501270_000579_2129_3019 | 296 |
| 413 | 3300050510 | nmdc:mga06r32_8778_c1 | nmdc:mga06r32_8778_c1_574_1464 | 296 |
| 414 | 3300053094 | Ga0500566_0184295 | Ga0500566_0184295_130_1020 | 296 |
| 415 | 3300053730 | Ga0500645_001222 | Ga0500645_001222_8584_9474 | 296 |
| 416 | 3300001979 | JGI24740J21852_10066055 | JGI24740J21852_100660551 | 297 |
| 417 | 3300001989 | JGI24739J22299_10004008 | JGI24739J22299_100040084 | 297 |
| 418 | 3300001990 | JGI24737J22298_10001195 | JGI24737J22298_100011958 | 297 |
| 419 | 3300002067 | JGI24735J21928_10008752 | JGI24735J21928_100087523 | 297 |
| 420 | 3300002067 | JGI24735J21928_10015899 | JGI24735J21928_100158993 | 297 |
| 421 | 3300002067 | JGI24735J21928_10016482 | JGI24735J21928_100164823 | 297 |
| 422 | 3300002067 | JGI24735J21928_10027960 | JGI24735J21928_100279602 | 297 |
| 423 | 3300002067 | JGI24735J21928_10039234 | JGI24735J21928_100392342 | 297 |
| 424 | 3300002067 | JGI24735J21928_10059668 | JGI24735J21928_100596681 | 297 |
| 425 | 3300002075 | JGI24738J21930_10005507 | JGI24738J21930_100055073 | 297 |
| 426 | 3300002244 | JGI24742J22300_10006052 | JGI24742J22300_100060521 | 297 |
| 427 | 3300002244 | JGI24742J22300_10031262 | JGI24742J22300_100312621 | 297 |
| 428 | 3300003214 | JGI25165J46597_1000165 | JGI25165J46597_100016537 | 297 |
| 429 | 3300003215 | JGI25153J46596_10000007 | JGI25153J46596_10000007141 | 297 |
| 430 | 3300003794 | Ga0055531_10025182 | Ga0055531_100251823 | 297 |
| 431 | 3300003911 | JGI25405J52794_10007653 | JGI25405J52794_100076532 | 297 |
| 432 | 3300005289 | Ga0065704_10208631 | Ga0065704_102086311 | 297 |
| 433 | 3300005295 | Ga0065707_10082626 | Ga0065707_100826265 | 297 |
| 434 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001708 | 297 |
| 435 | 3300005327 | Ga0070658_10000062 | Ga0070658_1000006275 | 297 |
| 436 | 3300005327 | Ga0070658_10000612 | Ga0070658_1000061213 | 297 |
| 437 | 3300005327 | Ga0070658_10000691 | Ga0070658_1000069114 | 297 |
| 438 | 3300005327 | Ga0070658_10008207 | Ga0070658_1000820711 | 297 |
| 439 | 3300005327 | Ga0070658_10092146 | Ga0070658_100921463 | 297 |
| 440 | 3300005328 | Ga0070676_10000999 | Ga0070676_1000099911 | 297 |
| 441 | 3300005329 | Ga0070683_100365320 | Ga0070683_1003653202 | 297 |
| 442 | 3300005333 | Ga0070677_10000059 | Ga0070677_100000598 | 297 |
| 443 | 3300005334 | Ga0068869_100000225 | Ga0068869_10000022526 | 297 |
| 444 | 3300005336 | Ga0070680_100000295 | Ga0070680_10000029534 | 297 |
| 445 | 3300005338 | Ga0068868_100000007 | Ga0068868_10000000769 | 297 |
| 446 | 3300005338 | Ga0068868_100000013 | Ga0068868_10000001333 | 297 |
| 447 | 3300005339 | Ga0070660_100000377 | Ga0070660_10000037726 | 297 |
| 448 | 3300005339 | Ga0070660_100001392 | Ga0070660_10000139216 | 297 |
| 449 | 3300005339 | Ga0070660_100002789 | Ga0070660_10000278914 | 297 |
| 450 | 3300005339 | Ga0070660_100004887 | Ga0070660_1000048876 | 297 |
| 451 | 3300005339 | Ga0070660_100017709 | Ga0070660_1000177095 | 297 |
| 452 | 3300005341 | Ga0070691_10002318 | Ga0070691_100023183 | 297 |
| 453 | 3300005347 | Ga0070668_100011115 | Ga0070668_1000111156 | 297 |
| 454 | 3300005353 | Ga0070669_100384601 | Ga0070669_1003846012 | 297 |
| 455 | 3300005353 | Ga0070669_100425099 | Ga0070669_1004250991 | 297 |
| 456 | 3300005355 | Ga0070671_100048588 | Ga0070671_1000485882 | 297 |
| 457 | 3300005356 | Ga0070674_100005285 | Ga0070674_1000052854 | 297 |
| 458 | 3300005356 | Ga0070674_100007950 | Ga0070674_1000079506 | 297 |
| 459 | 3300005356 | Ga0070674_100014858 | Ga0070674_1000148584 | 297 |
| 460 | 3300005364 | Ga0070673_100000002 | Ga0070673_100000002165 | 297 |
| 461 | 3300005364 | Ga0070673_100007485 | Ga0070673_1000074856 | 297 |
| 462 | 3300005366 | Ga0070659_100000004 | Ga0070659_100000004172 | 297 |
| 463 | 3300005366 | Ga0070659_100003359 | Ga0070659_1000033593 | 297 |
| 464 | 3300005366 | Ga0070659_100009411 | Ga0070659_1000094113 | 297 |
| 465 | 3300005366 | Ga0070659_100011569 | Ga0070659_1000115694 | 297 |
| 466 | 3300005366 | Ga0070659_100040630 | Ga0070659_1000406304 | 297 |
| 467 | 3300005366 | Ga0070659_100115687 | Ga0070659_1001156872 | 297 |
| 468 | 3300005436 | Ga0070713_100103909 | Ga0070713_1001039092 | 297 |
| 469 | 3300005445 | Ga0070708_100327768 | Ga0070708_1003277682 | 297 |
| 470 | 3300005455 | Ga0070663_100036161 | Ga0070663_1000361615 | 297 |
| 471 | 3300005456 | Ga0070678_100000055 | Ga0070678_10000005519 | 297 |
| 472 | 3300005458 | Ga0070681_10006314 | Ga0070681_1000631413 | 297 |
| 473 | 3300005458 | Ga0070681_10010156 | Ga0070681_100101563 | 297 |
| 474 | 3300005458 | Ga0070681_10063724 | Ga0070681_100637242 | 297 |
| 475 | 3300005459 | Ga0068867_100000012 | Ga0068867_10000001249 | 297 |
| 476 | 3300005459 | Ga0068867_100013901 | Ga0068867_1000139014 | 297 |
| 477 | 3300005467 | Ga0070706_100022961 | Ga0070706_1000229615 | 297 |
| 478 | 3300005471 | Ga0070698_100005702 | Ga0070698_1000057027 | 297 |
| 479 | 3300005530 | Ga0070679_100000017 | Ga0070679_100000017107 | 297 |
| 480 | 3300005530 | Ga0070679_100033401 | Ga0070679_1000334015 | 297 |
| 481 | 3300005530 | Ga0070679_100260778 | Ga0070679_1002607781 | 297 |
| 482 | 3300005539 | Ga0068853_100007016 | Ga0068853_1000070166 | 297 |
| 483 | 3300005539 | Ga0068853_100008695 | Ga0068853_1000086953 | 297 |
| 484 | 3300005539 | Ga0068853_100288759 | Ga0068853_1002887592 | 297 |
| 485 | 3300005539 | Ga0068853_100494545 | Ga0068853_1004945451 | 297 |
| 486 | 3300005548 | Ga0070665_100000495 | Ga0070665_10000049515 | 297 |
| 487 | 3300005548 | Ga0070665_100004318 | Ga0070665_10000431813 | 297 |
| 488 | 3300005563 | Ga0068855_100000095 | Ga0068855_10000009525 | 297 |
| 489 | 3300005563 | Ga0068855_100001110 | Ga0068855_10000111030 | 297 |
| 490 | 3300005563 | Ga0068855_100012722 | Ga0068855_1000127223 | 297 |
| 491 | 3300005563 | Ga0068855_100053334 | Ga0068855_1000533343 | 297 |
| 492 | 3300005563 | Ga0068855_100066469 | Ga0068855_1000664693 | 297 |
| 493 | 3300005577 | Ga0068857_100012795 | Ga0068857_1000127955 | 297 |
| 494 | 3300005577 | Ga0068857_100048509 | Ga0068857_1000485094 | 297 |
| 495 | 3300005577 | Ga0068857_100168788 | Ga0068857_1001687882 | 297 |
| 496 | 3300005578 | Ga0068854_100000265 | Ga0068854_10000026537 | 297 |
| 497 | 3300005578 | Ga0068854_100004418 | Ga0068854_1000044186 | 297 |
| 498 | 3300005578 | Ga0068854_100113994 | Ga0068854_1001139942 | 297 |
| 499 | 3300005616 | Ga0068852_100004651 | Ga0068852_1000046514 | 297 |
| 500 | 3300005616 | Ga0068852_100431322 | Ga0068852_1004313222 | 297 |
| 501 | 3300005841 | Ga0068863_100010310 | Ga0068863_1000103106 | 297 |
| 502 | 3300005842 | Ga0068858_100274295 | Ga0068858_1002742952 | 297 |
| 503 | 3300005843 | Ga0068860_100040396 | Ga0068860_1000403964 | 297 |
| 504 | 3300005937 | Ga0081455_10000395 | Ga0081455_1000039511 | 297 |
| 505 | 3300005937 | Ga0081455_10001457 | Ga0081455_1000145719 | 297 |
| 506 | 3300005937 | Ga0081455_10002932 | Ga0081455_100029322 | 297 |
| 507 | 3300005985 | Ga0081539_10001300 | Ga0081539_100013005 | 297 |
| 508 | 3300005985 | Ga0081539_10015064 | Ga0081539_100150643 | 297 |
| 509 | 3300005985 | Ga0081539_10064432 | Ga0081539_100644323 | 297 |
| 510 | 3300006177 | Ga0075362_10026145 | Ga0075362_100261452 | 297 |
| 511 | 3300006177 | Ga0075362_10048194 | Ga0075362_100481942 | 297 |
| 512 | 3300006178 | Ga0075367_10049571 | Ga0075367_100495713 | 297 |
| 513 | 3300006186 | Ga0075369_10000420 | Ga0075369_1000042010 | 297 |
| 514 | 3300006186 | Ga0075369_10017179 | Ga0075369_100171792 | 297 |
| 515 | 3300006237 | Ga0097621_100014631 | Ga0097621_1000146312 | 297 |
| 516 | 3300006237 | Ga0097621_100168773 | Ga0097621_1001687732 | 297 |
| 517 | 3300006871 | Ga0075434_100057873 | Ga0075434_1000578733 | 297 |
| 518 | 3300006881 | Ga0068865_100000004 | Ga0068865_100000004165 | 297 |
| 519 | 3300006914 | Ga0075436_100181547 | Ga0075436_1001815471 | 297 |
| 520 | 3300009093 | Ga0105240_10018988 | Ga0105240_100189882 | 297 |
| 521 | 3300009093 | Ga0105240_10104302 | Ga0105240_101043022 | 297 |
| 522 | 3300009094 | Ga0111539_10181217 | Ga0111539_101812173 | 297 |
| 523 | 3300009098 | Ga0105245_10000195 | Ga0105245_1000019562 | 297 |
| 524 | 3300009098 | Ga0105245_10000620 | Ga0105245_1000062029 | 297 |
| 525 | 3300009098 | Ga0105245_10319433 | Ga0105245_103194332 | 297 |
| 526 | 3300009148 | Ga0105243_10000146 | Ga0105243_1000014646 | 297 |
| 527 | 3300009148 | Ga0105243_10000227 | Ga0105243_1000022723 | 297 |
| 528 | 3300009176 | Ga0105242_10007987 | Ga0105242_100079873 | 297 |
| 529 | 3300009177 | Ga0105248_10080171 | Ga0105248_100801717 | 297 |
| 530 | 3300009551 | Ga0105238_10030863 | Ga0105238_100308634 | 297 |
| 531 | 3300009551 | Ga0105238_10032552 | Ga0105238_100325523 | 297 |
| 532 | 3300009551 | Ga0105238_10107856 | Ga0105238_101078562 | 297 |
| 533 | 3300010375 | Ga0105239_10229587 | Ga0105239_102295872 | 297 |
| 534 | 3300010375 | Ga0105239_10479106 | Ga0105239_104791062 | 297 |
| 535 | 3300010375 | Ga0105239_10653171 | Ga0105239_106531711 | 297 |
| 536 | 3300011119 | Ga0105246_10002081 | Ga0105246_100020815 | 297 |
| 537 | 3300011119 | Ga0105246_10340701 | Ga0105246_103407012 | 297 |
| 538 | 3300013100 | Ga0157373_10017492 | Ga0157373_100174923 | 297 |
| 539 | 3300013102 | Ga0157371_10032088 | Ga0157371_100320884 | 297 |
| 540 | 3300013104 | Ga0157370_10002033 | Ga0157370_100020336 | 297 |
| 541 | 3300013104 | Ga0157370_10006332 | Ga0157370_100063324 | 297 |
| 542 | 3300013105 | Ga0157369_10189836 | Ga0157369_101898362 | 297 |
| 543 | 3300013296 | Ga0157374_10001738 | Ga0157374_1000173821 | 297 |
| 544 | 3300013297 | Ga0157378_10000408 | Ga0157378_100004085 | 297 |
| 545 | 3300013297 | Ga0157378_10131186 | Ga0157378_101311863 | 297 |
| 546 | 3300013306 | Ga0163162_10177052 | Ga0163162_101770521 | 297 |
| 547 | 3300013307 | Ga0157372_10406797 | Ga0157372_104067972 | 297 |
| 548 | 3300013308 | Ga0157375_10007814 | Ga0157375_1000781411 | 297 |
| 549 | 3300014326 | Ga0157380_10030260 | Ga0157380_100302602 | 297 |
| 550 | 3300014326 | Ga0157380_10185993 | Ga0157380_101859931 | 297 |
| 551 | 3300014745 | Ga0157377_10048205 | Ga0157377_100482052 | 297 |
| 552 | 3300014969 | Ga0157376_10000131 | Ga0157376_1000013111 | 297 |
| 553 | 3300020070 | Ga0206356_11001459 | Ga0206356_110014593 | 297 |
| 554 | 3300021358 | Ga0213873_10000027 | Ga0213873_1000002779 | 297 |
| 555 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004394 | 297 |
| 556 | 3300021384 | Ga0213876_10000873 | Ga0213876_1000087319 | 297 |
| 557 | 3300021384 | Ga0213876_10070156 | Ga0213876_100701562 | 297 |
| 558 | 3300021384 | Ga0213876_10083380 | Ga0213876_100833802 | 297 |
| 559 | 3300021441 | Ga0213871_10000912 | Ga0213871_100009124 | 297 |
| 560 | 3300025233 | Ga0209437_105644 | Ga0209437_1056443 | 297 |
| 561 | 3300025254 | Ga0209148_1000074 | Ga0209148_1000074241 | 297 |
| 562 | 3300025261 | Ga0209233_1000164 | Ga0209233_100016440 | 297 |
| 563 | 3300025272 | Ga0209455_1000767 | Ga0209455_100076725 | 297 |
| 564 | 3300025292 | Ga0209676_1000276 | Ga0209676_100027652 | 297 |
| 565 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017142 | 297 |
| 566 | 3300025304 | Ga0209257_1000695 | Ga0209257_100069540 | 297 |
| 567 | 3300025893 | Ga0207682_10001908 | Ga0207682_100019084 | 297 |
| 568 | 3300025901 | Ga0207688_10147536 | Ga0207688_101475362 | 297 |
| 569 | 3300025904 | Ga0207647_10001428 | Ga0207647_100014282 | 297 |
| 570 | 3300025904 | Ga0207647_10001494 | Ga0207647_100014947 | 297 |
| 571 | 3300025904 | Ga0207647_10007151 | Ga0207647_100071515 | 297 |
| 572 | 3300025904 | Ga0207647_10037408 | Ga0207647_100374081 | 297 |
| 573 | 3300025907 | Ga0207645_10002620 | Ga0207645_100026205 | 297 |
| 574 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021174 | 297 |
| 575 | 3300025909 | Ga0207705_10000055 | Ga0207705_10000055114 | 297 |
| 576 | 3300025909 | Ga0207705_10000179 | Ga0207705_1000017940 | 297 |
| 577 | 3300025909 | Ga0207705_10006076 | Ga0207705_100060765 | 297 |
| 578 | 3300025909 | Ga0207705_10023934 | Ga0207705_100239342 | 297 |
| 579 | 3300025912 | Ga0207707_10010908 | Ga0207707_100109083 | 297 |
| 580 | 3300025912 | Ga0207707_10020730 | Ga0207707_100207303 | 297 |
| 581 | 3300025913 | Ga0207695_10011332 | Ga0207695_100113327 | 297 |
| 582 | 3300025913 | Ga0207695_10063852 | Ga0207695_100638522 | 297 |
| 583 | 3300025917 | Ga0207660_10000048 | Ga0207660_1000004834 | 297 |
| 584 | 3300025917 | Ga0207660_10004472 | Ga0207660_100044729 | 297 |
| 585 | 3300025917 | Ga0207660_10102214 | Ga0207660_101022143 | 297 |
| 586 | 3300025919 | Ga0207657_10000791 | Ga0207657_1000079125 | 297 |
| 587 | 3300025919 | Ga0207657_10005726 | Ga0207657_1000572613 | 297 |
| 588 | 3300025919 | Ga0207657_10008671 | Ga0207657_100086714 | 297 |
| 589 | 3300025919 | Ga0207657_10008888 | Ga0207657_1000888814 | 297 |
| 590 | 3300025919 | Ga0207657_10013847 | Ga0207657_100138472 | 297 |
| 591 | 3300025919 | Ga0207657_10020682 | Ga0207657_100206824 | 297 |
| 592 | 3300025919 | Ga0207657_10065903 | Ga0207657_100659033 | 297 |
| 593 | 3300025920 | Ga0207649_10096375 | Ga0207649_100963752 | 297 |
| 594 | 3300025921 | Ga0207652_10000001 | Ga0207652_10000001957 | 297 |
| 595 | 3300025921 | Ga0207652_10009263 | Ga0207652_100092639 | 297 |
| 596 | 3300025921 | Ga0207652_10391557 | Ga0207652_103915572 | 297 |
| 597 | 3300025922 | Ga0207646_10046302 | Ga0207646_100463022 | 297 |
| 598 | 3300025924 | Ga0207694_10018991 | Ga0207694_100189916 | 297 |
| 599 | 3300025924 | Ga0207694_10034835 | Ga0207694_100348352 | 297 |
| 600 | 3300025925 | Ga0207650_10191833 | Ga0207650_101918332 | 297 |
| 601 | 3300025925 | Ga0207650_10286751 | Ga0207650_102867512 | 297 |
| 602 | 3300025926 | Ga0207659_10024872 | Ga0207659_100248724 | 297 |
| 603 | 3300025926 | Ga0207659_10108461 | Ga0207659_101084612 | 297 |
| 604 | 3300025926 | Ga0207659_10270936 | Ga0207659_102709361 | 297 |
| 605 | 3300025927 | Ga0207687_10002087 | Ga0207687_1000208714 | 297 |
| 606 | 3300025927 | Ga0207687_10011298 | Ga0207687_100112984 | 297 |
| 607 | 3300025927 | Ga0207687_10149302 | Ga0207687_101493023 | 297 |
| 608 | 3300025931 | Ga0207644_10041358 | Ga0207644_100413582 | 297 |
| 609 | 3300025932 | Ga0207690_10000001 | Ga0207690_10000001413 | 297 |
| 610 | 3300025932 | Ga0207690_10000002 | Ga0207690_10000002413 | 297 |
| 611 | 3300025932 | Ga0207690_10000003 | Ga0207690_10000003413 | 297 |
| 612 | 3300025932 | Ga0207690_10000004 | Ga0207690_10000004413 | 297 |
| 613 | 3300025932 | Ga0207690_10007315 | Ga0207690_100073154 | 297 |
| 614 | 3300025932 | Ga0207690_10009895 | Ga0207690_100098953 | 297 |
| 615 | 3300025932 | Ga0207690_10102030 | Ga0207690_101020302 | 297 |
| 616 | 3300025932 | Ga0207690_10177260 | Ga0207690_101772601 | 297 |
| 617 | 3300025933 | Ga0207706_10011966 | Ga0207706_100119661 | 297 |
| 618 | 3300025933 | Ga0207706_10027233 | Ga0207706_100272333 | 297 |
| 619 | 3300025933 | Ga0207706_10045683 | Ga0207706_100456834 | 297 |
| 620 | 3300025934 | Ga0207686_10000999 | Ga0207686_100009992 | 297 |
| 621 | 3300025935 | Ga0207709_10000093 | Ga0207709_1000009360 | 297 |
| 622 | 3300025935 | Ga0207709_10000314 | Ga0207709_1000031433 | 297 |
| 623 | 3300025935 | Ga0207709_10204658 | Ga0207709_102046582 | 297 |
| 624 | 3300025937 | Ga0207669_10000086 | Ga0207669_1000008617 | 297 |
| 625 | 3300025937 | Ga0207669_10001266 | Ga0207669_100012662 | 297 |
| 626 | 3300025937 | Ga0207669_10020553 | Ga0207669_100205533 | 297 |
| 627 | 3300025937 | Ga0207669_10160698 | Ga0207669_101606982 | 297 |
| 628 | 3300025938 | Ga0207704_10000005 | Ga0207704_1000000547 | 297 |
| 629 | 3300025940 | Ga0207691_10025393 | Ga0207691_100253933 | 297 |
| 630 | 3300025940 | Ga0207691_10129700 | Ga0207691_101297003 | 297 |
| 631 | 3300025942 | Ga0207689_10000043 | Ga0207689_1000004311 | 297 |
| 632 | 3300025949 | Ga0207667_10000016 | Ga0207667_10000016259 | 297 |
| 633 | 3300025949 | Ga0207667_10002740 | Ga0207667_1000274015 | 297 |
| 634 | 3300025949 | Ga0207667_10151404 | Ga0207667_101514043 | 297 |
| 635 | 3300025960 | Ga0207651_10000007 | Ga0207651_1000000747 | 297 |
| 636 | 3300025960 | Ga0207651_10008089 | Ga0207651_100080893 | 297 |
| 637 | 3300025972 | Ga0207668_10000632 | Ga0207668_100006325 | 297 |
| 638 | 3300025972 | Ga0207668_10193417 | Ga0207668_101934172 | 297 |
| 639 | 3300025981 | Ga0207640_10000139 | Ga0207640_1000013932 | 297 |
| 640 | 3300025981 | Ga0207640_10179802 | Ga0207640_101798022 | 297 |
| 641 | 3300026023 | Ga0207677_10000014 | Ga0207677_10000014163 | 297 |
| 642 | 3300026023 | Ga0207677_10000085 | Ga0207677_1000008536 | 297 |
| 643 | 3300026035 | Ga0207703_10000142 | Ga0207703_1000014228 | 297 |
| 644 | 3300026035 | Ga0207703_10351393 | Ga0207703_103513932 | 297 |
| 645 | 3300026041 | Ga0207639_10003835 | Ga0207639_100038358 | 297 |
| 646 | 3300026041 | Ga0207639_10006063 | Ga0207639_100060636 | 297 |
| 647 | 3300026041 | Ga0207639_10160692 | Ga0207639_101606921 | 297 |
| 648 | 3300026041 | Ga0207639_10222570 | Ga0207639_102225702 | 297 |
| 649 | 3300026041 | Ga0207639_10457969 | Ga0207639_104579692 | 297 |
| 650 | 3300026067 | Ga0207678_10000972 | Ga0207678_1000097223 | 297 |
| 651 | 3300026078 | Ga0207702_10400581 | Ga0207702_104005812 | 297 |
| 652 | 3300026088 | Ga0207641_10013104 | Ga0207641_100131044 | 297 |
| 653 | 3300026088 | Ga0207641_10431942 | Ga0207641_104319422 | 297 |
| 654 | 3300026089 | Ga0207648_10000005 | Ga0207648_1000000548 | 297 |
| 655 | 3300026089 | Ga0207648_10014658 | Ga0207648_100146585 | 297 |
| 656 | 3300026116 | Ga0207674_10015150 | Ga0207674_100151504 | 297 |
| 657 | 3300026116 | Ga0207674_10083489 | Ga0207674_100834894 | 297 |
| 658 | 3300026121 | Ga0207683_10000181 | Ga0207683_1000018136 | 297 |
| 659 | 3300026121 | Ga0207683_10192584 | Ga0207683_101925842 | 297 |
| 660 | 3300026142 | Ga0207698_10092206 | Ga0207698_100922063 | 297 |
| 661 | 3300027364 | Ga0209967_1009977 | Ga0209967_10099771 | 297 |
| 662 | 3300027876 | Ga0209974_10014975 | Ga0209974_100149753 | 297 |
| 663 | 3300028379 | Ga0268266_10003762 | Ga0268266_100037627 | 297 |
| 664 | 3300028379 | Ga0268266_10006216 | Ga0268266_100062167 | 297 |
| 665 | 3300028381 | Ga0268264_10042335 | Ga0268264_100423353 | 297 |
| 666 | 3300028786 | Ga0307517_10009945 | Ga0307517_100099456 | 297 |
| 667 | 3300028786 | Ga0307517_10011892 | Ga0307517_100118927 | 297 |
| 668 | 3300031247 | Ga0265340_10015248 | Ga0265340_100152484 | 297 |
| 669 | 3300031548 | Ga0307408_100059266 | Ga0307408_1000592664 | 297 |
| 670 | 3300031616 | Ga0307508_10002203 | Ga0307508_1000220320 | 297 |
| 671 | 3300031731 | Ga0307405_10045849 | Ga0307405_100458493 | 297 |
| 672 | 3300031731 | Ga0307405_10126124 | Ga0307405_101261242 | 297 |
| 673 | 3300031824 | Ga0307413_10010607 | Ga0307413_100106076 | 297 |
| 674 | 3300031824 | Ga0307413_10080578 | Ga0307413_100805781 | 297 |
| 675 | 3300031824 | Ga0307413_10153354 | Ga0307413_101533542 | 297 |
| 676 | 3300031901 | Ga0307406_10028909 | Ga0307406_100289094 | 297 |
| 677 | 3300031901 | Ga0307406_10110373 | Ga0307406_101103732 | 297 |
| 678 | 3300031901 | Ga0307406_10213899 | Ga0307406_102138992 | 297 |
| 679 | 3300031903 | Ga0307407_10042853 | Ga0307407_100428534 | 297 |
| 680 | 3300031911 | Ga0307412_10042238 | Ga0307412_100422383 | 297 |
| 681 | 3300031911 | Ga0307412_10166831 | Ga0307412_101668311 | 297 |
| 682 | 3300031911 | Ga0307412_10210810 | Ga0307412_102108101 | 297 |
| 683 | 3300031911 | Ga0307412_10306474 | Ga0307412_103064741 | 297 |
| 684 | 3300031911 | Ga0307412_10311991 | Ga0307412_103119912 | 297 |
| 685 | 3300031995 | Ga0307409_100003478 | Ga0307409_1000034784 | 297 |
| 686 | 3300031995 | Ga0307409_100016750 | Ga0307409_1000167502 | 297 |
| 687 | 3300032002 | Ga0307416_100146606 | Ga0307416_1001466062 | 297 |
| 688 | 3300032004 | Ga0307414_10002151 | Ga0307414_100021512 | 297 |
| 689 | 3300032004 | Ga0307414_10014045 | Ga0307414_100140454 | 297 |
| 690 | 3300032004 | Ga0307414_10038104 | Ga0307414_100381044 | 297 |
| 691 | 3300032004 | Ga0307414_10048367 | Ga0307414_100483672 | 297 |
| 692 | 3300032004 | Ga0307414_10085270 | Ga0307414_100852701 | 297 |
| 693 | 3300032004 | Ga0307414_10122390 | Ga0307414_101223902 | 297 |
| 694 | 3300032004 | Ga0307414_10269530 | Ga0307414_102695302 | 297 |
| 695 | 3300032005 | Ga0307411_10049862 | Ga0307411_100498623 | 297 |
| 696 | 3300032005 | Ga0307411_10217865 | Ga0307411_102178652 | 297 |
| 697 | 3300032005 | Ga0307411_10229289 | Ga0307411_102292892 | 297 |
| 698 | 3300032005 | Ga0307411_10504986 | Ga0307411_105049861 | 297 |
| 699 | 3300032126 | Ga0307415_100087862 | Ga0307415_1000878622 | 297 |
| 700 | 3300033180 | Ga0307510_10066196 | Ga0307510_100661962 | 297 |
| 701 | 3300037312 | Ga0395899_0128664 | Ga0395899_0128664_784_1677 | 297 |
| 702 | 3300037418 | Ga0395900_0002008 | Ga0395900_0002008_9481_10374 | 297 |
| 703 | 3300037418 | Ga0395900_0047992 | Ga0395900_0047992_2669_3589 | 297 |
| 704 | 3300037466 | Ga0395898_0024226 | Ga0395898_0024226_1398_2318 | 297 |
| 705 | 3300037471 | Ga0395905_0000218 | Ga0395905_0000218_3780_4673 | 297 |
| 706 | 3300037471 | Ga0395905_0017192 | Ga0395905_0017192_944_1846 | 297 |
| 707 | 3300038443 | Ga0395901_0002884 | Ga0395901_0002884_2413_3306 | 297 |
| 708 | 3300038443 | Ga0395901_0019988 | Ga0395901_0019988_936_1856 | 297 |
| 709 | 3300039437 | Ga0436365_0122535 | Ga0436365_0122535_688_1638 | 297 |
| 710 | 3300039437 | Ga0436365_0758923 | Ga0436365_0758923_371_1264 | 297 |
| 711 | 3300039437 | Ga0436365_1205090 | Ga0436365_1205090_30776_31669 | 297 |
| 712 | 3300039438 | Ga0436360_0428998 | Ga0436360_0428998_4930_5850 | 297 |
| 713 | 3300039447 | Ga0436361_0692291 | Ga0436361_0692291_5546_6466 | 297 |
| 714 | 3300039453 | Ga0436362_0251358 | Ga0436362_0251358_143_1036 | 297 |
| 715 | 3300041512 | Ga0451853_2025836 | Ga0451853_2025836_277_1170 | 297 |
| 716 | 3300042157 | Ga0439458_0001639 | Ga0439458_0001639_1433_2326 | 297 |
| 717 | 3300044658 | Ga0466972_0002157 | Ga0466972_0002157_5280_6173 | 297 |
| 718 | 3300044693 | Ga0466961_0034126 | Ga0466961_0034126_1025_1918 | 297 |
| 719 | 3300044694 | Ga0466963_0010040 | Ga0466963_0010040_3031_3924 | 297 |
| 720 | 3300044719 | Ga0466971_0060519 | Ga0466971_0060519_79_972 | 297 |
| 721 | 3300044735 | Ga0466968_0068784 | Ga0466968_0068784_229_1122 | 297 |
| 722 | 3300044765 | Ga0466970_0004756 | Ga0466970_0004756_4435_5328 | 297 |
| 723 | 3300044842 | Ga0466957_0007537 | Ga0466957_0007537_3825_4718 | 297 |
| 724 | 3300044842 | Ga0466957_0047567 | Ga0466957_0047567_1070_1963 | 297 |
| 725 | 3300045049 | Ga0466959_0097360 | Ga0466959_0097360_812_1705 | 297 |
| 726 | 3300045836 | Ga0466958_0004137 | Ga0466958_0004137_3068_3961 | 297 |
| 727 | 3300045836 | Ga0466958_0020218 | Ga0466958_0020218_189_1082 | 297 |
| 728 | 3300045976 | Ga0466967_0015827 | Ga0466967_0015827_3205_4098 | 297 |
| 729 | 3300046460 | Ga0495638_0000249 | Ga0495638_0000249_6732_7625 | 297 |
| 730 | 3300046460 | Ga0495638_0000266 | Ga0495638_0000266_56409_57305 | 297 |
| 731 | 3300046471 | Ga0495650_0000367 | Ga0495650_0000367_4044_4937 | 297 |
| 732 | 3300046471 | Ga0495650_0040743 | Ga0495650_0040743_639_1532 | 297 |
| 733 | 3300046492 | Ga0495585_0001411 | Ga0495585_0001411_12841_13734 | 297 |
| 734 | 3300046492 | Ga0495585_0043957 | Ga0495585_0043957_492_1394 | 297 |
| 735 | 3300046500 | Ga0495596_0004692 | Ga0495596_0004692_4818_5711 | 297 |
| 736 | 3300046506 | Ga0495583_0000175 | Ga0495583_0000175_52737_53630 | 297 |
| 737 | 3300046506 | Ga0495583_0000262 | Ga0495583_0000262_73439_74332 | 297 |
| 738 | 3300046506 | Ga0495583_0000879 | Ga0495583_0000879_11750_12643 | 297 |
| 739 | 3300046506 | Ga0495583_0004900 | Ga0495583_0004900_869_1762 | 297 |
| 740 | 3300046507 | Ga0495606_0000071 | Ga0495606_0000071_127482_128375 | 297 |
| 741 | 3300046519 | Ga0495632_0001780 | Ga0495632_0001780_8409_9302 | 297 |
| 742 | 3300046522 | Ga0495643_0000824 | Ga0495643_0000824_8524_9417 | 297 |
| 743 | 3300046522 | Ga0495643_0002434 | Ga0495643_0002434_4511_5404 | 297 |
| 744 | 3300046522 | Ga0495643_0008133 | Ga0495643_0008133_4803_5696 | 297 |
| 745 | 3300046522 | Ga0495643_0107803 | Ga0495643_0107803_260_1153 | 297 |
| 746 | 3300046524 | Ga0495648_0000015 | Ga0495648_0000015_208806_209699 | 297 |
| 747 | 3300046524 | Ga0495648_0000132 | Ga0495648_0000132_847_1740 | 297 |
| 748 | 3300046524 | Ga0495648_0075450 | Ga0495648_0075450_182_1075 | 297 |
| 749 | 3300046525 | Ga0495663_0004296 | Ga0495663_0004296_2191_3084 | 297 |
| 750 | 3300046528 | Ga0495642_0015818 | Ga0495642_0015818_480_1373 | 297 |
| 751 | 3300046536 | Ga0495587_0271263 | Ga0495587_0271263_34_927 | 297 |
| 752 | 3300046542 | Ga0495597_0075618 | Ga0495597_0075618_50_943 | 297 |
| 753 | 3300046558 | Ga0495633_0007590 | Ga0495633_0007590_340_1233 | 297 |
| 754 | 3300046616 | Ga0495668_0000013 | Ga0495668_0000013_367315_368208 | 297 |
| 755 | 3300046648 | Ga0495611_0025321 | Ga0495611_0025321_495_1388 | 297 |
| 756 | 3300046648 | Ga0495611_0041640 | Ga0495611_0041640_769_1662 | 297 |
| 757 | 3300046648 | Ga0495611_0053434 | Ga0495611_0053434_863_1756 | 297 |
| 758 | 3300046660 | Ga0495625_0000758 | Ga0495625_0000758_35836_36738 | 297 |
| 759 | 3300046660 | Ga0495625_0002253 | Ga0495625_0002253_10778_11671 | 297 |
| 760 | 3300046660 | Ga0495625_0005444 | Ga0495625_0005444_2231_3124 | 297 |
| 761 | 3300046660 | Ga0495625_0037437 | Ga0495625_0037437_2522_3418 | 297 |
| 762 | 3300046660 | Ga0495625_0047242 | Ga0495625_0047242_1588_2481 | 297 |
| 763 | 3300046660 | Ga0495625_0083277 | Ga0495625_0083277_1180_2073 | 297 |
| 764 | 3300046660 | Ga0495625_0127241 | Ga0495625_0127241_357_1250 | 297 |
| 765 | 3300046665 | Ga0495661_0043833 | Ga0495661_0043833_771_1664 | 297 |
| 766 | 3300046665 | Ga0495661_0161134 | Ga0495661_0161134_96_989 | 297 |
| 767 | 3300046684 | Ga0495669_0000023 | Ga0495669_0000023_10396_11289 | 297 |
| 768 | 3300046691 | Ga0495670_0127892 | Ga0495670_0127892_53_946 | 297 |
| 769 | 3300046692 | Ga0495671_0000084 | Ga0495671_0000084_73639_74532 | 297 |
| 770 | 3300046692 | Ga0495671_0061568 | Ga0495671_0061568_345_1238 | 297 |
| 771 | 3300046810 | Ga0495660_0074046 | Ga0495660_0074046_102_995 | 297 |
| 772 | 3300047323 | Ga0495683_0013556 | Ga0495683_0013556_2617_3510 | 297 |
| 773 | 3300047443 | Ga0495687_000076 | Ga0495687_000076_11806_12699 | 297 |
| 774 | 3300047469 | Ga0495673_0000206 | Ga0495673_0000206_14012_14905 | 297 |
| 775 | 3300047470 | Ga0495681_0075327 | Ga0495681_0075327_227_1120 | 297 |
| 776 | 3300047472 | Ga0495686_0000072 | Ga0495686_0000072_194141_195034 | 297 |
| 777 | 3300047472 | Ga0495686_0000962 | Ga0495686_0000962_28863_29756 | 297 |
| 778 | 3300047472 | Ga0495686_0002307 | Ga0495686_0002307_12315_13208 | 297 |
| 779 | 3300047472 | Ga0495686_0008799 | Ga0495686_0008799_1781_2674 | 297 |
| 780 | 3300047472 | Ga0495686_0032256 | Ga0495686_0032256_329_1225 | 297 |
| 781 | 3300047472 | Ga0495686_0128192 | Ga0495686_0128192_383_1276 | 297 |
| 782 | 3300048920 | Ga0496117_0003631 | Ga0496117_0003631_4268_5161 | 297 |
| 783 | 3300048920 | Ga0496117_0050916 | Ga0496117_0050916_1715_2608 | 297 |
| 784 | 3300048921 | Ga0496118_0000162 | Ga0496118_0000162_92623_93516 | 297 |
| 785 | 3300048921 | Ga0496118_0011572 | Ga0496118_0011572_5722_6615 | 297 |
| 786 | 3300048921 | Ga0496118_0086363 | Ga0496118_0086363_34_927 | 297 |
| 787 | 3300048923 | Ga0496120_0159902 | Ga0496120_0159902_17_910 | 297 |
| 788 | 3300048924 | Ga0496121_0002939 | Ga0496121_0002939_7087_7980 | 297 |
| 789 | 3300048924 | Ga0496121_0002997 | Ga0496121_0002997_8423_9316 | 297 |
| 790 | 3300048925 | Ga0496122_0008044 | Ga0496122_0008044_1329_2222 | 297 |
| 791 | 3300048925 | Ga0496122_0010853 | Ga0496122_0010853_2984_3877 | 297 |
| 792 | 3300048926 | Ga0496123_0000643 | Ga0496123_0000643_48336_49229 | 297 |
| 793 | 3300048926 | Ga0496123_0003112 | Ga0496123_0003112_813_1706 | 297 |
| 794 | 3300048927 | Ga0496124_0006400 | Ga0496124_0006400_4102_4995 | 297 |
| 795 | 3300048928 | Ga0496125_0006144 | Ga0496125_0006144_2607_3500 | 297 |
| 796 | 3300048928 | Ga0496125_0020332 | Ga0496125_0020332_5284_6177 | 297 |
| 797 | 3300049569 | Ga0501032_0016697 | Ga0501032_0016697_55_948 | 297 |
| 798 | 3300049570 | Ga0501033_0118730 | Ga0501033_0118730_620_1513 | 297 |
| 799 | 3300049571 | Ga0501034_0126968 | Ga0501034_0126968_1459_2352 | 297 |
| 800 | 3300049572 | Ga0501036_0005868 | Ga0501036_0005868_2288_3181 | 297 |
| 801 | 3300049573 | Ga0501037_0054790 | Ga0501037_0054790_1685_2578 | 297 |
| 802 | 3300049574 | Ga0501038_0212364 | Ga0501038_0212364_154_1047 | 297 |
| 803 | 3300049575 | Ga0501039_0032064 | Ga0501039_0032064_2988_3881 | 297 |
| 804 | 3300049580 | Ga0501046_0029514 | Ga0501046_0029514_1555_2481 | 297 |
| 805 | 3300049580 | Ga0501046_0192311 | Ga0501046_0192311_184_1077 | 297 |
| 806 | 3300049581 | Ga0501047_0110882 | Ga0501047_0110882_1436_2362 | 297 |
| 807 | 3300049581 | Ga0501047_0159672 | Ga0501047_0159672_1109_2002 | 297 |
| 808 | 3300049581 | Ga0501047_0301658 | Ga0501047_0301658_530_1423 | 297 |
| 809 | 3300049822 | Ga0501035_0025664 | Ga0501035_0025664_327_1220 | 297 |
| 810 | 3300050492 | nmdc:mga0yw44_168075_c1 | nmdc:mga0yw44_168075_c1_88_1017 | 297 |
| 811 | 3300050494 | nmdc:mga06z11_34258_c1 | nmdc:mga06z11_34258_c1_1263_2195 | 297 |
| 812 | 3300050494 | nmdc:mga06z11_37633_c1 | nmdc:mga06z11_37633_c1_579_1499 | 297 |
| 813 | 3300050494 | nmdc:mga06z11_40934_c1 | nmdc:mga06z11_40934_c1_634_1554 | 297 |
| 814 | 3300050496 | nmdc:mga07m45_38635_c1 | nmdc:mga07m45_38635_c1_397_1329 | 297 |
| 815 | 3300050508 | nmdc:mga09592_287644_c1 | nmdc:mga09592_287644_c1_521_1414 | 297 |
| 816 | 3300050512 | nmdc:mga0n895_65333_c1 | nmdc:mga0n895_65333_c1_2602_3495 | 297 |
| 817 | 3300050516 | nmdc:mga0sz30_148_c1 | nmdc:mga0sz30_148_c1_19677_20609 | 297 |
| 818 | 3300050516 | nmdc:mga0sz30_7134_c1 | nmdc:mga0sz30_7134_c1_1633_2553 | 297 |
| 819 | 3300053079 | Ga0500610_0010169 | Ga0500610_0010169_1726_2619 | 297 |
| 820 | 3300053087 | Ga0500643_069194 | Ga0500643_069194_28_921 | 297 |
| 821 | 3300053098 | Ga0500650_0022660 | Ga0500650_0022660_805_1698 | 297 |
| 822 | 3300053103 | Ga0500555_002637 | Ga0500555_002637_69_962 | 297 |
| 823 | 3300053104 | Ga0500556_0000013 | Ga0500556_0000013_12063_12956 | 297 |
| 824 | 3300053105 | Ga0500557_046688 | Ga0500557_046688_366_1259 | 297 |
| 825 | 3300053119 | Ga0500595_000322 | Ga0500595_000322_25042_25935 | 297 |
| 826 | 3300053130 | Ga0500642_0002968 | Ga0500642_0002968_1267_2160 | 297 |
| 827 | 3300053134 | Ga0500658_0001557 | Ga0500658_0001557_4029_4925 | 297 |
| 828 | 3300053136 | Ga0500559_0025686 | Ga0500559_0025686_702_1595 | 297 |
| 829 | 3300053136 | Ga0500559_0108698 | Ga0500559_0108698_305_1207 | 297 |
| 830 | 3300053139 | Ga0500568_0047570 | Ga0500568_0047570_249_1151 | 297 |
| 831 | 3300053142 | Ga0500577_0018894 | Ga0500577_0018894_1237_2130 | 297 |
| 832 | 3300053153 | Ga0500616_0001491 | Ga0500616_0001491_7963_8883 | 297 |
| 833 | 3300053156 | Ga0500622_0045229 | Ga0500622_0045229_1106_1999 | 297 |
| 834 | 3300053730 | Ga0500645_000003 | Ga0500645_000003_103858_104751 | 297 |
| 835 | 3300053733 | Ga0500552_000111 | Ga0500552_000111_1110_2030 | 297 |
| 836 | 3300053735 | Ga0500596_003051 | Ga0500596_003051_55_948 | 297 |
| 837 | 3300061719 | Ga0466962_0000873 | Ga0466962_0000873_9342_10235 | 297 |
| 838 | iso_pu_bacteria | 2643221622 | 2644125173 | 297 |
| 839 | iso_pu_bacteria | 2879163058 | 2879164295 | 297 |
| 840 | iso_pu_bacteria | 2885429604 | 2885430764 | 297 |
| 841 | 3300003215 | JGI25153J46596_10025950 | JGI25153J46596_100259502 | 298 |
| 842 | 3300005344 | Ga0070661_100000001 | Ga0070661_10000000148 | 298 |
| 843 | 3300005719 | Ga0068861_100319791 | Ga0068861_1003197912 | 298 |
| 844 | 3300006038 | Ga0075365_10073461 | Ga0075365_100734612 | 298 |
| 845 | 3300013297 | Ga0157378_10237536 | Ga0157378_102375362 | 298 |
| 846 | 3300025263 | Ga0209565_1000306 | Ga0209565_100030617 | 298 |
| 847 | 3300025273 | Ga0209673_1008882 | Ga0209673_10088823 | 298 |
| 848 | 3300025920 | Ga0207649_10000018 | Ga0207649_1000001871 | 298 |
| 849 | 3300026118 | Ga0207675_100306769 | Ga0207675_1003067692 | 298 |
| 850 | 3300046524 | Ga0495648_0046973 | Ga0495648_0046973_381_1277 | 298 |
| 851 | 3300046530 | Ga0495654_0000264 | Ga0495654_0000264_40388_41284 | 298 |
| 852 | 3300046616 | Ga0495668_0080252 | Ga0495668_0080252_834_1730 | 298 |
| 853 | 3300046660 | Ga0495625_0014698 | Ga0495625_0014698_3839_4735 | 298 |
| 854 | 3300049523 | Ga0501300_004127 | Ga0501300_004127_28_924 | 298 |
| 855 | 3300049571 | Ga0501034_0162907 | Ga0501034_0162907_897_1793 | 298 |
| 856 | 3300049585 | Ga0501069_0008799 | Ga0501069_0008799_1199_2095 | 298 |
| 857 | 3300049586 | Ga0501070_0042512 | Ga0501070_0042512_2608_3504 | 298 |
| 858 | 3300049663 | Ga0501223_002015 | Ga0501223_002015_3328_4224 | 298 |
| 859 | 3300049686 | Ga0501257_000074 | Ga0501257_000074_8992_9888 | 298 |
| 860 | 3300049776 | Ga0501280_014312 | Ga0501280_014312_217_1113 | 298 |
| 861 | 3300053151 | Ga0500604_0000018 | Ga0500604_0000018_73808_74713 | 298 |
| 862 | 3300053158 | Ga0500627_0000188 | Ga0500627_0000188_12819_13715 | 298 |
| 863 | iso_pu_bacteria | 2512564014 | 2512642088 | 298 |
| 864 | iso_pu_bacteria | 2599185359 | 2600228046 | 298 |
| 865 | iso_pu_bacteria | 2775507255 | 2778124071 | 298 |
| 866 | iso_pu_bacteria | 2818991466 | 2819715149 | 298 |
| 867 | iso_pu_bacteria | 2919709256 | 2919710073 | 298 |
| 868 | iso_pu_bacteria | 2928526807 | 2928531163 | 298 |
| 869 | iso_pu_bacteria | 2928968154 | 2928972339 | 298 |
| 870 | 3300005577 | Ga0068857_100017141 | Ga0068857_1000171415 | 299 |
| 871 | 3300005617 | Ga0068859_100000682 | Ga0068859_10000068213 | 299 |
| 872 | 3300006931 | Ga0097620_100000682 | Ga0097620_10000068213 | 299 |
| 873 | 3300009177 | Ga0105248_10000824 | Ga0105248_100008244 | 299 |
| 874 | 3300025941 | Ga0207711_10032269 | Ga0207711_100322694 | 299 |
| 875 | 3300026041 | Ga0207639_10001919 | Ga0207639_100019195 | 299 |
| 876 | 3300026078 | Ga0207702_10440943 | Ga0207702_104409432 | 299 |
| 877 | 3300026116 | Ga0207674_10047233 | Ga0207674_100472333 | 299 |
| 878 | 3300037068 | Ga0373925_0290818 | Ga0373925_0290818_273_1223 | 299 |
| 879 | 3300005842 | Ga0068858_100000482 | Ga0068858_1000004825 | 300 |
| 880 | 3300009177 | Ga0105248_10015827 | Ga0105248_100158279 | 300 |
| 881 | 3300025941 | Ga0207711_10022434 | Ga0207711_100224342 | 300 |
| 882 | 3300026035 | Ga0207703_10000254 | Ga0207703_1000025437 | 300 |
| 883 | 3300026095 | Ga0207676_10000331 | Ga0207676_100003311 | 300 |
| 884 | 3300027876 | Ga0209974_10007473 | Ga0209974_100074735 | 300 |
| 885 | 3300031824 | Ga0307413_10119634 | Ga0307413_101196341 | 300 |
| 886 | 3300031911 | Ga0307412_10089533 | Ga0307412_100895332 | 300 |
| 887 | 3300032002 | Ga0307416_100015921 | Ga0307416_1000159215 | 300 |
| 888 | 3300032004 | Ga0307414_10429377 | Ga0307414_104293771 | 300 |
| 889 | 3300033180 | Ga0307510_10034948 | Ga0307510_100349481 | 300 |
| 890 | 3300046460 | Ga0495638_0014466 | Ga0495638_0014466_3002_3925 | 300 |
| 891 | 3300053087 | Ga0500643_001426 | Ga0500643_001426_5475_6377 | 300 |
| 892 | iso_pu_bacteria | 2808606401 | 2809063680 | 300 |
| 893 | iso_pu_bacteria | 2808606404 | 2809079702 | 300 |
| 894 | iso_pu_bacteria | 2808606405 | 2809084067 | 300 |
| 895 | iso_pu_bacteria | 2880518877 | 2880519390 | 300 |
| 896 | 3300000043 | ARcpr5yngRDRAFT_c001989 | ARcpr5yngRDRAFT_0019892 | 301 |
| 897 | 3300001990 | JGI24737J22298_10000584 | JGI24737J22298_100005847 | 301 |
| 898 | 3300003759 | Ga0055525_1000096 | Ga0055525_100009616 | 301 |
| 899 | 3300003762 | Ga0055542_1000012 | Ga0055542_1000012315 | 301 |
| 900 | 3300003763 | Ga0055529_1000002 | Ga0055529_1000002231 | 301 |
| 901 | 3300003763 | Ga0055529_1000021 | Ga0055529_1000021250 | 301 |
| 902 | 3300003773 | Ga0055537_1000357 | Ga0055537_100035724 | 301 |
| 903 | 3300003775 | Ga0055524_1000361 | Ga0055524_100036120 | 301 |
| 904 | 3300003794 | Ga0055531_10000100 | Ga0055531_10000100105 | 301 |
| 905 | 3300003794 | Ga0055531_10003757 | Ga0055531_100037577 | 301 |
| 906 | 3300004625 | Ga0055543_1020161 | Ga0055543_10201611 | 301 |
| 907 | 3300005262 | Ga0065165_1001356 | Ga0065165_100135623 | 301 |
| 908 | 3300005262 | Ga0065165_1002875 | Ga0065165_10028757 | 301 |
| 909 | 3300005262 | Ga0065165_1021348 | Ga0065165_10213483 | 301 |
| 910 | 3300005262 | Ga0065165_1056879 | Ga0065165_10568791 | 301 |
| 911 | 3300005327 | Ga0070658_10005123 | Ga0070658_100051232 | 301 |
| 912 | 3300005344 | Ga0070661_100002510 | Ga0070661_1000025107 | 301 |
| 913 | 3300005455 | Ga0070663_100040999 | Ga0070663_1000409992 | 301 |
| 914 | 3300005535 | Ga0070684_100027100 | Ga0070684_1000271004 | 301 |
| 915 | 3300005548 | Ga0070665_100000043 | Ga0070665_100000043144 | 301 |
| 916 | 3300005563 | Ga0068855_100590007 | Ga0068855_1005900071 | 301 |
| 917 | 3300005577 | Ga0068857_100068383 | Ga0068857_1000683831 | 301 |
| 918 | 3300009174 | Ga0105241_10006348 | Ga0105241_100063484 | 301 |
| 919 | 3300013102 | Ga0157371_10000094 | Ga0157371_1000009444 | 301 |
| 920 | 3300013104 | Ga0157370_10039775 | Ga0157370_100397754 | 301 |
| 921 | 3300014968 | Ga0157379_10385122 | Ga0157379_103851221 | 301 |
| 922 | 3300025226 | Ga0209674_103207 | Ga0209674_1032073 | 301 |
| 923 | 3300025230 | Ga0209563_100058 | Ga0209563_100058107 | 301 |
| 924 | 3300025245 | Ga0207425_1006442 | Ga0207425_10064423 | 301 |
| 925 | 3300025253 | Ga0209677_109339 | Ga0209677_1093392 | 301 |
| 926 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008948 | 301 |
| 927 | 3300025263 | Ga0209565_1000011 | Ga0209565_100001126 | 301 |
| 928 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002477 | 301 |
| 929 | 3300025273 | Ga0209673_1002201 | Ga0209673_10022014 | 301 |
| 930 | 3300025291 | Ga0209675_1008549 | Ga0209675_10085492 | 301 |
| 931 | 3300025297 | Ga0209758_1005550 | Ga0209758_10055505 | 301 |
| 932 | 3300025298 | Ga0209050_1000071 | Ga0209050_1000071129 | 301 |
| 933 | 3300025298 | Ga0209050_1005347 | Ga0209050_10053476 | 301 |
| 934 | 3300025299 | Ga0209256_1000016 | Ga0209256_1000016573 | 301 |
| 935 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027174 | 301 |
| 936 | 3300025304 | Ga0209257_1005113 | Ga0209257_10051134 | 301 |
| 937 | 3300025304 | Ga0209257_1014104 | Ga0209257_10141043 | 301 |
| 938 | 3300025909 | Ga0207705_10001170 | Ga0207705_100011706 | 301 |
| 939 | 3300025911 | Ga0207654_10000020 | Ga0207654_1000002034 | 301 |
| 940 | 3300025913 | Ga0207695_10020535 | Ga0207695_100205355 | 301 |
| 941 | 3300025914 | Ga0207671_10014334 | Ga0207671_100143345 | 301 |
| 942 | 3300025919 | Ga0207657_10023951 | Ga0207657_100239513 | 301 |
| 943 | 3300025920 | Ga0207649_10000130 | Ga0207649_1000013053 | 301 |
| 944 | 3300025931 | Ga0207644_10064136 | Ga0207644_100641363 | 301 |
| 945 | 3300025932 | Ga0207690_10000063 | Ga0207690_1000006374 | 301 |
| 946 | 3300025933 | Ga0207706_10040050 | Ga0207706_100400502 | 301 |
| 947 | 3300025937 | Ga0207669_10110758 | Ga0207669_101107582 | 301 |
| 948 | 3300025945 | Ga0207679_10016813 | Ga0207679_100168133 | 301 |
| 949 | 3300025949 | Ga0207667_10000006 | Ga0207667_1000000683 | 301 |
| 950 | 3300026035 | Ga0207703_10054466 | Ga0207703_100544663 | 301 |
| 951 | 3300026041 | Ga0207639_10001668 | Ga0207639_1000166812 | 301 |
| 952 | 3300026067 | Ga0207678_10004783 | Ga0207678_100047837 | 301 |
| 953 | 3300026078 | Ga0207702_10002032 | Ga0207702_100020322 | 301 |
| 954 | 3300026089 | Ga0207648_10165026 | Ga0207648_101650262 | 301 |
| 955 | 3300026116 | Ga0207674_10019142 | Ga0207674_100191422 | 301 |
| 956 | 3300026116 | Ga0207674_10036234 | Ga0207674_100362341 | 301 |
| 957 | 3300026118 | Ga0207675_100001943 | Ga0207675_10000194323 | 301 |
| 958 | 3300026142 | Ga0207698_10026229 | Ga0207698_100262292 | 301 |
| 959 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002446 | 301 |
| 960 | 3300031731 | Ga0307405_10143520 | Ga0307405_101435202 | 301 |
| 961 | 3300031731 | Ga0307405_10233591 | Ga0307405_102335912 | 301 |
| 962 | 3300031824 | Ga0307413_10095823 | Ga0307413_100958232 | 301 |
| 963 | 3300031852 | Ga0307410_10063922 | Ga0307410_100639222 | 301 |
| 964 | 3300031901 | Ga0307406_10111203 | Ga0307406_101112032 | 301 |
| 965 | 3300031911 | Ga0307412_10110118 | Ga0307412_101101182 | 301 |
| 966 | 3300031995 | Ga0307409_100341322 | Ga0307409_1003413222 | 301 |
| 967 | 3300032004 | Ga0307414_10079800 | Ga0307414_100798003 | 301 |
| 968 | 3300032004 | Ga0307414_10334196 | Ga0307414_103341962 | 301 |
| 969 | 3300032126 | Ga0307415_100045438 | Ga0307415_1000454384 | 301 |
| 970 | 3300041404 | Ga0439436_0023454 | Ga0439436_0023454_592_1497 | 301 |
| 971 | 3300041406 | Ga0439439_0011720 | Ga0439439_0011720_141_1046 | 301 |
| 972 | 3300041997 | Ga0439431_0025523 | Ga0439431_0025523_406_1311 | 301 |
| 973 | 3300042012 | Ga0439455_0000097 | Ga0439455_0000097_1094_2008 | 301 |
| 974 | 3300042435 | Ga0439434_0025664 | Ga0439434_0025664_524_1429 | 301 |
| 975 | 3300046506 | Ga0495583_0020752 | Ga0495583_0020752_2118_3023 | 301 |
| 976 | 3300046691 | Ga0495670_0000010 | Ga0495670_0000010_97826_98743 | 301 |
| 977 | 3300046694 | Ga0495649_0007386 | Ga0495649_0007386_3704_4609 | 301 |
| 978 | 3300047443 | Ga0495687_000080 | Ga0495687_000080_119104_120009 | 301 |
| 979 | 3300047470 | Ga0495681_0042262 | Ga0495681_0042262_951_1856 | 301 |
| 980 | 3300048919 | Ga0496116_0068160 | Ga0496116_0068160_566_1471 | 301 |
| 981 | 3300048925 | Ga0496122_0013101 | Ga0496122_0013101_354_1259 | 301 |
| 982 | 3300048926 | Ga0496123_0017852 | Ga0496123_0017852_4740_5645 | 301 |
| 983 | 3300048927 | Ga0496124_0000830 | Ga0496124_0000830_47021_47926 | 301 |
| 984 | 3300048928 | Ga0496125_0007778 | Ga0496125_0007778_10379_11284 | 301 |
| 985 | 3300049765 | Ga0501268_002046 | Ga0501268_002046_1342_2247 | 301 |
| 986 | 3300053087 | Ga0500643_000203 | Ga0500643_000203_51687_52613 | 301 |
| 987 | 3300053094 | Ga0500566_0001654 | Ga0500566_0001654_5224_6129 | 301 |
| 988 | 3300053134 | Ga0500658_0004819 | Ga0500658_0004819_2837_3742 | 301 |
| 989 | 2162886007 | SwRhRL2b_contig_1751179 | SwRhRL2b_0904.00006160 | 302 |
| 990 | 2162886007 | SwRhRL2b_contig_3930390 | SwRhRL2b_0982.00007710 | 302 |
| 991 | 3300001915 | JGI24741J21665_1000004 | JGI24741J21665_100000430 | 302 |
| 992 | 3300001989 | JGI24739J22299_10000714 | JGI24739J22299_1000071412 | 302 |
| 993 | 3300001990 | JGI24737J22298_10001100 | JGI24737J22298_100011003 | 302 |
| 994 | 3300002067 | JGI24735J21928_10009901 | JGI24735J21928_100099013 | 302 |
| 995 | 3300003215 | JGI25153J46596_10000032 | JGI25153J46596_10000032184 | 302 |
| 996 | 3300003781 | Ga0055536_1015678 | Ga0055536_10156783 | 302 |
| 997 | 3300003791 | Ga0055530_10022189 | Ga0055530_100221892 | 302 |
| 998 | 3300003792 | Ga0055540_1005045 | Ga0055540_10050457 | 302 |
| 999 | 3300005289 | Ga0065704_10006098 | Ga0065704_100060983 | 302 |
| 1000 | 3300005355 | Ga0070671_100077802 | Ga0070671_1000778022 | 302 |
| 1001 | 3300005548 | Ga0070665_100066271 | Ga0070665_1000662712 | 302 |
| 1002 | 3300005563 | Ga0068855_100393588 | Ga0068855_1003935882 | 302 |
| 1003 | 3300005577 | Ga0068857_100078386 | Ga0068857_1000783865 | 302 |
| 1004 | 3300005577 | Ga0068857_100175331 | Ga0068857_1001753312 | 302 |
| 1005 | 3300005578 | Ga0068854_100065856 | Ga0068854_1000658564 | 302 |
| 1006 | 3300005614 | Ga0068856_100003848 | Ga0068856_10000384811 | 302 |
| 1007 | 3300009147 | Ga0114129_10080446 | Ga0114129_100804464 | 302 |
| 1008 | 3300009174 | Ga0105241_10001135 | Ga0105241_100011356 | 302 |
| 1009 | 3300009545 | Ga0105237_10231725 | Ga0105237_102317251 | 302 |
| 1010 | 3300009553 | Ga0105249_10323481 | Ga0105249_103234812 | 302 |
| 1011 | 3300017792 | Ga0163161_10057115 | Ga0163161_100571152 | 302 |
| 1012 | 3300025245 | Ga0207425_1000025 | Ga0207425_1000025268 | 302 |
| 1013 | 3300025258 | Ga0209129_1000671 | Ga0209129_100067119 | 302 |
| 1014 | 3300025294 | Ga0209025_1000663 | Ga0209025_100066327 | 302 |
| 1015 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002352 | 302 |
| 1016 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001295 | 302 |
| 1017 | 3300025298 | Ga0209050_1000823 | Ga0209050_100082329 | 302 |
| 1018 | 3300025298 | Ga0209050_1014947 | Ga0209050_10149474 | 302 |
| 1019 | 3300025303 | Ga0209051_1000689 | Ga0209051_100068927 | 302 |
| 1020 | 3300025304 | Ga0209257_1012649 | Ga0209257_10126492 | 302 |
| 1021 | 3300025304 | Ga0209257_1012697 | Ga0209257_10126972 | 302 |
| 1022 | 3300025904 | Ga0207647_10021613 | Ga0207647_100216131 | 302 |
| 1023 | 3300025914 | Ga0207671_10013921 | Ga0207671_100139216 | 302 |
| 1024 | 3300025925 | Ga0207650_10088181 | Ga0207650_100881812 | 302 |
| 1025 | 3300025931 | Ga0207644_10025155 | Ga0207644_100251553 | 302 |
| 1026 | 3300025945 | Ga0207679_10571384 | Ga0207679_105713841 | 302 |
| 1027 | 3300025981 | Ga0207640_10008156 | Ga0207640_100081566 | 302 |
| 1028 | 3300026041 | Ga0207639_10002219 | Ga0207639_100022195 | 302 |
| 1029 | 3300026067 | Ga0207678_10000072 | Ga0207678_1000007218 | 302 |
| 1030 | 3300026116 | Ga0207674_10040826 | Ga0207674_100408263 | 302 |
| 1031 | 3300026116 | Ga0207674_10064391 | Ga0207674_100643916 | 302 |
| 1032 | 3300028379 | Ga0268266_10144969 | Ga0268266_101449692 | 302 |
| 1033 | 3300031548 | Ga0307408_100016395 | Ga0307408_1000163954 | 302 |
| 1034 | 3300031548 | Ga0307408_100396766 | Ga0307408_1003967662 | 302 |
| 1035 | 3300031711 | Ga0265314_10054163 | Ga0265314_100541633 | 302 |
| 1036 | 3300031731 | Ga0307405_10060893 | Ga0307405_100608932 | 302 |
| 1037 | 3300031731 | Ga0307405_10199937 | Ga0307405_101999372 | 302 |
| 1038 | 3300031852 | Ga0307410_10121780 | Ga0307410_101217802 | 302 |
| 1039 | 3300031911 | Ga0307412_10005140 | Ga0307412_100051402 | 302 |
| 1040 | 3300032002 | Ga0307416_100147262 | Ga0307416_1001472623 | 302 |
| 1041 | 3300041413 | Ga0439465_0000784 | Ga0439465_0000784_2798_3706 | 302 |
| 1042 | 3300041997 | Ga0439431_0000151 | Ga0439431_0000151_3647_4555 | 302 |
| 1043 | 3300042006 | Ga0439432_001267 | Ga0439432_001267_2332_3240 | 302 |
| 1044 | 3300042015 | Ga0439462_0001229 | Ga0439462_0001229_521_1429 | 302 |
| 1045 | 3300042156 | Ga0439446_0010555 | Ga0439446_0010555_1105_2013 | 302 |
| 1046 | 3300042435 | Ga0439434_0000358 | Ga0439434_0000358_677_1585 | 302 |
| 1047 | 3300046520 | Ga0495637_0000886 | Ga0495637_0000886_5002_5910 | 302 |
| 1048 | 3300046522 | Ga0495643_0000053 | Ga0495643_0000053_174736_175644 | 302 |
| 1049 | 3300046524 | Ga0495648_0068485 | Ga0495648_0068485_980_1903 | 302 |
| 1050 | 3300046525 | Ga0495663_0000020 | Ga0495663_0000020_26473_27471 | 302 |
| 1051 | 3300046558 | Ga0495633_0001251 | Ga0495633_0001251_3424_4422 | 302 |
| 1052 | 3300046558 | Ga0495633_0001282 | Ga0495633_0001282_5531_6439 | 302 |
| 1053 | 3300046692 | Ga0495671_0000031 | Ga0495671_0000031_26388_27296 | 302 |
| 1054 | 3300047470 | Ga0495681_0008207 | Ga0495681_0008207_2245_3153 | 302 |
| 1055 | 3300047470 | Ga0495681_0049049 | Ga0495681_0049049_519_1427 | 302 |
| 1056 | 3300048911 | Ga0496108_0006481 | Ga0496108_0006481_6451_7359 | 302 |
| 1057 | 3300048913 | Ga0496110_0054021 | Ga0496110_0054021_1035_1964 | 302 |
| 1058 | 3300048913 | Ga0496110_0407099 | Ga0496110_0407099_101_1009 | 302 |
| 1059 | 3300048914 | Ga0496111_0095883 | Ga0496111_0095883_1002_1931 | 302 |
| 1060 | 3300048920 | Ga0496117_0080500 | Ga0496117_0080500_181_1089 | 302 |
| 1061 | 3300048924 | Ga0496121_0001861 | Ga0496121_0001861_9769_10677 | 302 |
| 1062 | 3300048924 | Ga0496121_0087804 | Ga0496121_0087804_407_1336 | 302 |
| 1063 | 3300048925 | Ga0496122_0067654 | Ga0496122_0067654_62_970 | 302 |
| 1064 | 3300048925 | Ga0496122_0189030 | Ga0496122_0189030_203_1111 | 302 |
| 1065 | 3300048926 | Ga0496123_0000804 | Ga0496123_0000804_26946_27884 | 302 |
| 1066 | 3300048926 | Ga0496123_0025967 | Ga0496123_0025967_3467_4375 | 302 |
| 1067 | 3300048926 | Ga0496123_0102046 | Ga0496123_0102046_56_964 | 302 |
| 1068 | 3300048926 | Ga0496123_0115362 | Ga0496123_0115362_274_1203 | 302 |
| 1069 | 3300048927 | Ga0496124_0007019 | Ga0496124_0007019_1863_2792 | 302 |
| 1070 | 3300048927 | Ga0496124_0049666 | Ga0496124_0049666_1020_1928 | 302 |
| 1071 | 3300048927 | Ga0496124_0132784 | Ga0496124_0132784_968_1909 | 302 |
| 1072 | 3300048928 | Ga0496125_0000335 | Ga0496125_0000335_11438_12367 | 302 |
| 1073 | 3300048928 | Ga0496125_0009669 | Ga0496125_0009669_8550_9458 | 302 |
| 1074 | 3300048928 | Ga0496125_0020675 | Ga0496125_0020675_3996_4904 | 302 |
| 1075 | 3300049663 | Ga0501223_000082 | Ga0501223_000082_19617_20525 | 302 |
| 1076 | 3300049705 | Ga0501225_0000059 | Ga0501225_0000059_25248_26156 | 302 |
| 1077 | 3300049758 | Ga0501241_000565 | Ga0501241_000565_277_1185 | 302 |
| 1078 | 3300053096 | Ga0500641_0001530 | Ga0500641_0001530_5281_6222 | 302 |
| 1079 | 3300053119 | Ga0500595_001189 | Ga0500595_001189_7750_8658 | 302 |
| 1080 | 3300053139 | Ga0500568_0004980 | Ga0500568_0004980_4001_5035 | 302 |
| 1081 | 3300053151 | Ga0500604_0008220 | Ga0500604_0008220_1801_2709 | 302 |
| 1082 | 3300053153 | Ga0500616_0002249 | Ga0500616_0002249_6412_7446 | 302 |
| 1083 | 3300053157 | Ga0500624_000024 | Ga0500624_000024_58567_59517 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wf3-assembly1.cif.gz_A | crystal structure of gtp-binding protein tt1341 from thermus thermophilus hb8 | 0.7981 | 8 | 300 |
| 4acb-assembly1.cif.gz_A | crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp | 0.7958 | 7 | 173 |
| 5x4b-assembly2.cif.gz_B | crystal structure of n-terminal g-domain of enga from bacillus subtilis | 0.7936 | 11 | 173 |
| 1wf3-assembly1.cif.gz_A | crystal structure of gtp-binding protein tt1341 from thermus thermophilus hb8 | 0.7885 | 8 | 300 |
| 4aca-assembly1.cif.gz_A | crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form | 0.7801 | 7 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FY06_2_183_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8698 | 8 | 187 | 3.40.50.300 |
| af_P9WNK9_2_186_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.859 | 8 | 183 | 3.40.50.300 |
| af_Q2FY06_2_183_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8564 | 8 | 187 | 3.40.50.300 |
| af_Q9CZU4_341_437_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8443 | 195 | 283 | 3.30.300.20 |
| af_Q8ILA6_408_504_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.844 | 196 | 283 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G1Z763-F1-model_v4 | GTPase Era | 0.9101 | 1 | 182 |
GO:0000028
GO:0005525 GO:0005829 GO:0019843 GO:0043024 |
| AF-A0A2G1Z763-F1-model_v4 | GTPase Era | 0.9053 | 1 | 182 |
GO:0000028
GO:0005525 GO:0005829 GO:0019843 GO:0043024 |
| AF-A0A520HLZ2-F1-model_v4 | GTPase Era | 0.897 | 6 | 178 |
GO:0000028
GO:0005525 GO:0019843 GO:0043024 |
| AF-A0A3D2DJA7-F1-model_v4 | GTPase Era | 0.8911 | 45 | 184 |
GO:0000028
GO:0003924 GO:0005525 GO:0005829 GO:0019843 GO:0043024 |
| AF-A0A6L6EHY1-F1-model_v4 | GTPase Era | 0.8853 | 8 | 182 |
GO:0000028
GO:0005525 GO:0005829 GO:0019843 GO:0043024 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar