F489732
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1083 | 533 | 2167 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300053147|Ga0500589_093167|Ga0500589_093167_139_1242 |
| Length | 367 |
| Sequence | MAGRRYGMKNRRCSVVVTSVLMVWSLVCRMRLFRQQAHCRVRPFQPRFSAALLCFVCIACSRPTIIDRMPVTLAGQLVVAISSRALFDFEEENRLFEATDDRAYMQLQLQRVSQPAKPGVAFSLVNKLLAFNAAAPAASVEVVILSRNDPVSGMRVFRSAQHYGLPIQRGVFTRGESPWRYLKPLNAHLFLSTNEADVRSALGAGVPAARVYPNSARASSAHPNEVRIAFDGDAVLFSDEAERVFQLRGLDAFQSHERDQVDTPLAAGPFKPLLLALQRLQREPAQGMRIRTALVTARSAPAHERAIRTLMNWNIEVDEAMFLGGLPKGEFLREFEPDFFFDDQTGHVDSAAAHVPAGHVASGISNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 95 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 96 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 226 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 227 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 228 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 233 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 234 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 236 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 238 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 239 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 240 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 241 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 242 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 245 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 247 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 248 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 249 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 268 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 269 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 272 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 273 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 274 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 275 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 276 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 277 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 278 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 279 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 280 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 281 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 282 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 283 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 284 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 285 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 286 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 287 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 288 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 289 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 290 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 291 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 292 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 293 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 294 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 295 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 296 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 297 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 298 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 299 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 300 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 301 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 302 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 303 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 304 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 305 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 306 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 307 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 308 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 309 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 310 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 311 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 312 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 313 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 314 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 318 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 319 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 320 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 321 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 322 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 323 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 324 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 327 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 328 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 329 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 377 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 378 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 379 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 380 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 381 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 384 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 385 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 386 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 387 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 388 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 389 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 390 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 391 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 392 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 393 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 394 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 395 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 396 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 397 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 398 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 407 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 408 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 409 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 410 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 411 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 412 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 413 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 414 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 418 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 424 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 432 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 433 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 435 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 436 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 438 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 439 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 440 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 442 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 444 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 445 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 446 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 447 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 448 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 449 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 450 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 451 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 452 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 454 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 455 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 457 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 458 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 459 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 460 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 461 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 462 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 463 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 464 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 465 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 466 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 467 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 468 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 469 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 470 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 471 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 472 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 473 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 474 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 475 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 476 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 477 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 478 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 479 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 480 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 481 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 482 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 483 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 484 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 485 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 486 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 487 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 488 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 489 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 490 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 491 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 492 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 493 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 494 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 495 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 496 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 497 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 498 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 499 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 500 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 501 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 502 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 503 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 504 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 505 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 506 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 507 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 508 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 509 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 510 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 511 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 512 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 513 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 514 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 515 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 516 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 517 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 518 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 519 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 520 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 521 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 522 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 523 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 524 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 525 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 526 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 527 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 528 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 529 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 530 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 531 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 532 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 533 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.09 |
| Metatranscriptomes | 0 |
| Isolates | 5.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.78 |
| Nodule | 0.92 |
| Rhizoplane | 2.68 |
| Rhizosphere | 57.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500589_093167 | 3300053147 | Bacteria | 1323 |
| 2 | JGI25155J39150_1000024 | 3300002704 | Bacteria | 133561 |
| 3 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 4 | JGI25156J39149_1000534 | 3300002705 | Bacteria | 21912 |
| 5 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 6 | JGI25154J39366_1000918 | 3300002738 | Bacteria | 12386 |
| 7 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 8 | JGI25157J39369_1000054 | 3300002741 | Bacteria | 108825 |
| 9 | JGI25157J39369_1000144 | 3300002741 | Bacteria | 60361 |
| 10 | JGI25152J39213_1000889 | 3300002773 | Bacteria | 14700 |
| 11 | JGI25150J39212_1014335 | 3300002774 | Bacteria | 1349 |
| 12 | JGI25151J46595_10003495 | 3300003187 | Bacteria | 8666 |
| 13 | JGI25151J46595_10022127 | 3300003187 | Bacteria | 2645 |
| 14 | JGI25153J46596_10001144 | 3300003215 | Bacteria | 16045 |
| 15 | JGI25153J46596_10002770 | 3300003215 | Bacteria | 9965 |
| 16 | rootH2_10060114 | 3300003320 | Bacteria | 2518 |
| 17 | rootL2_10028978 | 3300003322 | Bacteria | 4031 |
| 18 | rootH1_10001684 | 3300003323 | Bacteria | 9012 |
| 19 | rootH1_10004925 | 3300003316 | Bacteria | 12287 |
| 20 | rootH1_10004925 | 3300003323 | Bacteria | 10403 |
| 21 | rootH1_10058178 | 3300003323 | Bacteria | 2635 |
| 22 | JGI25160J50197_1000904 | 3300003354 | Bacteria | 15618 |
| 23 | JGI25161J50226_1000098 | 3300003374 | Bacteria | 71121 |
| 24 | Ga0055539_1000812 | 3300003752 | Bacteria | 7362 |
| 25 | Ga0055533_1000008 | 3300003756 | Bacteria | 575861 |
| 26 | Ga0055525_1000729 | 3300003759 | Bacteria | 11493 |
| 27 | Ga0055535_1000069 | 3300003761 | Bacteria | 115207 |
| 28 | Ga0055535_1000271 | 3300003761 | Bacteria | 54319 |
| 29 | Ga0055542_1000084 | 3300003762 | Bacteria | 125518 |
| 30 | Ga0055529_1000321 | 3300003763 | Bacteria | 54307 |
| 31 | Ga0055526_1000687 | 3300003771 | Bacteria | 25833 |
| 32 | Ga0055526_1001509 | 3300003771 | Bacteria | 16488 |
| 33 | Ga0055526_1002509 | 3300003771 | Bacteria | 12346 |
| 34 | Ga0055537_1000777 | 3300003773 | Bacteria | 16055 |
| 35 | Ga0055537_1001949 | 3300003773 | Bacteria | 7371 |
| 36 | Ga0055537_1002668 | 3300003773 | Bacteria | 5827 |
| 37 | Ga0055524_1000085 | 3300003775 | Bacteria | 117478 |
| 38 | Ga0055524_1000111 | 3300003775 | Bacteria | 96812 |
| 39 | Ga0055524_1005251 | 3300003775 | Bacteria | 5821 |
| 40 | Ga0055536_1000843 | 3300003781 | Bacteria | 20193 |
| 41 | Ga0055536_1003305 | 3300003781 | Bacteria | 8726 |
| 42 | Ga0055536_1003834 | 3300003781 | Bacteria | 7917 |
| 43 | Ga0055536_1005817 | 3300003781 | Bacteria | 5927 |
| 44 | Ga0055534_1000746 | 3300003784 | Bacteria | 15587 |
| 45 | Ga0055534_1001110 | 3300003784 | Bacteria | 11440 |
| 46 | Ga0055534_1002569 | 3300003784 | Bacteria | 6211 |
| 47 | Ga0055528_1001586 | 3300003790 | Bacteria | 13492 |
| 48 | Ga0055528_1002505 | 3300003790 | Bacteria | 9802 |
| 49 | Ga0055528_1005575 | 3300003790 | Bacteria | 5827 |
| 50 | Ga0055530_10002078 | 3300003791 | Bacteria | 13413 |
| 51 | Ga0055530_10004190 | 3300003791 | Bacteria | 7597 |
| 52 | Ga0055530_10009204 | 3300003791 | Bacteria | 3831 |
| 53 | Ga0055540_1000056 | 3300003792 | Bacteria | 139732 |
| 54 | Ga0055540_1000059 | 3300003792 | Bacteria | 132075 |
| 55 | Ga0055540_1000511 | 3300003792 | Bacteria | 29333 |
| 56 | Ga0055540_1001809 | 3300003792 | Bacteria | 12128 |
| 57 | Ga0055540_1006362 | 3300003792 | Bacteria | 4702 |
| 58 | Ga0055540_1015290 | 3300003792 | Bacteria | 2244 |
| 59 | Ga0055531_10001013 | 3300003794 | Bacteria | 22261 |
| 60 | Ga0055531_10001080 | 3300003794 | Bacteria | 21409 |
| 61 | Ga0055531_10001126 | 3300003794 | Bacteria | 20696 |
| 62 | Ga0055531_10001730 | 3300003794 | Bacteria | 15622 |
| 63 | Ga0055531_10002107 | 3300003794 | Bacteria | 13679 |
| 64 | Ga0055531_10003087 | 3300003794 | Bacteria | 10768 |
| 65 | Ga0055531_10007677 | 3300003794 | Bacteria | 5830 |
| 66 | Ga0055531_10008253 | 3300003794 | Bacteria | 5537 |
| 67 | Ga0055531_10009600 | 3300003794 | Bacteria | 4928 |
| 68 | Ga0055543_1000144 | 3300004625 | Bacteria | 59417 |
| 69 | Ga0065165_1000290 | 3300005262 | Bacteria | 85623 |
| 70 | Ga0065165_1001688 | 3300005262 | Bacteria | 22283 |
| 71 | Ga0065165_1004995 | 3300005262 | Bacteria | 7773 |
| 72 | Ga0065165_1024955 | 3300005262 | Bacteria | 1997 |
| 73 | Ga0065704_10212318 | 3300005289 | Bacteria | 1104 |
| 74 | Ga0065715_10118213 | 3300005293 | Bacteria | 2322 |
| 75 | Ga0065707_10096400 | 3300005295 | Bacteria | 3273 |
| 76 | Ga0070658_10013228 | 3300005327 | Bacteria | 6620 |
| 77 | Ga0070658_10027912 | 3300005327 | Bacteria | 4530 |
| 78 | Ga0070658_10119931 | 3300005327 | Bacteria | 2185 |
| 79 | Ga0070676_10004505 | 3300005328 | Bacteria | 7334 |
| 80 | Ga0070676_10017357 | 3300005328 | Bacteria | 3984 |
| 81 | Ga0070670_100013930 | 3300005331 | Bacteria | 6895 |
| 82 | Ga0070670_100067762 | 3300005331 | Bacteria | 3062 |
| 83 | Ga0070677_10004821 | 3300005333 | Bacteria | 4426 |
| 84 | Ga0070677_10005340 | 3300005333 | Bacteria | 4229 |
| 85 | Ga0068869_100009917 | 3300005334 | Bacteria | 6189 |
| 86 | Ga0068869_100198011 | 3300005334 | Bacteria | 1583 |
| 87 | Ga0068869_100201887 | 3300005334 | Bacteria | 1568 |
| 88 | Ga0068869_100224963 | 3300005334 | Bacteria | 1489 |
| 89 | Ga0070680_100112876 | 3300005336 | Bacteria | 2263 |
| 90 | Ga0068868_100003620 | 3300005338 | Bacteria | 10778 |
| 91 | Ga0068868_100028882 | 3300005338 | Bacteria | 4245 |
| 92 | Ga0068868_100031863 | 3300005338 | Bacteria | 4053 |
| 93 | Ga0068868_100320367 | 3300005338 | Bacteria | 1321 |
| 94 | Ga0068868_100546121 | 3300005338 | Bacteria | 1021 |
| 95 | Ga0070660_100016356 | 3300005339 | Bacteria | 5383 |
| 96 | Ga0070687_100101420 | 3300005343 | Bacteria | 1612 |
| 97 | Ga0070661_100001284 | 3300005344 | Bacteria | 17642 |
| 98 | Ga0070661_100174483 | 3300005344 | Bacteria | 1634 |
| 99 | Ga0070668_100206409 | 3300005347 | Bacteria | 1614 |
| 100 | Ga0070669_100006711 | 3300005353 | Bacteria | 8286 |
| 101 | Ga0070675_100000649 | 3300005354 | Bacteria | 24051 |
| 102 | Ga0070675_100002638 | 3300005354 | Bacteria | 13478 |
| 103 | Ga0070675_100009330 | 3300005354 | Bacteria | 7631 |
| 104 | Ga0070675_100215755 | 3300005354 | Bacteria | 1669 |
| 105 | Ga0070671_100008484 | 3300005355 | Bacteria | 8235 |
| 106 | Ga0070671_100028189 | 3300005355 | Bacteria | 4624 |
| 107 | Ga0070671_100105561 | 3300005355 | Bacteria | 2364 |
| 108 | Ga0070674_100026754 | 3300005356 | Bacteria | 3772 |
| 109 | Ga0070674_100065348 | 3300005356 | Bacteria | 2553 |
| 110 | Ga0070673_100007348 | 3300005364 | Bacteria | 7257 |
| 111 | Ga0070673_100008721 | 3300005364 | Bacteria | 6766 |
| 112 | Ga0070673_100025419 | 3300005364 | Bacteria | 4358 |
| 113 | Ga0070673_100078009 | 3300005364 | Bacteria | 2678 |
| 114 | Ga0070673_100498034 | 3300005364 | Bacteria | 1102 |
| 115 | Ga0070688_100087771 | 3300005365 | Bacteria | 2027 |
| 116 | Ga0070659_100032212 | 3300005366 | Bacteria | 4065 |
| 117 | Ga0070659_100331302 | 3300005366 | Bacteria | 1274 |
| 118 | Ga0070667_100008076 | 3300005367 | Bacteria | 8728 |
| 119 | Ga0070667_100020719 | 3300005367 | Bacteria | 5460 |
| 120 | Ga0070667_100160063 | 3300005367 | Bacteria | 1982 |
| 121 | Ga0070667_100321755 | 3300005367 | Bacteria | 1396 |
| 122 | Ga0070700_100006774 | 3300005441 | Bacteria | 6141 |
| 123 | Ga0070663_100334964 | 3300005455 | Bacteria | 1221 |
| 124 | Ga0070678_100124819 | 3300005456 | Bacteria | 2036 |
| 125 | Ga0070662_100006549 | 3300005457 | Bacteria | 7513 |
| 126 | Ga0070662_100006860 | 3300005457 | Bacteria | 7369 |
| 127 | Ga0070662_100017731 | 3300005457 | Bacteria | 4804 |
| 128 | Ga0070662_100027761 | 3300005457 | Bacteria | 3934 |
| 129 | Ga0068867_100006375 | 3300005459 | Bacteria | 8341 |
| 130 | Ga0068867_100038141 | 3300005459 | Bacteria | 3497 |
| 131 | Ga0070706_100013199 | 3300005467 | Bacteria | 7644 |
| 132 | Ga0070706_100195888 | 3300005467 | Bacteria | 1888 |
| 133 | Ga0070707_100014896 | 3300005468 | Bacteria | 7294 |
| 134 | Ga0070679_100017318 | 3300005530 | Bacteria | 6974 |
| 135 | Ga0068853_100028973 | 3300005539 | Bacteria | 4662 |
| 136 | Ga0068853_100259527 | 3300005539 | Bacteria | 1597 |
| 137 | Ga0068853_100262503 | 3300005539 | Bacteria | 1588 |
| 138 | Ga0070672_100000177 | 3300005543 | Bacteria | 35110 |
| 139 | Ga0070672_100035185 | 3300005543 | Bacteria | 3806 |
| 140 | Ga0070665_100038155 | 3300005548 | Bacteria | 4829 |
| 141 | Ga0070665_100184237 | 3300005548 | Bacteria | 2089 |
| 142 | Ga0070665_100279330 | 3300005548 | Bacteria | 1672 |
| 143 | Ga0068855_100009119 | 3300005563 | Bacteria | 11985 |
| 144 | Ga0068855_100019700 | 3300005563 | Bacteria | 8102 |
| 145 | Ga0068855_100107009 | 3300005563 | Bacteria | 3213 |
| 146 | Ga0070664_100015850 | 3300005564 | Bacteria | 6169 |
| 147 | Ga0068857_100000906 | 3300005577 | Bacteria | 22345 |
| 148 | Ga0068857_100043606 | 3300005577 | Bacteria | 3979 |
| 149 | Ga0068854_100002536 | 3300005578 | Bacteria | 11298 |
| 150 | Ga0068856_100000135 | 3300005614 | Bacteria | 74419 |
| 151 | Ga0068856_100160035 | 3300005614 | Bacteria | 2262 |
| 152 | Ga0068852_100007509 | 3300005616 | Bacteria | 7959 |
| 153 | Ga0068852_100066113 | 3300005616 | Bacteria | 3157 |
| 154 | Ga0068852_100225701 | 3300005616 | Bacteria | 1783 |
| 155 | Ga0068852_100269325 | 3300005616 | Bacteria | 1638 |
| 156 | Ga0068859_100011878 | 3300005617 | Bacteria | 8749 |
| 157 | Ga0068859_100228069 | 3300005617 | Bacteria | 1951 |
| 158 | Ga0068864_100000826 | 3300005618 | Bacteria | 26103 |
| 159 | Ga0068864_100030188 | 3300005618 | Bacteria | 4594 |
| 160 | Ga0068864_100135502 | 3300005618 | Bacteria | 2217 |
| 161 | Ga0068861_100002005 | 3300005719 | Bacteria | 13174 |
| 162 | Ga0068861_100199929 | 3300005719 | Bacteria | 1677 |
| 163 | Ga0068851_10001974 | 3300005834 | Bacteria | 9014 |
| 164 | Ga0068870_10047892 | 3300005840 | Bacteria | 2249 |
| 165 | Ga0068870_10083320 | 3300005840 | Bacteria | 1773 |
| 166 | Ga0068863_100210596 | 3300005841 | Bacteria | 1872 |
| 167 | Ga0068858_100005422 | 3300005842 | Bacteria | 12496 |
| 168 | Ga0068862_100017745 | 3300005844 | Bacteria | 5923 |
| 169 | Ga0075365_10007547 | 3300006038 | Bacteria | 6104 |
| 170 | Ga0075365_10028773 | 3300006038 | Bacteria | 3546 |
| 171 | Ga0075365_10042812 | 3300006038 | Bacteria | 2962 |
| 172 | Ga0075368_10010843 | 3300006042 | Bacteria | 3305 |
| 173 | Ga0075368_10014475 | 3300006042 | Bacteria | 2915 |
| 174 | Ga0075368_10072169 | 3300006042 | Bacteria | 1396 |
| 175 | Ga0075363_100232698 | 3300006048 | Bacteria | 1058 |
| 176 | Ga0075432_10008618 | 3300006058 | Bacteria | 3481 |
| 177 | Ga0075362_10000958 | 3300006177 | Bacteria | 8822 |
| 178 | Ga0075362_10000960 | 3300006177 | Bacteria | 8815 |
| 179 | Ga0075362_10004300 | 3300006177 | Bacteria | 5093 |
| 180 | Ga0075362_10013783 | 3300006177 | Bacteria | 3245 |
| 181 | Ga0075362_10116435 | 3300006177 | Bacteria | 1262 |
| 182 | Ga0075367_10003979 | 3300006178 | Bacteria | 7136 |
| 183 | Ga0075367_10088453 | 3300006178 | Bacteria | 1882 |
| 184 | Ga0075367_10198950 | 3300006178 | Bacteria | 1252 |
| 185 | Ga0075369_10013819 | 3300006186 | Bacteria | 3213 |
| 186 | Ga0075366_10000550 | 3300006195 | Bacteria | 17475 |
| 187 | Ga0075366_10001062 | 3300006195 | Bacteria | 13471 |
| 188 | Ga0075366_10008558 | 3300006195 | Bacteria | 5693 |
| 189 | Ga0075366_10013928 | 3300006195 | Bacteria | 4585 |
| 190 | Ga0075366_10019395 | 3300006195 | Bacteria | 3934 |
| 191 | Ga0075366_10019789 | 3300006195 | Bacteria | 3901 |
| 192 | Ga0075366_10022374 | 3300006195 | Bacteria | 3677 |
| 193 | Ga0075366_10037033 | 3300006195 | Bacteria | 2878 |
| 194 | Ga0075366_10050962 | 3300006195 | Bacteria | 2459 |
| 195 | Ga0075366_10135180 | 3300006195 | Bacteria | 1489 |
| 196 | Ga0075370_10000148 | 3300006353 | Bacteria | 23924 |
| 197 | Ga0075370_10000920 | 3300006353 | Bacteria | 12087 |
| 198 | Ga0075370_10003393 | 3300006353 | Bacteria | 7571 |
| 199 | Ga0075370_10011423 | 3300006353 | Bacteria | 4666 |
| 200 | Ga0075370_10057014 | 3300006353 | Bacteria | 2220 |
| 201 | Ga0075370_10060981 | 3300006353 | Bacteria | 2149 |
| 202 | Ga0075370_10080275 | 3300006353 | Bacteria | 1874 |
| 203 | Ga0075370_10129776 | 3300006353 | Bacteria | 1470 |
| 204 | Ga0075370_10179561 | 3300006353 | Bacteria | 1245 |
| 205 | Ga0075370_10207239 | 3300006353 | Bacteria | 1157 |
| 206 | Ga0068871_100027888 | 3300006358 | Bacteria | 4422 |
| 207 | Ga0075430_100065409 | 3300006846 | Bacteria | 3055 |
| 208 | Ga0075430_100220709 | 3300006846 | Bacteria | 1573 |
| 209 | Ga0075431_100528281 | 3300006847 | Bacteria | 1169 |
| 210 | Ga0075429_100001600 | 3300006880 | Bacteria | 18663 |
| 211 | Ga0068865_100245777 | 3300006881 | Bacteria | 1410 |
| 212 | Ga0097620_100011878 | 3300006931 | Bacteria | 8749 |
| 213 | Ga0097620_100228061 | 3300006931 | Bacteria | 1951 |
| 214 | Ga0099823_1000065 | 3300006944 | Bacteria | 50323 |
| 215 | Ga0079104_1000073 | 3300006946 | Bacteria | 152269 |
| 216 | Ga0079104_1013281 | 3300006946 | Bacteria | 2546 |
| 217 | Ga0099826_10021938 | 3300006948 | Bacteria | 4776 |
| 218 | Ga0105240_10010486 | 3300009093 | Bacteria | 13026 |
| 219 | Ga0105240_10019736 | 3300009093 | Bacteria | 9005 |
| 220 | Ga0105240_10574497 | 3300009093 | Bacteria | 1244 |
| 221 | Ga0105245_10080390 | 3300009098 | Bacteria | 2978 |
| 222 | Ga0105245_10103504 | 3300009098 | Bacteria | 2638 |
| 223 | Ga0105245_10167552 | 3300009098 | Bacteria | 2089 |
| 224 | Ga0105243_10001635 | 3300009148 | Bacteria | 19469 |
| 225 | Ga0105243_10003223 | 3300009148 | Bacteria | 13332 |
| 226 | Ga0105243_10022613 | 3300009148 | Bacteria | 4780 |
| 227 | Ga0105243_10081328 | 3300009148 | Bacteria | 2645 |
| 228 | Ga0105243_10160487 | 3300009148 | Bacteria | 1938 |
| 229 | Ga0105241_10206459 | 3300009174 | Bacteria | 1644 |
| 230 | Ga0105242_10056615 | 3300009176 | Bacteria | 3209 |
| 231 | Ga0105248_10003890 | 3300009177 | Bacteria | 16508 |
| 232 | Ga0105248_10031182 | 3300009177 | Bacteria | 5959 |
| 233 | Ga0105248_10217621 | 3300009177 | Bacteria | 2151 |
| 234 | Ga0105237_10000646 | 3300009545 | Bacteria | 48623 |
| 235 | Ga0105237_10022295 | 3300009545 | Bacteria | 6498 |
| 236 | Ga0105237_10068746 | 3300009545 | Bacteria | 3536 |
| 237 | Ga0105238_10026742 | 3300009551 | Bacteria | 5881 |
| 238 | Ga0105238_10037676 | 3300009551 | Bacteria | 4915 |
| 239 | Ga0105238_10082294 | 3300009551 | Bacteria | 3209 |
| 240 | Ga0105249_10106595 | 3300009553 | Bacteria | 2644 |
| 241 | Ga0105249_10216666 | 3300009553 | Bacteria | 1882 |
| 242 | Ga0105239_10001160 | 3300010375 | Bacteria | 36170 |
| 243 | Ga0105239_10088990 | 3300010375 | Bacteria | 3404 |
| 244 | Ga0105246_10035063 | 3300011119 | Bacteria | 3350 |
| 245 | Ga0105246_10085320 | 3300011119 | Bacteria | 2261 |
| 246 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 247 | Ga0157373_10004013 | 3300013100 | Bacteria | 11100 |
| 248 | Ga0157373_10114421 | 3300013100 | Bacteria | 1896 |
| 249 | Ga0157370_10022622 | 3300013104 | Bacteria | 6254 |
| 250 | Ga0157370_10370591 | 3300013104 | Bacteria | 1319 |
| 251 | Ga0157369_10020212 | 3300013105 | Bacteria | 7444 |
| 252 | Ga0157369_10190275 | 3300013105 | Bacteria | 2157 |
| 253 | Ga0157374_10056021 | 3300013296 | Bacteria | 3680 |
| 254 | Ga0157378_10074051 | 3300013297 | Bacteria | 3064 |
| 255 | Ga0157378_10452883 | 3300013297 | Bacteria | 1274 |
| 256 | Ga0163162_10035363 | 3300013306 | Bacteria | 4976 |
| 257 | Ga0163162_10197493 | 3300013306 | Bacteria | 2141 |
| 258 | Ga0163162_10381835 | 3300013306 | Bacteria | 1542 |
| 259 | Ga0157372_10291506 | 3300013307 | Bacteria | 1898 |
| 260 | Ga0157372_10328667 | 3300013307 | Bacteria | 1780 |
| 261 | Ga0157372_10364568 | 3300013307 | Bacteria | 1684 |
| 262 | Ga0157375_10007001 | 3300013308 | Bacteria | 9846 |
| 263 | Ga0157375_10058836 | 3300013308 | Bacteria | 3804 |
| 264 | Ga0163163_10292368 | 3300014325 | Bacteria | 1681 |
| 265 | Ga0182008_10000617 | 3300014497 | Bacteria | 26148 |
| 266 | Ga0182008_10001994 | 3300014497 | Bacteria | 13102 |
| 267 | Ga0182008_10012188 | 3300014497 | Bacteria | 4543 |
| 268 | Ga0182008_10118960 | 3300014497 | Bacteria | 1312 |
| 269 | Ga0182008_10153589 | 3300014497 | Bacteria | 1155 |
| 270 | Ga0157377_10000044 | 3300014745 | Bacteria | 100420 |
| 271 | Ga0157379_10374713 | 3300014968 | Bacteria | 1305 |
| 272 | Ga0157376_10004287 | 3300014969 | Bacteria | 9906 |
| 273 | Ga0157376_10182905 | 3300014969 | Bacteria | 1917 |
| 274 | Ga0182006_1000976 | 3300015261 | Bacteria | 18948 |
| 275 | Ga0182006_1051814 | 3300015261 | Bacteria | 1578 |
| 276 | Ga0182006_1064144 | 3300015261 | Bacteria | 1378 |
| 277 | Ga0182007_10000481 | 3300015262 | Bacteria | 24034 |
| 278 | Ga0182007_10001306 | 3300015262 | Bacteria | 13481 |
| 279 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 280 | Ga0163161_10003002 | 3300017792 | Bacteria | 11918 |
| 281 | Ga0163161_10399346 | 3300017792 | Bacteria | 1102 |
| 282 | Ga0213872_10000233 | 3300021361 | Bacteria | 48866 |
| 283 | Ga0213872_10007480 | 3300021361 | Bacteria | 5371 |
| 284 | Ga0213872_10053399 | 3300021361 | Bacteria | 1833 |
| 285 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 286 | Ga0209436_101107 | 3300025208 | Bacteria | 10031 |
| 287 | Ga0209674_100015 | 3300025226 | Bacteria | 697299 |
| 288 | Ga0209672_100307 | 3300025228 | Bacteria | 32865 |
| 289 | Ga0209147_101110 | 3300025229 | Bacteria | 11186 |
| 290 | Ga0209563_100017 | 3300025230 | Bacteria | 796449 |
| 291 | Ga0207427_102838 | 3300025231 | Bacteria | 4196 |
| 292 | Ga0209258_100025 | 3300025242 | Bacteria | 534777 |
| 293 | Ga0209258_100093 | 3300025242 | Bacteria | 223559 |
| 294 | Ga0209258_100881 | 3300025242 | Bacteria | 15759 |
| 295 | Ga0207425_1000886 | 3300025245 | Bacteria | 14554 |
| 296 | Ga0207425_1002809 | 3300025245 | Bacteria | 5879 |
| 297 | Ga0207425_1003373 | 3300025245 | Bacteria | 5135 |
| 298 | Ga0207425_1003655 | 3300025245 | Bacteria | 4843 |
| 299 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 300 | Ga0209646_1000229 | 3300025246 | Bacteria | 59524 |
| 301 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 302 | Ga0209026_1000028 | 3300025250 | Bacteria | 341399 |
| 303 | Ga0209677_100037 | 3300025253 | Bacteria | 286702 |
| 304 | Ga0209677_100113 | 3300025253 | Bacteria | 84174 |
| 305 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 306 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 307 | Ga0209759_1000021 | 3300025256 | Bacteria | 341399 |
| 308 | Ga0209759_1000844 | 3300025256 | Bacteria | 23901 |
| 309 | Ga0209759_1002258 | 3300025256 | Bacteria | 8760 |
| 310 | Ga0209129_1000469 | 3300025258 | Bacteria | 29599 |
| 311 | Ga0209129_1000692 | 3300025258 | Bacteria | 22110 |
| 312 | Ga0209129_1001207 | 3300025258 | Bacteria | 14867 |
| 313 | Ga0209129_1006588 | 3300025258 | Bacteria | 3703 |
| 314 | Ga0209129_1012548 | 3300025258 | Bacteria | 1935 |
| 315 | Ga0209565_1000016 | 3300025263 | Bacteria | 477707 |
| 316 | Ga0209565_1000117 | 3300025263 | Bacteria | 113536 |
| 317 | Ga0209565_1000203 | 3300025263 | Bacteria | 69824 |
| 318 | Ga0209565_1000388 | 3300025263 | Bacteria | 37308 |
| 319 | Ga0209565_1000923 | 3300025263 | Bacteria | 15607 |
| 320 | Ga0209455_1000166 | 3300025272 | Bacteria | 113101 |
| 321 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 322 | Ga0209673_1000218 | 3300025273 | Bacteria | 113542 |
| 323 | Ga0209673_1000555 | 3300025273 | Bacteria | 60035 |
| 324 | Ga0209673_1000659 | 3300025273 | Bacteria | 50504 |
| 325 | Ga0209673_1003795 | 3300025273 | Bacteria | 8581 |
| 326 | Ga0209673_1009241 | 3300025273 | Bacteria | 4296 |
| 327 | Ga0209673_1014492 | 3300025273 | Bacteria | 3047 |
| 328 | Ga0209673_1033602 | 3300025273 | Bacteria | 1561 |
| 329 | Ga0209130_1000104 | 3300025284 | Bacteria | 136694 |
| 330 | Ga0209130_1000161 | 3300025284 | Bacteria | 100375 |
| 331 | Ga0209130_1000247 | 3300025284 | Bacteria | 68383 |
| 332 | Ga0209130_1000526 | 3300025284 | Bacteria | 38634 |
| 333 | Ga0209130_1003544 | 3300025284 | Bacteria | 6545 |
| 334 | Ga0209675_1000099 | 3300025291 | Bacteria | 128911 |
| 335 | Ga0209675_1000113 | 3300025291 | Bacteria | 113542 |
| 336 | Ga0209675_1000230 | 3300025291 | Bacteria | 56831 |
| 337 | Ga0209675_1000885 | 3300025291 | Bacteria | 19265 |
| 338 | Ga0209675_1011276 | 3300025291 | Bacteria | 2976 |
| 339 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 340 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 341 | Ga0209676_1000367 | 3300025292 | Bacteria | 84271 |
| 342 | Ga0209676_1002155 | 3300025292 | Bacteria | 14897 |
| 343 | Ga0209676_1015790 | 3300025292 | Bacteria | 2761 |
| 344 | Ga0209676_1016222 | 3300025292 | Bacteria | 2700 |
| 345 | Ga0209025_1000194 | 3300025294 | Bacteria | 148593 |
| 346 | Ga0209025_1000561 | 3300025294 | Bacteria | 68208 |
| 347 | Ga0209025_1000665 | 3300025294 | Bacteria | 59423 |
| 348 | Ga0209025_1001618 | 3300025294 | Bacteria | 28133 |
| 349 | Ga0209025_1012448 | 3300025294 | Bacteria | 5448 |
| 350 | Ga0209025_1012982 | 3300025294 | Bacteria | 5278 |
| 351 | Ga0209025_1015106 | 3300025294 | Bacteria | 4685 |
| 352 | Ga0209025_1016816 | 3300025294 | Bacteria | 4276 |
| 353 | Ga0209025_1051324 | 3300025294 | Bacteria | 1640 |
| 354 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 355 | Ga0209564_1000344 | 3300025295 | Bacteria | 88136 |
| 356 | Ga0209564_1000555 | 3300025295 | Bacteria | 59942 |
| 357 | Ga0209564_1000777 | 3300025295 | Bacteria | 44339 |
| 358 | Ga0209564_1002809 | 3300025295 | Bacteria | 12946 |
| 359 | Ga0209564_1009693 | 3300025295 | Bacteria | 4540 |
| 360 | Ga0209758_1000124 | 3300025297 | Bacteria | 189933 |
| 361 | Ga0209758_1000199 | 3300025297 | Bacteria | 133164 |
| 362 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 363 | Ga0209050_1000072 | 3300025298 | Bacteria | 293619 |
| 364 | Ga0209050_1000133 | 3300025298 | Bacteria | 184688 |
| 365 | Ga0209050_1001503 | 3300025298 | Bacteria | 24644 |
| 366 | Ga0209050_1001949 | 3300025298 | Bacteria | 19549 |
| 367 | Ga0209050_1004416 | 3300025298 | Bacteria | 9513 |
| 368 | Ga0209050_1004742 | 3300025298 | Bacteria | 8989 |
| 369 | Ga0209050_1011534 | 3300025298 | Bacteria | 4172 |
| 370 | Ga0209050_1026920 | 3300025298 | Bacteria | 1910 |
| 371 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 372 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 373 | Ga0209256_1000151 | 3300025299 | Bacteria | 145299 |
| 374 | Ga0209256_1000256 | 3300025299 | Bacteria | 94699 |
| 375 | Ga0209256_1009778 | 3300025299 | Bacteria | 4136 |
| 376 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 377 | Ga0207426_1000156 | 3300025302 | Bacteria | 178646 |
| 378 | Ga0207426_1000315 | 3300025302 | Bacteria | 94699 |
| 379 | Ga0207426_1001121 | 3300025302 | Bacteria | 24462 |
| 380 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 381 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 382 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 383 | Ga0209051_1000068 | 3300025303 | Bacteria | 220063 |
| 384 | Ga0209051_1000172 | 3300025303 | Bacteria | 117180 |
| 385 | Ga0209051_1000535 | 3300025303 | Bacteria | 46757 |
| 386 | Ga0209051_1000948 | 3300025303 | Bacteria | 28532 |
| 387 | Ga0209051_1001202 | 3300025303 | Bacteria | 23394 |
| 388 | Ga0209051_1005351 | 3300025303 | Bacteria | 7541 |
| 389 | Ga0209051_1033775 | 3300025303 | Bacteria | 1928 |
| 390 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 391 | Ga0209257_1000037 | 3300025304 | Bacteria | 612915 |
| 392 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 393 | Ga0209257_1000108 | 3300025304 | Bacteria | 240229 |
| 394 | Ga0209257_1000146 | 3300025304 | Bacteria | 194261 |
| 395 | Ga0209257_1001593 | 3300025304 | Bacteria | 25967 |
| 396 | Ga0209257_1001704 | 3300025304 | Bacteria | 24663 |
| 397 | Ga0209257_1001972 | 3300025304 | Bacteria | 22091 |
| 398 | Ga0207655_1000974 | 3300025728 | Bacteria | 29497 |
| 399 | Ga0207682_10037399 | 3300025893 | Bacteria | 1967 |
| 400 | Ga0207682_10137617 | 3300025893 | Bacteria | 1094 |
| 401 | Ga0207642_10004964 | 3300025899 | Bacteria | 4311 |
| 402 | Ga0207688_10091857 | 3300025901 | Bacteria | 1744 |
| 403 | Ga0207688_10096340 | 3300025901 | Bacteria | 1704 |
| 404 | Ga0207680_10003414 | 3300025903 | Bacteria | 7491 |
| 405 | Ga0207645_10008378 | 3300025907 | Bacteria | 7212 |
| 406 | Ga0207643_10028248 | 3300025908 | Bacteria | 3114 |
| 407 | Ga0207643_10053955 | 3300025908 | Bacteria | 2284 |
| 408 | Ga0207684_10000714 | 3300025910 | Bacteria | 39062 |
| 409 | Ga0207695_10010328 | 3300025913 | Bacteria | 11432 |
| 410 | Ga0207695_10047103 | 3300025913 | Bacteria | 4565 |
| 411 | Ga0207695_10059939 | 3300025913 | Bacteria | 3944 |
| 412 | Ga0207695_10157669 | 3300025913 | Bacteria | 2204 |
| 413 | Ga0207695_10216327 | 3300025913 | Bacteria | 1825 |
| 414 | Ga0207671_10003088 | 3300025914 | Bacteria | 16998 |
| 415 | Ga0207671_10228065 | 3300025914 | Bacteria | 1461 |
| 416 | Ga0207660_10146459 | 3300025917 | Bacteria | 1810 |
| 417 | Ga0207657_10064644 | 3300025919 | Bacteria | 3122 |
| 418 | Ga0207657_10084888 | 3300025919 | Bacteria | 2653 |
| 419 | Ga0207649_10001995 | 3300025920 | Bacteria | 11614 |
| 420 | Ga0207652_10300149 | 3300025921 | Bacteria | 1450 |
| 421 | Ga0207681_10016203 | 3300025923 | Bacteria | 4658 |
| 422 | Ga0207681_10049788 | 3300025923 | Bacteria | 2833 |
| 423 | Ga0207681_10071794 | 3300025923 | Bacteria | 2416 |
| 424 | Ga0207694_10093074 | 3300025924 | Bacteria | 2380 |
| 425 | Ga0207694_10118198 | 3300025924 | Bacteria | 2114 |
| 426 | Ga0207694_10127280 | 3300025924 | Bacteria | 2039 |
| 427 | Ga0207650_10001020 | 3300025925 | Bacteria | 21020 |
| 428 | Ga0207650_10007256 | 3300025925 | Bacteria | 7551 |
| 429 | Ga0207650_10043960 | 3300025925 | Bacteria | 3282 |
| 430 | Ga0207650_10097562 | 3300025925 | Bacteria | 2256 |
| 431 | Ga0207659_10000614 | 3300025926 | Bacteria | 21272 |
| 432 | Ga0207659_10004223 | 3300025926 | Bacteria | 8680 |
| 433 | Ga0207659_10089873 | 3300025926 | Bacteria | 2291 |
| 434 | Ga0207644_10001630 | 3300025931 | Bacteria | 14470 |
| 435 | Ga0207644_10122931 | 3300025931 | Bacteria | 1978 |
| 436 | Ga0207690_10006152 | 3300025932 | Bacteria | 7110 |
| 437 | Ga0207690_10139037 | 3300025932 | Bacteria | 1787 |
| 438 | Ga0207690_10144538 | 3300025932 | Bacteria | 1757 |
| 439 | Ga0207690_10267357 | 3300025932 | Bacteria | 1327 |
| 440 | Ga0207706_10013837 | 3300025933 | Bacteria | 7319 |
| 441 | Ga0207706_10034484 | 3300025933 | Bacteria | 4502 |
| 442 | Ga0207686_10059077 | 3300025934 | Bacteria | 2421 |
| 443 | Ga0207709_10000208 | 3300025935 | Bacteria | 76530 |
| 444 | Ga0207709_10000357 | 3300025935 | Bacteria | 46258 |
| 445 | Ga0207709_10001132 | 3300025935 | Bacteria | 19467 |
| 446 | Ga0207709_10007415 | 3300025935 | Bacteria | 6111 |
| 447 | Ga0207709_10073675 | 3300025935 | Bacteria | 2177 |
| 448 | Ga0207709_10121704 | 3300025935 | Bacteria | 1763 |
| 449 | Ga0207670_10031642 | 3300025936 | Bacteria | 3393 |
| 450 | Ga0207669_10023687 | 3300025937 | Bacteria | 3284 |
| 451 | Ga0207669_10258530 | 3300025937 | Bacteria | 1301 |
| 452 | Ga0207704_10178357 | 3300025938 | Bacteria | 1532 |
| 453 | Ga0207691_10007703 | 3300025940 | Bacteria | 10363 |
| 454 | Ga0207691_10015702 | 3300025940 | Bacteria | 7198 |
| 455 | Ga0207711_10014140 | 3300025941 | Bacteria | 6630 |
| 456 | Ga0207711_10174740 | 3300025941 | Bacteria | 1951 |
| 457 | Ga0207689_10008177 | 3300025942 | Bacteria | 9114 |
| 458 | Ga0207689_10008989 | 3300025942 | Bacteria | 8654 |
| 459 | Ga0207689_10088037 | 3300025942 | Bacteria | 2551 |
| 460 | Ga0207661_10244488 | 3300025944 | Bacteria | 1593 |
| 461 | Ga0207679_10000453 | 3300025945 | Bacteria | 28920 |
| 462 | Ga0207667_10082864 | 3300025949 | Bacteria | 3321 |
| 463 | Ga0207667_10116351 | 3300025949 | Bacteria | 2755 |
| 464 | Ga0207667_10130776 | 3300025949 | Bacteria | 2585 |
| 465 | Ga0207651_10000476 | 3300025960 | Bacteria | 16840 |
| 466 | Ga0207651_10011142 | 3300025960 | Bacteria | 5019 |
| 467 | Ga0207651_10062131 | 3300025960 | Bacteria | 2601 |
| 468 | Ga0207712_10195926 | 3300025961 | Bacteria | 1598 |
| 469 | Ga0207712_10330512 | 3300025961 | Bacteria | 1261 |
| 470 | Ga0207640_10059247 | 3300025981 | Bacteria | 2526 |
| 471 | Ga0207658_10022597 | 3300025986 | Bacteria | 4381 |
| 472 | Ga0207658_10107715 | 3300025986 | Bacteria | 2197 |
| 473 | Ga0207658_10257209 | 3300025986 | Bacteria | 1486 |
| 474 | Ga0207677_10006252 | 3300026023 | Bacteria | 6512 |
| 475 | Ga0207677_10008894 | 3300026023 | Bacteria | 5631 |
| 476 | Ga0207677_10029076 | 3300026023 | Bacteria | 3507 |
| 477 | Ga0207703_10003022 | 3300026035 | Bacteria | 14257 |
| 478 | Ga0207639_10221011 | 3300026041 | Bacteria | 1636 |
| 479 | Ga0207639_10343561 | 3300026041 | Bacteria | 1331 |
| 480 | Ga0207678_10043665 | 3300026067 | Bacteria | 3878 |
| 481 | Ga0207678_10092970 | 3300026067 | Bacteria | 2577 |
| 482 | Ga0207708_10045951 | 3300026075 | Bacteria | 3327 |
| 483 | Ga0207702_10000345 | 3300026078 | Bacteria | 53392 |
| 484 | Ga0207702_10307168 | 3300026078 | Bacteria | 1507 |
| 485 | Ga0207641_10164550 | 3300026088 | Bacteria | 2019 |
| 486 | Ga0207648_10008899 | 3300026089 | Bacteria | 9664 |
| 487 | Ga0207648_10028479 | 3300026089 | Bacteria | 4952 |
| 488 | Ga0207648_10069236 | 3300026089 | Bacteria | 3074 |
| 489 | Ga0207648_10161568 | 3300026089 | Bacteria | 1978 |
| 490 | Ga0207676_10000855 | 3300026095 | Bacteria | 23661 |
| 491 | Ga0207674_10019325 | 3300026116 | Bacteria | 7381 |
| 492 | Ga0207674_10049805 | 3300026116 | Bacteria | 4282 |
| 493 | Ga0207674_10080316 | 3300026116 | Bacteria | 3265 |
| 494 | Ga0207675_100000103 | 3300026118 | Bacteria | 67419 |
| 495 | Ga0207675_100148638 | 3300026118 | Bacteria | 2229 |
| 496 | Ga0207675_100495076 | 3300026118 | Bacteria | 1216 |
| 497 | Ga0207683_10016681 | 3300026121 | Bacteria | 6250 |
| 498 | Ga0207683_10022010 | 3300026121 | Bacteria | 5469 |
| 499 | Ga0207683_10078878 | 3300026121 | Bacteria | 2918 |
| 500 | Ga0207698_10005200 | 3300026142 | Bacteria | 8002 |
| 501 | Ga0207698_10100599 | 3300026142 | Bacteria | 2395 |
| 502 | Ga0209281_1000263 | 3300027111 | Bacteria | 101190 |
| 503 | Ga0209281_1017852 | 3300027111 | Bacteria | 1431 |
| 504 | Ga0209389_1001227 | 3300027296 | Bacteria | 17705 |
| 505 | Ga0209371_1005280 | 3300027312 | Bacteria | 5205 |
| 506 | Ga0209969_1007997 | 3300027360 | Bacteria | 1497 |
| 507 | Ga0209967_1002007 | 3300027364 | Bacteria | 2624 |
| 508 | Ga0209996_1010143 | 3300027395 | Bacteria | 1247 |
| 509 | Ga0209968_1000714 | 3300027526 | Bacteria | 5113 |
| 510 | Ga0209999_1008888 | 3300027543 | Bacteria | 1817 |
| 511 | Ga0209282_1000720 | 3300027666 | Bacteria | 16583 |
| 512 | Ga0209971_1015227 | 3300027682 | Bacteria | 1823 |
| 513 | Ga0209966_1000017 | 3300027695 | Bacteria | 71183 |
| 514 | Ga0209974_10012934 | 3300027876 | Bacteria | 2785 |
| 515 | Ga0209974_10034322 | 3300027876 | Bacteria | 1685 |
| 516 | Ga0207428_10027528 | 3300027907 | Bacteria | 4733 |
| 517 | Ga0268266_10010311 | 3300028379 | Bacteria | 8173 |
| 518 | Ga0268266_10100787 | 3300028379 | Bacteria | 2545 |
| 519 | Ga0268266_10231970 | 3300028379 | Bacteria | 1700 |
| 520 | Ga0268264_10445553 | 3300028381 | Bacteria | 1253 |
| 521 | Ga0268264_10511588 | 3300028381 | Bacteria | 1172 |
| 522 | Ga0265336_10000010 | 3300028666 | Bacteria | 277947 |
| 523 | Ga0307517_10002030 | 3300028786 | Bacteria | 32950 |
| 524 | Ga0307517_10103305 | 3300028786 | Bacteria | 2228 |
| 525 | Ga0307517_10140067 | 3300028786 | Bacteria | 1702 |
| 526 | Ga0307515_10000281 | 3300028794 | Bacteria | 125306 |
| 527 | Ga0307515_10000399 | 3300028794 | Bacteria | 105068 |
| 528 | Ga0307515_10002930 | 3300028794 | Bacteria | 36206 |
| 529 | Ga0307515_10003462 | 3300028794 | Bacteria | 33182 |
| 530 | Ga0307515_10011834 | 3300028794 | Bacteria | 16504 |
| 531 | Ga0307515_10011860 | 3300028794 | Bacteria | 16480 |
| 532 | Ga0307515_10018081 | 3300028794 | Bacteria | 12791 |
| 533 | Ga0307515_10049174 | 3300028794 | Bacteria | 6354 |
| 534 | Ga0307515_10066254 | 3300028794 | Bacteria | 5007 |
| 535 | Ga0307515_10068831 | 3300028794 | Bacteria | 4854 |
| 536 | Ga0307515_10184951 | 3300028794 | Bacteria | 2017 |
| 537 | Ga0307515_10218326 | 3300028794 | Bacteria | 1732 |
| 538 | Ga0307515_10235047 | 3300028794 | Bacteria | 1616 |
| 539 | Ga0307515_10236578 | 3300028794 | Bacteria | 1606 |
| 540 | Ga0265324_10001637 | 3300029957 | Bacteria | 12387 |
| 541 | Ga0268256_1005278 | 3300030500 | Bacteria | 5119 |
| 542 | Ga0307512_10011191 | 3300030522 | Bacteria | 8515 |
| 543 | Ga0307512_10074820 | 3300030522 | Bacteria | 2483 |
| 544 | Ga0314311_1212901 | 3300030733 | Bacteria | 4766 |
| 545 | Ga0316183_1188808 | 3300030742 | Bacteria | 5467 |
| 546 | Ga0316181_1054429 | 3300030744 | Bacteria | 1600 |
| 547 | Ga0316181_1057358 | 3300030744 | Bacteria | 2139 |
| 548 | Ga0265330_10000046 | 3300031235 | Bacteria | 108853 |
| 549 | Ga0265330_10041662 | 3300031235 | Bacteria | 2035 |
| 550 | Ga0265332_10000005 | 3300031238 | Bacteria | 377525 |
| 551 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 552 | Ga0265332_10012523 | 3300031238 | Bacteria | 3763 |
| 553 | Ga0265328_10004495 | 3300031239 | Bacteria | 6053 |
| 554 | Ga0265328_10014090 | 3300031239 | Bacteria | 3154 |
| 555 | Ga0265325_10002230 | 3300031241 | Bacteria | 13143 |
| 556 | Ga0265325_10063000 | 3300031241 | Bacteria | 1877 |
| 557 | Ga0265340_10012777 | 3300031247 | Bacteria | 4431 |
| 558 | Ga0265331_10001815 | 3300031250 | Bacteria | 15137 |
| 559 | Ga0265327_10000035 | 3300031251 | Bacteria | 314419 |
| 560 | Ga0265327_10000327 | 3300031251 | Bacteria | 90721 |
| 561 | Ga0265327_10000536 | 3300031251 | Bacteria | 65055 |
| 562 | Ga0265327_10037546 | 3300031251 | Bacteria | 2651 |
| 563 | Ga0265316_10000556 | 3300031344 | Bacteria | 41880 |
| 564 | Ga0307513_10000029 | 3300031456 | Bacteria | 191823 |
| 565 | Ga0307513_10021439 | 3300031456 | Bacteria | 7627 |
| 566 | Ga0307513_10052787 | 3300031456 | Bacteria | 4375 |
| 567 | Ga0307513_10140467 | 3300031456 | Bacteria | 2342 |
| 568 | Ga0307509_10000249 | 3300031507 | Bacteria | 87094 |
| 569 | Ga0307509_10004869 | 3300031507 | Bacteria | 19042 |
| 570 | Ga0307509_10053300 | 3300031507 | Bacteria | 4314 |
| 571 | Ga0307509_10083981 | 3300031507 | Bacteria | 3281 |
| 572 | Ga0307509_10208364 | 3300031507 | Bacteria | 1783 |
| 573 | Ga0307408_100042041 | 3300031548 | Bacteria | 3243 |
| 574 | Ga0307408_100087573 | 3300031548 | Bacteria | 2343 |
| 575 | Ga0307408_100095526 | 3300031548 | Bacteria | 2253 |
| 576 | Ga0307508_10000143 | 3300031616 | Bacteria | 85046 |
| 577 | Ga0307508_10000216 | 3300031616 | Bacteria | 69990 |
| 578 | Ga0307508_10001407 | 3300031616 | Bacteria | 27099 |
| 579 | Ga0307508_10038603 | 3300031616 | Bacteria | 4291 |
| 580 | Ga0307514_10001116 | 3300031649 | Bacteria | 37410 |
| 581 | Ga0307514_10006402 | 3300031649 | Bacteria | 10268 |
| 582 | Ga0307514_10135889 | 3300031649 | Bacteria | 1683 |
| 583 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 584 | Ga0265314_10005007 | 3300031711 | Bacteria | 12071 |
| 585 | Ga0265342_10014895 | 3300031712 | Bacteria | 5141 |
| 586 | Ga0307516_10000065 | 3300031730 | Bacteria | 113187 |
| 587 | Ga0307516_10000236 | 3300031730 | Bacteria | 71013 |
| 588 | Ga0307516_10002712 | 3300031730 | Bacteria | 23333 |
| 589 | Ga0307516_10003015 | 3300031730 | Bacteria | 21972 |
| 590 | Ga0307516_10010074 | 3300031730 | Bacteria | 10453 |
| 591 | Ga0307516_10072223 | 3300031730 | Bacteria | 3311 |
| 592 | Ga0307516_10087141 | 3300031730 | Bacteria | 2957 |
| 593 | Ga0307405_10028914 | 3300031731 | Bacteria | 3234 |
| 594 | Ga0307405_10031433 | 3300031731 | Bacteria | 3125 |
| 595 | Ga0307405_10034773 | 3300031731 | Bacteria | 3002 |
| 596 | Ga0307405_10047596 | 3300031731 | Bacteria | 2641 |
| 597 | Ga0307405_10064883 | 3300031731 | Bacteria | 2322 |
| 598 | Ga0307405_10189070 | 3300031731 | Bacteria | 1485 |
| 599 | Ga0307405_10261202 | 3300031731 | Bacteria | 1293 |
| 600 | Ga0307410_10004481 | 3300031852 | Bacteria | 7230 |
| 601 | Ga0307410_10308078 | 3300031852 | Bacteria | 1252 |
| 602 | Ga0307406_10013926 | 3300031901 | Bacteria | 4617 |
| 603 | Ga0307406_10090424 | 3300031901 | Bacteria | 2060 |
| 604 | Ga0307407_10064608 | 3300031903 | Bacteria | 2151 |
| 605 | Ga0307412_10002112 | 3300031911 | Bacteria | 11029 |
| 606 | Ga0307412_10006384 | 3300031911 | Bacteria | 6665 |
| 607 | Ga0307412_10027010 | 3300031911 | Bacteria | 3574 |
| 608 | Ga0307412_10080050 | 3300031911 | Bacteria | 2256 |
| 609 | Ga0307412_10174099 | 3300031911 | Bacteria | 1612 |
| 610 | Ga0307409_100018418 | 3300031995 | Bacteria | 4695 |
| 611 | Ga0307416_100027129 | 3300032002 | Bacteria | 4235 |
| 612 | Ga0307416_100059445 | 3300032002 | Bacteria | 3106 |
| 613 | Ga0307414_10190895 | 3300032004 | Bacteria | 1657 |
| 614 | Ga0307414_10654725 | 3300032004 | Bacteria | 947 |
| 615 | Ga0307411_10000084 | 3300032005 | Bacteria | 28974 |
| 616 | Ga0307411_10037095 | 3300032005 | Bacteria | 3061 |
| 617 | Ga0307411_10087925 | 3300032005 | Bacteria | 2159 |
| 618 | Ga0307411_10437936 | 3300032005 | Bacteria | 1090 |
| 619 | Ga0307415_100069750 | 3300032126 | Bacteria | 2466 |
| 620 | Ga0316583_10001261 | 3300032133 | Bacteria | 8349 |
| 621 | Ga0307510_10002166 | 3300033180 | Bacteria | 22175 |
| 622 | Ga0307510_10017769 | 3300033180 | Bacteria | 8379 |
| 623 | Ga0307510_10113957 | 3300033180 | Bacteria | 2434 |
| 624 | Ga0373934_0006284 | 3300035086 | Bacteria | 4404 |
| 625 | Ga0373923_0010198 | 3300035111 | Bacteria | 3412 |
| 626 | Ga0373954_0109084 | 3300035118 | Bacteria | 1338 |
| 627 | Ga0373931_0009597 | 3300035691 | Bacteria | 4632 |
| 628 | Ga0373931_0080310 | 3300035691 | Bacteria | 1798 |
| 629 | Ga0373927_0036096 | 3300035695 | Bacteria | 3215 |
| 630 | Ga0373925_0003753 | 3300037068 | Bacteria | 11671 |
| 631 | Ga0373925_0134171 | 3300037068 | Bacteria | 1933 |
| 632 | Ga0395899_0018517 | 3300037312 | Bacteria | 5293 |
| 633 | Ga0395899_0056635 | 3300037312 | Bacteria | 2897 |
| 634 | Ga0395900_0013050 | 3300037418 | Bacteria | 8492 |
| 635 | Ga0395900_0017963 | 3300037418 | Bacteria | 7220 |
| 636 | Ga0395898_0012551 | 3300037466 | Bacteria | 8763 |
| 637 | Ga0395898_0019168 | 3300037466 | Bacteria | 6965 |
| 638 | Ga0395898_0040215 | 3300037466 | Bacteria | 4625 |
| 639 | Ga0395898_0074595 | 3300037466 | Bacteria | 3276 |
| 640 | Ga0395905_0000090 | 3300037471 | Bacteria | 152117 |
| 641 | Ga0395905_0001810 | 3300037471 | Bacteria | 24729 |
| 642 | Ga0395905_0005572 | 3300037471 | Bacteria | 12830 |
| 643 | Ga0395905_0011798 | 3300037471 | Bacteria | 8437 |
| 644 | Ga0395905_0031793 | 3300037471 | Bacteria | 4966 |
| 645 | Ga0395905_0049559 | 3300037471 | Bacteria | 3936 |
| 646 | Ga0395905_0052627 | 3300037471 | Bacteria | 3811 |
| 647 | Ga0395905_0056154 | 3300037471 | Bacteria | 3684 |
| 648 | Ga0395905_0088671 | 3300037471 | Bacteria | 2899 |
| 649 | Ga0395905_0288940 | 3300037471 | Bacteria | 1526 |
| 650 | Ga0395905_0545519 | 3300037471 | Bacteria | 1060 |
| 651 | Ga0395901_0016676 | 3300038443 | Bacteria | 7484 |
| 652 | Ga0395901_0148309 | 3300038443 | Bacteria | 2465 |
| 653 | Ga0395901_0483830 | 3300038443 | Bacteria | 1262 |
| 654 | Ga0436365_0365298 | 3300039437 | Bacteria | 2012 |
| 655 | Ga0436360_1018511 | 3300039438 | Bacteria | 2975 |
| 656 | Ga0436361_0004571 | 3300039447 | Bacteria | 29875 |
| 657 | Ga0436361_0052876 | 3300039447 | Bacteria | 3613 |
| 658 | Ga0436361_0504982 | 3300039447 | Bacteria | 102576 |
| 659 | Ga0436361_0943202 | 3300039447 | Bacteria | 12249 |
| 660 | Ga0436361_0949608 | 3300039447 | Bacteria | 5393 |
| 661 | Ga0439436_0000433 | 3300041404 | Bacteria | 10593 |
| 662 | Ga0439436_0004913 | 3300041404 | Bacteria | 4102 |
| 663 | Ga0439439_0003942 | 3300041406 | Bacteria | 3308 |
| 664 | Ga0439439_0037742 | 3300041406 | Bacteria | 1246 |
| 665 | Ga0439447_040234 | 3300041407 | Bacteria | 1142 |
| 666 | Ga0439466_0000773 | 3300041411 | Bacteria | 12123 |
| 667 | Ga0439466_0069061 | 3300041411 | Bacteria | 1128 |
| 668 | Ga0439465_0001191 | 3300041413 | Bacteria | 8368 |
| 669 | Ga0439431_0001685 | 3300041997 | Bacteria | 4880 |
| 670 | Ga0439433_0000272 | 3300041999 | Bacteria | 8784 |
| 671 | Ga0439437_001274 | 3300042000 | Bacteria | 2648 |
| 672 | Ga0439442_002999 | 3300042002 | Bacteria | 3331 |
| 673 | Ga0439442_024879 | 3300042002 | Bacteria | 1246 |
| 674 | Ga0439445_0000236 | 3300042004 | Bacteria | 10343 |
| 675 | Ga0439432_002286 | 3300042006 | Bacteria | 7220 |
| 676 | Ga0439432_006073 | 3300042006 | Bacteria | 4330 |
| 677 | Ga0439449_0000814 | 3300042007 | Bacteria | 12017 |
| 678 | Ga0439449_0001806 | 3300042007 | Bacteria | 8418 |
| 679 | Ga0439449_0002258 | 3300042007 | Bacteria | 7573 |
| 680 | Ga0439449_0017950 | 3300042007 | Bacteria | 2656 |
| 681 | Ga0439452_002048 | 3300042010 | Bacteria | 7662 |
| 682 | Ga0439452_010761 | 3300042010 | Bacteria | 2647 |
| 683 | Ga0439457_003079 | 3300042014 | Bacteria | 4613 |
| 684 | Ga0439457_036027 | 3300042014 | Bacteria | 1101 |
| 685 | Ga0439462_0001525 | 3300042015 | Bacteria | 5184 |
| 686 | Ga0439462_0005602 | 3300042015 | Bacteria | 3100 |
| 687 | Ga0439462_0040532 | 3300042015 | Bacteria | 1242 |
| 688 | Ga0450911_000367 | 3300042115 | Bacteria | 15028 |
| 689 | Ga0450912_003480 | 3300042116 | Bacteria | 1123 |
| 690 | Ga0450915_000829 | 3300042119 | Bacteria | 1287 |
| 691 | Ga0450917_000458 | 3300042120 | Bacteria | 3073 |
| 692 | Ga0450919_004117 | 3300042121 | Bacteria | 1788 |
| 693 | Ga0450923_000469 | 3300042125 | Bacteria | 4419 |
| 694 | Ga0450923_009815 | 3300042125 | Bacteria | 1683 |
| 695 | Ga0450888_000384 | 3300042126 | Bacteria | 4168 |
| 696 | Ga0450890_000733 | 3300042127 | Bacteria | 4760 |
| 697 | Ga0450890_000896 | 3300042127 | Bacteria | 4314 |
| 698 | Ga0450897_003323 | 3300042128 | Bacteria | 1282 |
| 699 | Ga0450891_001023 | 3300042129 | Bacteria | 2937 |
| 700 | Ga0450892_002663 | 3300042130 | Bacteria | 1501 |
| 701 | Ga0450894_007824 | 3300042131 | Bacteria | 1380 |
| 702 | Ga0450898_000098 | 3300042134 | Bacteria | 8117 |
| 703 | Ga0450898_001037 | 3300042134 | Bacteria | 3522 |
| 704 | Ga0450899_002077 | 3300042135 | Bacteria | 2183 |
| 705 | Ga0450889_000002 | 3300042144 | Bacteria | 23362 |
| 706 | Ga0450906_007126 | 3300042145 | Bacteria | 2219 |
| 707 | Ga0439446_0002237 | 3300042156 | Bacteria | 4622 |
| 708 | Ga0450908_002606 | 3300042184 | Bacteria | 3535 |
| 709 | Ga0450908_021527 | 3300042184 | Bacteria | 1131 |
| 710 | Ga0450909_019868 | 3300042185 | Bacteria | 1000 |
| 711 | Ga0439434_0000511 | 3300042435 | Bacteria | 11069 |
| 712 | Ga0439434_0003319 | 3300042435 | Bacteria | 4725 |
| 713 | Ga0439435_0008477 | 3300042436 | Bacteria | 2384 |
| 714 | Ga0439435_0081884 | 3300042436 | Bacteria | 969 |
| 715 | Ga0439459_0000080 | 3300042438 | Bacteria | 8377 |
| 716 | Ga0439464_0049500 | 3300042439 | Bacteria | 1212 |
| 717 | Ga0450918_002566 | 3300042531 | Bacteria | 3432 |
| 718 | Ga0450901_002844 | 3300042533 | Bacteria | 1836 |
| 719 | Ga0451577_0000152 | 3300042876 | Bacteria | 153284 |
| 720 | Ga0451577_0000960 | 3300042876 | Bacteria | 42223 |
| 721 | Ga0451577_0001888 | 3300042876 | Bacteria | 26618 |
| 722 | Ga0451577_0008924 | 3300042876 | Bacteria | 9703 |
| 723 | Ga0451577_0011213 | 3300042876 | Bacteria | 8498 |
| 724 | Ga0451577_0032480 | 3300042876 | Bacteria | 4702 |
| 725 | Ga0451577_0111170 | 3300042876 | Bacteria | 2451 |
| 726 | Ga0451577_0118247 | 3300042876 | Bacteria | 2374 |
| 727 | Ga0451577_0584775 | 3300042876 | Bacteria | 1013 |
| 728 | Ga0466969_0000046 | 3300044656 | Bacteria | 63999 |
| 729 | Ga0453683_0000780 | 3300044673 | Bacteria | 31494 |
| 730 | Ga0453683_0001915 | 3300044673 | Bacteria | 16995 |
| 731 | Ga0453683_0056286 | 3300044673 | Bacteria | 2461 |
| 732 | Ga0453683_0063951 | 3300044673 | Bacteria | 2300 |
| 733 | Ga0453683_0186382 | 3300044673 | Bacteria | 1316 |
| 734 | Ga0466965_0010795 | 3300044683 | Bacteria | 4271 |
| 735 | Ga0466965_0028134 | 3300044683 | Bacteria | 2730 |
| 736 | Ga0466966_0001824 | 3300044684 | Bacteria | 13821 |
| 737 | Ga0466966_0003197 | 3300044684 | Bacteria | 10785 |
| 738 | Ga0466966_0013012 | 3300044684 | Bacteria | 5508 |
| 739 | Ga0466966_0126880 | 3300044684 | Bacteria | 1564 |
| 740 | Ga0466966_0202601 | 3300044684 | Bacteria | 1200 |
| 741 | Ga0466961_0003378 | 3300044693 | Bacteria | 9964 |
| 742 | Ga0466961_0128098 | 3300044693 | Bacteria | 1591 |
| 743 | Ga0466961_0163579 | 3300044693 | Bacteria | 1386 |
| 744 | Ga0466963_0034322 | 3300044694 | Bacteria | 3300 |
| 745 | Ga0466963_0091823 | 3300044694 | Bacteria | 2068 |
| 746 | Ga0466963_0232429 | 3300044694 | Bacteria | 1292 |
| 747 | Ga0466963_0249219 | 3300044694 | Bacteria | 1246 |
| 748 | Ga0466963_0337457 | 3300044694 | Bacteria | 1061 |
| 749 | Ga0466964_0000661 | 3300044706 | Bacteria | 11023 |
| 750 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 751 | Ga0453684_0000122 | 3300044712 | Bacteria | 340529 |
| 752 | Ga0453684_0000292 | 3300044712 | Bacteria | 213050 |
| 753 | Ga0453684_0001481 | 3300044712 | Bacteria | 66267 |
| 754 | Ga0453684_0011876 | 3300044712 | Bacteria | 14501 |
| 755 | Ga0453684_0012714 | 3300044712 | Bacteria | 13820 |
| 756 | Ga0453684_0043725 | 3300044712 | Bacteria | 6013 |
| 757 | Ga0453684_0106707 | 3300044712 | Bacteria | 3412 |
| 758 | Ga0453684_0691202 | 3300044712 | Bacteria | 1109 |
| 759 | Ga0466971_0004012 | 3300044719 | Bacteria | 6330 |
| 760 | Ga0466971_0032441 | 3300044719 | Bacteria | 2340 |
| 761 | Ga0466968_0006091 | 3300044735 | Bacteria | 4530 |
| 762 | Ga0466970_0013356 | 3300044765 | Bacteria | 4210 |
| 763 | Ga0466957_0021403 | 3300044842 | Bacteria | 3809 |
| 764 | Ga0466960_0115552 | 3300044901 | Bacteria | 1399 |
| 765 | Ga0466959_0000174 | 3300045049 | Bacteria | 42543 |
| 766 | Ga0466959_0008463 | 3300045049 | Bacteria | 7276 |
| 767 | Ga0466959_0020372 | 3300045049 | Bacteria | 4886 |
| 768 | Ga0466959_0037334 | 3300045049 | Bacteria | 3589 |
| 769 | Ga0451576_0000386 | 3300045051 | Bacteria | 102813 |
| 770 | Ga0451576_0000559 | 3300045051 | Bacteria | 79734 |
| 771 | Ga0451576_0001016 | 3300045051 | Bacteria | 51882 |
| 772 | Ga0451576_0006691 | 3300045051 | Bacteria | 14058 |
| 773 | Ga0451576_0006746 | 3300045051 | Bacteria | 13978 |
| 774 | Ga0451576_0030234 | 3300045051 | Bacteria | 5792 |
| 775 | Ga0451576_0584317 | 3300045051 | Bacteria | 1174 |
| 776 | Ga0451576_0692484 | 3300045051 | Bacteria | 1071 |
| 777 | Ga0466958_0044925 | 3300045836 | Bacteria | 2663 |
| 778 | Ga0466967_0022574 | 3300045976 | Bacteria | 5138 |
| 779 | Ga0466967_0024163 | 3300045976 | Bacteria | 4992 |
| 780 | Ga0466967_0056041 | 3300045976 | Bacteria | 3474 |
| 781 | Ga0466967_0123860 | 3300045976 | Bacteria | 2392 |
| 782 | Ga0495627_004796 | 3300046453 | Bacteria | 5588 |
| 783 | Ga0495627_014974 | 3300046453 | Bacteria | 2689 |
| 784 | Ga0495592_0000266 | 3300046454 | Bacteria | 44803 |
| 785 | Ga0495629_0124653 | 3300046459 | Bacteria | 1795 |
| 786 | Ga0495638_0049699 | 3300046460 | Bacteria | 2621 |
| 787 | Ga0495650_0054464 | 3300046471 | Bacteria | 1632 |
| 788 | Ga0495639_0005280 | 3300046475 | Bacteria | 5558 |
| 789 | Ga0495639_0015870 | 3300046475 | Bacteria | 3266 |
| 790 | Ga0495585_0024071 | 3300046492 | Bacteria | 3493 |
| 791 | Ga0495583_0000428 | 3300046506 | Bacteria | 63526 |
| 792 | Ga0495606_0006933 | 3300046507 | Bacteria | 10303 |
| 793 | Ga0495606_0120750 | 3300046507 | Bacteria | 1569 |
| 794 | Ga0495610_0011787 | 3300046512 | Bacteria | 5312 |
| 795 | Ga0495610_0047700 | 3300046512 | Bacteria | 2106 |
| 796 | Ga0495616_0004282 | 3300046513 | Bacteria | 9013 |
| 797 | Ga0495620_0046540 | 3300046515 | Bacteria | 1872 |
| 798 | Ga0495628_0398874 | 3300046516 | Bacteria | 1005 |
| 799 | Ga0495631_0000152 | 3300046518 | Bacteria | 47290 |
| 800 | Ga0495632_0002610 | 3300046519 | Bacteria | 13576 |
| 801 | Ga0495632_0006664 | 3300046519 | Bacteria | 7386 |
| 802 | Ga0495643_0030909 | 3300046522 | Bacteria | 2985 |
| 803 | Ga0495642_0078491 | 3300046528 | Bacteria | 1387 |
| 804 | Ga0495654_0006840 | 3300046530 | Bacteria | 6434 |
| 805 | Ga0495621_0016139 | 3300046539 | Bacteria | 2392 |
| 806 | Ga0495597_0000038 | 3300046542 | Bacteria | 113027 |
| 807 | Ga0495597_0048985 | 3300046542 | Bacteria | 1868 |
| 808 | Ga0495645_0084769 | 3300046543 | Bacteria | 2269 |
| 809 | Ga0495633_0001724 | 3300046558 | Bacteria | 16339 |
| 810 | Ga0495656_0001010 | 3300046615 | Bacteria | 9099 |
| 811 | Ga0495656_0090085 | 3300046615 | Bacteria | 1401 |
| 812 | Ga0495668_0064031 | 3300046616 | Bacteria | 2025 |
| 813 | Ga0495668_0065248 | 3300046616 | Bacteria | 2004 |
| 814 | Ga0495625_0000294 | 3300046660 | Bacteria | 77321 |
| 815 | Ga0495625_0012585 | 3300046660 | Bacteria | 6847 |
| 816 | Ga0495625_0018155 | 3300046660 | Bacteria | 5498 |
| 817 | Ga0495625_0124209 | 3300046660 | Bacteria | 1753 |
| 818 | Ga0495588_0059095 | 3300046674 | Bacteria | 1982 |
| 819 | Ga0495588_0118840 | 3300046674 | Bacteria | 1393 |
| 820 | Ga0495647_0076902 | 3300046681 | Bacteria | 1346 |
| 821 | Ga0495658_0020103 | 3300046683 | Bacteria | 3498 |
| 822 | Ga0495658_0033012 | 3300046683 | Bacteria | 2831 |
| 823 | Ga0495669_0025262 | 3300046684 | Bacteria | 2590 |
| 824 | Ga0495670_0007639 | 3300046691 | Bacteria | 5318 |
| 825 | Ga0495670_0059305 | 3300046691 | Bacteria | 1921 |
| 826 | Ga0495671_0013044 | 3300046692 | Bacteria | 4519 |
| 827 | Ga0495649_0000210 | 3300046694 | Bacteria | 51361 |
| 828 | Ga0495649_0000401 | 3300046694 | Bacteria | 37516 |
| 829 | Ga0495589_0026413 | 3300046794 | Bacteria | 2941 |
| 830 | Ga0495600_0175781 | 3300046809 | Bacteria | 1381 |
| 831 | Ga0495660_0046211 | 3300046810 | Bacteria | 2388 |
| 832 | Ga0495660_0110528 | 3300046810 | Bacteria | 1403 |
| 833 | Ga0495674_0054126 | 3300047319 | Bacteria | 3525 |
| 834 | Ga0495672_0026238 | 3300047320 | Bacteria | 3719 |
| 835 | Ga0495676_0017637 | 3300047321 | Bacteria | 6307 |
| 836 | Ga0495687_000174 | 3300047443 | Bacteria | 95031 |
| 837 | Ga0495687_011763 | 3300047443 | Bacteria | 4678 |
| 838 | Ga0495687_015227 | 3300047443 | Bacteria | 3921 |
| 839 | Ga0495677_0035297 | 3300047445 | Bacteria | 1825 |
| 840 | Ga0495685_032242 | 3300047447 | Bacteria | 1801 |
| 841 | Ga0495673_0066156 | 3300047469 | Bacteria | 1533 |
| 842 | Ga0495681_0063316 | 3300047470 | Bacteria | 1698 |
| 843 | Ga0495686_0005097 | 3300047472 | Bacteria | 10506 |
| 844 | Ga0495593_0009585 | 3300047673 | Bacteria | 5621 |
| 845 | Ga0496100_0002506 | 3300048903 | Bacteria | 9348 |
| 846 | Ga0496100_0229286 | 3300048903 | Bacteria | 1366 |
| 847 | Ga0496101_0018733 | 3300048904 | Bacteria | 4712 |
| 848 | Ga0496102_0001785 | 3300048905 | Bacteria | 18666 |
| 849 | Ga0496102_0012360 | 3300048905 | Bacteria | 7388 |
| 850 | Ga0496102_0115223 | 3300048905 | Bacteria | 2508 |
| 851 | Ga0496102_0311942 | 3300048905 | Bacteria | 1482 |
| 852 | Ga0496103_0026597 | 3300048906 | Bacteria | 3502 |
| 853 | Ga0496104_0005399 | 3300048907 | Bacteria | 11183 |
| 854 | Ga0496105_0000270 | 3300048908 | Bacteria | 34384 |
| 855 | Ga0496106_0029116 | 3300048909 | Bacteria | 4115 |
| 856 | Ga0496106_0219939 | 3300048909 | Bacteria | 1514 |
| 857 | Ga0496108_0036777 | 3300048911 | Bacteria | 4075 |
| 858 | Ga0496108_0097563 | 3300048911 | Bacteria | 2504 |
| 859 | Ga0496108_0340663 | 3300048911 | Bacteria | 1308 |
| 860 | Ga0496109_0006879 | 3300048912 | Bacteria | 9589 |
| 861 | Ga0496109_0092423 | 3300048912 | Bacteria | 2799 |
| 862 | Ga0496109_0111256 | 3300048912 | Bacteria | 2547 |
| 863 | Ga0496109_0327993 | 3300048912 | Bacteria | 1445 |
| 864 | Ga0496110_0034590 | 3300048913 | Bacteria | 4378 |
| 865 | Ga0496111_0069048 | 3300048914 | Bacteria | 2569 |
| 866 | Ga0496112_0027735 | 3300048915 | Bacteria | 5461 |
| 867 | Ga0496113_0061238 | 3300048916 | Bacteria | 2840 |
| 868 | Ga0496113_0315437 | 3300048916 | Bacteria | 1253 |
| 869 | Ga0496114_0052452 | 3300048917 | Bacteria | 3398 |
| 870 | Ga0496114_0080712 | 3300048917 | Bacteria | 2747 |
| 871 | Ga0496116_0010837 | 3300048919 | Bacteria | 7604 |
| 872 | Ga0496117_0028405 | 3300048920 | Bacteria | 4333 |
| 873 | Ga0496118_0008785 | 3300048921 | Bacteria | 10361 |
| 874 | Ga0496118_0017785 | 3300048921 | Bacteria | 6452 |
| 875 | Ga0496119_0031441 | 3300048922 | Bacteria | 3560 |
| 876 | Ga0496121_0025097 | 3300048924 | Bacteria | 5673 |
| 877 | Ga0496121_0091460 | 3300048924 | Bacteria | 2375 |
| 878 | Ga0496121_0095099 | 3300048924 | Bacteria | 2316 |
| 879 | Ga0496122_0000319 | 3300048925 | Bacteria | 105543 |
| 880 | Ga0496122_0045563 | 3300048925 | Bacteria | 3407 |
| 881 | Ga0496122_0165015 | 3300048925 | Bacteria | 1344 |
| 882 | Ga0496122_0172747 | 3300048925 | Bacteria | 1300 |
| 883 | Ga0496123_0000117 | 3300048926 | Bacteria | 161679 |
| 884 | Ga0496123_0049423 | 3300048926 | Bacteria | 2820 |
| 885 | Ga0496124_0000108 | 3300048927 | Bacteria | 167473 |
| 886 | Ga0496124_0005335 | 3300048927 | Bacteria | 14516 |
| 887 | Ga0496124_0012533 | 3300048927 | Bacteria | 8359 |
| 888 | Ga0496124_0191163 | 3300048927 | Bacteria | 1566 |
| 889 | Ga0496125_0030669 | 3300048928 | Bacteria | 4806 |
| 890 | Ga0496125_0031844 | 3300048928 | Bacteria | 4692 |
| 891 | Ga0496125_0041469 | 3300048928 | Bacteria | 3933 |
| 892 | Ga0496125_0080242 | 3300048928 | Bacteria | 2498 |
| 893 | Ga0496125_0081740 | 3300048928 | Bacteria | 2467 |
| 894 | Ga0496125_0137503 | 3300048928 | Bacteria | 1706 |
| 895 | Ga0496125_0181339 | 3300048928 | Bacteria | 1402 |
| 896 | Ga0496126_0257994 | 3300048929 | Bacteria | 1450 |
| 897 | Ga0501032_0077390 | 3300049569 | Bacteria | 2215 |
| 898 | Ga0501034_0311587 | 3300049571 | Bacteria | 1508 |
| 899 | Ga0501036_0560498 | 3300049572 | Bacteria | 949 |
| 900 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 901 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 902 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 903 | Ga0501048_0001290 | 3300049582 | Bacteria | 19011 |
| 904 | Ga0501073_0327386 | 3300049589 | Bacteria | 1058 |
| 905 | Ga0501198_000007 | 3300049649 | Bacteria | 129700 |
| 906 | Ga0501222_000005 | 3300049662 | Bacteria | 129724 |
| 907 | Ga0501222_003974 | 3300049662 | Bacteria | 2004 |
| 908 | Ga0501221_000521 | 3300049704 | Bacteria | 6095 |
| 909 | Ga0501225_0003739 | 3300049705 | Bacteria | 4582 |
| 910 | Ga0501229_002242 | 3300049706 | Bacteria | 2271 |
| 911 | Ga0501262_000238 | 3300049759 | Bacteria | 6785 |
| 912 | Ga0501266_001273 | 3300049763 | Bacteria | 3217 |
| 913 | Ga0501267_000280 | 3300049764 | Bacteria | 3739 |
| 914 | Ga0501035_0065657 | 3300049822 | Bacteria | 3222 |
| 915 | Ga0501035_0137830 | 3300049822 | Bacteria | 2123 |
| 916 | Ga0501035_0215301 | 3300049822 | Bacteria | 1642 |
| 917 | Ga0501044_0120692 | 3300049823 | Bacteria | 2623 |
| 918 | Ga0501044_0230364 | 3300049823 | Bacteria | 1800 |
| 919 | Ga0501045_0013748 | 3300049824 | Bacteria | 5723 |
| 920 | nmdc:mga03683_11300_c1 | 3300050489 | Bacteria | 3229 |
| 921 | nmdc:mga03683_11861_c1 | 3300050489 | Bacteria | 3167 |
| 922 | nmdc:mga03683_1606_c1 | 3300050489 | Bacteria | 6764 |
| 923 | nmdc:mga03683_17733_c1 | 3300050489 | Bacteria | 2699 |
| 924 | nmdc:mga03683_28362_c1 | 3300050489 | Bacteria | 2225 |
| 925 | nmdc:mga03683_3472_c1 | 3300050489 | Bacteria | 5092 |
| 926 | nmdc:mga03683_6609_c1 | 3300050489 | Bacteria | 2260 |
| 927 | nmdc:mga03683_91574_c1 | 3300050489 | Bacteria | 1326 |
| 928 | nmdc:mga03n38_189278_c1 | 3300050490 | Bacteria | 1059 |
| 929 | nmdc:mga03n38_68079_c1 | 3300050490 | Bacteria | 1641 |
| 930 | nmdc:mga00v17_7452_c1 | 3300050491 | Bacteria | 5840 |
| 931 | nmdc:mga0yw44_113914_c1 | 3300050492 | Bacteria | 1735 |
| 932 | nmdc:mga0yw44_13078_c1 | 3300050492 | Bacteria | 4354 |
| 933 | nmdc:mga0yw44_42703_c1 | 3300050492 | Bacteria | 2705 |
| 934 | nmdc:mga0yw44_50834_c1 | 3300050492 | Bacteria | 2508 |
| 935 | nmdc:mga0k408_106644_c1 | 3300050493 | Bacteria | 1655 |
| 936 | nmdc:mga0k408_12253_c1 | 3300050493 | Bacteria | 4686 |
| 937 | nmdc:mga0k408_1368_c1 | 3300050493 | Bacteria | 13151 |
| 938 | nmdc:mga0k408_17052_c1 | 3300050493 | Bacteria | 4039 |
| 939 | nmdc:mga0k408_18859_c1 | 3300050493 | Bacteria | 3851 |
| 940 | nmdc:mga0k408_24920_c1 | 3300050493 | Bacteria | 3385 |
| 941 | nmdc:mga0k408_29274_c1 | 3300050493 | Bacteria | 3134 |
| 942 | nmdc:mga0k408_31968_c1 | 3300050493 | Bacteria | 3007 |
| 943 | nmdc:mga0k408_42664_c1 | 3300050493 | Bacteria | 2612 |
| 944 | nmdc:mga0k408_43413_c1 | 3300050493 | Bacteria | 2591 |
| 945 | nmdc:mga0k408_6428_c1 | 3300050493 | Bacteria | 6269 |
| 946 | nmdc:mga0k408_6872_c1 | 3300050493 | Bacteria | 6071 |
| 947 | nmdc:mga0k408_7451_c1 | 3300050493 | Bacteria | 5843 |
| 948 | nmdc:mga0k408_75045_c1 | 3300050493 | Bacteria | 1976 |
| 949 | nmdc:mga0k408_8312_c1 | 3300050493 | Bacteria | 5569 |
| 950 | nmdc:mga06z11_11077_c1 | 3300050494 | Bacteria | 3873 |
| 951 | nmdc:mga04h51_15526_c1 | 3300050495 | Bacteria | 2195 |
| 952 | nmdc:mga07m45_1112_c1 | 3300050496 | Bacteria | 12037 |
| 953 | nmdc:mga07m45_115984_c1 | 3300050496 | Bacteria | 1544 |
| 954 | nmdc:mga07m45_12251_c1 | 3300050496 | Bacteria | 4529 |
| 955 | nmdc:mga07m45_2245_c1 | 3300050496 | Bacteria | 9018 |
| 956 | nmdc:mga07m45_24862_c1 | 3300050496 | Bacteria | 3284 |
| 957 | nmdc:mga07m45_3134_c1 | 3300050496 | Bacteria | 7922 |
| 958 | nmdc:mga07m45_39957_c1 | 3300050496 | Bacteria | 2624 |
| 959 | nmdc:mga05p37_279607_c1 | 3300050507 | Bacteria | 1991 |
| 960 | nmdc:mga09592_9075_c1 | 3300050508 | Bacteria | 8084 |
| 961 | nmdc:mga0qj67_360772_c1 | 3300050509 | Bacteria | 1174 |
| 962 | nmdc:mga0qj67_36946_c1 | 3300050509 | Bacteria | 3824 |
| 963 | nmdc:mga06r32_449751_c1 | 3300050510 | Bacteria | 1268 |
| 964 | nmdc:mga0sz30_9079_c1 | 3300050516 | Bacteria | 3770 |
| 965 | Ga0495601_0268997 | 3300053077 | Bacteria | 1112 |
| 966 | Ga0500610_0000833 | 3300053079 | Bacteria | 9844 |
| 967 | Ga0500635_0000070 | 3300053080 | Bacteria | 67480 |
| 968 | Ga0495595_0076487 | 3300053084 | Bacteria | 1589 |
| 969 | Ga0500578_0000637 | 3300053086 | Bacteria | 42499 |
| 970 | Ga0500643_003900 | 3300053087 | Bacteria | 6927 |
| 971 | Ga0500644_0004062 | 3300053088 | Bacteria | 3639 |
| 972 | Ga0500646_0009529 | 3300053090 | Bacteria | 2486 |
| 973 | Ga0500583_0114117 | 3300053092 | Bacteria | 1333 |
| 974 | Ga0500651_0000046 | 3300053093 | Bacteria | 84379 |
| 975 | Ga0500651_0008197 | 3300053093 | Bacteria | 6134 |
| 976 | Ga0500651_0054861 | 3300053093 | Bacteria | 2496 |
| 977 | Ga0500566_0006938 | 3300053094 | Bacteria | 6708 |
| 978 | Ga0500555_034236 | 3300053103 | Bacteria | 1431 |
| 979 | Ga0500571_000037 | 3300053110 | Bacteria | 41415 |
| 980 | Ga0500572_032822 | 3300053111 | Bacteria | 1460 |
| 981 | Ga0500592_006985 | 3300053116 | Bacteria | 1796 |
| 982 | Ga0500593_000315 | 3300053117 | Bacteria | 19405 |
| 983 | Ga0500593_002077 | 3300053117 | Bacteria | 7268 |
| 984 | Ga0500593_014481 | 3300053117 | Bacteria | 3384 |
| 985 | Ga0500594_0004982 | 3300053118 | Bacteria | 2936 |
| 986 | Ga0500594_0021400 | 3300053118 | Bacteria | 1621 |
| 987 | Ga0500607_003946 | 3300053121 | Bacteria | 10492 |
| 988 | Ga0500608_003983 | 3300053122 | Bacteria | 5642 |
| 989 | Ga0500608_020866 | 3300053122 | Bacteria | 3019 |
| 990 | Ga0500642_0023612 | 3300053130 | Bacteria | 2471 |
| 991 | Ga0500652_004170 | 3300053131 | Bacteria | 4448 |
| 992 | Ga0500655_002347 | 3300053133 | Bacteria | 3468 |
| 993 | Ga0500658_0000869 | 3300053134 | Bacteria | 12407 |
| 994 | Ga0500658_0001634 | 3300053134 | Bacteria | 8943 |
| 995 | Ga0500658_0004194 | 3300053134 | Bacteria | 5412 |
| 996 | Ga0500658_0017664 | 3300053134 | Bacteria | 2667 |
| 997 | Ga0500559_0000032 | 3300053136 | Bacteria | 113579 |
| 998 | Ga0500559_0005220 | 3300053136 | Bacteria | 5989 |
| 999 | Ga0500559_0007014 | 3300053136 | Bacteria | 5035 |
| 1000 | Ga0500561_0015607 | 3300053137 | Bacteria | 1688 |
| 1001 | Ga0500564_019579 | 3300053138 | Bacteria | 3096 |
| 1002 | Ga0500564_024284 | 3300053138 | Bacteria | 2782 |
| 1003 | Ga0500568_0003832 | 3300053139 | Bacteria | 8216 |
| 1004 | Ga0500568_0058927 | 3300053139 | Bacteria | 1490 |
| 1005 | Ga0500574_003796 | 3300053141 | Bacteria | 2728 |
| 1006 | Ga0500590_004909 | 3300053148 | Bacteria | 6385 |
| 1007 | Ga0500616_0088713 | 3300053153 | Bacteria | 1537 |
| 1008 | Ga0500619_000137 | 3300053154 | Bacteria | 18737 |
| 1009 | Ga0500622_0000125 | 3300053156 | Bacteria | 81109 |
| 1010 | Ga0500622_0003836 | 3300053156 | Bacteria | 9780 |
| 1011 | Ga0500634_0044606 | 3300053161 | Bacteria | 2400 |
| 1012 | Ga0500638_081797 | 3300053162 | Bacteria | 1532 |
| 1013 | Ga0500570_118610 | 3300053724 | Bacteria | 1047 |
| 1014 | Ga0500645_000042 | 3300053730 | Bacteria | 110470 |
| 1015 | Ga0500587_001091 | 3300053739 | Bacteria | 3717 |
| 1016 | Ga0500587_005447 | 3300053739 | Bacteria | 1710 |
| 1017 | Ga0500661_000710 | 3300055283 | Bacteria | 6221 |
| 1018 | Ga0590075_049232 | 3300059424 | Bacteria | 1080 |
| 1019 | Ga0466962_0030900 | 3300061719 | Bacteria | 2564 |
| 1020 | Ga0466962_0158799 | 3300061719 | Bacteria | 1098 |
| 1021 | 2511243098 | 2511231002 | Bacteria | 5042903 |
| 1022 | 2513228429 | 2513020051 | Bacteria | 6053213 |
| 1023 | 2548501532 | 2547132374 | Bacteria | 5530232 |
| 1024 | 2587725299 | 2585428057 | Bacteria | 6737412 |
| 1025 | 2587731343 | 2585428058 | Bacteria | 6853932 |
| 1026 | 2588290099 | 2588253510 | Bacteria | 6901809 |
| 1027 | 2599620723 | 2599185214 | Bacteria | 8209958 |
| 1028 | 2599674022 | 2599185226 | Bacteria | 8233575 |
| 1029 | 2599678661 | 2599185227 | Bacteria | 8246414 |
| 1030 | 2599690234 | 2599185229 | Bacteria | 8216126 |
| 1031 | 2643867297 | 2643221570 | Bacteria | 5103772 |
| 1032 | 2643972817 | 2643221592 | Bacteria | 6608788 |
| 1033 | 2643990214 | 2643221596 | Bacteria | 5006805 |
| 1034 | 2644059242 | 2643221609 | Bacteria | 6756331 |
| 1035 | 2644075720 | 2643221611 | Bacteria | 6820941 |
| 1036 | 2644143336 | 2643221625 | Bacteria | 6512927 |
| 1037 | 2644161467 | 2643221628 | Bacteria | 5745828 |
| 1038 | 2644243509 | 2643221644 | Bacteria | 6865017 |
| 1039 | 2644276227 | 2643221648 | Bacteria | 6521465 |
| 1040 | 2644295707 | 2643221652 | Bacteria | 5140275 |
| 1041 | 2644324189 | 2643221658 | Bacteria | 6064537 |
| 1042 | 2644338657 | 2643221660 | Bacteria | 4208257 |
| 1043 | 2644400565 | 2643221672 | Bacteria | 6322190 |
| 1044 | 2644465083 | 2643221683 | Bacteria | 5749203 |
| 1045 | 2644645251 | 2643221717 | Bacteria | 5676132 |
| 1046 | 2738720572 | 2738541277 | Bacteria | 7458140 |
| 1047 | 2738884145 | 2738541307 | Bacteria | 8606193 |
| 1048 | 2739055994 | 2738541337 | Bacteria | 6183410 |
| 1049 | 2739240733 | 2738543012 | Bacteria | 7115078 |
| 1050 | 2739250237 | 2738543013 | Bacteria | 5618633 |
| 1051 | 2739279771 | 2738543019 | Bacteria | 7459457 |
| 1052 | 2816472190 | 2816332133 | Bacteria | 7249298 |
| 1053 | 2819601252 | 2818991446 | Bacteria | 7757362 |
| 1054 | 2831269336 | 2831265667 | Bacteria | 7184833 |
| 1055 | 2831864586 | 2831864461 | Bacteria | 6502356 |
| 1056 | 2838055332 | 2838054893 | Bacteria | 7451788 |
| 1057 | 2842679420 | 2842677519 | Bacteria | 5615038 |
| 1058 | 2842737644 | 2842733646 | Bacteria | 5716726 |
| 1059 | 2842749631 | 2842747753 | Bacteria | 5578255 |
| 1060 | 2881104799 | 2881101125 | Bacteria | 4590519 |
| 1061 | 2885197164 | 2885192300 | Bacteria | 5882526 |
| 1062 | 2885201593 | 2885198086 | Bacteria | 7212419 |
| 1063 | 2885215696 | 2885211737 | Bacteria | 7212420 |
| 1064 | 2899927400 | 2899924645 | Bacteria | 7487985 |
| 1065 | 2904450871 | 2904449895 | Bacteria | 6927402 |
| 1066 | 2904459626 | 2904456579 | Bacteria | 6819253 |
| 1067 | 2919462604 | 2919462493 | Bacteria | 5817112 |
| 1068 | 2919707014 | 2919704043 | Bacteria | 5560311 |
| 1069 | 2928042688 | 2928037797 | Bacteria | 7273642 |
| 1070 | 2928048885 | 2928044640 | Bacteria | 7271509 |
| 1071 | 2928055219 | 2928051484 | Bacteria | 7773759 |
| 1072 | 2928068647 | 2928064002 | Bacteria | 7419480 |
| 1073 | 2928073441 | 2928070936 | Bacteria | 8062541 |
| 1074 | 2928090002 | 2928084124 | Bacteria | 7159212 |
| 1075 | 2929161486 | 2929160207 | Bacteria | 9075316 |
| 1076 | 2929521726 | 2929520902 | Bacteria | 6765052 |
| 1077 | 2932423839 | 2932422444 | Bacteria | 4678430 |
| 1078 | 2939635705 | 2939631187 | Bacteria | 6118131 |
| 1079 | 2945914046 | 2945909444 | Bacteria | 7065066 |
| 1080 | 2945949611 | 2945945610 | Bacteria | 5951079 |
| 1081 | 2945973647 | 2945972063 | Bacteria | 6086495 |
| 1082 | 2945990560 | 2945984333 | Bacteria | 7358892 |
| 1083 | 2954770737 | 2954767861 | Bacteria | 5535784 |
| 1084 | 2990711066 | 2990710928 | Bacteria | 5002431 |
| 1085 | Ga0500589_093167 | |||
| 1086 | JGI25155J39150_1000024 | |||
| 1087 | JGI25156J39149_1000005 | |||
| 1088 | JGI25156J39149_1000534 | |||
| 1089 | JGI25154J39366_1000017 | |||
| 1090 | JGI25154J39366_1000918 | |||
| 1091 | JGI25157J39369_1000003 | |||
| 1092 | JGI25157J39369_1000054 | |||
| 1093 | JGI25157J39369_1000144 | |||
| 1094 | JGI25152J39213_1000889 | |||
| 1095 | JGI25150J39212_1014335 | |||
| 1096 | JGI25151J46595_10003495 | |||
| 1097 | JGI25151J46595_10022127 | |||
| 1098 | JGI25153J46596_10001144 | |||
| 1099 | JGI25153J46596_10002770 | |||
| 1100 | rootH2_10060114 | |||
| 1101 | rootL2_10028978 | |||
| 1102 | rootH1_10001684 | |||
| 1103 | rootH1_10004925 | |||
| 1104 | rootH1_10058178 | |||
| 1105 | JGI25160J50197_1000904 | |||
| 1106 | JGI25161J50226_1000098 | |||
| 1107 | Ga0055539_1000812 | |||
| 1108 | Ga0055533_1000008 | |||
| 1109 | Ga0055525_1000729 | |||
| 1110 | Ga0055535_1000069 | |||
| 1111 | Ga0055535_1000271 | |||
| 1112 | Ga0055542_1000084 | |||
| 1113 | Ga0055529_1000321 | |||
| 1114 | Ga0055526_1000687 | |||
| 1115 | Ga0055526_1001509 | |||
| 1116 | Ga0055526_1002509 | |||
| 1117 | Ga0055537_1000777 | |||
| 1118 | Ga0055537_1001949 | |||
| 1119 | Ga0055537_1002668 | |||
| 1120 | Ga0055524_1000085 | |||
| 1121 | Ga0055524_1000111 | |||
| 1122 | Ga0055524_1005251 | |||
| 1123 | Ga0055536_1000843 | |||
| 1124 | Ga0055536_1003305 | |||
| 1125 | Ga0055536_1003834 | |||
| 1126 | Ga0055536_1005817 | |||
| 1127 | Ga0055534_1000746 | |||
| 1128 | Ga0055534_1001110 | |||
| 1129 | Ga0055534_1002569 | |||
| 1130 | Ga0055528_1001586 | |||
| 1131 | Ga0055528_1002505 | |||
| 1132 | Ga0055528_1005575 | |||
| 1133 | Ga0055530_10002078 | |||
| 1134 | Ga0055530_10004190 | |||
| 1135 | Ga0055530_10009204 | |||
| 1136 | Ga0055540_1000056 | |||
| 1137 | Ga0055540_1000059 | |||
| 1138 | Ga0055540_1000511 | |||
| 1139 | Ga0055540_1001809 | |||
| 1140 | Ga0055540_1006362 | |||
| 1141 | Ga0055540_1015290 | |||
| 1142 | Ga0055531_10001013 | |||
| 1143 | Ga0055531_10001080 | |||
| 1144 | Ga0055531_10001126 | |||
| 1145 | Ga0055531_10001730 | |||
| 1146 | Ga0055531_10002107 | |||
| 1147 | Ga0055531_10003087 | |||
| 1148 | Ga0055531_10007677 | |||
| 1149 | Ga0055531_10008253 | |||
| 1150 | Ga0055531_10009600 | |||
| 1151 | Ga0055543_1000144 | |||
| 1152 | Ga0065165_1000290 | |||
| 1153 | Ga0065165_1001688 | |||
| 1154 | Ga0065165_1004995 | |||
| 1155 | Ga0065165_1024955 | |||
| 1156 | Ga0065704_10212318 | |||
| 1157 | Ga0065715_10118213 | |||
| 1158 | Ga0065707_10096400 | |||
| 1159 | Ga0070658_10013228 | |||
| 1160 | Ga0070658_10027912 | |||
| 1161 | Ga0070658_10119931 | |||
| 1162 | Ga0070676_10004505 | |||
| 1163 | Ga0070676_10017357 | |||
| 1164 | Ga0070670_100013930 | |||
| 1165 | Ga0070670_100067762 | |||
| 1166 | Ga0070677_10004821 | |||
| 1167 | Ga0070677_10005340 | |||
| 1168 | Ga0068869_100009917 | |||
| 1169 | Ga0068869_100198011 | |||
| 1170 | Ga0068869_100201887 | |||
| 1171 | Ga0068869_100224963 | |||
| 1172 | Ga0070680_100112876 | |||
| 1173 | Ga0068868_100003620 | |||
| 1174 | Ga0068868_100028882 | |||
| 1175 | Ga0068868_100031863 | |||
| 1176 | Ga0068868_100320367 | |||
| 1177 | Ga0068868_100546121 | |||
| 1178 | Ga0070660_100016356 | |||
| 1179 | Ga0070687_100101420 | |||
| 1180 | Ga0070661_100001284 | |||
| 1181 | Ga0070661_100174483 | |||
| 1182 | Ga0070668_100206409 | |||
| 1183 | Ga0070669_100006711 | |||
| 1184 | Ga0070675_100000649 | |||
| 1185 | Ga0070675_100002638 | |||
| 1186 | Ga0070675_100009330 | |||
| 1187 | Ga0070675_100215755 | |||
| 1188 | Ga0070671_100008484 | |||
| 1189 | Ga0070671_100028189 | |||
| 1190 | Ga0070671_100105561 | |||
| 1191 | Ga0070674_100026754 | |||
| 1192 | Ga0070674_100065348 | |||
| 1193 | Ga0070673_100007348 | |||
| 1194 | Ga0070673_100008721 | |||
| 1195 | Ga0070673_100025419 | |||
| 1196 | Ga0070673_100078009 | |||
| 1197 | Ga0070673_100498034 | |||
| 1198 | Ga0070688_100087771 | |||
| 1199 | Ga0070659_100032212 | |||
| 1200 | Ga0070659_100331302 | |||
| 1201 | Ga0070667_100008076 | |||
| 1202 | Ga0070667_100020719 | |||
| 1203 | Ga0070667_100160063 | |||
| 1204 | Ga0070667_100321755 | |||
| 1205 | Ga0070700_100006774 | |||
| 1206 | Ga0070663_100334964 | |||
| 1207 | Ga0070678_100124819 | |||
| 1208 | Ga0070662_100006549 | |||
| 1209 | Ga0070662_100006860 | |||
| 1210 | Ga0070662_100017731 | |||
| 1211 | Ga0070662_100027761 | |||
| 1212 | Ga0068867_100006375 | |||
| 1213 | Ga0068867_100038141 | |||
| 1214 | Ga0070706_100013199 | |||
| 1215 | Ga0070706_100195888 | |||
| 1216 | Ga0070707_100014896 | |||
| 1217 | Ga0070679_100017318 | |||
| 1218 | Ga0068853_100028973 | |||
| 1219 | Ga0068853_100259527 | |||
| 1220 | Ga0068853_100262503 | |||
| 1221 | Ga0070672_100000177 | |||
| 1222 | Ga0070672_100035185 | |||
| 1223 | Ga0070665_100038155 | |||
| 1224 | Ga0070665_100184237 | |||
| 1225 | Ga0070665_100279330 | |||
| 1226 | Ga0068855_100009119 | |||
| 1227 | Ga0068855_100019700 | |||
| 1228 | Ga0068855_100107009 | |||
| 1229 | Ga0070664_100015850 | |||
| 1230 | Ga0068857_100000906 | |||
| 1231 | Ga0068857_100043606 | |||
| 1232 | Ga0068854_100002536 | |||
| 1233 | Ga0068856_100000135 | |||
| 1234 | Ga0068856_100160035 | |||
| 1235 | Ga0068852_100007509 | |||
| 1236 | Ga0068852_100066113 | |||
| 1237 | Ga0068852_100225701 | |||
| 1238 | Ga0068852_100269325 | |||
| 1239 | Ga0068859_100011878 | |||
| 1240 | Ga0068859_100228069 | |||
| 1241 | Ga0068864_100000826 | |||
| 1242 | Ga0068864_100030188 | |||
| 1243 | Ga0068864_100135502 | |||
| 1244 | Ga0068861_100002005 | |||
| 1245 | Ga0068861_100199929 | |||
| 1246 | Ga0068851_10001974 | |||
| 1247 | Ga0068870_10047892 | |||
| 1248 | Ga0068870_10083320 | |||
| 1249 | Ga0068863_100210596 | |||
| 1250 | Ga0068858_100005422 | |||
| 1251 | Ga0068862_100017745 | |||
| 1252 | Ga0075365_10007547 | |||
| 1253 | Ga0075365_10028773 | |||
| 1254 | Ga0075365_10042812 | |||
| 1255 | Ga0075368_10010843 | |||
| 1256 | Ga0075368_10014475 | |||
| 1257 | Ga0075368_10072169 | |||
| 1258 | Ga0075363_100232698 | |||
| 1259 | Ga0075432_10008618 | |||
| 1260 | Ga0075362_10000958 | |||
| 1261 | Ga0075362_10000960 | |||
| 1262 | Ga0075362_10004300 | |||
| 1263 | Ga0075362_10013783 | |||
| 1264 | Ga0075362_10116435 | |||
| 1265 | Ga0075367_10003979 | |||
| 1266 | Ga0075367_10088453 | |||
| 1267 | Ga0075367_10198950 | |||
| 1268 | Ga0075369_10013819 | |||
| 1269 | Ga0075366_10000550 | |||
| 1270 | Ga0075366_10001062 | |||
| 1271 | Ga0075366_10008558 | |||
| 1272 | Ga0075366_10013928 | |||
| 1273 | Ga0075366_10019395 | |||
| 1274 | Ga0075366_10019789 | |||
| 1275 | Ga0075366_10022374 | |||
| 1276 | Ga0075366_10037033 | |||
| 1277 | Ga0075366_10050962 | |||
| 1278 | Ga0075366_10135180 | |||
| 1279 | Ga0075370_10000148 | |||
| 1280 | Ga0075370_10000920 | |||
| 1281 | Ga0075370_10003393 | |||
| 1282 | Ga0075370_10011423 | |||
| 1283 | Ga0075370_10057014 | |||
| 1284 | Ga0075370_10060981 | |||
| 1285 | Ga0075370_10080275 | |||
| 1286 | Ga0075370_10129776 | |||
| 1287 | Ga0075370_10179561 | |||
| 1288 | Ga0075370_10207239 | |||
| 1289 | Ga0068871_100027888 | |||
| 1290 | Ga0075430_100065409 | |||
| 1291 | Ga0075430_100220709 | |||
| 1292 | Ga0075431_100528281 | |||
| 1293 | Ga0075429_100001600 | |||
| 1294 | Ga0068865_100245777 | |||
| 1295 | Ga0097620_100011878 | |||
| 1296 | Ga0097620_100228061 | |||
| 1297 | Ga0099823_1000065 | |||
| 1298 | Ga0079104_1000073 | |||
| 1299 | Ga0079104_1013281 | |||
| 1300 | Ga0099826_10021938 | |||
| 1301 | Ga0105240_10010486 | |||
| 1302 | Ga0105240_10019736 | |||
| 1303 | Ga0105240_10574497 | |||
| 1304 | Ga0105245_10080390 | |||
| 1305 | Ga0105245_10103504 | |||
| 1306 | Ga0105245_10167552 | |||
| 1307 | Ga0105243_10001635 | |||
| 1308 | Ga0105243_10003223 | |||
| 1309 | Ga0105243_10022613 | |||
| 1310 | Ga0105243_10081328 | |||
| 1311 | Ga0105243_10160487 | |||
| 1312 | Ga0105241_10206459 | |||
| 1313 | Ga0105242_10056615 | |||
| 1314 | Ga0105248_10003890 | |||
| 1315 | Ga0105248_10031182 | |||
| 1316 | Ga0105248_10217621 | |||
| 1317 | Ga0105237_10000646 | |||
| 1318 | Ga0105237_10022295 | |||
| 1319 | Ga0105237_10068746 | |||
| 1320 | Ga0105238_10026742 | |||
| 1321 | Ga0105238_10037676 | |||
| 1322 | Ga0105238_10082294 | |||
| 1323 | Ga0105249_10106595 | |||
| 1324 | Ga0105249_10216666 | |||
| 1325 | Ga0105239_10001160 | |||
| 1326 | Ga0105239_10088990 | |||
| 1327 | Ga0105246_10035063 | |||
| 1328 | Ga0105246_10085320 | |||
| 1329 | Ga0157319_1000005 | |||
| 1330 | Ga0157373_10004013 | |||
| 1331 | Ga0157373_10114421 | |||
| 1332 | Ga0157370_10022622 | |||
| 1333 | Ga0157370_10370591 | |||
| 1334 | Ga0157369_10020212 | |||
| 1335 | Ga0157369_10190275 | |||
| 1336 | Ga0157374_10056021 | |||
| 1337 | Ga0157378_10074051 | |||
| 1338 | Ga0157378_10452883 | |||
| 1339 | Ga0163162_10035363 | |||
| 1340 | Ga0163162_10197493 | |||
| 1341 | Ga0163162_10381835 | |||
| 1342 | Ga0157372_10291506 | |||
| 1343 | Ga0157372_10328667 | |||
| 1344 | Ga0157372_10364568 | |||
| 1345 | Ga0157375_10007001 | |||
| 1346 | Ga0157375_10058836 | |||
| 1347 | Ga0163163_10292368 | |||
| 1348 | Ga0182008_10000617 | |||
| 1349 | Ga0182008_10001994 | |||
| 1350 | Ga0182008_10012188 | |||
| 1351 | Ga0182008_10118960 | |||
| 1352 | Ga0182008_10153589 | |||
| 1353 | Ga0157377_10000044 | |||
| 1354 | Ga0157379_10374713 | |||
| 1355 | Ga0157376_10004287 | |||
| 1356 | Ga0157376_10182905 | |||
| 1357 | Ga0182006_1000976 | |||
| 1358 | Ga0182006_1051814 | |||
| 1359 | Ga0182006_1064144 | |||
| 1360 | Ga0182007_10000481 | |||
| 1361 | Ga0182007_10001306 | |||
| 1362 | Ga0183362_10003 | |||
| 1363 | Ga0163161_10003002 | |||
| 1364 | Ga0163161_10399346 | |||
| 1365 | Ga0213872_10000233 | |||
| 1366 | Ga0213872_10007480 | |||
| 1367 | Ga0213872_10053399 | |||
| 1368 | Ga0209435_100002 | |||
| 1369 | Ga0209436_101107 | |||
| 1370 | Ga0209674_100015 | |||
| 1371 | Ga0209672_100307 | |||
| 1372 | Ga0209147_101110 | |||
| 1373 | Ga0209563_100017 | |||
| 1374 | Ga0207427_102838 | |||
| 1375 | Ga0209258_100025 | |||
| 1376 | Ga0209258_100093 | |||
| 1377 | Ga0209258_100881 | |||
| 1378 | Ga0207425_1000886 | |||
| 1379 | Ga0207425_1002809 | |||
| 1380 | Ga0207425_1003373 | |||
| 1381 | Ga0207425_1003655 | |||
| 1382 | Ga0209646_1000001 | |||
| 1383 | Ga0209646_1000229 | |||
| 1384 | Ga0209026_1000001 | |||
| 1385 | Ga0209026_1000028 | |||
| 1386 | Ga0209677_100037 | |||
| 1387 | Ga0209677_100113 | |||
| 1388 | Ga0209148_1000007 | |||
| 1389 | Ga0209759_1000001 | |||
| 1390 | Ga0209759_1000021 | |||
| 1391 | Ga0209759_1000844 | |||
| 1392 | Ga0209759_1002258 | |||
| 1393 | Ga0209129_1000469 | |||
| 1394 | Ga0209129_1000692 | |||
| 1395 | Ga0209129_1001207 | |||
| 1396 | Ga0209129_1006588 | |||
| 1397 | Ga0209129_1012548 | |||
| 1398 | Ga0209565_1000016 | |||
| 1399 | Ga0209565_1000117 | |||
| 1400 | Ga0209565_1000203 | |||
| 1401 | Ga0209565_1000388 | |||
| 1402 | Ga0209565_1000923 | |||
| 1403 | Ga0209455_1000166 | |||
| 1404 | Ga0209673_1000008 | |||
| 1405 | Ga0209673_1000218 | |||
| 1406 | Ga0209673_1000555 | |||
| 1407 | Ga0209673_1000659 | |||
| 1408 | Ga0209673_1003795 | |||
| 1409 | Ga0209673_1009241 | |||
| 1410 | Ga0209673_1014492 | |||
| 1411 | Ga0209673_1033602 | |||
| 1412 | Ga0209130_1000104 | |||
| 1413 | Ga0209130_1000161 | |||
| 1414 | Ga0209130_1000247 | |||
| 1415 | Ga0209130_1000526 | |||
| 1416 | Ga0209130_1003544 | |||
| 1417 | Ga0209675_1000099 | |||
| 1418 | Ga0209675_1000113 | |||
| 1419 | Ga0209675_1000230 | |||
| 1420 | Ga0209675_1000885 | |||
| 1421 | Ga0209675_1011276 | |||
| 1422 | Ga0209676_1000023 | |||
| 1423 | Ga0209676_1000028 | |||
| 1424 | Ga0209676_1000367 | |||
| 1425 | Ga0209676_1002155 | |||
| 1426 | Ga0209676_1015790 | |||
| 1427 | Ga0209676_1016222 | |||
| 1428 | Ga0209025_1000194 | |||
| 1429 | Ga0209025_1000561 | |||
| 1430 | Ga0209025_1000665 | |||
| 1431 | Ga0209025_1001618 | |||
| 1432 | Ga0209025_1012448 | |||
| 1433 | Ga0209025_1012982 | |||
| 1434 | Ga0209025_1015106 | |||
| 1435 | Ga0209025_1016816 | |||
| 1436 | Ga0209025_1051324 | |||
| 1437 | Ga0209564_1000008 | |||
| 1438 | Ga0209564_1000344 | |||
| 1439 | Ga0209564_1000555 | |||
| 1440 | Ga0209564_1000777 | |||
| 1441 | Ga0209564_1002809 | |||
| 1442 | Ga0209564_1009693 | |||
| 1443 | Ga0209758_1000124 | |||
| 1444 | Ga0209758_1000199 | |||
| 1445 | Ga0209050_1000022 | |||
| 1446 | Ga0209050_1000072 | |||
| 1447 | Ga0209050_1000133 | |||
| 1448 | Ga0209050_1001503 | |||
| 1449 | Ga0209050_1001949 | |||
| 1450 | Ga0209050_1004416 | |||
| 1451 | Ga0209050_1004742 | |||
| 1452 | Ga0209050_1011534 | |||
| 1453 | Ga0209050_1026920 | |||
| 1454 | Ga0209256_1000001 | |||
| 1455 | Ga0209256_1000036 | |||
| 1456 | Ga0209256_1000151 | |||
| 1457 | Ga0209256_1000256 | |||
| 1458 | Ga0209256_1009778 | |||
| 1459 | Ga0207426_1000049 | |||
| 1460 | Ga0207426_1000156 | |||
| 1461 | Ga0207426_1000315 | |||
| 1462 | Ga0207426_1001121 | |||
| 1463 | Ga0209051_1000013 | |||
| 1464 | Ga0209051_1000015 | |||
| 1465 | Ga0209051_1000056 | |||
| 1466 | Ga0209051_1000068 | |||
| 1467 | Ga0209051_1000172 | |||
| 1468 | Ga0209051_1000535 | |||
| 1469 | Ga0209051_1000948 | |||
| 1470 | Ga0209051_1001202 | |||
| 1471 | Ga0209051_1005351 | |||
| 1472 | Ga0209051_1033775 | |||
| 1473 | Ga0209257_1000015 | |||
| 1474 | Ga0209257_1000037 | |||
| 1475 | Ga0209257_1000042 | |||
| 1476 | Ga0209257_1000108 | |||
| 1477 | Ga0209257_1000146 | |||
| 1478 | Ga0209257_1001593 | |||
| 1479 | Ga0209257_1001704 | |||
| 1480 | Ga0209257_1001972 | |||
| 1481 | Ga0207655_1000974 | |||
| 1482 | Ga0207682_10037399 | |||
| 1483 | Ga0207682_10137617 | |||
| 1484 | Ga0207642_10004964 | |||
| 1485 | Ga0207688_10091857 | |||
| 1486 | Ga0207688_10096340 | |||
| 1487 | Ga0207680_10003414 | |||
| 1488 | Ga0207645_10008378 | |||
| 1489 | Ga0207643_10028248 | |||
| 1490 | Ga0207643_10053955 | |||
| 1491 | Ga0207684_10000714 | |||
| 1492 | Ga0207695_10010328 | |||
| 1493 | Ga0207695_10047103 | |||
| 1494 | Ga0207695_10059939 | |||
| 1495 | Ga0207695_10157669 | |||
| 1496 | Ga0207695_10216327 | |||
| 1497 | Ga0207671_10003088 | |||
| 1498 | Ga0207671_10228065 | |||
| 1499 | Ga0207660_10146459 | |||
| 1500 | Ga0207657_10064644 | |||
| 1501 | Ga0207657_10084888 | |||
| 1502 | Ga0207649_10001995 | |||
| 1503 | Ga0207652_10300149 | |||
| 1504 | Ga0207681_10016203 | |||
| 1505 | Ga0207681_10049788 | |||
| 1506 | Ga0207681_10071794 | |||
| 1507 | Ga0207694_10093074 | |||
| 1508 | Ga0207694_10118198 | |||
| 1509 | Ga0207694_10127280 | |||
| 1510 | Ga0207650_10001020 | |||
| 1511 | Ga0207650_10007256 | |||
| 1512 | Ga0207650_10043960 | |||
| 1513 | Ga0207650_10097562 | |||
| 1514 | Ga0207659_10000614 | |||
| 1515 | Ga0207659_10004223 | |||
| 1516 | Ga0207659_10089873 | |||
| 1517 | Ga0207644_10001630 | |||
| 1518 | Ga0207644_10122931 | |||
| 1519 | Ga0207690_10006152 | |||
| 1520 | Ga0207690_10139037 | |||
| 1521 | Ga0207690_10144538 | |||
| 1522 | Ga0207690_10267357 | |||
| 1523 | Ga0207706_10013837 | |||
| 1524 | Ga0207706_10034484 | |||
| 1525 | Ga0207686_10059077 | |||
| 1526 | Ga0207709_10000208 | |||
| 1527 | Ga0207709_10000357 | |||
| 1528 | Ga0207709_10001132 | |||
| 1529 | Ga0207709_10007415 | |||
| 1530 | Ga0207709_10073675 | |||
| 1531 | Ga0207709_10121704 | |||
| 1532 | Ga0207670_10031642 | |||
| 1533 | Ga0207669_10023687 | |||
| 1534 | Ga0207669_10258530 | |||
| 1535 | Ga0207704_10178357 | |||
| 1536 | Ga0207691_10007703 | |||
| 1537 | Ga0207691_10015702 | |||
| 1538 | Ga0207711_10014140 | |||
| 1539 | Ga0207711_10174740 | |||
| 1540 | Ga0207689_10008177 | |||
| 1541 | Ga0207689_10008989 | |||
| 1542 | Ga0207689_10088037 | |||
| 1543 | Ga0207661_10244488 | |||
| 1544 | Ga0207679_10000453 | |||
| 1545 | Ga0207667_10082864 | |||
| 1546 | Ga0207667_10116351 | |||
| 1547 | Ga0207667_10130776 | |||
| 1548 | Ga0207651_10000476 | |||
| 1549 | Ga0207651_10011142 | |||
| 1550 | Ga0207651_10062131 | |||
| 1551 | Ga0207712_10195926 | |||
| 1552 | Ga0207712_10330512 | |||
| 1553 | Ga0207640_10059247 | |||
| 1554 | Ga0207658_10022597 | |||
| 1555 | Ga0207658_10107715 | |||
| 1556 | Ga0207658_10257209 | |||
| 1557 | Ga0207677_10006252 | |||
| 1558 | Ga0207677_10008894 | |||
| 1559 | Ga0207677_10029076 | |||
| 1560 | Ga0207703_10003022 | |||
| 1561 | Ga0207639_10221011 | |||
| 1562 | Ga0207639_10343561 | |||
| 1563 | Ga0207678_10043665 | |||
| 1564 | Ga0207678_10092970 | |||
| 1565 | Ga0207708_10045951 | |||
| 1566 | Ga0207702_10000345 | |||
| 1567 | Ga0207702_10307168 | |||
| 1568 | Ga0207641_10164550 | |||
| 1569 | Ga0207648_10008899 | |||
| 1570 | Ga0207648_10028479 | |||
| 1571 | Ga0207648_10069236 | |||
| 1572 | Ga0207648_10161568 | |||
| 1573 | Ga0207676_10000855 | |||
| 1574 | Ga0207674_10019325 | |||
| 1575 | Ga0207674_10049805 | |||
| 1576 | Ga0207674_10080316 | |||
| 1577 | Ga0207675_100000103 | |||
| 1578 | Ga0207675_100148638 | |||
| 1579 | Ga0207675_100495076 | |||
| 1580 | Ga0207683_10016681 | |||
| 1581 | Ga0207683_10022010 | |||
| 1582 | Ga0207683_10078878 | |||
| 1583 | Ga0207698_10005200 | |||
| 1584 | Ga0207698_10100599 | |||
| 1585 | Ga0209281_1000263 | |||
| 1586 | Ga0209281_1017852 | |||
| 1587 | Ga0209389_1001227 | |||
| 1588 | Ga0209371_1005280 | |||
| 1589 | Ga0209969_1007997 | |||
| 1590 | Ga0209967_1002007 | |||
| 1591 | Ga0209996_1010143 | |||
| 1592 | Ga0209968_1000714 | |||
| 1593 | Ga0209999_1008888 | |||
| 1594 | Ga0209282_1000720 | |||
| 1595 | Ga0209971_1015227 | |||
| 1596 | Ga0209966_1000017 | |||
| 1597 | Ga0209974_10012934 | |||
| 1598 | Ga0209974_10034322 | |||
| 1599 | Ga0207428_10027528 | |||
| 1600 | Ga0268266_10010311 | |||
| 1601 | Ga0268266_10100787 | |||
| 1602 | Ga0268266_10231970 | |||
| 1603 | Ga0268264_10445553 | |||
| 1604 | Ga0268264_10511588 | |||
| 1605 | Ga0265336_10000010 | |||
| 1606 | Ga0307517_10002030 | |||
| 1607 | Ga0307517_10103305 | |||
| 1608 | Ga0307517_10140067 | |||
| 1609 | Ga0307515_10000281 | |||
| 1610 | Ga0307515_10000399 | |||
| 1611 | Ga0307515_10002930 | |||
| 1612 | Ga0307515_10003462 | |||
| 1613 | Ga0307515_10011834 | |||
| 1614 | Ga0307515_10011860 | |||
| 1615 | Ga0307515_10018081 | |||
| 1616 | Ga0307515_10049174 | |||
| 1617 | Ga0307515_10066254 | |||
| 1618 | Ga0307515_10068831 | |||
| 1619 | Ga0307515_10184951 | |||
| 1620 | Ga0307515_10218326 | |||
| 1621 | Ga0307515_10235047 | |||
| 1622 | Ga0307515_10236578 | |||
| 1623 | Ga0265324_10001637 | |||
| 1624 | Ga0268256_1005278 | |||
| 1625 | Ga0307512_10011191 | |||
| 1626 | Ga0307512_10074820 | |||
| 1627 | Ga0314311_1212901 | |||
| 1628 | Ga0316183_1188808 | |||
| 1629 | Ga0316181_1054429 | |||
| 1630 | Ga0316181_1057358 | |||
| 1631 | Ga0265330_10000046 | |||
| 1632 | Ga0265330_10041662 | |||
| 1633 | Ga0265332_10000005 | |||
| 1634 | Ga0265332_10000028 | |||
| 1635 | Ga0265332_10012523 | |||
| 1636 | Ga0265328_10004495 | |||
| 1637 | Ga0265328_10014090 | |||
| 1638 | Ga0265325_10002230 | |||
| 1639 | Ga0265325_10063000 | |||
| 1640 | Ga0265340_10012777 | |||
| 1641 | Ga0265331_10001815 | |||
| 1642 | Ga0265327_10000035 | |||
| 1643 | Ga0265327_10000327 | |||
| 1644 | Ga0265327_10000536 | |||
| 1645 | Ga0265327_10037546 | |||
| 1646 | Ga0265316_10000556 | |||
| 1647 | Ga0307513_10000029 | |||
| 1648 | Ga0307513_10021439 | |||
| 1649 | Ga0307513_10052787 | |||
| 1650 | Ga0307513_10140467 | |||
| 1651 | Ga0307509_10000249 | |||
| 1652 | Ga0307509_10004869 | |||
| 1653 | Ga0307509_10053300 | |||
| 1654 | Ga0307509_10083981 | |||
| 1655 | Ga0307509_10208364 | |||
| 1656 | Ga0307408_100042041 | |||
| 1657 | Ga0307408_100087573 | |||
| 1658 | Ga0307408_100095526 | |||
| 1659 | Ga0307508_10000143 | |||
| 1660 | Ga0307508_10000216 | |||
| 1661 | Ga0307508_10001407 | |||
| 1662 | Ga0307508_10038603 | |||
| 1663 | Ga0307514_10001116 | |||
| 1664 | Ga0307514_10006402 | |||
| 1665 | Ga0307514_10135889 | |||
| 1666 | Ga0265314_10000054 | |||
| 1667 | Ga0265314_10005007 | |||
| 1668 | Ga0265342_10014895 | |||
| 1669 | Ga0307516_10000065 | |||
| 1670 | Ga0307516_10000236 | |||
| 1671 | Ga0307516_10002712 | |||
| 1672 | Ga0307516_10003015 | |||
| 1673 | Ga0307516_10010074 | |||
| 1674 | Ga0307516_10072223 | |||
| 1675 | Ga0307516_10087141 | |||
| 1676 | Ga0307405_10028914 | |||
| 1677 | Ga0307405_10031433 | |||
| 1678 | Ga0307405_10034773 | |||
| 1679 | Ga0307405_10047596 | |||
| 1680 | Ga0307405_10064883 | |||
| 1681 | Ga0307405_10189070 | |||
| 1682 | Ga0307405_10261202 | |||
| 1683 | Ga0307410_10004481 | |||
| 1684 | Ga0307410_10308078 | |||
| 1685 | Ga0307406_10013926 | |||
| 1686 | Ga0307406_10090424 | |||
| 1687 | Ga0307407_10064608 | |||
| 1688 | Ga0307412_10002112 | |||
| 1689 | Ga0307412_10006384 | |||
| 1690 | Ga0307412_10027010 | |||
| 1691 | Ga0307412_10080050 | |||
| 1692 | Ga0307412_10174099 | |||
| 1693 | Ga0307409_100018418 | |||
| 1694 | Ga0307416_100027129 | |||
| 1695 | Ga0307416_100059445 | |||
| 1696 | Ga0307414_10190895 | |||
| 1697 | Ga0307414_10654725 | |||
| 1698 | Ga0307411_10000084 | |||
| 1699 | Ga0307411_10037095 | |||
| 1700 | Ga0307411_10087925 | |||
| 1701 | Ga0307411_10437936 | |||
| 1702 | Ga0307415_100069750 | |||
| 1703 | Ga0316583_10001261 | |||
| 1704 | Ga0307510_10002166 | |||
| 1705 | Ga0307510_10017769 | |||
| 1706 | Ga0307510_10113957 | |||
| 1707 | Ga0373934_0006284 | |||
| 1708 | Ga0373923_0010198 | |||
| 1709 | Ga0373954_0109084 | |||
| 1710 | Ga0373931_0009597 | |||
| 1711 | Ga0373931_0080310 | |||
| 1712 | Ga0373927_0036096 | |||
| 1713 | Ga0373925_0003753 | |||
| 1714 | Ga0373925_0134171 | |||
| 1715 | Ga0395899_0018517 | |||
| 1716 | Ga0395899_0056635 | |||
| 1717 | Ga0395900_0013050 | |||
| 1718 | Ga0395900_0017963 | |||
| 1719 | Ga0395898_0012551 | |||
| 1720 | Ga0395898_0019168 | |||
| 1721 | Ga0395898_0040215 | |||
| 1722 | Ga0395898_0074595 | |||
| 1723 | Ga0395905_0000090 | |||
| 1724 | Ga0395905_0001810 | |||
| 1725 | Ga0395905_0005572 | |||
| 1726 | Ga0395905_0011798 | |||
| 1727 | Ga0395905_0031793 | |||
| 1728 | Ga0395905_0049559 | |||
| 1729 | Ga0395905_0052627 | |||
| 1730 | Ga0395905_0056154 | |||
| 1731 | Ga0395905_0088671 | |||
| 1732 | Ga0395905_0288940 | |||
| 1733 | Ga0395905_0545519 | |||
| 1734 | Ga0395901_0016676 | |||
| 1735 | Ga0395901_0148309 | |||
| 1736 | Ga0395901_0483830 | |||
| 1737 | Ga0436365_0365298 | |||
| 1738 | Ga0436360_1018511 | |||
| 1739 | Ga0436361_0004571 | |||
| 1740 | Ga0436361_0052876 | |||
| 1741 | Ga0436361_0504982 | |||
| 1742 | Ga0436361_0943202 | |||
| 1743 | Ga0436361_0949608 | |||
| 1744 | Ga0439436_0000433 | |||
| 1745 | Ga0439436_0004913 | |||
| 1746 | Ga0439439_0003942 | |||
| 1747 | Ga0439439_0037742 | |||
| 1748 | Ga0439447_040234 | |||
| 1749 | Ga0439466_0000773 | |||
| 1750 | Ga0439466_0069061 | |||
| 1751 | Ga0439465_0001191 | |||
| 1752 | Ga0439431_0001685 | |||
| 1753 | Ga0439433_0000272 | |||
| 1754 | Ga0439437_001274 | |||
| 1755 | Ga0439442_002999 | |||
| 1756 | Ga0439442_024879 | |||
| 1757 | Ga0439445_0000236 | |||
| 1758 | Ga0439432_002286 | |||
| 1759 | Ga0439432_006073 | |||
| 1760 | Ga0439449_0000814 | |||
| 1761 | Ga0439449_0001806 | |||
| 1762 | Ga0439449_0002258 | |||
| 1763 | Ga0439449_0017950 | |||
| 1764 | Ga0439452_002048 | |||
| 1765 | Ga0439452_010761 | |||
| 1766 | Ga0439457_003079 | |||
| 1767 | Ga0439457_036027 | |||
| 1768 | Ga0439462_0001525 | |||
| 1769 | Ga0439462_0005602 | |||
| 1770 | Ga0439462_0040532 | |||
| 1771 | Ga0450911_000367 | |||
| 1772 | Ga0450912_003480 | |||
| 1773 | Ga0450915_000829 | |||
| 1774 | Ga0450917_000458 | |||
| 1775 | Ga0450919_004117 | |||
| 1776 | Ga0450923_000469 | |||
| 1777 | Ga0450923_009815 | |||
| 1778 | Ga0450888_000384 | |||
| 1779 | Ga0450890_000733 | |||
| 1780 | Ga0450890_000896 | |||
| 1781 | Ga0450897_003323 | |||
| 1782 | Ga0450891_001023 | |||
| 1783 | Ga0450892_002663 | |||
| 1784 | Ga0450894_007824 | |||
| 1785 | Ga0450898_000098 | |||
| 1786 | Ga0450898_001037 | |||
| 1787 | Ga0450899_002077 | |||
| 1788 | Ga0450889_000002 | |||
| 1789 | Ga0450906_007126 | |||
| 1790 | Ga0439446_0002237 | |||
| 1791 | Ga0450908_002606 | |||
| 1792 | Ga0450908_021527 | |||
| 1793 | Ga0450909_019868 | |||
| 1794 | Ga0439434_0000511 | |||
| 1795 | Ga0439434_0003319 | |||
| 1796 | Ga0439435_0008477 | |||
| 1797 | Ga0439435_0081884 | |||
| 1798 | Ga0439459_0000080 | |||
| 1799 | Ga0439464_0049500 | |||
| 1800 | Ga0450918_002566 | |||
| 1801 | Ga0450901_002844 | |||
| 1802 | Ga0451577_0000152 | |||
| 1803 | Ga0451577_0000960 | |||
| 1804 | Ga0451577_0001888 | |||
| 1805 | Ga0451577_0008924 | |||
| 1806 | Ga0451577_0011213 | |||
| 1807 | Ga0451577_0032480 | |||
| 1808 | Ga0451577_0111170 | |||
| 1809 | Ga0451577_0118247 | |||
| 1810 | Ga0451577_0584775 | |||
| 1811 | Ga0466969_0000046 | |||
| 1812 | Ga0453683_0000780 | |||
| 1813 | Ga0453683_0001915 | |||
| 1814 | Ga0453683_0056286 | |||
| 1815 | Ga0453683_0063951 | |||
| 1816 | Ga0453683_0186382 | |||
| 1817 | Ga0466965_0010795 | |||
| 1818 | Ga0466965_0028134 | |||
| 1819 | Ga0466966_0001824 | |||
| 1820 | Ga0466966_0003197 | |||
| 1821 | Ga0466966_0013012 | |||
| 1822 | Ga0466966_0126880 | |||
| 1823 | Ga0466966_0202601 | |||
| 1824 | Ga0466961_0003378 | |||
| 1825 | Ga0466961_0128098 | |||
| 1826 | Ga0466961_0163579 | |||
| 1827 | Ga0466963_0034322 | |||
| 1828 | Ga0466963_0091823 | |||
| 1829 | Ga0466963_0232429 | |||
| 1830 | Ga0466963_0249219 | |||
| 1831 | Ga0466963_0337457 | |||
| 1832 | Ga0466964_0000661 | |||
| 1833 | Ga0453684_0000005 | |||
| 1834 | Ga0453684_0000122 | |||
| 1835 | Ga0453684_0000292 | |||
| 1836 | Ga0453684_0001481 | |||
| 1837 | Ga0453684_0011876 | |||
| 1838 | Ga0453684_0012714 | |||
| 1839 | Ga0453684_0043725 | |||
| 1840 | Ga0453684_0106707 | |||
| 1841 | Ga0453684_0691202 | |||
| 1842 | Ga0466971_0004012 | |||
| 1843 | Ga0466971_0032441 | |||
| 1844 | Ga0466968_0006091 | |||
| 1845 | Ga0466970_0013356 | |||
| 1846 | Ga0466957_0021403 | |||
| 1847 | Ga0466960_0115552 | |||
| 1848 | Ga0466959_0000174 | |||
| 1849 | Ga0466959_0008463 | |||
| 1850 | Ga0466959_0020372 | |||
| 1851 | Ga0466959_0037334 | |||
| 1852 | Ga0451576_0000386 | |||
| 1853 | Ga0451576_0000559 | |||
| 1854 | Ga0451576_0001016 | |||
| 1855 | Ga0451576_0006691 | |||
| 1856 | Ga0451576_0006746 | |||
| 1857 | Ga0451576_0030234 | |||
| 1858 | Ga0451576_0584317 | |||
| 1859 | Ga0451576_0692484 | |||
| 1860 | Ga0466958_0044925 | |||
| 1861 | Ga0466967_0022574 | |||
| 1862 | Ga0466967_0024163 | |||
| 1863 | Ga0466967_0056041 | |||
| 1864 | Ga0466967_0123860 | |||
| 1865 | Ga0495627_004796 | |||
| 1866 | Ga0495627_014974 | |||
| 1867 | Ga0495592_0000266 | |||
| 1868 | Ga0495629_0124653 | |||
| 1869 | Ga0495638_0049699 | |||
| 1870 | Ga0495650_0054464 | |||
| 1871 | Ga0495639_0005280 | |||
| 1872 | Ga0495639_0015870 | |||
| 1873 | Ga0495585_0024071 | |||
| 1874 | Ga0495583_0000428 | |||
| 1875 | Ga0495606_0006933 | |||
| 1876 | Ga0495606_0120750 | |||
| 1877 | Ga0495610_0011787 | |||
| 1878 | Ga0495610_0047700 | |||
| 1879 | Ga0495616_0004282 | |||
| 1880 | Ga0495620_0046540 | |||
| 1881 | Ga0495628_0398874 | |||
| 1882 | Ga0495631_0000152 | |||
| 1883 | Ga0495632_0002610 | |||
| 1884 | Ga0495632_0006664 | |||
| 1885 | Ga0495643_0030909 | |||
| 1886 | Ga0495642_0078491 | |||
| 1887 | Ga0495654_0006840 | |||
| 1888 | Ga0495621_0016139 | |||
| 1889 | Ga0495597_0000038 | |||
| 1890 | Ga0495597_0048985 | |||
| 1891 | Ga0495645_0084769 | |||
| 1892 | Ga0495633_0001724 | |||
| 1893 | Ga0495656_0001010 | |||
| 1894 | Ga0495656_0090085 | |||
| 1895 | Ga0495668_0064031 | |||
| 1896 | Ga0495668_0065248 | |||
| 1897 | Ga0495625_0000294 | |||
| 1898 | Ga0495625_0012585 | |||
| 1899 | Ga0495625_0018155 | |||
| 1900 | Ga0495625_0124209 | |||
| 1901 | Ga0495588_0059095 | |||
| 1902 | Ga0495588_0118840 | |||
| 1903 | Ga0495647_0076902 | |||
| 1904 | Ga0495658_0020103 | |||
| 1905 | Ga0495658_0033012 | |||
| 1906 | Ga0495669_0025262 | |||
| 1907 | Ga0495670_0007639 | |||
| 1908 | Ga0495670_0059305 | |||
| 1909 | Ga0495671_0013044 | |||
| 1910 | Ga0495649_0000210 | |||
| 1911 | Ga0495649_0000401 | |||
| 1912 | Ga0495589_0026413 | |||
| 1913 | Ga0495600_0175781 | |||
| 1914 | Ga0495660_0046211 | |||
| 1915 | Ga0495660_0110528 | |||
| 1916 | Ga0495674_0054126 | |||
| 1917 | Ga0495672_0026238 | |||
| 1918 | Ga0495676_0017637 | |||
| 1919 | Ga0495687_000174 | |||
| 1920 | Ga0495687_011763 | |||
| 1921 | Ga0495687_015227 | |||
| 1922 | Ga0495677_0035297 | |||
| 1923 | Ga0495685_032242 | |||
| 1924 | Ga0495673_0066156 | |||
| 1925 | Ga0495681_0063316 | |||
| 1926 | Ga0495686_0005097 | |||
| 1927 | Ga0495593_0009585 | |||
| 1928 | Ga0496100_0002506 | |||
| 1929 | Ga0496100_0229286 | |||
| 1930 | Ga0496101_0018733 | |||
| 1931 | Ga0496102_0001785 | |||
| 1932 | Ga0496102_0012360 | |||
| 1933 | Ga0496102_0115223 | |||
| 1934 | Ga0496102_0311942 | |||
| 1935 | Ga0496103_0026597 | |||
| 1936 | Ga0496104_0005399 | |||
| 1937 | Ga0496105_0000270 | |||
| 1938 | Ga0496106_0029116 | |||
| 1939 | Ga0496106_0219939 | |||
| 1940 | Ga0496108_0036777 | |||
| 1941 | Ga0496108_0097563 | |||
| 1942 | Ga0496108_0340663 | |||
| 1943 | Ga0496109_0006879 | |||
| 1944 | Ga0496109_0092423 | |||
| 1945 | Ga0496109_0111256 | |||
| 1946 | Ga0496109_0327993 | |||
| 1947 | Ga0496110_0034590 | |||
| 1948 | Ga0496111_0069048 | |||
| 1949 | Ga0496112_0027735 | |||
| 1950 | Ga0496113_0061238 | |||
| 1951 | Ga0496113_0315437 | |||
| 1952 | Ga0496114_0052452 | |||
| 1953 | Ga0496114_0080712 | |||
| 1954 | Ga0496116_0010837 | |||
| 1955 | Ga0496117_0028405 | |||
| 1956 | Ga0496118_0008785 | |||
| 1957 | Ga0496118_0017785 | |||
| 1958 | Ga0496119_0031441 | |||
| 1959 | Ga0496121_0025097 | |||
| 1960 | Ga0496121_0091460 | |||
| 1961 | Ga0496121_0095099 | |||
| 1962 | Ga0496122_0000319 | |||
| 1963 | Ga0496122_0045563 | |||
| 1964 | Ga0496122_0165015 | |||
| 1965 | Ga0496122_0172747 | |||
| 1966 | Ga0496123_0000117 | |||
| 1967 | Ga0496123_0049423 | |||
| 1968 | Ga0496124_0000108 | |||
| 1969 | Ga0496124_0005335 | |||
| 1970 | Ga0496124_0012533 | |||
| 1971 | Ga0496124_0191163 | |||
| 1972 | Ga0496125_0030669 | |||
| 1973 | Ga0496125_0031844 | |||
| 1974 | Ga0496125_0041469 | |||
| 1975 | Ga0496125_0080242 | |||
| 1976 | Ga0496125_0081740 | |||
| 1977 | Ga0496125_0137503 | |||
| 1978 | Ga0496125_0181339 | |||
| 1979 | Ga0496126_0257994 | |||
| 1980 | Ga0501032_0077390 | |||
| 1981 | Ga0501034_0311587 | |||
| 1982 | Ga0501036_0560498 | |||
| 1983 | Ga0501043_0000002 | |||
| 1984 | Ga0501046_0000008 | |||
| 1985 | Ga0501047_0000003 | |||
| 1986 | Ga0501048_0001290 | |||
| 1987 | Ga0501073_0327386 | |||
| 1988 | Ga0501198_000007 | |||
| 1989 | Ga0501222_000005 | |||
| 1990 | Ga0501222_003974 | |||
| 1991 | Ga0501221_000521 | |||
| 1992 | Ga0501225_0003739 | |||
| 1993 | Ga0501229_002242 | |||
| 1994 | Ga0501262_000238 | |||
| 1995 | Ga0501266_001273 | |||
| 1996 | Ga0501267_000280 | |||
| 1997 | Ga0501035_0065657 | |||
| 1998 | Ga0501035_0137830 | |||
| 1999 | Ga0501035_0215301 | |||
| 2000 | Ga0501044_0120692 | |||
| 2001 | Ga0501044_0230364 | |||
| 2002 | Ga0501045_0013748 | |||
| 2003 | nmdc:mga03683_11300_c1 | |||
| 2004 | nmdc:mga03683_11861_c1 | |||
| 2005 | nmdc:mga03683_1606_c1 | |||
| 2006 | nmdc:mga03683_17733_c1 | |||
| 2007 | nmdc:mga03683_28362_c1 | |||
| 2008 | nmdc:mga03683_3472_c1 | |||
| 2009 | nmdc:mga03683_6609_c1 | |||
| 2010 | nmdc:mga03683_91574_c1 | |||
| 2011 | nmdc:mga03n38_189278_c1 | |||
| 2012 | nmdc:mga03n38_68079_c1 | |||
| 2013 | nmdc:mga00v17_7452_c1 | |||
| 2014 | nmdc:mga0yw44_113914_c1 | |||
| 2015 | nmdc:mga0yw44_13078_c1 | |||
| 2016 | nmdc:mga0yw44_42703_c1 | |||
| 2017 | nmdc:mga0yw44_50834_c1 | |||
| 2018 | nmdc:mga0k408_106644_c1 | |||
| 2019 | nmdc:mga0k408_12253_c1 | |||
| 2020 | nmdc:mga0k408_1368_c1 | |||
| 2021 | nmdc:mga0k408_17052_c1 | |||
| 2022 | nmdc:mga0k408_18859_c1 | |||
| 2023 | nmdc:mga0k408_24920_c1 | |||
| 2024 | nmdc:mga0k408_29274_c1 | |||
| 2025 | nmdc:mga0k408_31968_c1 | |||
| 2026 | nmdc:mga0k408_42664_c1 | |||
| 2027 | nmdc:mga0k408_43413_c1 | |||
| 2028 | nmdc:mga0k408_6428_c1 | |||
| 2029 | nmdc:mga0k408_6872_c1 | |||
| 2030 | nmdc:mga0k408_7451_c1 | |||
| 2031 | nmdc:mga0k408_75045_c1 | |||
| 2032 | nmdc:mga0k408_8312_c1 | |||
| 2033 | nmdc:mga06z11_11077_c1 | |||
| 2034 | nmdc:mga04h51_15526_c1 | |||
| 2035 | nmdc:mga07m45_1112_c1 | |||
| 2036 | nmdc:mga07m45_115984_c1 | |||
| 2037 | nmdc:mga07m45_12251_c1 | |||
| 2038 | nmdc:mga07m45_2245_c1 | |||
| 2039 | nmdc:mga07m45_24862_c1 | |||
| 2040 | nmdc:mga07m45_3134_c1 | |||
| 2041 | nmdc:mga07m45_39957_c1 | |||
| 2042 | nmdc:mga05p37_279607_c1 | |||
| 2043 | nmdc:mga09592_9075_c1 | |||
| 2044 | nmdc:mga0qj67_360772_c1 | |||
| 2045 | nmdc:mga0qj67_36946_c1 | |||
| 2046 | nmdc:mga06r32_449751_c1 | |||
| 2047 | nmdc:mga0sz30_9079_c1 | |||
| 2048 | Ga0495601_0268997 | |||
| 2049 | Ga0500610_0000833 | |||
| 2050 | Ga0500635_0000070 | |||
| 2051 | Ga0495595_0076487 | |||
| 2052 | Ga0500578_0000637 | |||
| 2053 | Ga0500643_003900 | |||
| 2054 | Ga0500644_0004062 | |||
| 2055 | Ga0500646_0009529 | |||
| 2056 | Ga0500583_0114117 | |||
| 2057 | Ga0500651_0000046 | |||
| 2058 | Ga0500651_0008197 | |||
| 2059 | Ga0500651_0054861 | |||
| 2060 | Ga0500566_0006938 | |||
| 2061 | Ga0500555_034236 | |||
| 2062 | Ga0500571_000037 | |||
| 2063 | Ga0500572_032822 | |||
| 2064 | Ga0500592_006985 | |||
| 2065 | Ga0500593_000315 | |||
| 2066 | Ga0500593_002077 | |||
| 2067 | Ga0500593_014481 | |||
| 2068 | Ga0500594_0004982 | |||
| 2069 | Ga0500594_0021400 | |||
| 2070 | Ga0500607_003946 | |||
| 2071 | Ga0500608_003983 | |||
| 2072 | Ga0500608_020866 | |||
| 2073 | Ga0500642_0023612 | |||
| 2074 | Ga0500652_004170 | |||
| 2075 | Ga0500655_002347 | |||
| 2076 | Ga0500658_0000869 | |||
| 2077 | Ga0500658_0001634 | |||
| 2078 | Ga0500658_0004194 | |||
| 2079 | Ga0500658_0017664 | |||
| 2080 | Ga0500559_0000032 | |||
| 2081 | Ga0500559_0005220 | |||
| 2082 | Ga0500559_0007014 | |||
| 2083 | Ga0500561_0015607 | |||
| 2084 | Ga0500564_019579 | |||
| 2085 | Ga0500564_024284 | |||
| 2086 | Ga0500568_0003832 | |||
| 2087 | Ga0500568_0058927 | |||
| 2088 | Ga0500574_003796 | |||
| 2089 | Ga0500590_004909 | |||
| 2090 | Ga0500616_0088713 | |||
| 2091 | Ga0500619_000137 | |||
| 2092 | Ga0500622_0000125 | |||
| 2093 | Ga0500622_0003836 | |||
| 2094 | Ga0500634_0044606 | |||
| 2095 | Ga0500638_081797 | |||
| 2096 | Ga0500570_118610 | |||
| 2097 | Ga0500645_000042 | |||
| 2098 | Ga0500587_001091 | |||
| 2099 | Ga0500587_005447 | |||
| 2100 | Ga0500661_000710 | |||
| 2101 | Ga0590075_049232 | |||
| 2102 | Ga0466962_0030900 | |||
| 2103 | Ga0466962_0158799 | |||
| 2104 | 2511243098 | |||
| 2105 | 2513228429 | |||
| 2106 | 2548501532 | |||
| 2107 | 2587725299 | |||
| 2108 | 2587731343 | |||
| 2109 | 2588290099 | |||
| 2110 | 2599620723 | |||
| 2111 | 2599674022 | |||
| 2112 | 2599678661 | |||
| 2113 | 2599690234 | |||
| 2114 | 2643867297 | |||
| 2115 | 2643972817 | |||
| 2116 | 2643990214 | |||
| 2117 | 2644059242 | |||
| 2118 | 2644075720 | |||
| 2119 | 2644143336 | |||
| 2120 | 2644161467 | |||
| 2121 | 2644243509 | |||
| 2122 | 2644276227 | |||
| 2123 | 2644295707 | |||
| 2124 | 2644324189 | |||
| 2125 | 2644338657 | |||
| 2126 | 2644400565 | |||
| 2127 | 2644465083 | |||
| 2128 | 2644645251 | |||
| 2129 | 2738720572 | |||
| 2130 | 2738884145 | |||
| 2131 | 2739055994 | |||
| 2132 | 2739240733 | |||
| 2133 | 2739250237 | |||
| 2134 | 2739279771 | |||
| 2135 | 2816472190 | |||
| 2136 | 2819601252 | |||
| 2137 | 2831269336 | |||
| 2138 | 2831864586 | |||
| 2139 | 2838055332 | |||
| 2140 | 2842679420 | |||
| 2141 | 2842737644 | |||
| 2142 | 2842749631 | |||
| 2143 | 2881104799 | |||
| 2144 | 2885197164 | |||
| 2145 | 2885201593 | |||
| 2146 | 2885215696 | |||
| 2147 | 2899927400 | |||
| 2148 | 2904450871 | |||
| 2149 | 2904459626 | |||
| 2150 | 2919462604 | |||
| 2151 | 2919707014 | |||
| 2152 | 2928042688 | |||
| 2153 | 2928048885 | |||
| 2154 | 2928055219 | |||
| 2155 | 2928068647 | |||
| 2156 | 2928073441 | |||
| 2157 | 2928090002 | |||
| 2158 | 2929161486 | |||
| 2159 | 2929521726 | |||
| 2160 | 2932423839 | |||
| 2161 | 2939635705 | |||
| 2162 | 2945914046 | |||
| 2163 | 2945949611 | |||
| 2164 | 2945973647 | |||
| 2165 | 2945990560 | |||
| 2166 | 2954770737 | |||
| 2167 | 2990711066 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cjt-assembly7.cif.gz_M | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 | 0.7338 | 91 | 144 |
| 3cjq-assembly3.cif.gz_G | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 | 0.7092 | 91 | 156 |
| 6t2b-assembly2.cif.gz_D | glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and nad+. | 0.6415 | 92 | 161 |
| 6t2b-assembly1.cif.gz_C | glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and nad+. | 0.6344 | 92 | 161 |
| 1vgv-assembly2.cif.gz_D | crystal structure of udp-n-acetylglucosamine_2 epimerase | 0.6298 | 6 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZVD3_78_350_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9139 | 49 | 306 | 3.40.50.1000 |
| af_F1QI68_22_349_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8743 | 1 | 306 | 3.40.50.1000 |
| af_F1QI68_22_349_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8634 | 1 | 306 | 3.40.50.1000 |
| af_D3ZVD3_78_350_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.862 | 49 | 306 | 3.40.50.1000 |
| 2ynmD03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.6718 | 91 | 163 | 3.40.50.1980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537A3Y0-F1-model_v4 | 5'-nucleotidase | 0.9633 | 91 | 307 |
GO:0000166
GO:0000287 GO:0005737 GO:0008253 GO:0009117 |
| AF-T1BN83-F1-model_v4 | 5-nucleotidase (EC 3.1.3.5) | 0.9549 | 230 | 300 |
GO:0000166
GO:0000287 GO:0005737 GO:0009117 GO:0106411 |
| AF-A0A831KGM2-F1-model_v4 | 5'-nucleotidase | 0.9446 | 192 | 307 |
GO:0000166
GO:0000287 GO:0005737 GO:0008253 GO:0009117 |
| AF-A0A519H8Z0-F1-model_v4 | 5'-nucleotidase | 0.9426 | 1 | 166 |
GO:0000166
GO:0000287 GO:0005737 GO:0008253 GO:0009117 |
| AF-A0A1A8RB30-F1-model_v4 | 5'-nucleotidase, cytosolic IA | 0.9403 | 131 | 305 |
GO:0000166
GO:0000287 GO:0005829 GO:0008253 GO:0009117 GO:0046085 |