F489732

General Info

Members Datasets Scaffolds Average Seq Length
1083 533 2167 303

Family's Representative Sequence

Representative Sequence 3300053147|Ga0500589_093167|Ga0500589_093167_139_1242
Length 367
Sequence MAGRRYGMKNRRCSVVVTSVLMVWSLVCRMRLFRQQAHCRVRPFQPRFSAALLCFVCIACSRPTIIDRMPVTLAGQLVVAISSRALFDFEEENRLFEATDDRAYMQLQLQRVSQPAKPGVAFSLVNKLLAFNAAAPAASVEVVILSRNDPVSGMRVFRSAQHYGLPIQRGVFTRGESPWRYLKPLNAHLFLSTNEADVRSALGAGVPAARVYPNSARASSAHPNEVRIAFDGDAVLFSDEAERVFQLRGLDAFQSHERDQVDTPLAAGPFKPLLLALQRLQREPAQGMRIRTALVTARSAPAHERAIRTLMNWNIEVDEAMFLGGLPKGEFLREFEPDFFFDDQTGHVDSAAAHVPAGHVASGISNA

Samples

Sample ID Description Type Environment
1 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
95 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
96 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
128 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
206 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
207 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
214 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
224 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
225 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
226 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
227 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
228 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
233 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
236 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
241 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
242 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
243 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
244 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
245 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
258 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
272 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
273 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
274 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
275 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
276 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
277 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
278 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
279 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
280 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
281 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
282 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
283 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
284 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
285 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
286 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
287 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
288 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
289 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
290 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
291 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
292 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
293 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
294 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
295 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
296 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
297 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
298 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
299 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
300 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
301 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
302 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
303 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
304 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
305 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
306 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
307 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
308 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
309 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
310 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
311 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
312 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
313 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
314 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
319 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
320 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
321 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
322 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
330 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
331 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
332 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
333 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
334 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
335 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
336 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
337 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
338 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
339 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
340 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
341 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
342 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
343 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
344 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
345 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
346 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
347 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
348 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
349 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
350 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
351 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
352 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
353 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
359 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
360 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
361 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
362 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
363 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
367 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
368 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
369 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
370 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
371 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
375 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
382 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
383 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
384 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
387 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
388 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
389 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
390 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
391 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
392 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
393 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
394 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
395 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
396 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
397 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
398 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
406 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
407 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
408 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
409 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
410 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
411 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
412 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
413 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
414 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
417 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
418 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
424 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
425 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
426 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
427 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
428 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
429 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
430 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
431 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
432 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
433 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
434 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
435 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
436 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
437 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
438 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
439 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
440 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
441 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
442 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
443 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
444 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
445 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
446 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
447 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
448 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
449 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
450 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
451 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
452 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
453 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
454 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
455 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
458 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
459 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
460 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
461 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
462 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
463 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
464 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
465 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
466 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
467 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
468 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
469 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
470 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
471 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
472 2547132374 Acidovorax radicis N35 Isolate Unclassified
473 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
474 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
475 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
476 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
477 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
478 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
479 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
480 2643221570 Acidovorax sp. Root568 Isolate Unclassified
481 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
482 2643221596 Acidovorax sp. Root70 Isolate Unclassified
483 2643221609 Acidovorax sp. Root217 Isolate Unclassified
484 2643221611 Acidovorax sp. Root219 Isolate Unclassified
485 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
486 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
487 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
488 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
489 2643221652 Acidovorax sp. Root402 Isolate Unclassified
490 2643221658 Variovorax sp. Root411 Isolate Unclassified
491 2643221660 Methylibium sp. Root1272 Isolate Unclassified
492 2643221672 Variovorax sp. Root434 Isolate Unclassified
493 2643221683 Variovorax sp. Root473 Isolate Unclassified
494 2643221717 Acidovorax sp. Root267 Isolate Unclassified
495 2738541277 Variovorax sp. GV051 Isolate Unclassified
496 2738541307 Variovorax sp. GV008 Isolate Unclassified
497 2738541337 Pelomonas sp. BT06 Isolate Unclassified
498 2738543012 Acidovorax sp. CF301 Isolate Unclassified
499 2738543013 Variovorax sp. BT01 Isolate Unclassified
500 2738543019 Variovorax sp. GV040 Isolate Unclassified
501 2816332133 Acidovorax radicis 2721A Isolate Unclassified
502 2818991446 Variovorax sp. 1180 Isolate Unclassified
503 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
504 2831864461 Roseateles noduli HZ7 Isolate Nodule
505 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
506 2842677519 Variovorax sp. R-72495 Isolate Unclassified
507 2842733646 Variovorax sp. R-72446 Isolate Unclassified
508 2842747753 Variovorax sp. R-72060 Isolate Unclassified
509 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
510 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
511 2885198086 Variovorax sp. 679 Isolate Unclassified
512 2885211737 Variovorax sp. 553 Isolate Unclassified
513 2899924645 Variovorax sp. 369 Isolate Unclassified
514 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
515 2904456579 Variovorax sp. 2002 Isolate Unclassified
516 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
517 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
518 2928037797 Variovorax sp. 1126 Isolate Unclassified
519 2928044640 Variovorax sp. 1128 Isolate Unclassified
520 2928051484 Variovorax sp. 1133 Isolate Unclassified
521 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
522 2928070936 Variovorax gossypii 1167 Isolate Unclassified
523 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
524 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
525 2929520902 Variovorax beijingensis 502 Isolate Unclassified
526 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
527 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
528 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
529 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
530 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
531 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
532 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
533 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.09
Metatranscriptomes 0
Isolates 5.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.78
Nodule 0.92
Rhizoplane 2.68
Rhizosphere 57.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500589_093167 3300053147 Bacteria 1323
2 JGI25155J39150_1000024 3300002704 Bacteria 133561
3 JGI25156J39149_1000005 3300002705 Bacteria 263980
4 JGI25156J39149_1000534 3300002705 Bacteria 21912
5 JGI25154J39366_1000017 3300002738 Bacteria 252448
6 JGI25154J39366_1000918 3300002738 Bacteria 12386
7 JGI25157J39369_1000003 3300002741 Bacteria 274935
8 JGI25157J39369_1000054 3300002741 Bacteria 108825
9 JGI25157J39369_1000144 3300002741 Bacteria 60361
10 JGI25152J39213_1000889 3300002773 Bacteria 14700
11 JGI25150J39212_1014335 3300002774 Bacteria 1349
12 JGI25151J46595_10003495 3300003187 Bacteria 8666
13 JGI25151J46595_10022127 3300003187 Bacteria 2645
14 JGI25153J46596_10001144 3300003215 Bacteria 16045
15 JGI25153J46596_10002770 3300003215 Bacteria 9965
16 rootH2_10060114 3300003320 Bacteria 2518
17 rootL2_10028978 3300003322 Bacteria 4031
18 rootH1_10001684 3300003323 Bacteria 9012
19 rootH1_10004925 3300003316 Bacteria 12287
20 rootH1_10004925 3300003323 Bacteria 10403
21 rootH1_10058178 3300003323 Bacteria 2635
22 JGI25160J50197_1000904 3300003354 Bacteria 15618
23 JGI25161J50226_1000098 3300003374 Bacteria 71121
24 Ga0055539_1000812 3300003752 Bacteria 7362
25 Ga0055533_1000008 3300003756 Bacteria 575861
26 Ga0055525_1000729 3300003759 Bacteria 11493
27 Ga0055535_1000069 3300003761 Bacteria 115207
28 Ga0055535_1000271 3300003761 Bacteria 54319
29 Ga0055542_1000084 3300003762 Bacteria 125518
30 Ga0055529_1000321 3300003763 Bacteria 54307
31 Ga0055526_1000687 3300003771 Bacteria 25833
32 Ga0055526_1001509 3300003771 Bacteria 16488
33 Ga0055526_1002509 3300003771 Bacteria 12346
34 Ga0055537_1000777 3300003773 Bacteria 16055
35 Ga0055537_1001949 3300003773 Bacteria 7371
36 Ga0055537_1002668 3300003773 Bacteria 5827
37 Ga0055524_1000085 3300003775 Bacteria 117478
38 Ga0055524_1000111 3300003775 Bacteria 96812
39 Ga0055524_1005251 3300003775 Bacteria 5821
40 Ga0055536_1000843 3300003781 Bacteria 20193
41 Ga0055536_1003305 3300003781 Bacteria 8726
42 Ga0055536_1003834 3300003781 Bacteria 7917
43 Ga0055536_1005817 3300003781 Bacteria 5927
44 Ga0055534_1000746 3300003784 Bacteria 15587
45 Ga0055534_1001110 3300003784 Bacteria 11440
46 Ga0055534_1002569 3300003784 Bacteria 6211
47 Ga0055528_1001586 3300003790 Bacteria 13492
48 Ga0055528_1002505 3300003790 Bacteria 9802
49 Ga0055528_1005575 3300003790 Bacteria 5827
50 Ga0055530_10002078 3300003791 Bacteria 13413
51 Ga0055530_10004190 3300003791 Bacteria 7597
52 Ga0055530_10009204 3300003791 Bacteria 3831
53 Ga0055540_1000056 3300003792 Bacteria 139732
54 Ga0055540_1000059 3300003792 Bacteria 132075
55 Ga0055540_1000511 3300003792 Bacteria 29333
56 Ga0055540_1001809 3300003792 Bacteria 12128
57 Ga0055540_1006362 3300003792 Bacteria 4702
58 Ga0055540_1015290 3300003792 Bacteria 2244
59 Ga0055531_10001013 3300003794 Bacteria 22261
60 Ga0055531_10001080 3300003794 Bacteria 21409
61 Ga0055531_10001126 3300003794 Bacteria 20696
62 Ga0055531_10001730 3300003794 Bacteria 15622
63 Ga0055531_10002107 3300003794 Bacteria 13679
64 Ga0055531_10003087 3300003794 Bacteria 10768
65 Ga0055531_10007677 3300003794 Bacteria 5830
66 Ga0055531_10008253 3300003794 Bacteria 5537
67 Ga0055531_10009600 3300003794 Bacteria 4928
68 Ga0055543_1000144 3300004625 Bacteria 59417
69 Ga0065165_1000290 3300005262 Bacteria 85623
70 Ga0065165_1001688 3300005262 Bacteria 22283
71 Ga0065165_1004995 3300005262 Bacteria 7773
72 Ga0065165_1024955 3300005262 Bacteria 1997
73 Ga0065704_10212318 3300005289 Bacteria 1104
74 Ga0065715_10118213 3300005293 Bacteria 2322
75 Ga0065707_10096400 3300005295 Bacteria 3273
76 Ga0070658_10013228 3300005327 Bacteria 6620
77 Ga0070658_10027912 3300005327 Bacteria 4530
78 Ga0070658_10119931 3300005327 Bacteria 2185
79 Ga0070676_10004505 3300005328 Bacteria 7334
80 Ga0070676_10017357 3300005328 Bacteria 3984
81 Ga0070670_100013930 3300005331 Bacteria 6895
82 Ga0070670_100067762 3300005331 Bacteria 3062
83 Ga0070677_10004821 3300005333 Bacteria 4426
84 Ga0070677_10005340 3300005333 Bacteria 4229
85 Ga0068869_100009917 3300005334 Bacteria 6189
86 Ga0068869_100198011 3300005334 Bacteria 1583
87 Ga0068869_100201887 3300005334 Bacteria 1568
88 Ga0068869_100224963 3300005334 Bacteria 1489
89 Ga0070680_100112876 3300005336 Bacteria 2263
90 Ga0068868_100003620 3300005338 Bacteria 10778
91 Ga0068868_100028882 3300005338 Bacteria 4245
92 Ga0068868_100031863 3300005338 Bacteria 4053
93 Ga0068868_100320367 3300005338 Bacteria 1321
94 Ga0068868_100546121 3300005338 Bacteria 1021
95 Ga0070660_100016356 3300005339 Bacteria 5383
96 Ga0070687_100101420 3300005343 Bacteria 1612
97 Ga0070661_100001284 3300005344 Bacteria 17642
98 Ga0070661_100174483 3300005344 Bacteria 1634
99 Ga0070668_100206409 3300005347 Bacteria 1614
100 Ga0070669_100006711 3300005353 Bacteria 8286
101 Ga0070675_100000649 3300005354 Bacteria 24051
102 Ga0070675_100002638 3300005354 Bacteria 13478
103 Ga0070675_100009330 3300005354 Bacteria 7631
104 Ga0070675_100215755 3300005354 Bacteria 1669
105 Ga0070671_100008484 3300005355 Bacteria 8235
106 Ga0070671_100028189 3300005355 Bacteria 4624
107 Ga0070671_100105561 3300005355 Bacteria 2364
108 Ga0070674_100026754 3300005356 Bacteria 3772
109 Ga0070674_100065348 3300005356 Bacteria 2553
110 Ga0070673_100007348 3300005364 Bacteria 7257
111 Ga0070673_100008721 3300005364 Bacteria 6766
112 Ga0070673_100025419 3300005364 Bacteria 4358
113 Ga0070673_100078009 3300005364 Bacteria 2678
114 Ga0070673_100498034 3300005364 Bacteria 1102
115 Ga0070688_100087771 3300005365 Bacteria 2027
116 Ga0070659_100032212 3300005366 Bacteria 4065
117 Ga0070659_100331302 3300005366 Bacteria 1274
118 Ga0070667_100008076 3300005367 Bacteria 8728
119 Ga0070667_100020719 3300005367 Bacteria 5460
120 Ga0070667_100160063 3300005367 Bacteria 1982
121 Ga0070667_100321755 3300005367 Bacteria 1396
122 Ga0070700_100006774 3300005441 Bacteria 6141
123 Ga0070663_100334964 3300005455 Bacteria 1221
124 Ga0070678_100124819 3300005456 Bacteria 2036
125 Ga0070662_100006549 3300005457 Bacteria 7513
126 Ga0070662_100006860 3300005457 Bacteria 7369
127 Ga0070662_100017731 3300005457 Bacteria 4804
128 Ga0070662_100027761 3300005457 Bacteria 3934
129 Ga0068867_100006375 3300005459 Bacteria 8341
130 Ga0068867_100038141 3300005459 Bacteria 3497
131 Ga0070706_100013199 3300005467 Bacteria 7644
132 Ga0070706_100195888 3300005467 Bacteria 1888
133 Ga0070707_100014896 3300005468 Bacteria 7294
134 Ga0070679_100017318 3300005530 Bacteria 6974
135 Ga0068853_100028973 3300005539 Bacteria 4662
136 Ga0068853_100259527 3300005539 Bacteria 1597
137 Ga0068853_100262503 3300005539 Bacteria 1588
138 Ga0070672_100000177 3300005543 Bacteria 35110
139 Ga0070672_100035185 3300005543 Bacteria 3806
140 Ga0070665_100038155 3300005548 Bacteria 4829
141 Ga0070665_100184237 3300005548 Bacteria 2089
142 Ga0070665_100279330 3300005548 Bacteria 1672
143 Ga0068855_100009119 3300005563 Bacteria 11985
144 Ga0068855_100019700 3300005563 Bacteria 8102
145 Ga0068855_100107009 3300005563 Bacteria 3213
146 Ga0070664_100015850 3300005564 Bacteria 6169
147 Ga0068857_100000906 3300005577 Bacteria 22345
148 Ga0068857_100043606 3300005577 Bacteria 3979
149 Ga0068854_100002536 3300005578 Bacteria 11298
150 Ga0068856_100000135 3300005614 Bacteria 74419
151 Ga0068856_100160035 3300005614 Bacteria 2262
152 Ga0068852_100007509 3300005616 Bacteria 7959
153 Ga0068852_100066113 3300005616 Bacteria 3157
154 Ga0068852_100225701 3300005616 Bacteria 1783
155 Ga0068852_100269325 3300005616 Bacteria 1638
156 Ga0068859_100011878 3300005617 Bacteria 8749
157 Ga0068859_100228069 3300005617 Bacteria 1951
158 Ga0068864_100000826 3300005618 Bacteria 26103
159 Ga0068864_100030188 3300005618 Bacteria 4594
160 Ga0068864_100135502 3300005618 Bacteria 2217
161 Ga0068861_100002005 3300005719 Bacteria 13174
162 Ga0068861_100199929 3300005719 Bacteria 1677
163 Ga0068851_10001974 3300005834 Bacteria 9014
164 Ga0068870_10047892 3300005840 Bacteria 2249
165 Ga0068870_10083320 3300005840 Bacteria 1773
166 Ga0068863_100210596 3300005841 Bacteria 1872
167 Ga0068858_100005422 3300005842 Bacteria 12496
168 Ga0068862_100017745 3300005844 Bacteria 5923
169 Ga0075365_10007547 3300006038 Bacteria 6104
170 Ga0075365_10028773 3300006038 Bacteria 3546
171 Ga0075365_10042812 3300006038 Bacteria 2962
172 Ga0075368_10010843 3300006042 Bacteria 3305
173 Ga0075368_10014475 3300006042 Bacteria 2915
174 Ga0075368_10072169 3300006042 Bacteria 1396
175 Ga0075363_100232698 3300006048 Bacteria 1058
176 Ga0075432_10008618 3300006058 Bacteria 3481
177 Ga0075362_10000958 3300006177 Bacteria 8822
178 Ga0075362_10000960 3300006177 Bacteria 8815
179 Ga0075362_10004300 3300006177 Bacteria 5093
180 Ga0075362_10013783 3300006177 Bacteria 3245
181 Ga0075362_10116435 3300006177 Bacteria 1262
182 Ga0075367_10003979 3300006178 Bacteria 7136
183 Ga0075367_10088453 3300006178 Bacteria 1882
184 Ga0075367_10198950 3300006178 Bacteria 1252
185 Ga0075369_10013819 3300006186 Bacteria 3213
186 Ga0075366_10000550 3300006195 Bacteria 17475
187 Ga0075366_10001062 3300006195 Bacteria 13471
188 Ga0075366_10008558 3300006195 Bacteria 5693
189 Ga0075366_10013928 3300006195 Bacteria 4585
190 Ga0075366_10019395 3300006195 Bacteria 3934
191 Ga0075366_10019789 3300006195 Bacteria 3901
192 Ga0075366_10022374 3300006195 Bacteria 3677
193 Ga0075366_10037033 3300006195 Bacteria 2878
194 Ga0075366_10050962 3300006195 Bacteria 2459
195 Ga0075366_10135180 3300006195 Bacteria 1489
196 Ga0075370_10000148 3300006353 Bacteria 23924
197 Ga0075370_10000920 3300006353 Bacteria 12087
198 Ga0075370_10003393 3300006353 Bacteria 7571
199 Ga0075370_10011423 3300006353 Bacteria 4666
200 Ga0075370_10057014 3300006353 Bacteria 2220
201 Ga0075370_10060981 3300006353 Bacteria 2149
202 Ga0075370_10080275 3300006353 Bacteria 1874
203 Ga0075370_10129776 3300006353 Bacteria 1470
204 Ga0075370_10179561 3300006353 Bacteria 1245
205 Ga0075370_10207239 3300006353 Bacteria 1157
206 Ga0068871_100027888 3300006358 Bacteria 4422
207 Ga0075430_100065409 3300006846 Bacteria 3055
208 Ga0075430_100220709 3300006846 Bacteria 1573
209 Ga0075431_100528281 3300006847 Bacteria 1169
210 Ga0075429_100001600 3300006880 Bacteria 18663
211 Ga0068865_100245777 3300006881 Bacteria 1410
212 Ga0097620_100011878 3300006931 Bacteria 8749
213 Ga0097620_100228061 3300006931 Bacteria 1951
214 Ga0099823_1000065 3300006944 Bacteria 50323
215 Ga0079104_1000073 3300006946 Bacteria 152269
216 Ga0079104_1013281 3300006946 Bacteria 2546
217 Ga0099826_10021938 3300006948 Bacteria 4776
218 Ga0105240_10010486 3300009093 Bacteria 13026
219 Ga0105240_10019736 3300009093 Bacteria 9005
220 Ga0105240_10574497 3300009093 Bacteria 1244
221 Ga0105245_10080390 3300009098 Bacteria 2978
222 Ga0105245_10103504 3300009098 Bacteria 2638
223 Ga0105245_10167552 3300009098 Bacteria 2089
224 Ga0105243_10001635 3300009148 Bacteria 19469
225 Ga0105243_10003223 3300009148 Bacteria 13332
226 Ga0105243_10022613 3300009148 Bacteria 4780
227 Ga0105243_10081328 3300009148 Bacteria 2645
228 Ga0105243_10160487 3300009148 Bacteria 1938
229 Ga0105241_10206459 3300009174 Bacteria 1644
230 Ga0105242_10056615 3300009176 Bacteria 3209
231 Ga0105248_10003890 3300009177 Bacteria 16508
232 Ga0105248_10031182 3300009177 Bacteria 5959
233 Ga0105248_10217621 3300009177 Bacteria 2151
234 Ga0105237_10000646 3300009545 Bacteria 48623
235 Ga0105237_10022295 3300009545 Bacteria 6498
236 Ga0105237_10068746 3300009545 Bacteria 3536
237 Ga0105238_10026742 3300009551 Bacteria 5881
238 Ga0105238_10037676 3300009551 Bacteria 4915
239 Ga0105238_10082294 3300009551 Bacteria 3209
240 Ga0105249_10106595 3300009553 Bacteria 2644
241 Ga0105249_10216666 3300009553 Bacteria 1882
242 Ga0105239_10001160 3300010375 Bacteria 36170
243 Ga0105239_10088990 3300010375 Bacteria 3404
244 Ga0105246_10035063 3300011119 Bacteria 3350
245 Ga0105246_10085320 3300011119 Bacteria 2261
246 Ga0157319_1000005 3300012497 Bacteria 372810
247 Ga0157373_10004013 3300013100 Bacteria 11100
248 Ga0157373_10114421 3300013100 Bacteria 1896
249 Ga0157370_10022622 3300013104 Bacteria 6254
250 Ga0157370_10370591 3300013104 Bacteria 1319
251 Ga0157369_10020212 3300013105 Bacteria 7444
252 Ga0157369_10190275 3300013105 Bacteria 2157
253 Ga0157374_10056021 3300013296 Bacteria 3680
254 Ga0157378_10074051 3300013297 Bacteria 3064
255 Ga0157378_10452883 3300013297 Bacteria 1274
256 Ga0163162_10035363 3300013306 Bacteria 4976
257 Ga0163162_10197493 3300013306 Bacteria 2141
258 Ga0163162_10381835 3300013306 Bacteria 1542
259 Ga0157372_10291506 3300013307 Bacteria 1898
260 Ga0157372_10328667 3300013307 Bacteria 1780
261 Ga0157372_10364568 3300013307 Bacteria 1684
262 Ga0157375_10007001 3300013308 Bacteria 9846
263 Ga0157375_10058836 3300013308 Bacteria 3804
264 Ga0163163_10292368 3300014325 Bacteria 1681
265 Ga0182008_10000617 3300014497 Bacteria 26148
266 Ga0182008_10001994 3300014497 Bacteria 13102
267 Ga0182008_10012188 3300014497 Bacteria 4543
268 Ga0182008_10118960 3300014497 Bacteria 1312
269 Ga0182008_10153589 3300014497 Bacteria 1155
270 Ga0157377_10000044 3300014745 Bacteria 100420
271 Ga0157379_10374713 3300014968 Bacteria 1305
272 Ga0157376_10004287 3300014969 Bacteria 9906
273 Ga0157376_10182905 3300014969 Bacteria 1917
274 Ga0182006_1000976 3300015261 Bacteria 18948
275 Ga0182006_1051814 3300015261 Bacteria 1578
276 Ga0182006_1064144 3300015261 Bacteria 1378
277 Ga0182007_10000481 3300015262 Bacteria 24034
278 Ga0182007_10001306 3300015262 Bacteria 13481
279 Ga0183362_10003 3300015683 Bacteria 977584
280 Ga0163161_10003002 3300017792 Bacteria 11918
281 Ga0163161_10399346 3300017792 Bacteria 1102
282 Ga0213872_10000233 3300021361 Bacteria 48866
283 Ga0213872_10007480 3300021361 Bacteria 5371
284 Ga0213872_10053399 3300021361 Bacteria 1833
285 Ga0209435_100002 3300025206 Bacteria 794178
286 Ga0209436_101107 3300025208 Bacteria 10031
287 Ga0209674_100015 3300025226 Bacteria 697299
288 Ga0209672_100307 3300025228 Bacteria 32865
289 Ga0209147_101110 3300025229 Bacteria 11186
290 Ga0209563_100017 3300025230 Bacteria 796449
291 Ga0207427_102838 3300025231 Bacteria 4196
292 Ga0209258_100025 3300025242 Bacteria 534777
293 Ga0209258_100093 3300025242 Bacteria 223559
294 Ga0209258_100881 3300025242 Bacteria 15759
295 Ga0207425_1000886 3300025245 Bacteria 14554
296 Ga0207425_1002809 3300025245 Bacteria 5879
297 Ga0207425_1003373 3300025245 Bacteria 5135
298 Ga0207425_1003655 3300025245 Bacteria 4843
299 Ga0209646_1000001 3300025246 Bacteria 3092932
300 Ga0209646_1000229 3300025246 Bacteria 59524
301 Ga0209026_1000001 3300025250 Bacteria 1228671
302 Ga0209026_1000028 3300025250 Bacteria 341399
303 Ga0209677_100037 3300025253 Bacteria 286702
304 Ga0209677_100113 3300025253 Bacteria 84174
305 Ga0209148_1000007 3300025254 Bacteria 1592273
306 Ga0209759_1000001 3300025256 Bacteria 2799452
307 Ga0209759_1000021 3300025256 Bacteria 341399
308 Ga0209759_1000844 3300025256 Bacteria 23901
309 Ga0209759_1002258 3300025256 Bacteria 8760
310 Ga0209129_1000469 3300025258 Bacteria 29599
311 Ga0209129_1000692 3300025258 Bacteria 22110
312 Ga0209129_1001207 3300025258 Bacteria 14867
313 Ga0209129_1006588 3300025258 Bacteria 3703
314 Ga0209129_1012548 3300025258 Bacteria 1935
315 Ga0209565_1000016 3300025263 Bacteria 477707
316 Ga0209565_1000117 3300025263 Bacteria 113536
317 Ga0209565_1000203 3300025263 Bacteria 69824
318 Ga0209565_1000388 3300025263 Bacteria 37308
319 Ga0209565_1000923 3300025263 Bacteria 15607
320 Ga0209455_1000166 3300025272 Bacteria 113101
321 Ga0209673_1000008 3300025273 Bacteria 626013
322 Ga0209673_1000218 3300025273 Bacteria 113542
323 Ga0209673_1000555 3300025273 Bacteria 60035
324 Ga0209673_1000659 3300025273 Bacteria 50504
325 Ga0209673_1003795 3300025273 Bacteria 8581
326 Ga0209673_1009241 3300025273 Bacteria 4296
327 Ga0209673_1014492 3300025273 Bacteria 3047
328 Ga0209673_1033602 3300025273 Bacteria 1561
329 Ga0209130_1000104 3300025284 Bacteria 136694
330 Ga0209130_1000161 3300025284 Bacteria 100375
331 Ga0209130_1000247 3300025284 Bacteria 68383
332 Ga0209130_1000526 3300025284 Bacteria 38634
333 Ga0209130_1003544 3300025284 Bacteria 6545
334 Ga0209675_1000099 3300025291 Bacteria 128911
335 Ga0209675_1000113 3300025291 Bacteria 113542
336 Ga0209675_1000230 3300025291 Bacteria 56831
337 Ga0209675_1000885 3300025291 Bacteria 19265
338 Ga0209675_1011276 3300025291 Bacteria 2976
339 Ga0209676_1000023 3300025292 Bacteria 589732
340 Ga0209676_1000028 3300025292 Bacteria 559745
341 Ga0209676_1000367 3300025292 Bacteria 84271
342 Ga0209676_1002155 3300025292 Bacteria 14897
343 Ga0209676_1015790 3300025292 Bacteria 2761
344 Ga0209676_1016222 3300025292 Bacteria 2700
345 Ga0209025_1000194 3300025294 Bacteria 148593
346 Ga0209025_1000561 3300025294 Bacteria 68208
347 Ga0209025_1000665 3300025294 Bacteria 59423
348 Ga0209025_1001618 3300025294 Bacteria 28133
349 Ga0209025_1012448 3300025294 Bacteria 5448
350 Ga0209025_1012982 3300025294 Bacteria 5278
351 Ga0209025_1015106 3300025294 Bacteria 4685
352 Ga0209025_1016816 3300025294 Bacteria 4276
353 Ga0209025_1051324 3300025294 Bacteria 1640
354 Ga0209564_1000008 3300025295 Bacteria 953227
355 Ga0209564_1000344 3300025295 Bacteria 88136
356 Ga0209564_1000555 3300025295 Bacteria 59942
357 Ga0209564_1000777 3300025295 Bacteria 44339
358 Ga0209564_1002809 3300025295 Bacteria 12946
359 Ga0209564_1009693 3300025295 Bacteria 4540
360 Ga0209758_1000124 3300025297 Bacteria 189933
361 Ga0209758_1000199 3300025297 Bacteria 133164
362 Ga0209050_1000022 3300025298 Bacteria 565239
363 Ga0209050_1000072 3300025298 Bacteria 293619
364 Ga0209050_1000133 3300025298 Bacteria 184688
365 Ga0209050_1001503 3300025298 Bacteria 24644
366 Ga0209050_1001949 3300025298 Bacteria 19549
367 Ga0209050_1004416 3300025298 Bacteria 9513
368 Ga0209050_1004742 3300025298 Bacteria 8989
369 Ga0209050_1011534 3300025298 Bacteria 4172
370 Ga0209050_1026920 3300025298 Bacteria 1910
371 Ga0209256_1000001 3300025299 Bacteria 2166974
372 Ga0209256_1000036 3300025299 Bacteria 386664
373 Ga0209256_1000151 3300025299 Bacteria 145299
374 Ga0209256_1000256 3300025299 Bacteria 94699
375 Ga0209256_1009778 3300025299 Bacteria 4136
376 Ga0207426_1000049 3300025302 Bacteria 401954
377 Ga0207426_1000156 3300025302 Bacteria 178646
378 Ga0207426_1000315 3300025302 Bacteria 94699
379 Ga0207426_1001121 3300025302 Bacteria 24462
380 Ga0209051_1000013 3300025303 Bacteria 565239
381 Ga0209051_1000015 3300025303 Bacteria 546798
382 Ga0209051_1000056 3300025303 Bacteria 271616
383 Ga0209051_1000068 3300025303 Bacteria 220063
384 Ga0209051_1000172 3300025303 Bacteria 117180
385 Ga0209051_1000535 3300025303 Bacteria 46757
386 Ga0209051_1000948 3300025303 Bacteria 28532
387 Ga0209051_1001202 3300025303 Bacteria 23394
388 Ga0209051_1005351 3300025303 Bacteria 7541
389 Ga0209051_1033775 3300025303 Bacteria 1928
390 Ga0209257_1000015 3300025304 Bacteria 908141
391 Ga0209257_1000037 3300025304 Bacteria 612915
392 Ga0209257_1000042 3300025304 Bacteria 537149
393 Ga0209257_1000108 3300025304 Bacteria 240229
394 Ga0209257_1000146 3300025304 Bacteria 194261
395 Ga0209257_1001593 3300025304 Bacteria 25967
396 Ga0209257_1001704 3300025304 Bacteria 24663
397 Ga0209257_1001972 3300025304 Bacteria 22091
398 Ga0207655_1000974 3300025728 Bacteria 29497
399 Ga0207682_10037399 3300025893 Bacteria 1967
400 Ga0207682_10137617 3300025893 Bacteria 1094
401 Ga0207642_10004964 3300025899 Bacteria 4311
402 Ga0207688_10091857 3300025901 Bacteria 1744
403 Ga0207688_10096340 3300025901 Bacteria 1704
404 Ga0207680_10003414 3300025903 Bacteria 7491
405 Ga0207645_10008378 3300025907 Bacteria 7212
406 Ga0207643_10028248 3300025908 Bacteria 3114
407 Ga0207643_10053955 3300025908 Bacteria 2284
408 Ga0207684_10000714 3300025910 Bacteria 39062
409 Ga0207695_10010328 3300025913 Bacteria 11432
410 Ga0207695_10047103 3300025913 Bacteria 4565
411 Ga0207695_10059939 3300025913 Bacteria 3944
412 Ga0207695_10157669 3300025913 Bacteria 2204
413 Ga0207695_10216327 3300025913 Bacteria 1825
414 Ga0207671_10003088 3300025914 Bacteria 16998
415 Ga0207671_10228065 3300025914 Bacteria 1461
416 Ga0207660_10146459 3300025917 Bacteria 1810
417 Ga0207657_10064644 3300025919 Bacteria 3122
418 Ga0207657_10084888 3300025919 Bacteria 2653
419 Ga0207649_10001995 3300025920 Bacteria 11614
420 Ga0207652_10300149 3300025921 Bacteria 1450
421 Ga0207681_10016203 3300025923 Bacteria 4658
422 Ga0207681_10049788 3300025923 Bacteria 2833
423 Ga0207681_10071794 3300025923 Bacteria 2416
424 Ga0207694_10093074 3300025924 Bacteria 2380
425 Ga0207694_10118198 3300025924 Bacteria 2114
426 Ga0207694_10127280 3300025924 Bacteria 2039
427 Ga0207650_10001020 3300025925 Bacteria 21020
428 Ga0207650_10007256 3300025925 Bacteria 7551
429 Ga0207650_10043960 3300025925 Bacteria 3282
430 Ga0207650_10097562 3300025925 Bacteria 2256
431 Ga0207659_10000614 3300025926 Bacteria 21272
432 Ga0207659_10004223 3300025926 Bacteria 8680
433 Ga0207659_10089873 3300025926 Bacteria 2291
434 Ga0207644_10001630 3300025931 Bacteria 14470
435 Ga0207644_10122931 3300025931 Bacteria 1978
436 Ga0207690_10006152 3300025932 Bacteria 7110
437 Ga0207690_10139037 3300025932 Bacteria 1787
438 Ga0207690_10144538 3300025932 Bacteria 1757
439 Ga0207690_10267357 3300025932 Bacteria 1327
440 Ga0207706_10013837 3300025933 Bacteria 7319
441 Ga0207706_10034484 3300025933 Bacteria 4502
442 Ga0207686_10059077 3300025934 Bacteria 2421
443 Ga0207709_10000208 3300025935 Bacteria 76530
444 Ga0207709_10000357 3300025935 Bacteria 46258
445 Ga0207709_10001132 3300025935 Bacteria 19467
446 Ga0207709_10007415 3300025935 Bacteria 6111
447 Ga0207709_10073675 3300025935 Bacteria 2177
448 Ga0207709_10121704 3300025935 Bacteria 1763
449 Ga0207670_10031642 3300025936 Bacteria 3393
450 Ga0207669_10023687 3300025937 Bacteria 3284
451 Ga0207669_10258530 3300025937 Bacteria 1301
452 Ga0207704_10178357 3300025938 Bacteria 1532
453 Ga0207691_10007703 3300025940 Bacteria 10363
454 Ga0207691_10015702 3300025940 Bacteria 7198
455 Ga0207711_10014140 3300025941 Bacteria 6630
456 Ga0207711_10174740 3300025941 Bacteria 1951
457 Ga0207689_10008177 3300025942 Bacteria 9114
458 Ga0207689_10008989 3300025942 Bacteria 8654
459 Ga0207689_10088037 3300025942 Bacteria 2551
460 Ga0207661_10244488 3300025944 Bacteria 1593
461 Ga0207679_10000453 3300025945 Bacteria 28920
462 Ga0207667_10082864 3300025949 Bacteria 3321
463 Ga0207667_10116351 3300025949 Bacteria 2755
464 Ga0207667_10130776 3300025949 Bacteria 2585
465 Ga0207651_10000476 3300025960 Bacteria 16840
466 Ga0207651_10011142 3300025960 Bacteria 5019
467 Ga0207651_10062131 3300025960 Bacteria 2601
468 Ga0207712_10195926 3300025961 Bacteria 1598
469 Ga0207712_10330512 3300025961 Bacteria 1261
470 Ga0207640_10059247 3300025981 Bacteria 2526
471 Ga0207658_10022597 3300025986 Bacteria 4381
472 Ga0207658_10107715 3300025986 Bacteria 2197
473 Ga0207658_10257209 3300025986 Bacteria 1486
474 Ga0207677_10006252 3300026023 Bacteria 6512
475 Ga0207677_10008894 3300026023 Bacteria 5631
476 Ga0207677_10029076 3300026023 Bacteria 3507
477 Ga0207703_10003022 3300026035 Bacteria 14257
478 Ga0207639_10221011 3300026041 Bacteria 1636
479 Ga0207639_10343561 3300026041 Bacteria 1331
480 Ga0207678_10043665 3300026067 Bacteria 3878
481 Ga0207678_10092970 3300026067 Bacteria 2577
482 Ga0207708_10045951 3300026075 Bacteria 3327
483 Ga0207702_10000345 3300026078 Bacteria 53392
484 Ga0207702_10307168 3300026078 Bacteria 1507
485 Ga0207641_10164550 3300026088 Bacteria 2019
486 Ga0207648_10008899 3300026089 Bacteria 9664
487 Ga0207648_10028479 3300026089 Bacteria 4952
488 Ga0207648_10069236 3300026089 Bacteria 3074
489 Ga0207648_10161568 3300026089 Bacteria 1978
490 Ga0207676_10000855 3300026095 Bacteria 23661
491 Ga0207674_10019325 3300026116 Bacteria 7381
492 Ga0207674_10049805 3300026116 Bacteria 4282
493 Ga0207674_10080316 3300026116 Bacteria 3265
494 Ga0207675_100000103 3300026118 Bacteria 67419
495 Ga0207675_100148638 3300026118 Bacteria 2229
496 Ga0207675_100495076 3300026118 Bacteria 1216
497 Ga0207683_10016681 3300026121 Bacteria 6250
498 Ga0207683_10022010 3300026121 Bacteria 5469
499 Ga0207683_10078878 3300026121 Bacteria 2918
500 Ga0207698_10005200 3300026142 Bacteria 8002
501 Ga0207698_10100599 3300026142 Bacteria 2395
502 Ga0209281_1000263 3300027111 Bacteria 101190
503 Ga0209281_1017852 3300027111 Bacteria 1431
504 Ga0209389_1001227 3300027296 Bacteria 17705
505 Ga0209371_1005280 3300027312 Bacteria 5205
506 Ga0209969_1007997 3300027360 Bacteria 1497
507 Ga0209967_1002007 3300027364 Bacteria 2624
508 Ga0209996_1010143 3300027395 Bacteria 1247
509 Ga0209968_1000714 3300027526 Bacteria 5113
510 Ga0209999_1008888 3300027543 Bacteria 1817
511 Ga0209282_1000720 3300027666 Bacteria 16583
512 Ga0209971_1015227 3300027682 Bacteria 1823
513 Ga0209966_1000017 3300027695 Bacteria 71183
514 Ga0209974_10012934 3300027876 Bacteria 2785
515 Ga0209974_10034322 3300027876 Bacteria 1685
516 Ga0207428_10027528 3300027907 Bacteria 4733
517 Ga0268266_10010311 3300028379 Bacteria 8173
518 Ga0268266_10100787 3300028379 Bacteria 2545
519 Ga0268266_10231970 3300028379 Bacteria 1700
520 Ga0268264_10445553 3300028381 Bacteria 1253
521 Ga0268264_10511588 3300028381 Bacteria 1172
522 Ga0265336_10000010 3300028666 Bacteria 277947
523 Ga0307517_10002030 3300028786 Bacteria 32950
524 Ga0307517_10103305 3300028786 Bacteria 2228
525 Ga0307517_10140067 3300028786 Bacteria 1702
526 Ga0307515_10000281 3300028794 Bacteria 125306
527 Ga0307515_10000399 3300028794 Bacteria 105068
528 Ga0307515_10002930 3300028794 Bacteria 36206
529 Ga0307515_10003462 3300028794 Bacteria 33182
530 Ga0307515_10011834 3300028794 Bacteria 16504
531 Ga0307515_10011860 3300028794 Bacteria 16480
532 Ga0307515_10018081 3300028794 Bacteria 12791
533 Ga0307515_10049174 3300028794 Bacteria 6354
534 Ga0307515_10066254 3300028794 Bacteria 5007
535 Ga0307515_10068831 3300028794 Bacteria 4854
536 Ga0307515_10184951 3300028794 Bacteria 2017
537 Ga0307515_10218326 3300028794 Bacteria 1732
538 Ga0307515_10235047 3300028794 Bacteria 1616
539 Ga0307515_10236578 3300028794 Bacteria 1606
540 Ga0265324_10001637 3300029957 Bacteria 12387
541 Ga0268256_1005278 3300030500 Bacteria 5119
542 Ga0307512_10011191 3300030522 Bacteria 8515
543 Ga0307512_10074820 3300030522 Bacteria 2483
544 Ga0314311_1212901 3300030733 Bacteria 4766
545 Ga0316183_1188808 3300030742 Bacteria 5467
546 Ga0316181_1054429 3300030744 Bacteria 1600
547 Ga0316181_1057358 3300030744 Bacteria 2139
548 Ga0265330_10000046 3300031235 Bacteria 108853
549 Ga0265330_10041662 3300031235 Bacteria 2035
550 Ga0265332_10000005 3300031238 Bacteria 377525
551 Ga0265332_10000028 3300031238 Bacteria 184029
552 Ga0265332_10012523 3300031238 Bacteria 3763
553 Ga0265328_10004495 3300031239 Bacteria 6053
554 Ga0265328_10014090 3300031239 Bacteria 3154
555 Ga0265325_10002230 3300031241 Bacteria 13143
556 Ga0265325_10063000 3300031241 Bacteria 1877
557 Ga0265340_10012777 3300031247 Bacteria 4431
558 Ga0265331_10001815 3300031250 Bacteria 15137
559 Ga0265327_10000035 3300031251 Bacteria 314419
560 Ga0265327_10000327 3300031251 Bacteria 90721
561 Ga0265327_10000536 3300031251 Bacteria 65055
562 Ga0265327_10037546 3300031251 Bacteria 2651
563 Ga0265316_10000556 3300031344 Bacteria 41880
564 Ga0307513_10000029 3300031456 Bacteria 191823
565 Ga0307513_10021439 3300031456 Bacteria 7627
566 Ga0307513_10052787 3300031456 Bacteria 4375
567 Ga0307513_10140467 3300031456 Bacteria 2342
568 Ga0307509_10000249 3300031507 Bacteria 87094
569 Ga0307509_10004869 3300031507 Bacteria 19042
570 Ga0307509_10053300 3300031507 Bacteria 4314
571 Ga0307509_10083981 3300031507 Bacteria 3281
572 Ga0307509_10208364 3300031507 Bacteria 1783
573 Ga0307408_100042041 3300031548 Bacteria 3243
574 Ga0307408_100087573 3300031548 Bacteria 2343
575 Ga0307408_100095526 3300031548 Bacteria 2253
576 Ga0307508_10000143 3300031616 Bacteria 85046
577 Ga0307508_10000216 3300031616 Bacteria 69990
578 Ga0307508_10001407 3300031616 Bacteria 27099
579 Ga0307508_10038603 3300031616 Bacteria 4291
580 Ga0307514_10001116 3300031649 Bacteria 37410
581 Ga0307514_10006402 3300031649 Bacteria 10268
582 Ga0307514_10135889 3300031649 Bacteria 1683
583 Ga0265314_10000054 3300031711 Bacteria 184029
584 Ga0265314_10005007 3300031711 Bacteria 12071
585 Ga0265342_10014895 3300031712 Bacteria 5141
586 Ga0307516_10000065 3300031730 Bacteria 113187
587 Ga0307516_10000236 3300031730 Bacteria 71013
588 Ga0307516_10002712 3300031730 Bacteria 23333
589 Ga0307516_10003015 3300031730 Bacteria 21972
590 Ga0307516_10010074 3300031730 Bacteria 10453
591 Ga0307516_10072223 3300031730 Bacteria 3311
592 Ga0307516_10087141 3300031730 Bacteria 2957
593 Ga0307405_10028914 3300031731 Bacteria 3234
594 Ga0307405_10031433 3300031731 Bacteria 3125
595 Ga0307405_10034773 3300031731 Bacteria 3002
596 Ga0307405_10047596 3300031731 Bacteria 2641
597 Ga0307405_10064883 3300031731 Bacteria 2322
598 Ga0307405_10189070 3300031731 Bacteria 1485
599 Ga0307405_10261202 3300031731 Bacteria 1293
600 Ga0307410_10004481 3300031852 Bacteria 7230
601 Ga0307410_10308078 3300031852 Bacteria 1252
602 Ga0307406_10013926 3300031901 Bacteria 4617
603 Ga0307406_10090424 3300031901 Bacteria 2060
604 Ga0307407_10064608 3300031903 Bacteria 2151
605 Ga0307412_10002112 3300031911 Bacteria 11029
606 Ga0307412_10006384 3300031911 Bacteria 6665
607 Ga0307412_10027010 3300031911 Bacteria 3574
608 Ga0307412_10080050 3300031911 Bacteria 2256
609 Ga0307412_10174099 3300031911 Bacteria 1612
610 Ga0307409_100018418 3300031995 Bacteria 4695
611 Ga0307416_100027129 3300032002 Bacteria 4235
612 Ga0307416_100059445 3300032002 Bacteria 3106
613 Ga0307414_10190895 3300032004 Bacteria 1657
614 Ga0307414_10654725 3300032004 Bacteria 947
615 Ga0307411_10000084 3300032005 Bacteria 28974
616 Ga0307411_10037095 3300032005 Bacteria 3061
617 Ga0307411_10087925 3300032005 Bacteria 2159
618 Ga0307411_10437936 3300032005 Bacteria 1090
619 Ga0307415_100069750 3300032126 Bacteria 2466
620 Ga0316583_10001261 3300032133 Bacteria 8349
621 Ga0307510_10002166 3300033180 Bacteria 22175
622 Ga0307510_10017769 3300033180 Bacteria 8379
623 Ga0307510_10113957 3300033180 Bacteria 2434
624 Ga0373934_0006284 3300035086 Bacteria 4404
625 Ga0373923_0010198 3300035111 Bacteria 3412
626 Ga0373954_0109084 3300035118 Bacteria 1338
627 Ga0373931_0009597 3300035691 Bacteria 4632
628 Ga0373931_0080310 3300035691 Bacteria 1798
629 Ga0373927_0036096 3300035695 Bacteria 3215
630 Ga0373925_0003753 3300037068 Bacteria 11671
631 Ga0373925_0134171 3300037068 Bacteria 1933
632 Ga0395899_0018517 3300037312 Bacteria 5293
633 Ga0395899_0056635 3300037312 Bacteria 2897
634 Ga0395900_0013050 3300037418 Bacteria 8492
635 Ga0395900_0017963 3300037418 Bacteria 7220
636 Ga0395898_0012551 3300037466 Bacteria 8763
637 Ga0395898_0019168 3300037466 Bacteria 6965
638 Ga0395898_0040215 3300037466 Bacteria 4625
639 Ga0395898_0074595 3300037466 Bacteria 3276
640 Ga0395905_0000090 3300037471 Bacteria 152117
641 Ga0395905_0001810 3300037471 Bacteria 24729
642 Ga0395905_0005572 3300037471 Bacteria 12830
643 Ga0395905_0011798 3300037471 Bacteria 8437
644 Ga0395905_0031793 3300037471 Bacteria 4966
645 Ga0395905_0049559 3300037471 Bacteria 3936
646 Ga0395905_0052627 3300037471 Bacteria 3811
647 Ga0395905_0056154 3300037471 Bacteria 3684
648 Ga0395905_0088671 3300037471 Bacteria 2899
649 Ga0395905_0288940 3300037471 Bacteria 1526
650 Ga0395905_0545519 3300037471 Bacteria 1060
651 Ga0395901_0016676 3300038443 Bacteria 7484
652 Ga0395901_0148309 3300038443 Bacteria 2465
653 Ga0395901_0483830 3300038443 Bacteria 1262
654 Ga0436365_0365298 3300039437 Bacteria 2012
655 Ga0436360_1018511 3300039438 Bacteria 2975
656 Ga0436361_0004571 3300039447 Bacteria 29875
657 Ga0436361_0052876 3300039447 Bacteria 3613
658 Ga0436361_0504982 3300039447 Bacteria 102576
659 Ga0436361_0943202 3300039447 Bacteria 12249
660 Ga0436361_0949608 3300039447 Bacteria 5393
661 Ga0439436_0000433 3300041404 Bacteria 10593
662 Ga0439436_0004913 3300041404 Bacteria 4102
663 Ga0439439_0003942 3300041406 Bacteria 3308
664 Ga0439439_0037742 3300041406 Bacteria 1246
665 Ga0439447_040234 3300041407 Bacteria 1142
666 Ga0439466_0000773 3300041411 Bacteria 12123
667 Ga0439466_0069061 3300041411 Bacteria 1128
668 Ga0439465_0001191 3300041413 Bacteria 8368
669 Ga0439431_0001685 3300041997 Bacteria 4880
670 Ga0439433_0000272 3300041999 Bacteria 8784
671 Ga0439437_001274 3300042000 Bacteria 2648
672 Ga0439442_002999 3300042002 Bacteria 3331
673 Ga0439442_024879 3300042002 Bacteria 1246
674 Ga0439445_0000236 3300042004 Bacteria 10343
675 Ga0439432_002286 3300042006 Bacteria 7220
676 Ga0439432_006073 3300042006 Bacteria 4330
677 Ga0439449_0000814 3300042007 Bacteria 12017
678 Ga0439449_0001806 3300042007 Bacteria 8418
679 Ga0439449_0002258 3300042007 Bacteria 7573
680 Ga0439449_0017950 3300042007 Bacteria 2656
681 Ga0439452_002048 3300042010 Bacteria 7662
682 Ga0439452_010761 3300042010 Bacteria 2647
683 Ga0439457_003079 3300042014 Bacteria 4613
684 Ga0439457_036027 3300042014 Bacteria 1101
685 Ga0439462_0001525 3300042015 Bacteria 5184
686 Ga0439462_0005602 3300042015 Bacteria 3100
687 Ga0439462_0040532 3300042015 Bacteria 1242
688 Ga0450911_000367 3300042115 Bacteria 15028
689 Ga0450912_003480 3300042116 Bacteria 1123
690 Ga0450915_000829 3300042119 Bacteria 1287
691 Ga0450917_000458 3300042120 Bacteria 3073
692 Ga0450919_004117 3300042121 Bacteria 1788
693 Ga0450923_000469 3300042125 Bacteria 4419
694 Ga0450923_009815 3300042125 Bacteria 1683
695 Ga0450888_000384 3300042126 Bacteria 4168
696 Ga0450890_000733 3300042127 Bacteria 4760
697 Ga0450890_000896 3300042127 Bacteria 4314
698 Ga0450897_003323 3300042128 Bacteria 1282
699 Ga0450891_001023 3300042129 Bacteria 2937
700 Ga0450892_002663 3300042130 Bacteria 1501
701 Ga0450894_007824 3300042131 Bacteria 1380
702 Ga0450898_000098 3300042134 Bacteria 8117
703 Ga0450898_001037 3300042134 Bacteria 3522
704 Ga0450899_002077 3300042135 Bacteria 2183
705 Ga0450889_000002 3300042144 Bacteria 23362
706 Ga0450906_007126 3300042145 Bacteria 2219
707 Ga0439446_0002237 3300042156 Bacteria 4622
708 Ga0450908_002606 3300042184 Bacteria 3535
709 Ga0450908_021527 3300042184 Bacteria 1131
710 Ga0450909_019868 3300042185 Bacteria 1000
711 Ga0439434_0000511 3300042435 Bacteria 11069
712 Ga0439434_0003319 3300042435 Bacteria 4725
713 Ga0439435_0008477 3300042436 Bacteria 2384
714 Ga0439435_0081884 3300042436 Bacteria 969
715 Ga0439459_0000080 3300042438 Bacteria 8377
716 Ga0439464_0049500 3300042439 Bacteria 1212
717 Ga0450918_002566 3300042531 Bacteria 3432
718 Ga0450901_002844 3300042533 Bacteria 1836
719 Ga0451577_0000152 3300042876 Bacteria 153284
720 Ga0451577_0000960 3300042876 Bacteria 42223
721 Ga0451577_0001888 3300042876 Bacteria 26618
722 Ga0451577_0008924 3300042876 Bacteria 9703
723 Ga0451577_0011213 3300042876 Bacteria 8498
724 Ga0451577_0032480 3300042876 Bacteria 4702
725 Ga0451577_0111170 3300042876 Bacteria 2451
726 Ga0451577_0118247 3300042876 Bacteria 2374
727 Ga0451577_0584775 3300042876 Bacteria 1013
728 Ga0466969_0000046 3300044656 Bacteria 63999
729 Ga0453683_0000780 3300044673 Bacteria 31494
730 Ga0453683_0001915 3300044673 Bacteria 16995
731 Ga0453683_0056286 3300044673 Bacteria 2461
732 Ga0453683_0063951 3300044673 Bacteria 2300
733 Ga0453683_0186382 3300044673 Bacteria 1316
734 Ga0466965_0010795 3300044683 Bacteria 4271
735 Ga0466965_0028134 3300044683 Bacteria 2730
736 Ga0466966_0001824 3300044684 Bacteria 13821
737 Ga0466966_0003197 3300044684 Bacteria 10785
738 Ga0466966_0013012 3300044684 Bacteria 5508
739 Ga0466966_0126880 3300044684 Bacteria 1564
740 Ga0466966_0202601 3300044684 Bacteria 1200
741 Ga0466961_0003378 3300044693 Bacteria 9964
742 Ga0466961_0128098 3300044693 Bacteria 1591
743 Ga0466961_0163579 3300044693 Bacteria 1386
744 Ga0466963_0034322 3300044694 Bacteria 3300
745 Ga0466963_0091823 3300044694 Bacteria 2068
746 Ga0466963_0232429 3300044694 Bacteria 1292
747 Ga0466963_0249219 3300044694 Bacteria 1246
748 Ga0466963_0337457 3300044694 Bacteria 1061
749 Ga0466964_0000661 3300044706 Bacteria 11023
750 Ga0453684_0000005 3300044712 Bacteria 1431632
751 Ga0453684_0000122 3300044712 Bacteria 340529
752 Ga0453684_0000292 3300044712 Bacteria 213050
753 Ga0453684_0001481 3300044712 Bacteria 66267
754 Ga0453684_0011876 3300044712 Bacteria 14501
755 Ga0453684_0012714 3300044712 Bacteria 13820
756 Ga0453684_0043725 3300044712 Bacteria 6013
757 Ga0453684_0106707 3300044712 Bacteria 3412
758 Ga0453684_0691202 3300044712 Bacteria 1109
759 Ga0466971_0004012 3300044719 Bacteria 6330
760 Ga0466971_0032441 3300044719 Bacteria 2340
761 Ga0466968_0006091 3300044735 Bacteria 4530
762 Ga0466970_0013356 3300044765 Bacteria 4210
763 Ga0466957_0021403 3300044842 Bacteria 3809
764 Ga0466960_0115552 3300044901 Bacteria 1399
765 Ga0466959_0000174 3300045049 Bacteria 42543
766 Ga0466959_0008463 3300045049 Bacteria 7276
767 Ga0466959_0020372 3300045049 Bacteria 4886
768 Ga0466959_0037334 3300045049 Bacteria 3589
769 Ga0451576_0000386 3300045051 Bacteria 102813
770 Ga0451576_0000559 3300045051 Bacteria 79734
771 Ga0451576_0001016 3300045051 Bacteria 51882
772 Ga0451576_0006691 3300045051 Bacteria 14058
773 Ga0451576_0006746 3300045051 Bacteria 13978
774 Ga0451576_0030234 3300045051 Bacteria 5792
775 Ga0451576_0584317 3300045051 Bacteria 1174
776 Ga0451576_0692484 3300045051 Bacteria 1071
777 Ga0466958_0044925 3300045836 Bacteria 2663
778 Ga0466967_0022574 3300045976 Bacteria 5138
779 Ga0466967_0024163 3300045976 Bacteria 4992
780 Ga0466967_0056041 3300045976 Bacteria 3474
781 Ga0466967_0123860 3300045976 Bacteria 2392
782 Ga0495627_004796 3300046453 Bacteria 5588
783 Ga0495627_014974 3300046453 Bacteria 2689
784 Ga0495592_0000266 3300046454 Bacteria 44803
785 Ga0495629_0124653 3300046459 Bacteria 1795
786 Ga0495638_0049699 3300046460 Bacteria 2621
787 Ga0495650_0054464 3300046471 Bacteria 1632
788 Ga0495639_0005280 3300046475 Bacteria 5558
789 Ga0495639_0015870 3300046475 Bacteria 3266
790 Ga0495585_0024071 3300046492 Bacteria 3493
791 Ga0495583_0000428 3300046506 Bacteria 63526
792 Ga0495606_0006933 3300046507 Bacteria 10303
793 Ga0495606_0120750 3300046507 Bacteria 1569
794 Ga0495610_0011787 3300046512 Bacteria 5312
795 Ga0495610_0047700 3300046512 Bacteria 2106
796 Ga0495616_0004282 3300046513 Bacteria 9013
797 Ga0495620_0046540 3300046515 Bacteria 1872
798 Ga0495628_0398874 3300046516 Bacteria 1005
799 Ga0495631_0000152 3300046518 Bacteria 47290
800 Ga0495632_0002610 3300046519 Bacteria 13576
801 Ga0495632_0006664 3300046519 Bacteria 7386
802 Ga0495643_0030909 3300046522 Bacteria 2985
803 Ga0495642_0078491 3300046528 Bacteria 1387
804 Ga0495654_0006840 3300046530 Bacteria 6434
805 Ga0495621_0016139 3300046539 Bacteria 2392
806 Ga0495597_0000038 3300046542 Bacteria 113027
807 Ga0495597_0048985 3300046542 Bacteria 1868
808 Ga0495645_0084769 3300046543 Bacteria 2269
809 Ga0495633_0001724 3300046558 Bacteria 16339
810 Ga0495656_0001010 3300046615 Bacteria 9099
811 Ga0495656_0090085 3300046615 Bacteria 1401
812 Ga0495668_0064031 3300046616 Bacteria 2025
813 Ga0495668_0065248 3300046616 Bacteria 2004
814 Ga0495625_0000294 3300046660 Bacteria 77321
815 Ga0495625_0012585 3300046660 Bacteria 6847
816 Ga0495625_0018155 3300046660 Bacteria 5498
817 Ga0495625_0124209 3300046660 Bacteria 1753
818 Ga0495588_0059095 3300046674 Bacteria 1982
819 Ga0495588_0118840 3300046674 Bacteria 1393
820 Ga0495647_0076902 3300046681 Bacteria 1346
821 Ga0495658_0020103 3300046683 Bacteria 3498
822 Ga0495658_0033012 3300046683 Bacteria 2831
823 Ga0495669_0025262 3300046684 Bacteria 2590
824 Ga0495670_0007639 3300046691 Bacteria 5318
825 Ga0495670_0059305 3300046691 Bacteria 1921
826 Ga0495671_0013044 3300046692 Bacteria 4519
827 Ga0495649_0000210 3300046694 Bacteria 51361
828 Ga0495649_0000401 3300046694 Bacteria 37516
829 Ga0495589_0026413 3300046794 Bacteria 2941
830 Ga0495600_0175781 3300046809 Bacteria 1381
831 Ga0495660_0046211 3300046810 Bacteria 2388
832 Ga0495660_0110528 3300046810 Bacteria 1403
833 Ga0495674_0054126 3300047319 Bacteria 3525
834 Ga0495672_0026238 3300047320 Bacteria 3719
835 Ga0495676_0017637 3300047321 Bacteria 6307
836 Ga0495687_000174 3300047443 Bacteria 95031
837 Ga0495687_011763 3300047443 Bacteria 4678
838 Ga0495687_015227 3300047443 Bacteria 3921
839 Ga0495677_0035297 3300047445 Bacteria 1825
840 Ga0495685_032242 3300047447 Bacteria 1801
841 Ga0495673_0066156 3300047469 Bacteria 1533
842 Ga0495681_0063316 3300047470 Bacteria 1698
843 Ga0495686_0005097 3300047472 Bacteria 10506
844 Ga0495593_0009585 3300047673 Bacteria 5621
845 Ga0496100_0002506 3300048903 Bacteria 9348
846 Ga0496100_0229286 3300048903 Bacteria 1366
847 Ga0496101_0018733 3300048904 Bacteria 4712
848 Ga0496102_0001785 3300048905 Bacteria 18666
849 Ga0496102_0012360 3300048905 Bacteria 7388
850 Ga0496102_0115223 3300048905 Bacteria 2508
851 Ga0496102_0311942 3300048905 Bacteria 1482
852 Ga0496103_0026597 3300048906 Bacteria 3502
853 Ga0496104_0005399 3300048907 Bacteria 11183
854 Ga0496105_0000270 3300048908 Bacteria 34384
855 Ga0496106_0029116 3300048909 Bacteria 4115
856 Ga0496106_0219939 3300048909 Bacteria 1514
857 Ga0496108_0036777 3300048911 Bacteria 4075
858 Ga0496108_0097563 3300048911 Bacteria 2504
859 Ga0496108_0340663 3300048911 Bacteria 1308
860 Ga0496109_0006879 3300048912 Bacteria 9589
861 Ga0496109_0092423 3300048912 Bacteria 2799
862 Ga0496109_0111256 3300048912 Bacteria 2547
863 Ga0496109_0327993 3300048912 Bacteria 1445
864 Ga0496110_0034590 3300048913 Bacteria 4378
865 Ga0496111_0069048 3300048914 Bacteria 2569
866 Ga0496112_0027735 3300048915 Bacteria 5461
867 Ga0496113_0061238 3300048916 Bacteria 2840
868 Ga0496113_0315437 3300048916 Bacteria 1253
869 Ga0496114_0052452 3300048917 Bacteria 3398
870 Ga0496114_0080712 3300048917 Bacteria 2747
871 Ga0496116_0010837 3300048919 Bacteria 7604
872 Ga0496117_0028405 3300048920 Bacteria 4333
873 Ga0496118_0008785 3300048921 Bacteria 10361
874 Ga0496118_0017785 3300048921 Bacteria 6452
875 Ga0496119_0031441 3300048922 Bacteria 3560
876 Ga0496121_0025097 3300048924 Bacteria 5673
877 Ga0496121_0091460 3300048924 Bacteria 2375
878 Ga0496121_0095099 3300048924 Bacteria 2316
879 Ga0496122_0000319 3300048925 Bacteria 105543
880 Ga0496122_0045563 3300048925 Bacteria 3407
881 Ga0496122_0165015 3300048925 Bacteria 1344
882 Ga0496122_0172747 3300048925 Bacteria 1300
883 Ga0496123_0000117 3300048926 Bacteria 161679
884 Ga0496123_0049423 3300048926 Bacteria 2820
885 Ga0496124_0000108 3300048927 Bacteria 167473
886 Ga0496124_0005335 3300048927 Bacteria 14516
887 Ga0496124_0012533 3300048927 Bacteria 8359
888 Ga0496124_0191163 3300048927 Bacteria 1566
889 Ga0496125_0030669 3300048928 Bacteria 4806
890 Ga0496125_0031844 3300048928 Bacteria 4692
891 Ga0496125_0041469 3300048928 Bacteria 3933
892 Ga0496125_0080242 3300048928 Bacteria 2498
893 Ga0496125_0081740 3300048928 Bacteria 2467
894 Ga0496125_0137503 3300048928 Bacteria 1706
895 Ga0496125_0181339 3300048928 Bacteria 1402
896 Ga0496126_0257994 3300048929 Bacteria 1450
897 Ga0501032_0077390 3300049569 Bacteria 2215
898 Ga0501034_0311587 3300049571 Bacteria 1508
899 Ga0501036_0560498 3300049572 Bacteria 949
900 Ga0501043_0000002 3300049579 Bacteria 351081
901 Ga0501046_0000008 3300049580 Bacteria 351167
902 Ga0501047_0000003 3300049581 Bacteria 508375
903 Ga0501048_0001290 3300049582 Bacteria 19011
904 Ga0501073_0327386 3300049589 Bacteria 1058
905 Ga0501198_000007 3300049649 Bacteria 129700
906 Ga0501222_000005 3300049662 Bacteria 129724
907 Ga0501222_003974 3300049662 Bacteria 2004
908 Ga0501221_000521 3300049704 Bacteria 6095
909 Ga0501225_0003739 3300049705 Bacteria 4582
910 Ga0501229_002242 3300049706 Bacteria 2271
911 Ga0501262_000238 3300049759 Bacteria 6785
912 Ga0501266_001273 3300049763 Bacteria 3217
913 Ga0501267_000280 3300049764 Bacteria 3739
914 Ga0501035_0065657 3300049822 Bacteria 3222
915 Ga0501035_0137830 3300049822 Bacteria 2123
916 Ga0501035_0215301 3300049822 Bacteria 1642
917 Ga0501044_0120692 3300049823 Bacteria 2623
918 Ga0501044_0230364 3300049823 Bacteria 1800
919 Ga0501045_0013748 3300049824 Bacteria 5723
920 nmdc:mga03683_11300_c1 3300050489 Bacteria 3229
921 nmdc:mga03683_11861_c1 3300050489 Bacteria 3167
922 nmdc:mga03683_1606_c1 3300050489 Bacteria 6764
923 nmdc:mga03683_17733_c1 3300050489 Bacteria 2699
924 nmdc:mga03683_28362_c1 3300050489 Bacteria 2225
925 nmdc:mga03683_3472_c1 3300050489 Bacteria 5092
926 nmdc:mga03683_6609_c1 3300050489 Bacteria 2260
927 nmdc:mga03683_91574_c1 3300050489 Bacteria 1326
928 nmdc:mga03n38_189278_c1 3300050490 Bacteria 1059
929 nmdc:mga03n38_68079_c1 3300050490 Bacteria 1641
930 nmdc:mga00v17_7452_c1 3300050491 Bacteria 5840
931 nmdc:mga0yw44_113914_c1 3300050492 Bacteria 1735
932 nmdc:mga0yw44_13078_c1 3300050492 Bacteria 4354
933 nmdc:mga0yw44_42703_c1 3300050492 Bacteria 2705
934 nmdc:mga0yw44_50834_c1 3300050492 Bacteria 2508
935 nmdc:mga0k408_106644_c1 3300050493 Bacteria 1655
936 nmdc:mga0k408_12253_c1 3300050493 Bacteria 4686
937 nmdc:mga0k408_1368_c1 3300050493 Bacteria 13151
938 nmdc:mga0k408_17052_c1 3300050493 Bacteria 4039
939 nmdc:mga0k408_18859_c1 3300050493 Bacteria 3851
940 nmdc:mga0k408_24920_c1 3300050493 Bacteria 3385
941 nmdc:mga0k408_29274_c1 3300050493 Bacteria 3134
942 nmdc:mga0k408_31968_c1 3300050493 Bacteria 3007
943 nmdc:mga0k408_42664_c1 3300050493 Bacteria 2612
944 nmdc:mga0k408_43413_c1 3300050493 Bacteria 2591
945 nmdc:mga0k408_6428_c1 3300050493 Bacteria 6269
946 nmdc:mga0k408_6872_c1 3300050493 Bacteria 6071
947 nmdc:mga0k408_7451_c1 3300050493 Bacteria 5843
948 nmdc:mga0k408_75045_c1 3300050493 Bacteria 1976
949 nmdc:mga0k408_8312_c1 3300050493 Bacteria 5569
950 nmdc:mga06z11_11077_c1 3300050494 Bacteria 3873
951 nmdc:mga04h51_15526_c1 3300050495 Bacteria 2195
952 nmdc:mga07m45_1112_c1 3300050496 Bacteria 12037
953 nmdc:mga07m45_115984_c1 3300050496 Bacteria 1544
954 nmdc:mga07m45_12251_c1 3300050496 Bacteria 4529
955 nmdc:mga07m45_2245_c1 3300050496 Bacteria 9018
956 nmdc:mga07m45_24862_c1 3300050496 Bacteria 3284
957 nmdc:mga07m45_3134_c1 3300050496 Bacteria 7922
958 nmdc:mga07m45_39957_c1 3300050496 Bacteria 2624
959 nmdc:mga05p37_279607_c1 3300050507 Bacteria 1991
960 nmdc:mga09592_9075_c1 3300050508 Bacteria 8084
961 nmdc:mga0qj67_360772_c1 3300050509 Bacteria 1174
962 nmdc:mga0qj67_36946_c1 3300050509 Bacteria 3824
963 nmdc:mga06r32_449751_c1 3300050510 Bacteria 1268
964 nmdc:mga0sz30_9079_c1 3300050516 Bacteria 3770
965 Ga0495601_0268997 3300053077 Bacteria 1112
966 Ga0500610_0000833 3300053079 Bacteria 9844
967 Ga0500635_0000070 3300053080 Bacteria 67480
968 Ga0495595_0076487 3300053084 Bacteria 1589
969 Ga0500578_0000637 3300053086 Bacteria 42499
970 Ga0500643_003900 3300053087 Bacteria 6927
971 Ga0500644_0004062 3300053088 Bacteria 3639
972 Ga0500646_0009529 3300053090 Bacteria 2486
973 Ga0500583_0114117 3300053092 Bacteria 1333
974 Ga0500651_0000046 3300053093 Bacteria 84379
975 Ga0500651_0008197 3300053093 Bacteria 6134
976 Ga0500651_0054861 3300053093 Bacteria 2496
977 Ga0500566_0006938 3300053094 Bacteria 6708
978 Ga0500555_034236 3300053103 Bacteria 1431
979 Ga0500571_000037 3300053110 Bacteria 41415
980 Ga0500572_032822 3300053111 Bacteria 1460
981 Ga0500592_006985 3300053116 Bacteria 1796
982 Ga0500593_000315 3300053117 Bacteria 19405
983 Ga0500593_002077 3300053117 Bacteria 7268
984 Ga0500593_014481 3300053117 Bacteria 3384
985 Ga0500594_0004982 3300053118 Bacteria 2936
986 Ga0500594_0021400 3300053118 Bacteria 1621
987 Ga0500607_003946 3300053121 Bacteria 10492
988 Ga0500608_003983 3300053122 Bacteria 5642
989 Ga0500608_020866 3300053122 Bacteria 3019
990 Ga0500642_0023612 3300053130 Bacteria 2471
991 Ga0500652_004170 3300053131 Bacteria 4448
992 Ga0500655_002347 3300053133 Bacteria 3468
993 Ga0500658_0000869 3300053134 Bacteria 12407
994 Ga0500658_0001634 3300053134 Bacteria 8943
995 Ga0500658_0004194 3300053134 Bacteria 5412
996 Ga0500658_0017664 3300053134 Bacteria 2667
997 Ga0500559_0000032 3300053136 Bacteria 113579
998 Ga0500559_0005220 3300053136 Bacteria 5989
999 Ga0500559_0007014 3300053136 Bacteria 5035
1000 Ga0500561_0015607 3300053137 Bacteria 1688
1001 Ga0500564_019579 3300053138 Bacteria 3096
1002 Ga0500564_024284 3300053138 Bacteria 2782
1003 Ga0500568_0003832 3300053139 Bacteria 8216
1004 Ga0500568_0058927 3300053139 Bacteria 1490
1005 Ga0500574_003796 3300053141 Bacteria 2728
1006 Ga0500590_004909 3300053148 Bacteria 6385
1007 Ga0500616_0088713 3300053153 Bacteria 1537
1008 Ga0500619_000137 3300053154 Bacteria 18737
1009 Ga0500622_0000125 3300053156 Bacteria 81109
1010 Ga0500622_0003836 3300053156 Bacteria 9780
1011 Ga0500634_0044606 3300053161 Bacteria 2400
1012 Ga0500638_081797 3300053162 Bacteria 1532
1013 Ga0500570_118610 3300053724 Bacteria 1047
1014 Ga0500645_000042 3300053730 Bacteria 110470
1015 Ga0500587_001091 3300053739 Bacteria 3717
1016 Ga0500587_005447 3300053739 Bacteria 1710
1017 Ga0500661_000710 3300055283 Bacteria 6221
1018 Ga0590075_049232 3300059424 Bacteria 1080
1019 Ga0466962_0030900 3300061719 Bacteria 2564
1020 Ga0466962_0158799 3300061719 Bacteria 1098
1021 2511243098 2511231002 Bacteria 5042903
1022 2513228429 2513020051 Bacteria 6053213
1023 2548501532 2547132374 Bacteria 5530232
1024 2587725299 2585428057 Bacteria 6737412
1025 2587731343 2585428058 Bacteria 6853932
1026 2588290099 2588253510 Bacteria 6901809
1027 2599620723 2599185214 Bacteria 8209958
1028 2599674022 2599185226 Bacteria 8233575
1029 2599678661 2599185227 Bacteria 8246414
1030 2599690234 2599185229 Bacteria 8216126
1031 2643867297 2643221570 Bacteria 5103772
1032 2643972817 2643221592 Bacteria 6608788
1033 2643990214 2643221596 Bacteria 5006805
1034 2644059242 2643221609 Bacteria 6756331
1035 2644075720 2643221611 Bacteria 6820941
1036 2644143336 2643221625 Bacteria 6512927
1037 2644161467 2643221628 Bacteria 5745828
1038 2644243509 2643221644 Bacteria 6865017
1039 2644276227 2643221648 Bacteria 6521465
1040 2644295707 2643221652 Bacteria 5140275
1041 2644324189 2643221658 Bacteria 6064537
1042 2644338657 2643221660 Bacteria 4208257
1043 2644400565 2643221672 Bacteria 6322190
1044 2644465083 2643221683 Bacteria 5749203
1045 2644645251 2643221717 Bacteria 5676132
1046 2738720572 2738541277 Bacteria 7458140
1047 2738884145 2738541307 Bacteria 8606193
1048 2739055994 2738541337 Bacteria 6183410
1049 2739240733 2738543012 Bacteria 7115078
1050 2739250237 2738543013 Bacteria 5618633
1051 2739279771 2738543019 Bacteria 7459457
1052 2816472190 2816332133 Bacteria 7249298
1053 2819601252 2818991446 Bacteria 7757362
1054 2831269336 2831265667 Bacteria 7184833
1055 2831864586 2831864461 Bacteria 6502356
1056 2838055332 2838054893 Bacteria 7451788
1057 2842679420 2842677519 Bacteria 5615038
1058 2842737644 2842733646 Bacteria 5716726
1059 2842749631 2842747753 Bacteria 5578255
1060 2881104799 2881101125 Bacteria 4590519
1061 2885197164 2885192300 Bacteria 5882526
1062 2885201593 2885198086 Bacteria 7212419
1063 2885215696 2885211737 Bacteria 7212420
1064 2899927400 2899924645 Bacteria 7487985
1065 2904450871 2904449895 Bacteria 6927402
1066 2904459626 2904456579 Bacteria 6819253
1067 2919462604 2919462493 Bacteria 5817112
1068 2919707014 2919704043 Bacteria 5560311
1069 2928042688 2928037797 Bacteria 7273642
1070 2928048885 2928044640 Bacteria 7271509
1071 2928055219 2928051484 Bacteria 7773759
1072 2928068647 2928064002 Bacteria 7419480
1073 2928073441 2928070936 Bacteria 8062541
1074 2928090002 2928084124 Bacteria 7159212
1075 2929161486 2929160207 Bacteria 9075316
1076 2929521726 2929520902 Bacteria 6765052
1077 2932423839 2932422444 Bacteria 4678430
1078 2939635705 2939631187 Bacteria 6118131
1079 2945914046 2945909444 Bacteria 7065066
1080 2945949611 2945945610 Bacteria 5951079
1081 2945973647 2945972063 Bacteria 6086495
1082 2945990560 2945984333 Bacteria 7358892
1083 2954770737 2954767861 Bacteria 5535784
1084 2990711066 2990710928 Bacteria 5002431
1085 Ga0500589_093167
1086 JGI25155J39150_1000024
1087 JGI25156J39149_1000005
1088 JGI25156J39149_1000534
1089 JGI25154J39366_1000017
1090 JGI25154J39366_1000918
1091 JGI25157J39369_1000003
1092 JGI25157J39369_1000054
1093 JGI25157J39369_1000144
1094 JGI25152J39213_1000889
1095 JGI25150J39212_1014335
1096 JGI25151J46595_10003495
1097 JGI25151J46595_10022127
1098 JGI25153J46596_10001144
1099 JGI25153J46596_10002770
1100 rootH2_10060114
1101 rootL2_10028978
1102 rootH1_10001684
1103 rootH1_10004925
1104 rootH1_10058178
1105 JGI25160J50197_1000904
1106 JGI25161J50226_1000098
1107 Ga0055539_1000812
1108 Ga0055533_1000008
1109 Ga0055525_1000729
1110 Ga0055535_1000069
1111 Ga0055535_1000271
1112 Ga0055542_1000084
1113 Ga0055529_1000321
1114 Ga0055526_1000687
1115 Ga0055526_1001509
1116 Ga0055526_1002509
1117 Ga0055537_1000777
1118 Ga0055537_1001949
1119 Ga0055537_1002668
1120 Ga0055524_1000085
1121 Ga0055524_1000111
1122 Ga0055524_1005251
1123 Ga0055536_1000843
1124 Ga0055536_1003305
1125 Ga0055536_1003834
1126 Ga0055536_1005817
1127 Ga0055534_1000746
1128 Ga0055534_1001110
1129 Ga0055534_1002569
1130 Ga0055528_1001586
1131 Ga0055528_1002505
1132 Ga0055528_1005575
1133 Ga0055530_10002078
1134 Ga0055530_10004190
1135 Ga0055530_10009204
1136 Ga0055540_1000056
1137 Ga0055540_1000059
1138 Ga0055540_1000511
1139 Ga0055540_1001809
1140 Ga0055540_1006362
1141 Ga0055540_1015290
1142 Ga0055531_10001013
1143 Ga0055531_10001080
1144 Ga0055531_10001126
1145 Ga0055531_10001730
1146 Ga0055531_10002107
1147 Ga0055531_10003087
1148 Ga0055531_10007677
1149 Ga0055531_10008253
1150 Ga0055531_10009600
1151 Ga0055543_1000144
1152 Ga0065165_1000290
1153 Ga0065165_1001688
1154 Ga0065165_1004995
1155 Ga0065165_1024955
1156 Ga0065704_10212318
1157 Ga0065715_10118213
1158 Ga0065707_10096400
1159 Ga0070658_10013228
1160 Ga0070658_10027912
1161 Ga0070658_10119931
1162 Ga0070676_10004505
1163 Ga0070676_10017357
1164 Ga0070670_100013930
1165 Ga0070670_100067762
1166 Ga0070677_10004821
1167 Ga0070677_10005340
1168 Ga0068869_100009917
1169 Ga0068869_100198011
1170 Ga0068869_100201887
1171 Ga0068869_100224963
1172 Ga0070680_100112876
1173 Ga0068868_100003620
1174 Ga0068868_100028882
1175 Ga0068868_100031863
1176 Ga0068868_100320367
1177 Ga0068868_100546121
1178 Ga0070660_100016356
1179 Ga0070687_100101420
1180 Ga0070661_100001284
1181 Ga0070661_100174483
1182 Ga0070668_100206409
1183 Ga0070669_100006711
1184 Ga0070675_100000649
1185 Ga0070675_100002638
1186 Ga0070675_100009330
1187 Ga0070675_100215755
1188 Ga0070671_100008484
1189 Ga0070671_100028189
1190 Ga0070671_100105561
1191 Ga0070674_100026754
1192 Ga0070674_100065348
1193 Ga0070673_100007348
1194 Ga0070673_100008721
1195 Ga0070673_100025419
1196 Ga0070673_100078009
1197 Ga0070673_100498034
1198 Ga0070688_100087771
1199 Ga0070659_100032212
1200 Ga0070659_100331302
1201 Ga0070667_100008076
1202 Ga0070667_100020719
1203 Ga0070667_100160063
1204 Ga0070667_100321755
1205 Ga0070700_100006774
1206 Ga0070663_100334964
1207 Ga0070678_100124819
1208 Ga0070662_100006549
1209 Ga0070662_100006860
1210 Ga0070662_100017731
1211 Ga0070662_100027761
1212 Ga0068867_100006375
1213 Ga0068867_100038141
1214 Ga0070706_100013199
1215 Ga0070706_100195888
1216 Ga0070707_100014896
1217 Ga0070679_100017318
1218 Ga0068853_100028973
1219 Ga0068853_100259527
1220 Ga0068853_100262503
1221 Ga0070672_100000177
1222 Ga0070672_100035185
1223 Ga0070665_100038155
1224 Ga0070665_100184237
1225 Ga0070665_100279330
1226 Ga0068855_100009119
1227 Ga0068855_100019700
1228 Ga0068855_100107009
1229 Ga0070664_100015850
1230 Ga0068857_100000906
1231 Ga0068857_100043606
1232 Ga0068854_100002536
1233 Ga0068856_100000135
1234 Ga0068856_100160035
1235 Ga0068852_100007509
1236 Ga0068852_100066113
1237 Ga0068852_100225701
1238 Ga0068852_100269325
1239 Ga0068859_100011878
1240 Ga0068859_100228069
1241 Ga0068864_100000826
1242 Ga0068864_100030188
1243 Ga0068864_100135502
1244 Ga0068861_100002005
1245 Ga0068861_100199929
1246 Ga0068851_10001974
1247 Ga0068870_10047892
1248 Ga0068870_10083320
1249 Ga0068863_100210596
1250 Ga0068858_100005422
1251 Ga0068862_100017745
1252 Ga0075365_10007547
1253 Ga0075365_10028773
1254 Ga0075365_10042812
1255 Ga0075368_10010843
1256 Ga0075368_10014475
1257 Ga0075368_10072169
1258 Ga0075363_100232698
1259 Ga0075432_10008618
1260 Ga0075362_10000958
1261 Ga0075362_10000960
1262 Ga0075362_10004300
1263 Ga0075362_10013783
1264 Ga0075362_10116435
1265 Ga0075367_10003979
1266 Ga0075367_10088453
1267 Ga0075367_10198950
1268 Ga0075369_10013819
1269 Ga0075366_10000550
1270 Ga0075366_10001062
1271 Ga0075366_10008558
1272 Ga0075366_10013928
1273 Ga0075366_10019395
1274 Ga0075366_10019789
1275 Ga0075366_10022374
1276 Ga0075366_10037033
1277 Ga0075366_10050962
1278 Ga0075366_10135180
1279 Ga0075370_10000148
1280 Ga0075370_10000920
1281 Ga0075370_10003393
1282 Ga0075370_10011423
1283 Ga0075370_10057014
1284 Ga0075370_10060981
1285 Ga0075370_10080275
1286 Ga0075370_10129776
1287 Ga0075370_10179561
1288 Ga0075370_10207239
1289 Ga0068871_100027888
1290 Ga0075430_100065409
1291 Ga0075430_100220709
1292 Ga0075431_100528281
1293 Ga0075429_100001600
1294 Ga0068865_100245777
1295 Ga0097620_100011878
1296 Ga0097620_100228061
1297 Ga0099823_1000065
1298 Ga0079104_1000073
1299 Ga0079104_1013281
1300 Ga0099826_10021938
1301 Ga0105240_10010486
1302 Ga0105240_10019736
1303 Ga0105240_10574497
1304 Ga0105245_10080390
1305 Ga0105245_10103504
1306 Ga0105245_10167552
1307 Ga0105243_10001635
1308 Ga0105243_10003223
1309 Ga0105243_10022613
1310 Ga0105243_10081328
1311 Ga0105243_10160487
1312 Ga0105241_10206459
1313 Ga0105242_10056615
1314 Ga0105248_10003890
1315 Ga0105248_10031182
1316 Ga0105248_10217621
1317 Ga0105237_10000646
1318 Ga0105237_10022295
1319 Ga0105237_10068746
1320 Ga0105238_10026742
1321 Ga0105238_10037676
1322 Ga0105238_10082294
1323 Ga0105249_10106595
1324 Ga0105249_10216666
1325 Ga0105239_10001160
1326 Ga0105239_10088990
1327 Ga0105246_10035063
1328 Ga0105246_10085320
1329 Ga0157319_1000005
1330 Ga0157373_10004013
1331 Ga0157373_10114421
1332 Ga0157370_10022622
1333 Ga0157370_10370591
1334 Ga0157369_10020212
1335 Ga0157369_10190275
1336 Ga0157374_10056021
1337 Ga0157378_10074051
1338 Ga0157378_10452883
1339 Ga0163162_10035363
1340 Ga0163162_10197493
1341 Ga0163162_10381835
1342 Ga0157372_10291506
1343 Ga0157372_10328667
1344 Ga0157372_10364568
1345 Ga0157375_10007001
1346 Ga0157375_10058836
1347 Ga0163163_10292368
1348 Ga0182008_10000617
1349 Ga0182008_10001994
1350 Ga0182008_10012188
1351 Ga0182008_10118960
1352 Ga0182008_10153589
1353 Ga0157377_10000044
1354 Ga0157379_10374713
1355 Ga0157376_10004287
1356 Ga0157376_10182905
1357 Ga0182006_1000976
1358 Ga0182006_1051814
1359 Ga0182006_1064144
1360 Ga0182007_10000481
1361 Ga0182007_10001306
1362 Ga0183362_10003
1363 Ga0163161_10003002
1364 Ga0163161_10399346
1365 Ga0213872_10000233
1366 Ga0213872_10007480
1367 Ga0213872_10053399
1368 Ga0209435_100002
1369 Ga0209436_101107
1370 Ga0209674_100015
1371 Ga0209672_100307
1372 Ga0209147_101110
1373 Ga0209563_100017
1374 Ga0207427_102838
1375 Ga0209258_100025
1376 Ga0209258_100093
1377 Ga0209258_100881
1378 Ga0207425_1000886
1379 Ga0207425_1002809
1380 Ga0207425_1003373
1381 Ga0207425_1003655
1382 Ga0209646_1000001
1383 Ga0209646_1000229
1384 Ga0209026_1000001
1385 Ga0209026_1000028
1386 Ga0209677_100037
1387 Ga0209677_100113
1388 Ga0209148_1000007
1389 Ga0209759_1000001
1390 Ga0209759_1000021
1391 Ga0209759_1000844
1392 Ga0209759_1002258
1393 Ga0209129_1000469
1394 Ga0209129_1000692
1395 Ga0209129_1001207
1396 Ga0209129_1006588
1397 Ga0209129_1012548
1398 Ga0209565_1000016
1399 Ga0209565_1000117
1400 Ga0209565_1000203
1401 Ga0209565_1000388
1402 Ga0209565_1000923
1403 Ga0209455_1000166
1404 Ga0209673_1000008
1405 Ga0209673_1000218
1406 Ga0209673_1000555
1407 Ga0209673_1000659
1408 Ga0209673_1003795
1409 Ga0209673_1009241
1410 Ga0209673_1014492
1411 Ga0209673_1033602
1412 Ga0209130_1000104
1413 Ga0209130_1000161
1414 Ga0209130_1000247
1415 Ga0209130_1000526
1416 Ga0209130_1003544
1417 Ga0209675_1000099
1418 Ga0209675_1000113
1419 Ga0209675_1000230
1420 Ga0209675_1000885
1421 Ga0209675_1011276
1422 Ga0209676_1000023
1423 Ga0209676_1000028
1424 Ga0209676_1000367
1425 Ga0209676_1002155
1426 Ga0209676_1015790
1427 Ga0209676_1016222
1428 Ga0209025_1000194
1429 Ga0209025_1000561
1430 Ga0209025_1000665
1431 Ga0209025_1001618
1432 Ga0209025_1012448
1433 Ga0209025_1012982
1434 Ga0209025_1015106
1435 Ga0209025_1016816
1436 Ga0209025_1051324
1437 Ga0209564_1000008
1438 Ga0209564_1000344
1439 Ga0209564_1000555
1440 Ga0209564_1000777
1441 Ga0209564_1002809
1442 Ga0209564_1009693
1443 Ga0209758_1000124
1444 Ga0209758_1000199
1445 Ga0209050_1000022
1446 Ga0209050_1000072
1447 Ga0209050_1000133
1448 Ga0209050_1001503
1449 Ga0209050_1001949
1450 Ga0209050_1004416
1451 Ga0209050_1004742
1452 Ga0209050_1011534
1453 Ga0209050_1026920
1454 Ga0209256_1000001
1455 Ga0209256_1000036
1456 Ga0209256_1000151
1457 Ga0209256_1000256
1458 Ga0209256_1009778
1459 Ga0207426_1000049
1460 Ga0207426_1000156
1461 Ga0207426_1000315
1462 Ga0207426_1001121
1463 Ga0209051_1000013
1464 Ga0209051_1000015
1465 Ga0209051_1000056
1466 Ga0209051_1000068
1467 Ga0209051_1000172
1468 Ga0209051_1000535
1469 Ga0209051_1000948
1470 Ga0209051_1001202
1471 Ga0209051_1005351
1472 Ga0209051_1033775
1473 Ga0209257_1000015
1474 Ga0209257_1000037
1475 Ga0209257_1000042
1476 Ga0209257_1000108
1477 Ga0209257_1000146
1478 Ga0209257_1001593
1479 Ga0209257_1001704
1480 Ga0209257_1001972
1481 Ga0207655_1000974
1482 Ga0207682_10037399
1483 Ga0207682_10137617
1484 Ga0207642_10004964
1485 Ga0207688_10091857
1486 Ga0207688_10096340
1487 Ga0207680_10003414
1488 Ga0207645_10008378
1489 Ga0207643_10028248
1490 Ga0207643_10053955
1491 Ga0207684_10000714
1492 Ga0207695_10010328
1493 Ga0207695_10047103
1494 Ga0207695_10059939
1495 Ga0207695_10157669
1496 Ga0207695_10216327
1497 Ga0207671_10003088
1498 Ga0207671_10228065
1499 Ga0207660_10146459
1500 Ga0207657_10064644
1501 Ga0207657_10084888
1502 Ga0207649_10001995
1503 Ga0207652_10300149
1504 Ga0207681_10016203
1505 Ga0207681_10049788
1506 Ga0207681_10071794
1507 Ga0207694_10093074
1508 Ga0207694_10118198
1509 Ga0207694_10127280
1510 Ga0207650_10001020
1511 Ga0207650_10007256
1512 Ga0207650_10043960
1513 Ga0207650_10097562
1514 Ga0207659_10000614
1515 Ga0207659_10004223
1516 Ga0207659_10089873
1517 Ga0207644_10001630
1518 Ga0207644_10122931
1519 Ga0207690_10006152
1520 Ga0207690_10139037
1521 Ga0207690_10144538
1522 Ga0207690_10267357
1523 Ga0207706_10013837
1524 Ga0207706_10034484
1525 Ga0207686_10059077
1526 Ga0207709_10000208
1527 Ga0207709_10000357
1528 Ga0207709_10001132
1529 Ga0207709_10007415
1530 Ga0207709_10073675
1531 Ga0207709_10121704
1532 Ga0207670_10031642
1533 Ga0207669_10023687
1534 Ga0207669_10258530
1535 Ga0207704_10178357
1536 Ga0207691_10007703
1537 Ga0207691_10015702
1538 Ga0207711_10014140
1539 Ga0207711_10174740
1540 Ga0207689_10008177
1541 Ga0207689_10008989
1542 Ga0207689_10088037
1543 Ga0207661_10244488
1544 Ga0207679_10000453
1545 Ga0207667_10082864
1546 Ga0207667_10116351
1547 Ga0207667_10130776
1548 Ga0207651_10000476
1549 Ga0207651_10011142
1550 Ga0207651_10062131
1551 Ga0207712_10195926
1552 Ga0207712_10330512
1553 Ga0207640_10059247
1554 Ga0207658_10022597
1555 Ga0207658_10107715
1556 Ga0207658_10257209
1557 Ga0207677_10006252
1558 Ga0207677_10008894
1559 Ga0207677_10029076
1560 Ga0207703_10003022
1561 Ga0207639_10221011
1562 Ga0207639_10343561
1563 Ga0207678_10043665
1564 Ga0207678_10092970
1565 Ga0207708_10045951
1566 Ga0207702_10000345
1567 Ga0207702_10307168
1568 Ga0207641_10164550
1569 Ga0207648_10008899
1570 Ga0207648_10028479
1571 Ga0207648_10069236
1572 Ga0207648_10161568
1573 Ga0207676_10000855
1574 Ga0207674_10019325
1575 Ga0207674_10049805
1576 Ga0207674_10080316
1577 Ga0207675_100000103
1578 Ga0207675_100148638
1579 Ga0207675_100495076
1580 Ga0207683_10016681
1581 Ga0207683_10022010
1582 Ga0207683_10078878
1583 Ga0207698_10005200
1584 Ga0207698_10100599
1585 Ga0209281_1000263
1586 Ga0209281_1017852
1587 Ga0209389_1001227
1588 Ga0209371_1005280
1589 Ga0209969_1007997
1590 Ga0209967_1002007
1591 Ga0209996_1010143
1592 Ga0209968_1000714
1593 Ga0209999_1008888
1594 Ga0209282_1000720
1595 Ga0209971_1015227
1596 Ga0209966_1000017
1597 Ga0209974_10012934
1598 Ga0209974_10034322
1599 Ga0207428_10027528
1600 Ga0268266_10010311
1601 Ga0268266_10100787
1602 Ga0268266_10231970
1603 Ga0268264_10445553
1604 Ga0268264_10511588
1605 Ga0265336_10000010
1606 Ga0307517_10002030
1607 Ga0307517_10103305
1608 Ga0307517_10140067
1609 Ga0307515_10000281
1610 Ga0307515_10000399
1611 Ga0307515_10002930
1612 Ga0307515_10003462
1613 Ga0307515_10011834
1614 Ga0307515_10011860
1615 Ga0307515_10018081
1616 Ga0307515_10049174
1617 Ga0307515_10066254
1618 Ga0307515_10068831
1619 Ga0307515_10184951
1620 Ga0307515_10218326
1621 Ga0307515_10235047
1622 Ga0307515_10236578
1623 Ga0265324_10001637
1624 Ga0268256_1005278
1625 Ga0307512_10011191
1626 Ga0307512_10074820
1627 Ga0314311_1212901
1628 Ga0316183_1188808
1629 Ga0316181_1054429
1630 Ga0316181_1057358
1631 Ga0265330_10000046
1632 Ga0265330_10041662
1633 Ga0265332_10000005
1634 Ga0265332_10000028
1635 Ga0265332_10012523
1636 Ga0265328_10004495
1637 Ga0265328_10014090
1638 Ga0265325_10002230
1639 Ga0265325_10063000
1640 Ga0265340_10012777
1641 Ga0265331_10001815
1642 Ga0265327_10000035
1643 Ga0265327_10000327
1644 Ga0265327_10000536
1645 Ga0265327_10037546
1646 Ga0265316_10000556
1647 Ga0307513_10000029
1648 Ga0307513_10021439
1649 Ga0307513_10052787
1650 Ga0307513_10140467
1651 Ga0307509_10000249
1652 Ga0307509_10004869
1653 Ga0307509_10053300
1654 Ga0307509_10083981
1655 Ga0307509_10208364
1656 Ga0307408_100042041
1657 Ga0307408_100087573
1658 Ga0307408_100095526
1659 Ga0307508_10000143
1660 Ga0307508_10000216
1661 Ga0307508_10001407
1662 Ga0307508_10038603
1663 Ga0307514_10001116
1664 Ga0307514_10006402
1665 Ga0307514_10135889
1666 Ga0265314_10000054
1667 Ga0265314_10005007
1668 Ga0265342_10014895
1669 Ga0307516_10000065
1670 Ga0307516_10000236
1671 Ga0307516_10002712
1672 Ga0307516_10003015
1673 Ga0307516_10010074
1674 Ga0307516_10072223
1675 Ga0307516_10087141
1676 Ga0307405_10028914
1677 Ga0307405_10031433
1678 Ga0307405_10034773
1679 Ga0307405_10047596
1680 Ga0307405_10064883
1681 Ga0307405_10189070
1682 Ga0307405_10261202
1683 Ga0307410_10004481
1684 Ga0307410_10308078
1685 Ga0307406_10013926
1686 Ga0307406_10090424
1687 Ga0307407_10064608
1688 Ga0307412_10002112
1689 Ga0307412_10006384
1690 Ga0307412_10027010
1691 Ga0307412_10080050
1692 Ga0307412_10174099
1693 Ga0307409_100018418
1694 Ga0307416_100027129
1695 Ga0307416_100059445
1696 Ga0307414_10190895
1697 Ga0307414_10654725
1698 Ga0307411_10000084
1699 Ga0307411_10037095
1700 Ga0307411_10087925
1701 Ga0307411_10437936
1702 Ga0307415_100069750
1703 Ga0316583_10001261
1704 Ga0307510_10002166
1705 Ga0307510_10017769
1706 Ga0307510_10113957
1707 Ga0373934_0006284
1708 Ga0373923_0010198
1709 Ga0373954_0109084
1710 Ga0373931_0009597
1711 Ga0373931_0080310
1712 Ga0373927_0036096
1713 Ga0373925_0003753
1714 Ga0373925_0134171
1715 Ga0395899_0018517
1716 Ga0395899_0056635
1717 Ga0395900_0013050
1718 Ga0395900_0017963
1719 Ga0395898_0012551
1720 Ga0395898_0019168
1721 Ga0395898_0040215
1722 Ga0395898_0074595
1723 Ga0395905_0000090
1724 Ga0395905_0001810
1725 Ga0395905_0005572
1726 Ga0395905_0011798
1727 Ga0395905_0031793
1728 Ga0395905_0049559
1729 Ga0395905_0052627
1730 Ga0395905_0056154
1731 Ga0395905_0088671
1732 Ga0395905_0288940
1733 Ga0395905_0545519
1734 Ga0395901_0016676
1735 Ga0395901_0148309
1736 Ga0395901_0483830
1737 Ga0436365_0365298
1738 Ga0436360_1018511
1739 Ga0436361_0004571
1740 Ga0436361_0052876
1741 Ga0436361_0504982
1742 Ga0436361_0943202
1743 Ga0436361_0949608
1744 Ga0439436_0000433
1745 Ga0439436_0004913
1746 Ga0439439_0003942
1747 Ga0439439_0037742
1748 Ga0439447_040234
1749 Ga0439466_0000773
1750 Ga0439466_0069061
1751 Ga0439465_0001191
1752 Ga0439431_0001685
1753 Ga0439433_0000272
1754 Ga0439437_001274
1755 Ga0439442_002999
1756 Ga0439442_024879
1757 Ga0439445_0000236
1758 Ga0439432_002286
1759 Ga0439432_006073
1760 Ga0439449_0000814
1761 Ga0439449_0001806
1762 Ga0439449_0002258
1763 Ga0439449_0017950
1764 Ga0439452_002048
1765 Ga0439452_010761
1766 Ga0439457_003079
1767 Ga0439457_036027
1768 Ga0439462_0001525
1769 Ga0439462_0005602
1770 Ga0439462_0040532
1771 Ga0450911_000367
1772 Ga0450912_003480
1773 Ga0450915_000829
1774 Ga0450917_000458
1775 Ga0450919_004117
1776 Ga0450923_000469
1777 Ga0450923_009815
1778 Ga0450888_000384
1779 Ga0450890_000733
1780 Ga0450890_000896
1781 Ga0450897_003323
1782 Ga0450891_001023
1783 Ga0450892_002663
1784 Ga0450894_007824
1785 Ga0450898_000098
1786 Ga0450898_001037
1787 Ga0450899_002077
1788 Ga0450889_000002
1789 Ga0450906_007126
1790 Ga0439446_0002237
1791 Ga0450908_002606
1792 Ga0450908_021527
1793 Ga0450909_019868
1794 Ga0439434_0000511
1795 Ga0439434_0003319
1796 Ga0439435_0008477
1797 Ga0439435_0081884
1798 Ga0439459_0000080
1799 Ga0439464_0049500
1800 Ga0450918_002566
1801 Ga0450901_002844
1802 Ga0451577_0000152
1803 Ga0451577_0000960
1804 Ga0451577_0001888
1805 Ga0451577_0008924
1806 Ga0451577_0011213
1807 Ga0451577_0032480
1808 Ga0451577_0111170
1809 Ga0451577_0118247
1810 Ga0451577_0584775
1811 Ga0466969_0000046
1812 Ga0453683_0000780
1813 Ga0453683_0001915
1814 Ga0453683_0056286
1815 Ga0453683_0063951
1816 Ga0453683_0186382
1817 Ga0466965_0010795
1818 Ga0466965_0028134
1819 Ga0466966_0001824
1820 Ga0466966_0003197
1821 Ga0466966_0013012
1822 Ga0466966_0126880
1823 Ga0466966_0202601
1824 Ga0466961_0003378
1825 Ga0466961_0128098
1826 Ga0466961_0163579
1827 Ga0466963_0034322
1828 Ga0466963_0091823
1829 Ga0466963_0232429
1830 Ga0466963_0249219
1831 Ga0466963_0337457
1832 Ga0466964_0000661
1833 Ga0453684_0000005
1834 Ga0453684_0000122
1835 Ga0453684_0000292
1836 Ga0453684_0001481
1837 Ga0453684_0011876
1838 Ga0453684_0012714
1839 Ga0453684_0043725
1840 Ga0453684_0106707
1841 Ga0453684_0691202
1842 Ga0466971_0004012
1843 Ga0466971_0032441
1844 Ga0466968_0006091
1845 Ga0466970_0013356
1846 Ga0466957_0021403
1847 Ga0466960_0115552
1848 Ga0466959_0000174
1849 Ga0466959_0008463
1850 Ga0466959_0020372
1851 Ga0466959_0037334
1852 Ga0451576_0000386
1853 Ga0451576_0000559
1854 Ga0451576_0001016
1855 Ga0451576_0006691
1856 Ga0451576_0006746
1857 Ga0451576_0030234
1858 Ga0451576_0584317
1859 Ga0451576_0692484
1860 Ga0466958_0044925
1861 Ga0466967_0022574
1862 Ga0466967_0024163
1863 Ga0466967_0056041
1864 Ga0466967_0123860
1865 Ga0495627_004796
1866 Ga0495627_014974
1867 Ga0495592_0000266
1868 Ga0495629_0124653
1869 Ga0495638_0049699
1870 Ga0495650_0054464
1871 Ga0495639_0005280
1872 Ga0495639_0015870
1873 Ga0495585_0024071
1874 Ga0495583_0000428
1875 Ga0495606_0006933
1876 Ga0495606_0120750
1877 Ga0495610_0011787
1878 Ga0495610_0047700
1879 Ga0495616_0004282
1880 Ga0495620_0046540
1881 Ga0495628_0398874
1882 Ga0495631_0000152
1883 Ga0495632_0002610
1884 Ga0495632_0006664
1885 Ga0495643_0030909
1886 Ga0495642_0078491
1887 Ga0495654_0006840
1888 Ga0495621_0016139
1889 Ga0495597_0000038
1890 Ga0495597_0048985
1891 Ga0495645_0084769
1892 Ga0495633_0001724
1893 Ga0495656_0001010
1894 Ga0495656_0090085
1895 Ga0495668_0064031
1896 Ga0495668_0065248
1897 Ga0495625_0000294
1898 Ga0495625_0012585
1899 Ga0495625_0018155
1900 Ga0495625_0124209
1901 Ga0495588_0059095
1902 Ga0495588_0118840
1903 Ga0495647_0076902
1904 Ga0495658_0020103
1905 Ga0495658_0033012
1906 Ga0495669_0025262
1907 Ga0495670_0007639
1908 Ga0495670_0059305
1909 Ga0495671_0013044
1910 Ga0495649_0000210
1911 Ga0495649_0000401
1912 Ga0495589_0026413
1913 Ga0495600_0175781
1914 Ga0495660_0046211
1915 Ga0495660_0110528
1916 Ga0495674_0054126
1917 Ga0495672_0026238
1918 Ga0495676_0017637
1919 Ga0495687_000174
1920 Ga0495687_011763
1921 Ga0495687_015227
1922 Ga0495677_0035297
1923 Ga0495685_032242
1924 Ga0495673_0066156
1925 Ga0495681_0063316
1926 Ga0495686_0005097
1927 Ga0495593_0009585
1928 Ga0496100_0002506
1929 Ga0496100_0229286
1930 Ga0496101_0018733
1931 Ga0496102_0001785
1932 Ga0496102_0012360
1933 Ga0496102_0115223
1934 Ga0496102_0311942
1935 Ga0496103_0026597
1936 Ga0496104_0005399
1937 Ga0496105_0000270
1938 Ga0496106_0029116
1939 Ga0496106_0219939
1940 Ga0496108_0036777
1941 Ga0496108_0097563
1942 Ga0496108_0340663
1943 Ga0496109_0006879
1944 Ga0496109_0092423
1945 Ga0496109_0111256
1946 Ga0496109_0327993
1947 Ga0496110_0034590
1948 Ga0496111_0069048
1949 Ga0496112_0027735
1950 Ga0496113_0061238
1951 Ga0496113_0315437
1952 Ga0496114_0052452
1953 Ga0496114_0080712
1954 Ga0496116_0010837
1955 Ga0496117_0028405
1956 Ga0496118_0008785
1957 Ga0496118_0017785
1958 Ga0496119_0031441
1959 Ga0496121_0025097
1960 Ga0496121_0091460
1961 Ga0496121_0095099
1962 Ga0496122_0000319
1963 Ga0496122_0045563
1964 Ga0496122_0165015
1965 Ga0496122_0172747
1966 Ga0496123_0000117
1967 Ga0496123_0049423
1968 Ga0496124_0000108
1969 Ga0496124_0005335
1970 Ga0496124_0012533
1971 Ga0496124_0191163
1972 Ga0496125_0030669
1973 Ga0496125_0031844
1974 Ga0496125_0041469
1975 Ga0496125_0080242
1976 Ga0496125_0081740
1977 Ga0496125_0137503
1978 Ga0496125_0181339
1979 Ga0496126_0257994
1980 Ga0501032_0077390
1981 Ga0501034_0311587
1982 Ga0501036_0560498
1983 Ga0501043_0000002
1984 Ga0501046_0000008
1985 Ga0501047_0000003
1986 Ga0501048_0001290
1987 Ga0501073_0327386
1988 Ga0501198_000007
1989 Ga0501222_000005
1990 Ga0501222_003974
1991 Ga0501221_000521
1992 Ga0501225_0003739
1993 Ga0501229_002242
1994 Ga0501262_000238
1995 Ga0501266_001273
1996 Ga0501267_000280
1997 Ga0501035_0065657
1998 Ga0501035_0137830
1999 Ga0501035_0215301
2000 Ga0501044_0120692
2001 Ga0501044_0230364
2002 Ga0501045_0013748
2003 nmdc:mga03683_11300_c1
2004 nmdc:mga03683_11861_c1
2005 nmdc:mga03683_1606_c1
2006 nmdc:mga03683_17733_c1
2007 nmdc:mga03683_28362_c1
2008 nmdc:mga03683_3472_c1
2009 nmdc:mga03683_6609_c1
2010 nmdc:mga03683_91574_c1
2011 nmdc:mga03n38_189278_c1
2012 nmdc:mga03n38_68079_c1
2013 nmdc:mga00v17_7452_c1
2014 nmdc:mga0yw44_113914_c1
2015 nmdc:mga0yw44_13078_c1
2016 nmdc:mga0yw44_42703_c1
2017 nmdc:mga0yw44_50834_c1
2018 nmdc:mga0k408_106644_c1
2019 nmdc:mga0k408_12253_c1
2020 nmdc:mga0k408_1368_c1
2021 nmdc:mga0k408_17052_c1
2022 nmdc:mga0k408_18859_c1
2023 nmdc:mga0k408_24920_c1
2024 nmdc:mga0k408_29274_c1
2025 nmdc:mga0k408_31968_c1
2026 nmdc:mga0k408_42664_c1
2027 nmdc:mga0k408_43413_c1
2028 nmdc:mga0k408_6428_c1
2029 nmdc:mga0k408_6872_c1
2030 nmdc:mga0k408_7451_c1
2031 nmdc:mga0k408_75045_c1
2032 nmdc:mga0k408_8312_c1
2033 nmdc:mga06z11_11077_c1
2034 nmdc:mga04h51_15526_c1
2035 nmdc:mga07m45_1112_c1
2036 nmdc:mga07m45_115984_c1
2037 nmdc:mga07m45_12251_c1
2038 nmdc:mga07m45_2245_c1
2039 nmdc:mga07m45_24862_c1
2040 nmdc:mga07m45_3134_c1
2041 nmdc:mga07m45_39957_c1
2042 nmdc:mga05p37_279607_c1
2043 nmdc:mga09592_9075_c1
2044 nmdc:mga0qj67_360772_c1
2045 nmdc:mga0qj67_36946_c1
2046 nmdc:mga06r32_449751_c1
2047 nmdc:mga0sz30_9079_c1
2048 Ga0495601_0268997
2049 Ga0500610_0000833
2050 Ga0500635_0000070
2051 Ga0495595_0076487
2052 Ga0500578_0000637
2053 Ga0500643_003900
2054 Ga0500644_0004062
2055 Ga0500646_0009529
2056 Ga0500583_0114117
2057 Ga0500651_0000046
2058 Ga0500651_0008197
2059 Ga0500651_0054861
2060 Ga0500566_0006938
2061 Ga0500555_034236
2062 Ga0500571_000037
2063 Ga0500572_032822
2064 Ga0500592_006985
2065 Ga0500593_000315
2066 Ga0500593_002077
2067 Ga0500593_014481
2068 Ga0500594_0004982
2069 Ga0500594_0021400
2070 Ga0500607_003946
2071 Ga0500608_003983
2072 Ga0500608_020866
2073 Ga0500642_0023612
2074 Ga0500652_004170
2075 Ga0500655_002347
2076 Ga0500658_0000869
2077 Ga0500658_0001634
2078 Ga0500658_0004194
2079 Ga0500658_0017664
2080 Ga0500559_0000032
2081 Ga0500559_0005220
2082 Ga0500559_0007014
2083 Ga0500561_0015607
2084 Ga0500564_019579
2085 Ga0500564_024284
2086 Ga0500568_0003832
2087 Ga0500568_0058927
2088 Ga0500574_003796
2089 Ga0500590_004909
2090 Ga0500616_0088713
2091 Ga0500619_000137
2092 Ga0500622_0000125
2093 Ga0500622_0003836
2094 Ga0500634_0044606
2095 Ga0500638_081797
2096 Ga0500570_118610
2097 Ga0500645_000042
2098 Ga0500587_001091
2099 Ga0500587_005447
2100 Ga0500661_000710
2101 Ga0590075_049232
2102 Ga0466962_0030900
2103 Ga0466962_0158799
2104 2511243098
2105 2513228429
2106 2548501532
2107 2587725299
2108 2587731343
2109 2588290099
2110 2599620723
2111 2599674022
2112 2599678661
2113 2599690234
2114 2643867297
2115 2643972817
2116 2643990214
2117 2644059242
2118 2644075720
2119 2644143336
2120 2644161467
2121 2644243509
2122 2644276227
2123 2644295707
2124 2644324189
2125 2644338657
2126 2644400565
2127 2644465083
2128 2644645251
2129 2738720572
2130 2738884145
2131 2739055994
2132 2739240733
2133 2739250237
2134 2739279771
2135 2816472190
2136 2819601252
2137 2831269336
2138 2831864586
2139 2838055332
2140 2842679420
2141 2842737644
2142 2842749631
2143 2881104799
2144 2885197164
2145 2885201593
2146 2885215696
2147 2899927400
2148 2904450871
2149 2904459626
2150 2919462604
2151 2919707014
2152 2928042688
2153 2928048885
2154 2928055219
2155 2928068647
2156 2928073441
2157 2928090002
2158 2929161486
2159 2929521726
2160 2932423839
2161 2939635705
2162 2945914046
2163 2945949611
2164 2945973647
2165 2945990560
2166 2954770737
2167 2990711066

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06189

5-nucleotidase

5'-nucleotidase

69

367

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjt-assembly7.cif.gz_M ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.7338 91 144
3cjq-assembly3.cif.gz_G ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 0.7092 91 156
6t2b-assembly2.cif.gz_D glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and nad+. 0.6415 92 161
6t2b-assembly1.cif.gz_C glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and nad+. 0.6344 92 161
1vgv-assembly2.cif.gz_D crystal structure of udp-n-acetylglucosamine_2 epimerase 0.6298 6 165
ID Description Score Start End Superfamily
af_D3ZVD3_78_350_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9139 49 306 3.40.50.1000
af_F1QI68_22_349_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8743 1 306 3.40.50.1000
af_F1QI68_22_349_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8634 1 306 3.40.50.1000
af_D3ZVD3_78_350_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.862 49 306 3.40.50.1000
2ynmD03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.6718 91 163 3.40.50.1980

Map