F489733

General Info

Members Datasets Scaffolds Average Seq Length
1084 473 2168 448

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1003090|Ga0055536_10030902
Length 503
Sequence MDGYPAALPGCLPAHPTGISAMTGTPASTLPTSAGTAVPAIDSPRPDLLPLPGSRPQVAGPVRGKLYIKTHGCQMNEYDSGKMADVLAAEEGLELTDDPAEADVLLMNTCSIREKAQEKVFSQLGYWKALKNNGRGVIIGVGGCVASQEGEAIIKRAPHVDLVFGPQTLHRLPELIRQRRESGKSQVDISFPEIEKFDRLPEPRAEGGSAFVSIMEGCSKYCSFCVVPYTRGTEVSRPFEDVVVEVAQLAAQGVREINLLGQNVNAYRGPYGEGDVADLGLLIRTIAEIDGVDRIRFTTSHPLEFSDSLVDAYRDVPQLANFLHLPVQAGSDRVLSAMKRGYTALEFKARIRKLRAVRPDISISSDFIVGFPGETEADFEKTMKLIEDVGFDHSFSFIYSRRPGTPAADLEDTISDAEKHARLSRLQARINEQAAAISQAMIGTVQTVLVEGPSRRDPNELTGKTENMRSVNFPGQARLVGQLVDVEITEAYSNSLRGRLVVA

Samples

Sample ID Description Type Environment
1 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
242 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
245 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
246 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
247 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
248 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
257 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
260 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
264 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
265 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
272 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
274 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
277 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
278 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
279 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
280 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
281 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
284 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
285 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
286 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
287 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
289 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
292 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
299 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
304 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
305 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
306 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
307 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
308 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
309 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
310 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
311 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
312 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
316 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
317 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
318 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
321 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
328 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
331 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
334 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
338 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
339 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
340 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
345 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
348 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
349 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
354 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
369 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
370 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
371 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
372 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
373 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
374 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
375 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
376 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
377 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
378 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
379 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
380 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
392 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
393 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
394 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
395 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
396 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
397 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
398 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
399 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
400 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
401 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
404 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
405 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
406 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
408 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
409 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
410 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
411 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
412 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
413 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
414 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
417 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
418 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
422 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
423 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
424 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
425 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
426 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
427 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
428 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
429 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
430 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
431 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
432 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
433 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
434 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
435 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
436 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
437 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
438 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
439 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
440 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
441 2643221573 Lysobacter sp. Root604 Isolate Unclassified
442 2643221720 Lysobacter sp. Root916 Isolate Unclassified
443 2643221728 Lysobacter sp. Root983 Isolate Unclassified
444 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
445 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
446 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
447 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
448 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
449 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
450 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
451 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
452 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
453 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
454 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
455 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
456 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
457 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
458 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
459 2919513703 Luteimonas sp. 3794 Isolate Unclassified
460 2919675420 Luteimonas terrae 4099 Isolate Unclassified
461 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
462 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
463 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
464 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
465 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
466 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
467 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
468 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
469 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
470 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
471 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
472 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
473 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.94
Metatranscriptomes 0.18
Isolates 3.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 9.13
Nodule 0.09
Rhizoplane 3.04
Rhizosphere 83.76
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1003090 3300003781 Bacteria 9068
2 JGI25162J39368_1000136 3300002737 Bacteria 79587
3 JGI25164J39214_1000260 3300002772 Bacteria 39803
4 JGI25152J39213_1000074 3300002773 Bacteria 66463
5 JGI25150J39212_1000056 3300002774 Bacteria 66462
6 JGI25151J46595_10000178 3300003187 Bacteria 80734
7 JGI25151J46595_10000430 3300003187 Bacteria 41709
8 JGI25165J46597_1000222 3300003214 Bacteria 79609
9 JGI25153J46596_10000131 3300003215 Bacteria 80734
10 Ga0055526_1000008 3300003771 Bacteria 300059
11 Ga0055526_1001472 3300003771 Bacteria 16701
12 Ga0055526_1013160 3300003771 Bacteria 3529
13 Ga0055537_1000343 3300003773 Bacteria 31889
14 Ga0055537_1000713 3300003773 Bacteria 17195
15 Ga0055524_1001290 3300003775 Bacteria 14699
16 Ga0055524_1008350 3300003775 Bacteria 4307
17 Ga0055536_1005503 3300003781 Bacteria 6170
18 Ga0055536_1006485 3300003781 Bacteria 5447
19 Ga0055536_1006496 3300003781 Bacteria 5437
20 Ga0055534_1000003 3300003784 Bacteria 300063
21 Ga0055534_1000717 3300003784 Bacteria 16215
22 Ga0055528_1000019 3300003790 Bacteria 149715
23 Ga0055528_1003920 3300003790 Bacteria 7308
24 Ga0055530_10000036 3300003791 Bacteria 117493
25 Ga0055530_10002049 3300003791 Bacteria 13576
26 Ga0055530_10002228 3300003791 Bacteria 12767
27 Ga0055530_10003987 3300003791 Bacteria 7964
28 Ga0055540_1000072 3300003792 Bacteria 117493
29 Ga0055531_10001707 3300003794 Bacteria 15749
30 Ga0055531_10004113 3300003794 Bacteria 8993
31 Ga0055531_10007124 3300003794 Bacteria 6170
32 Ga0058692_1000002 3300003856 Bacteria 508401
33 Ga0065707_10003200 3300005295 Bacteria 4167
34 Ga0070658_10015935 3300005327 Bacteria 6011
35 Ga0070658_10038645 3300005327 Bacteria 3848
36 Ga0070683_100004250 3300005329 Bacteria 11747
37 Ga0070683_100013072 3300005329 Bacteria 7229
38 Ga0070683_100027452 3300005329 Bacteria 5134
39 Ga0070690_100003693 3300005330 Bacteria 8428
40 Ga0070690_100007788 3300005330 Bacteria 6139
41 Ga0070690_100020584 3300005330 Bacteria 4020
42 Ga0070670_100000002 3300005331 Bacteria 568775
43 Ga0070670_100006153 3300005331 Bacteria 10144
44 Ga0070670_100009718 3300005331 Bacteria 8213
45 Ga0070670_100084272 3300005331 Bacteria 2731
46 Ga0070670_100119198 3300005331 Bacteria 2276
47 Ga0070677_10015431 3300005333 Bacteria 2706
48 Ga0068869_100011009 3300005334 Bacteria 5924
49 Ga0068869_100027051 3300005334 Bacteria 3996
50 Ga0068869_100043138 3300005334 Bacteria 3238
51 Ga0068869_100053905 3300005334 Bacteria 2926
52 Ga0068869_100069021 3300005334 Bacteria 2612
53 Ga0070666_10004787 3300005335 Bacteria 8275
54 Ga0070666_10007365 3300005335 Bacteria 6779
55 Ga0070666_10010051 3300005335 Bacteria 5907
56 Ga0070666_10016249 3300005335 Bacteria 4760
57 Ga0070666_10017293 3300005335 Bacteria 4621
58 Ga0070680_100035809 3300005336 Bacteria 4008
59 Ga0070680_100096487 3300005336 Bacteria 2451
60 Ga0070680_100156843 3300005336 Bacteria 1912
61 Ga0070680_100205416 3300005336 Bacteria 1661
62 Ga0070682_100000380 3300005337 Bacteria 29800
63 Ga0068868_100004418 3300005338 Bacteria 9858
64 Ga0068868_100014076 3300005338 Bacteria 5888
65 Ga0068868_100041521 3300005338 Bacteria 3584
66 Ga0068868_100063241 3300005338 Bacteria 2936
67 Ga0070660_100028013 3300005339 Bacteria 4211
68 Ga0070660_100066755 3300005339 Bacteria 2801
69 Ga0070660_100079329 3300005339 Bacteria 2575
70 Ga0070689_100006598 3300005340 Bacteria 8054
71 Ga0070689_100008044 3300005340 Bacteria 7405
72 Ga0070689_100008330 3300005340 Bacteria 7299
73 Ga0070689_100019537 3300005340 Bacteria 5011
74 Ga0070689_100026938 3300005340 Bacteria 4331
75 Ga0070689_100041828 3300005340 Bacteria 3517
76 Ga0070689_100057648 3300005340 Bacteria 3015
77 Ga0070691_10053731 3300005341 Bacteria 1928
78 Ga0070687_100006690 3300005343 Bacteria 4744
79 Ga0070661_100004439 3300005344 Bacteria 9668
80 Ga0070661_100007342 3300005344 Bacteria 7603
81 Ga0070661_100020822 3300005344 Bacteria 4679
82 Ga0070661_100028288 3300005344 Bacteria 4042
83 Ga0070661_100040918 3300005344 Bacteria 3381
84 Ga0070692_10003861 3300005345 Bacteria 6174
85 Ga0070692_10006651 3300005345 Bacteria 5032
86 Ga0070692_10034034 3300005345 Bacteria 2571
87 Ga0070669_100004277 3300005353 Bacteria 10313
88 Ga0070669_100076355 3300005353 Bacteria 2487
89 Ga0070669_100103978 3300005353 Bacteria 2147
90 Ga0070669_100114814 3300005353 Bacteria 2047
91 Ga0070675_100009894 3300005354 Bacteria 7434
92 Ga0070675_100088797 3300005354 Bacteria 2587
93 Ga0070671_100000022 3300005355 Bacteria 124364
94 Ga0070671_100002957 3300005355 Bacteria 13218
95 Ga0070671_100018536 3300005355 Bacteria 5655
96 Ga0070671_100022375 3300005355 Bacteria 5162
97 Ga0070671_100076762 3300005355 Bacteria 2791
98 Ga0070673_100001706 3300005364 Bacteria 13051
99 Ga0070673_100011790 3300005364 Bacteria 5980
100 Ga0070673_100012540 3300005364 Bacteria 5823
101 Ga0070673_100031437 3300005364 Bacteria 3983
102 Ga0070673_100036017 3300005364 Bacteria 3757
103 Ga0070688_100000292 3300005365 Bacteria 25676
104 Ga0070688_100000882 3300005365 Bacteria 14934
105 Ga0070688_100039128 3300005365 Bacteria 2901
106 Ga0070659_100013147 3300005366 Bacteria 6155
107 Ga0070667_100000007 3300005367 Bacteria 292130
108 Ga0070667_100000150 3300005367 Bacteria 86639
109 Ga0070667_100026515 3300005367 Bacteria 4821
110 Ga0070709_10001553 3300005434 Bacteria 12395
111 Ga0070714_100000332 3300005435 Bacteria 35550
112 Ga0070714_100229316 3300005435 Bacteria 1710
113 Ga0070713_100003519 3300005436 Bacteria 10347
114 Ga0070713_100003782 3300005436 Bacteria 10019
115 Ga0070713_100024900 3300005436 Bacteria 4671
116 Ga0070713_100032686 3300005436 Bacteria 4158
117 Ga0070710_10004468 3300005437 Bacteria 6620
118 Ga0070701_10000319 3300005438 Bacteria 15741
119 Ga0070701_10044853 3300005438 Bacteria 2266
120 Ga0070711_100005649 3300005439 Bacteria 7490
121 Ga0070711_100011627 3300005439 Bacteria 5470
122 Ga0070711_100163499 3300005439 Bacteria 1690
123 Ga0070705_100017497 3300005440 Bacteria 3742
124 Ga0070705_100027675 3300005440 Bacteria 3098
125 Ga0070705_100099519 3300005440 Bacteria 1832
126 Ga0070700_100002665 3300005441 Bacteria 9128
127 Ga0070700_100138762 3300005441 Bacteria 1650
128 Ga0070694_100038329 3300005444 Bacteria 3185
129 Ga0070694_100041113 3300005444 Bacteria 3083
130 Ga0070694_100057539 3300005444 Bacteria 2643
131 Ga0070694_100066611 3300005444 Bacteria 2471
132 Ga0070708_100054686 3300005445 Bacteria 3546
133 Ga0070708_100090993 3300005445 Bacteria 2778
134 Ga0070663_100003494 3300005455 Bacteria 9066
135 Ga0070663_100013809 3300005455 Bacteria 5166
136 Ga0070663_100107051 3300005455 Bacteria 2095
137 Ga0070678_100001364 3300005456 Bacteria 12980
138 Ga0070678_100001708 3300005456 Bacteria 11795
139 Ga0070678_100006602 3300005456 Bacteria 6820
140 Ga0070662_100005429 3300005457 Bacteria 8142
141 Ga0070662_100035331 3300005457 Bacteria 3529
142 Ga0070662_100050051 3300005457 Bacteria 3014
143 Ga0070662_100156998 3300005457 Bacteria 1777
144 Ga0070662_100159289 3300005457 Bacteria 1764
145 Ga0070681_10002119 3300005458 Bacteria 18014
146 Ga0070681_10005255 3300005458 Bacteria 12504
147 Ga0070681_10210658 3300005458 Bacteria 1860
148 Ga0068867_100026979 3300005459 Bacteria 4127
149 Ga0070685_10000148 3300005466 Bacteria 45956
150 Ga0070685_10001092 3300005466 Bacteria 14518
151 Ga0070685_10020262 3300005466 Bacteria 3599
152 Ga0070706_100161198 3300005467 Bacteria 2094
153 Ga0070706_100221170 3300005467 Bacteria 1767
154 Ga0070707_100031393 3300005468 Bacteria 5060
155 Ga0070698_100105258 3300005471 Bacteria 2791
156 Ga0070698_100111171 3300005471 Bacteria 2705
157 Ga0070699_100022242 3300005518 Bacteria 5463
158 Ga0070699_100147439 3300005518 Bacteria 2079
159 Ga0070679_100044336 3300005530 Bacteria 4431
160 Ga0070684_100008392 3300005535 Bacteria 8071
161 Ga0070684_100020377 3300005535 Bacteria 5502
162 Ga0070697_100003127 3300005536 Bacteria 12721
163 Ga0070697_100087221 3300005536 Bacteria 2576
164 Ga0070697_100110115 3300005536 Bacteria 2294
165 Ga0068853_100001036 3300005539 Bacteria 19626
166 Ga0068853_100002186 3300005539 Bacteria 14576
167 Ga0068853_100142979 3300005539 Bacteria 2149
168 Ga0070672_100001829 3300005543 Bacteria 13270
169 Ga0070672_100002876 3300005543 Bacteria 11063
170 Ga0070686_100000740 3300005544 Bacteria 18920
171 Ga0070686_100011553 3300005544 Bacteria 5010
172 Ga0070686_100018117 3300005544 Bacteria 4127
173 Ga0070686_100059326 3300005544 Bacteria 2465
174 Ga0070695_100016539 3300005545 Bacteria 4466
175 Ga0070695_100028709 3300005545 Bacteria 3453
176 Ga0070696_100090501 3300005546 Bacteria 2177
177 Ga0070696_100090912 3300005546 Bacteria 2173
178 Ga0070696_100141385 3300005546 Bacteria 1759
179 Ga0070693_100000355 3300005547 Bacteria 20822
180 Ga0070693_100018554 3300005547 Bacteria 3637
181 Ga0070665_100002349 3300005548 Bacteria 20939
182 Ga0070665_100015445 3300005548 Bacteria 7669
183 Ga0070665_100020180 3300005548 Bacteria 6690
184 Ga0070665_100024535 3300005548 Bacteria 6075
185 Ga0070665_100055246 3300005548 Bacteria 3982
186 Ga0070665_100084976 3300005548 Bacteria 3170
187 Ga0070704_100005685 3300005549 Bacteria 7284
188 Ga0070704_100033773 3300005549 Bacteria 3462
189 Ga0070704_100051353 3300005549 Bacteria 2903
190 Ga0070704_100191315 3300005549 Bacteria 1645
191 Ga0068855_100008633 3300005563 Bacteria 12311
192 Ga0068855_100009797 3300005563 Bacteria 11560
193 Ga0068855_100023835 3300005563 Bacteria 7331
194 Ga0068855_100039911 3300005563 Bacteria 5572
195 Ga0068855_100082958 3300005563 Bacteria 3714
196 Ga0070664_100002191 3300005564 Bacteria 15697
197 Ga0070664_100002880 3300005564 Bacteria 13941
198 Ga0070664_100008398 3300005564 Bacteria 8351
199 Ga0070664_100017980 3300005564 Bacteria 5804
200 Ga0070664_100063715 3300005564 Bacteria 3143
201 Ga0070664_100208628 3300005564 Bacteria 1745
202 Ga0068857_100003513 3300005577 Bacteria 13093
203 Ga0068857_100017944 3300005577 Bacteria 6207
204 Ga0068854_100011844 3300005578 Bacteria 5695
205 Ga0068854_100019777 3300005578 Bacteria 4544
206 Ga0068854_100039035 3300005578 Bacteria 3342
207 Ga0068854_100053310 3300005578 Bacteria 2904
208 Ga0068854_100124579 3300005578 Bacteria 1961
209 Ga0068856_100005841 3300005614 Bacteria 12128
210 Ga0068856_100033965 3300005614 Bacteria 4994
211 Ga0068856_100137761 3300005614 Bacteria 2447
212 Ga0070702_100002726 3300005615 Bacteria 7718
213 Ga0070702_100006583 3300005615 Bacteria 5509
214 Ga0070702_100047510 3300005615 Bacteria 2438
215 Ga0068852_100001889 3300005616 Bacteria 14267
216 Ga0068852_100010864 3300005616 Bacteria 6822
217 Ga0068852_100232838 3300005616 Bacteria 1757
218 Ga0068859_100010871 3300005617 Bacteria 9159
219 Ga0068859_100083482 3300005617 Bacteria 3238
220 Ga0068859_100155567 3300005617 Bacteria 2363
221 Ga0068859_100160028 3300005617 Bacteria 2331
222 Ga0068859_100208277 3300005617 Bacteria 2041
223 Ga0068864_100000003 3300005618 Bacteria 568775
224 Ga0068864_100005774 3300005618 Bacteria 10157
225 Ga0068864_100014149 3300005618 Bacteria 6622
226 Ga0068864_100019036 3300005618 Bacteria 5739
227 Ga0068866_10001916 3300005718 Bacteria 8694
228 Ga0068866_10003766 3300005718 Bacteria 6217
229 Ga0068861_100002552 3300005719 Bacteria 11909
230 Ga0068861_100005187 3300005719 Bacteria 8784
231 Ga0068861_100006869 3300005719 Bacteria 7771
232 Ga0068861_100007103 3300005719 Bacteria 7662
233 Ga0068861_100042029 3300005719 Bacteria 3425
234 Ga0068861_100058879 3300005719 Bacteria 2939
235 Ga0068851_10000872 3300005834 Bacteria 13006
236 Ga0068851_10008908 3300005834 Bacteria 4653
237 Ga0068851_10009765 3300005834 Bacteria 4469
238 Ga0068870_10006457 3300005840 Bacteria 5171
239 Ga0068863_100009028 3300005841 Bacteria 9736
240 Ga0068863_100010280 3300005841 Bacteria 9093
241 Ga0068863_100021142 3300005841 Bacteria 6215
242 Ga0068863_100095539 3300005841 Bacteria 2821
243 Ga0068863_100174063 3300005841 Bacteria 2065
244 Ga0068863_100222846 3300005841 Bacteria 1817
245 Ga0068858_100002485 3300005842 Bacteria 18611
246 Ga0068858_100007459 3300005842 Bacteria 10571
247 Ga0068858_100007973 3300005842 Bacteria 10206
248 Ga0068858_100027261 3300005842 Bacteria 5308
249 Ga0068858_100060543 3300005842 Bacteria 3499
250 Ga0068858_100065191 3300005842 Bacteria 3370
251 Ga0068860_100001638 3300005843 Bacteria 24006
252 Ga0068860_100013859 3300005843 Bacteria 7905
253 Ga0068860_100030834 3300005843 Bacteria 5155
254 Ga0068860_100110409 3300005843 Bacteria 2628
255 Ga0068862_100000452 3300005844 Bacteria 44564
256 Ga0068862_100006537 3300005844 Bacteria 9673
257 Ga0068862_100009412 3300005844 Bacteria 8081
258 Ga0068862_100014383 3300005844 Bacteria 6565
259 Ga0068862_100043953 3300005844 Bacteria 3810
260 Ga0068862_100062042 3300005844 Bacteria 3214
261 Ga0068862_100091519 3300005844 Bacteria 2649
262 Ga0068862_100124290 3300005844 Bacteria 2277
263 Ga0081538_10073395 3300005981 Bacteria 1870
264 Ga0081540_1004336 3300005983 Bacteria 10868
265 Ga0075365_10000122 3300006038 Bacteria 23481
266 Ga0075363_100001163 3300006048 Bacteria 9653
267 Ga0075364_10000213 3300006051 Bacteria 27332
268 Ga0075364_10000562 3300006051 Bacteria 19043
269 Ga0070715_10014203 3300006163 Bacteria 2944
270 Ga0070716_100001077 3300006173 Bacteria 11962
271 Ga0070716_100019418 3300006173 Bacteria 3552
272 Ga0070712_100040974 3300006175 Bacteria 3177
273 Ga0075367_10001536 3300006178 Bacteria 9978
274 Ga0075369_10000212 3300006186 Bacteria 17155
275 Ga0097621_100002878 3300006237 Bacteria 11808
276 Ga0097621_100028624 3300006237 Bacteria 4392
277 Ga0075370_10032942 3300006353 Bacteria 2899
278 Ga0068871_100006555 3300006358 Bacteria 8249
279 Ga0068871_100008816 3300006358 Bacteria 7265
280 Ga0068871_100027588 3300006358 Bacteria 4442
281 Ga0075428_100000982 3300006844 Bacteria 30234
282 Ga0075428_100002975 3300006844 Bacteria 18464
283 Ga0075430_100000566 3300006846 Bacteria 28123
284 Ga0075430_100011327 3300006846 Bacteria 7564
285 Ga0075430_100022826 3300006846 Bacteria 5321
286 Ga0075430_100030371 3300006846 Bacteria 4589
287 Ga0075430_100145781 3300006846 Bacteria 1972
288 Ga0075430_100163607 3300006846 Bacteria 1852
289 Ga0075431_100002345 3300006847 Bacteria 18184
290 Ga0075431_100002432 3300006847 Bacteria 17917
291 Ga0075431_100035882 3300006847 Bacteria 5105
292 Ga0075431_100120469 3300006847 Bacteria 2707
293 Ga0075433_10054163 3300006852 Bacteria 3499
294 Ga0075434_100009366 3300006871 Bacteria 9130
295 Ga0075434_100105823 3300006871 Bacteria 2823
296 Ga0075434_100157039 3300006871 Bacteria 2294
297 Ga0075429_100000015 3300006880 Bacteria 78823
298 Ga0075429_100000217 3300006880 Bacteria 38727
299 Ga0075429_100024442 3300006880 Bacteria 5242
300 Ga0075429_100049651 3300006880 Bacteria 3649
301 Ga0068865_100005740 3300006881 Bacteria 7543
302 Ga0068865_100063933 3300006881 Bacteria 2588
303 Ga0075436_100065816 3300006914 Bacteria 2504
304 Ga0075436_100137968 3300006914 Bacteria 1713
305 Ga0097620_100010870 3300006931 Bacteria 9159
306 Ga0097620_100083480 3300006931 Bacteria 3238
307 Ga0097620_100155574 3300006931 Bacteria 2363
308 Ga0097620_100160027 3300006931 Bacteria 2331
309 Ga0097620_100208260 3300006931 Bacteria 2041
310 Ga0075435_100062780 3300007076 Bacteria 3016
311 Ga0075435_100103983 3300007076 Bacteria 2356
312 Ga0099794_10001346 3300007265 Bacteria 8525
313 Ga0105251_10025919 3300009011 Bacteria 2991
314 Ga0105240_10002074 3300009093 Bacteria 32842
315 Ga0105240_10007281 3300009093 Bacteria 16108
316 Ga0105240_10014161 3300009093 Bacteria 10895
317 Ga0105240_10073166 3300009093 Bacteria 4233
318 Ga0105240_10321353 3300009093 Bacteria 1764
319 Ga0111539_10002751 3300009094 Bacteria 23328
320 Ga0111539_10002953 3300009094 Bacteria 22574
321 Ga0111539_10058516 3300009094 Bacteria 4572
322 Ga0111539_10081464 3300009094 Bacteria 3807
323 Ga0111539_10124594 3300009094 Bacteria 3020
324 Ga0111539_10393720 3300009094 Bacteria 1614
325 Ga0105245_10004129 3300009098 Bacteria 12897
326 Ga0105245_10008792 3300009098 Bacteria 8809
327 Ga0105245_10051378 3300009098 Bacteria 3696
328 Ga0105245_10266813 3300009098 Bacteria 1668
329 Ga0105247_10005141 3300009101 Bacteria 8280
330 Ga0105247_10017181 3300009101 Bacteria 4342
331 Ga0114129_10000248 3300009147 Bacteria 60807
332 Ga0114129_10041162 3300009147 Bacteria 6512
333 Ga0105243_10003141 3300009148 Bacteria 13568
334 Ga0105243_10011531 3300009148 Bacteria 6687
335 Ga0105243_10065919 3300009148 Bacteria 2911
336 Ga0105241_10116676 3300009174 Bacteria 2144
337 Ga0105241_10125335 3300009174 Unclassified 2073
338 Ga0105242_10002322 3300009176 Bacteria 15001
339 Ga0105242_10005056 3300009176 Bacteria 10185
340 Ga0105242_10014096 3300009176 Bacteria 6189
341 Ga0105248_10000246 3300009177 Bacteria 62735
342 Ga0105248_10010195 3300009177 Bacteria 10348
343 Ga0105248_10039245 3300009177 Bacteria 5302
344 Ga0105248_10110131 3300009177 Bacteria 3105
345 Ga0105248_10229774 3300009177 Bacteria 2088
346 Ga0105248_10315134 3300009177 Bacteria 1762
347 Ga0105237_10000231 3300009545 Bacteria 79368
348 Ga0105237_10026395 3300009545 Bacteria 5936
349 Ga0105237_10059158 3300009545 Bacteria 3834
350 Ga0105237_10136504 3300009545 Bacteria 2447
351 Ga0105238_10035805 3300009551 Bacteria 5045
352 Ga0105238_10043127 3300009551 Bacteria 4565
353 Ga0105249_10005115 3300009553 Bacteria 11306
354 Ga0105249_10006419 3300009553 Bacteria 10222
355 Ga0105249_10012784 3300009553 Bacteria 7403
356 Ga0105249_10012863 3300009553 Bacteria 7385
357 Ga0105249_10013252 3300009553 Bacteria 7276
358 Ga0105249_10179243 3300009553 Bacteria 2060
359 Ga0099796_10024514 3300010159 Bacteria 1895
360 Ga0105239_10005689 3300010375 Bacteria 14562
361 Ga0105239_10109140 3300010375 Bacteria 3066
362 Ga0157373_10001374 3300013100 Bacteria 18676
363 Ga0157371_10000429 3300013102 Bacteria 51605
364 Ga0157371_10007777 3300013102 Bacteria 8615
365 Ga0157371_10014829 3300013102 Bacteria 5868
366 Ga0157370_10012042 3300013104 Bacteria 9003
367 Ga0157370_10049463 3300013104 Bacteria 4023
368 Ga0157374_10014292 3300013296 Bacteria 6946
369 Ga0157374_10016690 3300013296 Bacteria 6458
370 Ga0157374_10035124 3300013296 Bacteria 4585
371 Ga0157374_10053996 3300013296 Bacteria 3747
372 Ga0157378_10013710 3300013297 Bacteria 7088
373 Ga0157378_10016375 3300013297 Bacteria 6491
374 Ga0157378_10022130 3300013297 Bacteria 5594
375 Ga0157378_10045867 3300013297 Bacteria 3885
376 Ga0157378_10046570 3300013297 Bacteria 3854
377 Ga0157378_10133048 3300013297 Bacteria 2304
378 Ga0157378_10198705 3300013297 Bacteria 1895
379 Ga0163162_10072809 3300013306 Bacteria 3491
380 Ga0163162_10374648 3300013306 Bacteria 1557
381 Ga0157372_10004213 3300013307 Bacteria 15389
382 Ga0157372_10015001 3300013307 Bacteria 8292
383 Ga0157372_10021657 3300013307 Bacteria 6948
384 Ga0157372_10266499 3300013307 Bacteria 1989
385 Ga0157375_10109230 3300013308 Bacteria 2862
386 Ga0157375_10135352 3300013308 Bacteria 2587
387 Ga0163163_10000835 3300014325 Bacteria 26202
388 Ga0163163_10018597 3300014325 Bacteria 6509
389 Ga0163163_10054458 3300014325 Bacteria 3952
390 Ga0163163_10168564 3300014325 Bacteria 2236
391 Ga0157380_10015682 3300014326 Bacteria 5571
392 Ga0157380_10281250 3300014326 Unclassified 1522
393 Ga0182008_10000269 3300014497 Bacteria 40734
394 Ga0157377_10001111 3300014745 Bacteria 11384
395 Ga0157377_10002019 3300014745 Bacteria 8896
396 Ga0157377_10014693 3300014745 Bacteria 3988
397 Ga0157379_10005419 3300014968 Bacteria 10960
398 Ga0157379_10066007 3300014968 Bacteria 3235
399 Ga0157376_10002756 3300014969 Bacteria 12000
400 Ga0157376_10003114 3300014969 Bacteria 11397
401 Ga0157376_10013527 3300014969 Bacteria 6092
402 Ga0157376_10111927 3300014969 Bacteria 2404
403 Ga0182006_1007044 3300015261 Bacteria 5172
404 Ga0182007_10000127 3300015262 Bacteria 53385
405 Ga0182005_1000168 3300015265 Bacteria 45063
406 Ga0183360_10001 3300015689 Bacteria 3943671
407 Ga0163161_10044445 3300017792 Bacteria 3199
408 Ga0163161_10109759 3300017792 Bacteria 2061
409 Ga0213876_10039093 3300021384 Bacteria 2506
410 Ga0209760_100058 3300025207 Bacteria 98827
411 Ga0207427_100063 3300025231 Bacteria 177711
412 Ga0209437_100133 3300025233 Bacteria 178493
413 Ga0207425_1000108 3300025245 Bacteria 77709
414 Ga0207425_1004437 3300025245 Bacteria 4207
415 Ga0209129_1000178 3300025258 Bacteria 92006
416 Ga0209233_1000133 3300025261 Bacteria 202716
417 Ga0209565_1000001 3300025263 Bacteria 2950419
418 Ga0209565_1000014 3300025263 Bacteria 530302
419 Ga0209673_1000001 3300025273 Bacteria 3176258
420 Ga0209673_1000570 3300025273 Bacteria 58750
421 Ga0209130_1003922 3300025284 Bacteria 5961
422 Ga0209130_1017144 3300025284 Bacteria 1734
423 Ga0209675_1000001 3300025291 Bacteria 2950293
424 Ga0209675_1000021 3300025291 Bacteria 334833
425 Ga0209676_1000027 3300025292 Bacteria 560222
426 Ga0209676_1000047 3300025292 Bacteria 408645
427 Ga0209676_1000079 3300025292 Bacteria 290447
428 Ga0209676_1001090 3300025292 Bacteria 30462
429 Ga0209676_1007037 3300025292 Bacteria 5397
430 Ga0209676_1007436 3300025292 Bacteria 5143
431 Ga0209676_1010731 3300025292 Bacteria 3775
432 Ga0209025_1000012 3300025294 Bacteria 924362
433 Ga0209025_1000102 3300025294 Bacteria 228393
434 Ga0209025_1003190 3300025294 Bacteria 15903
435 Ga0209564_1000001 3300025295 Bacteria 3176258
436 Ga0209564_1000263 3300025295 Bacteria 112148
437 Ga0209758_1000018 3300025297 Bacteria 753320
438 Ga0209758_1021599 3300025297 Bacteria 2994
439 Ga0209050_1000080 3300025298 Bacteria 275154
440 Ga0209050_1000153 3300025298 Bacteria 160851
441 Ga0209050_1000311 3300025298 Bacteria 98948
442 Ga0209050_1002761 3300025298 Bacteria 14119
443 Ga0209256_1000002 3300025299 Bacteria 1906740
444 Ga0209256_1002605 3300025299 Bacteria 14307
445 Ga0209256_1002692 3300025299 Bacteria 13883
446 Ga0209256_1004733 3300025299 Bacteria 8322
447 Ga0209051_1000082 3300025303 Bacteria 193133
448 Ga0209051_1006455 3300025303 Bacteria 6603
449 Ga0209257_1000081 3300025304 Bacteria 306577
450 Ga0209257_1000274 3300025304 Bacteria 117076
451 Ga0209257_1000664 3300025304 Bacteria 54069
452 Ga0209257_1001912 3300025304 Bacteria 22505
453 Ga0209257_1002586 3300025304 Bacteria 17596
454 Ga0209257_1007820 3300025304 Bacteria 6329
455 Ga0209257_1009194 3300025304 Bacteria 5368
456 Ga0207697_10000149 3300025315 Bacteria 34272
457 Ga0207697_10020793 3300025315 Bacteria 2686
458 Ga0207656_10003769 3300025321 Bacteria 5249
459 Ga0207656_10012278 3300025321 Bacteria 3254
460 Ga0207655_1033072 3300025728 Bacteria 2351
461 Ga0207682_10000459 3300025893 Bacteria 18829
462 Ga0207642_10001236 3300025899 Bacteria 7908
463 Ga0207710_10027304 3300025900 Bacteria 2471
464 Ga0207688_10001830 3300025901 Bacteria 11341
465 Ga0207688_10007340 3300025901 Bacteria 5999
466 Ga0207680_10036342 3300025903 Bacteria 2836
467 Ga0207685_10045386 3300025905 Bacteria 1666
468 Ga0207645_10001936 3300025907 Bacteria 16708
469 Ga0207645_10100063 3300025907 Bacteria 1870
470 Ga0207643_10000257 3300025908 Bacteria 36775
471 Ga0207643_10002766 3300025908 Bacteria 9480
472 Ga0207643_10009427 3300025908 Bacteria 5246
473 Ga0207643_10043792 3300025908 Bacteria 2526
474 Ga0207643_10047912 3300025908 Bacteria 2420
475 Ga0207707_10010165 3300025912 Bacteria 8167
476 Ga0207707_10012870 3300025912 Bacteria 7282
477 Ga0207707_10048090 3300025912 Bacteria 3715
478 Ga0207695_10001882 3300025913 Bacteria 32824
479 Ga0207695_10006211 3300025913 Bacteria 15562
480 Ga0207695_10011988 3300025913 Bacteria 10431
481 Ga0207695_10015440 3300025913 Bacteria 8991
482 Ga0207695_10207552 3300025913 Bacteria 1871
483 Ga0207671_10008456 3300025914 Bacteria 8726
484 Ga0207693_10002740 3300025915 Bacteria 15256
485 Ga0207693_10020534 3300025915 Bacteria 5252
486 Ga0207663_10005447 3300025916 Bacteria 6413
487 Ga0207663_10018487 3300025916 Bacteria 3907
488 Ga0207660_10027866 3300025917 Bacteria 3860
489 Ga0207660_10033993 3300025917 Bacteria 3530
490 Ga0207660_10124814 3300025917 Bacteria 1954
491 Ga0207662_10009238 3300025918 Bacteria 5418
492 Ga0207662_10012415 3300025918 Bacteria 4744
493 Ga0207662_10024694 3300025918 Bacteria 3459
494 Ga0207662_10085548 3300025918 Bacteria 1931
495 Ga0207657_10001446 3300025919 Bacteria 25420
496 Ga0207657_10017013 3300025919 Bacteria 6995
497 Ga0207657_10051076 3300025919 Bacteria 3595
498 Ga0207657_10113044 3300025919 Bacteria 2241
499 Ga0207649_10023500 3300025920 Bacteria 3571
500 Ga0207649_10067791 3300025920 Bacteria 2267
501 Ga0207649_10102326 3300025920 Bacteria 1898
502 Ga0207652_10018305 3300025921 Bacteria 5745
503 Ga0207652_10215803 3300025921 Bacteria 1728
504 Ga0207646_10105596 3300025922 Bacteria 2526
505 Ga0207646_10154480 3300025922 Bacteria 2070
506 Ga0207646_10176713 3300025922 Bacteria 1928
507 Ga0207681_10003243 3300025923 Bacteria 10199
508 Ga0207681_10008178 3300025923 Bacteria 6396
509 Ga0207681_10011656 3300025923 Bacteria 5405
510 Ga0207681_10034434 3300025923 Bacteria 3330
511 Ga0207681_10066205 3300025923 Bacteria 2500
512 Ga0207681_10073914 3300025923 Bacteria 2386
513 Ga0207694_10026021 3300025924 Bacteria 4449
514 Ga0207694_10095594 3300025924 Bacteria 2349
515 Ga0207650_10000003 3300025925 Bacteria 1123235
516 Ga0207650_10001825 3300025925 Bacteria 15046
517 Ga0207650_10002621 3300025925 Bacteria 12446
518 Ga0207650_10085318 3300025925 Bacteria 2402
519 Ga0207659_10003990 3300025926 Bacteria 8905
520 Ga0207659_10014471 3300025926 Bacteria 5090
521 Ga0207659_10071353 3300025926 Bacteria 2536
522 Ga0207687_10006961 3300025927 Bacteria 7450
523 Ga0207687_10026690 3300025927 Bacteria 3870
524 Ga0207700_10003571 3300025928 Bacteria 9059
525 Ga0207700_10020142 3300025928 Bacteria 4522
526 Ga0207664_10000325 3300025929 Bacteria 35400
527 Ga0207664_10003311 3300025929 Bacteria 10715
528 Ga0207664_10100168 3300025929 Bacteria 2392
529 Ga0207644_10000037 3300025931 Bacteria 124306
530 Ga0207644_10002823 3300025931 Bacteria 11196
531 Ga0207644_10003679 3300025931 Bacteria 9942
532 Ga0207644_10032756 3300025931 Bacteria 3628
533 Ga0207644_10071271 3300025931 Bacteria 2542
534 Ga0207690_10133711 3300025932 Bacteria 1819
535 Ga0207706_10000775 3300025933 Bacteria 33144
536 Ga0207706_10007089 3300025933 Bacteria 10368
537 Ga0207706_10041143 3300025933 Bacteria 4098
538 Ga0207706_10108387 3300025933 Bacteria 2444
539 Ga0207706_10181447 3300025933 Bacteria 1849
540 Ga0207686_10004363 3300025934 Bacteria 7582
541 Ga0207686_10012082 3300025934 Bacteria 4743
542 Ga0207686_10036442 3300025934 Bacteria 2962
543 Ga0207686_10043800 3300025934 Bacteria 2744
544 Ga0207686_10109420 3300025934 Bacteria 1861
545 Ga0207709_10000930 3300025935 Bacteria 22057
546 Ga0207709_10007789 3300025935 Bacteria 5938
547 Ga0207709_10029160 3300025935 Bacteria 3197
548 Ga0207670_10009955 3300025936 Bacteria 5450
549 Ga0207670_10055151 3300025936 Bacteria 2685
550 Ga0207669_10009438 3300025937 Bacteria 4646
551 Ga0207669_10031724 3300025937 Bacteria 2956
552 Ga0207669_10168456 3300025937 Bacteria 1556
553 Ga0207704_10001220 3300025938 Bacteria 11452
554 Ga0207704_10005871 3300025938 Bacteria 5684
555 Ga0207704_10017993 3300025938 Bacteria 3678
556 Ga0207704_10024054 3300025938 Bacteria 3295
557 Ga0207665_10003114 3300025939 Bacteria 11122
558 Ga0207691_10001095 3300025940 Bacteria 26926
559 Ga0207691_10001701 3300025940 Bacteria 21735
560 Ga0207691_10003722 3300025940 Bacteria 14796
561 Ga0207691_10005811 3300025940 Bacteria 11937
562 Ga0207691_10025607 3300025940 Bacteria 5538
563 Ga0207691_10046818 3300025940 Bacteria 3972
564 Ga0207691_10142642 3300025940 Bacteria 2110
565 Ga0207711_10000782 3300025941 Bacteria 31251
566 Ga0207711_10003291 3300025941 Bacteria 14044
567 Ga0207711_10003296 3300025941 Bacteria 14031
568 Ga0207711_10006050 3300025941 Bacteria 10224
569 Ga0207711_10064392 3300025941 Bacteria 3166
570 Ga0207689_10000474 3300025942 Bacteria 37756
571 Ga0207689_10002613 3300025942 Bacteria 16674
572 Ga0207689_10003706 3300025942 Bacteria 13935
573 Ga0207689_10030707 3300025942 Bacteria 4477
574 Ga0207689_10038779 3300025942 Bacteria 3944
575 Ga0207661_10036429 3300025944 Bacteria 3840
576 Ga0207661_10070183 3300025944 Bacteria 2859
577 Ga0207661_10166349 3300025944 Bacteria 1917
578 Ga0207679_10037767 3300025945 Bacteria 3436
579 Ga0207679_10051272 3300025945 Bacteria 3020
580 Ga0207667_10004596 3300025949 Bacteria 16930
581 Ga0207667_10055847 3300025949 Bacteria 4149
582 Ga0207667_10144569 3300025949 Bacteria 2448
583 Ga0207667_10187414 3300025949 Bacteria 2123
584 Ga0207651_10002306 3300025960 Bacteria 9083
585 Ga0207651_10014477 3300025960 Bacteria 4557
586 Ga0207651_10015257 3300025960 Bacteria 4460
587 Ga0207651_10032842 3300025960 Bacteria 3339
588 Ga0207712_10000314 3300025961 Bacteria 44397
589 Ga0207712_10010887 3300025961 Bacteria 5789
590 Ga0207712_10058562 3300025961 Bacteria 2723
591 Ga0207712_10113733 3300025961 Bacteria 2035
592 Ga0207712_10131469 3300025961 Bacteria 1908
593 Ga0207640_10007253 3300025981 Bacteria 6115
594 Ga0207640_10007928 3300025981 Bacteria 5861
595 Ga0207640_10069786 3300025981 Bacteria 2361
596 Ga0207658_10000004 3300025986 Bacteria 569357
597 Ga0207658_10000013 3300025986 Bacteria 220396
598 Ga0207658_10006563 3300025986 Bacteria 7935
599 Ga0207658_10022252 3300025986 Bacteria 4413
600 Ga0207677_10000390 3300026023 Bacteria 30230
601 Ga0207677_10045330 3300026023 Bacteria 2936
602 Ga0207703_10002767 3300026035 Bacteria 15018
603 Ga0207703_10009021 3300026035 Bacteria 7854
604 Ga0207703_10013439 3300026035 Bacteria 6377
605 Ga0207703_10016031 3300026035 Bacteria 5844
606 Ga0207703_10017347 3300026035 Bacteria 5620
607 Ga0207639_10000791 3300026041 Bacteria 21545
608 Ga0207639_10001337 3300026041 Bacteria 16645
609 Ga0207639_10002604 3300026041 Bacteria 12099
610 Ga0207639_10006184 3300026041 Bacteria 8131
611 Ga0207678_10000306 3300026067 Bacteria 44067
612 Ga0207678_10001020 3300026067 Bacteria 25550
613 Ga0207678_10007277 3300026067 Bacteria 9810
614 Ga0207678_10092442 3300026067 Bacteria 2586
615 Ga0207708_10000382 3300026075 Bacteria 34635
616 Ga0207708_10001552 3300026075 Bacteria 17143
617 Ga0207708_10008147 3300026075 Bacteria 7761
618 Ga0207708_10070029 3300026075 Bacteria 2686
619 Ga0207708_10072844 3300026075 Bacteria 2632
620 Ga0207702_10022168 3300026078 Bacteria 5263
621 Ga0207702_10101256 3300026078 Bacteria 2543
622 Ga0207641_10008134 3300026088 Bacteria 8684
623 Ga0207641_10010582 3300026088 Bacteria 7568
624 Ga0207641_10039494 3300026088 Bacteria 3947
625 Ga0207641_10047478 3300026088 Bacteria 3621
626 Ga0207641_10079119 3300026088 Bacteria 2849
627 Ga0207641_10130049 3300026088 Bacteria 2259
628 Ga0207641_10202846 3300026088 Bacteria 1829
629 Ga0207648_10001543 3300026089 Bacteria 25355
630 Ga0207648_10004782 3300026089 Bacteria 13831
631 Ga0207648_10011595 3300026089 Bacteria 8299
632 Ga0207648_10023419 3300026089 Bacteria 5531
633 Ga0207648_10040757 3300026089 Bacteria 4080
634 Ga0207676_10000003 3300026095 Bacteria 1123235
635 Ga0207676_10004850 3300026095 Bacteria 9524
636 Ga0207676_10044317 3300026095 Bacteria 3432
637 Ga0207676_10120415 3300026095 Bacteria 2212
638 Ga0207676_10169815 3300026095 Bacteria 1899
639 Ga0207674_10000052 3300026116 Bacteria 115252
640 Ga0207674_10002975 3300026116 Bacteria 21037
641 Ga0207674_10005532 3300026116 Bacteria 15000
642 Ga0207674_10064951 3300026116 Bacteria 3680
643 Ga0207674_10131797 3300026116 Bacteria 2462
644 Ga0207675_100000178 3300026118 Bacteria 57002
645 Ga0207675_100000448 3300026118 Bacteria 40003
646 Ga0207675_100001443 3300026118 Bacteria 23801
647 Ga0207675_100008376 3300026118 Bacteria 9745
648 Ga0207675_100014452 3300026118 Bacteria 7360
649 Ga0207683_10000746 3300026121 Bacteria 29503
650 Ga0207683_10001065 3300026121 Bacteria 25020
651 Ga0207683_10001720 3300026121 Bacteria 19575
652 Ga0207683_10005776 3300026121 Bacteria 10605
653 Ga0207683_10006227 3300026121 Bacteria 10228
654 Ga0207683_10022573 3300026121 Bacteria 5403
655 Ga0207698_10013985 3300026142 Bacteria 5317
656 Ga0207698_10016541 3300026142 Bacteria 4976
657 Ga0209371_1000004 3300027312 Bacteria 1098197
658 Ga0209969_1000461 3300027360 Bacteria 5447
659 Ga0209967_1002692 3300027364 Bacteria 2314
660 Ga0209995_1000660 3300027471 Bacteria 5297
661 Ga0209179_1003929 3300027512 Bacteria 2197
662 Ga0209999_1005905 3300027543 Bacteria 2200
663 Ga0209588_1003131 3300027671 Bacteria 4562
664 Ga0209971_1000947 3300027682 Bacteria 7476
665 Ga0209974_10002636 3300027876 Bacteria 6505
666 Ga0209974_10004499 3300027876 Bacteria 4965
667 Ga0209974_10030390 3300027876 Bacteria 1790
668 Ga0207428_10008034 3300027907 Bacteria 9573
669 Ga0207428_10030182 3300027907 Bacteria 4484
670 Ga0268266_10012254 3300028379 Bacteria 7418
671 Ga0268266_10137036 3300028379 Bacteria 2193
672 Ga0268266_10164960 3300028379 Bacteria 2006
673 Ga0268266_10168477 3300028379 Bacteria 1986
674 Ga0268265_10000435 3300028380 Bacteria 44242
675 Ga0268265_10002275 3300028380 Bacteria 14630
676 Ga0268265_10003258 3300028380 Bacteria 11771
677 Ga0268265_10011011 3300028380 Bacteria 6109
678 Ga0268265_10066373 3300028380 Bacteria 2789
679 Ga0268265_10122229 3300028380 Bacteria 2147
680 Ga0268264_10018814 3300028381 Bacteria 5648
681 Ga0268264_10037447 3300028381 Bacteria 3999
682 Ga0268264_10087362 3300028381 Bacteria 2681
683 Ga0268264_10113232 3300028381 Bacteria 2380
684 Ga0268264_10114761 3300028381 Bacteria 2365
685 Ga0265334_10000005 3300028573 Bacteria 242590
686 Ga0265336_10000707 3300028666 Bacteria 17694
687 Ga0265338_10059795 3300028800 Bacteria 3355
688 Ga0265324_10000471 3300029957 Bacteria 28353
689 Ga0268256_1000005 3300030500 Bacteria 1082342
690 Ga0316183_1012956 3300030742 Bacteria 4183
691 Ga0265332_10002887 3300031238 Bacteria 8493
692 Ga0265328_10024962 3300031239 Bacteria 2254
693 Ga0265325_10001388 3300031241 Bacteria 17089
694 Ga0265331_10003541 3300031250 Bacteria 10022
695 Ga0265327_10000103 3300031251 Bacteria 185405
696 Ga0265327_10000218 3300031251 Bacteria 116690
697 Ga0265316_10018527 3300031344 Bacteria 5979
698 Ga0265316_10039994 3300031344 Bacteria 3762
699 Ga0265316_10098849 3300031344 Bacteria 2220
700 Ga0307509_10001479 3300031507 Bacteria 39686
701 Ga0307408_100000013 3300031548 Bacteria 386212
702 Ga0307408_100117636 3300031548 Bacteria 2053
703 Ga0265313_10000014 3300031595 Bacteria 156295
704 Ga0316575_10000160 3300031665 Bacteria 17023
705 Ga0316575_10009816 3300031665 Bacteria 3511
706 Ga0316579_10030649 3300031691 Bacteria 2459
707 Ga0265314_10001405 3300031711 Bacteria 26998
708 Ga0316576_10005155 3300031727 Bacteria 7937
709 Ga0316576_10007031 3300031727 Bacteria 7047
710 Ga0316578_10017487 3300031728 Bacteria 3903
711 Ga0316578_10035343 3300031728 Bacteria 2872
712 Ga0307413_10001956 3300031824 Bacteria 8180
713 Ga0307410_10000274 3300031852 Bacteria 19850
714 Ga0307410_10015369 3300031852 Bacteria 4538
715 Ga0307406_10018458 3300031901 Bacteria 4076
716 Ga0307407_10000538 3300031903 Bacteria 11807
717 Ga0307412_10178096 3300031911 Bacteria 1596
718 Ga0307409_100050745 3300031995 Bacteria 3170
719 Ga0307409_100213330 3300031995 Bacteria 1737
720 Ga0307416_100045347 3300032002 Bacteria 3461
721 Ga0307416_100191774 3300032002 Bacteria 1928
722 Ga0307414_10009479 3300032004 Bacteria 5596
723 Ga0307414_10010491 3300032004 Bacteria 5380
724 Ga0307414_10044868 3300032004 Bacteria 3023
725 Ga0307414_10264785 3300032004 Bacteria 1436
726 Ga0307411_10008785 3300032005 Bacteria 5257
727 Ga0307415_100101149 3300032126 Bacteria 2114
728 Ga0316585_10023576 3300032137 Bacteria 1899
729 Ga0316593_10011167 3300032168 Bacteria 2602
730 Ga0316593_10021935 3300032168 Bacteria 2001
731 Ga0373929_0011927 3300035085 Bacteria 1644
732 Ga0373944_0018739 3300035089 Bacteria 1979
733 Ga0373952_0001197 3300035092 Bacteria 4724
734 Ga0373953_0009832 3300035117 Bacteria 3309
735 Ga0373954_0023593 3300035118 Bacteria 2799
736 Ga0373954_0026496 3300035118 Bacteria 2657
737 Ga0373956_0000260 3300035119 Bacteria 21143
738 Ga0373957_0005151 3300035120 Bacteria 4038
739 Ga0373957_0006986 3300035120 Bacteria 3587
740 Ga0373943_0019349 3300035170 Bacteria 3130
741 Ga0373943_0065665 3300035170 Bacteria 1825
742 Ga0373946_0056597 3300035171 Bacteria 1656
743 Ga0373955_0007379 3300035172 Bacteria 5052
744 Ga0373955_0008151 3300035172 Bacteria 4848
745 Ga0373942_0010777 3300035207 Bacteria 2155
746 Ga0373961_0027768 3300035241 Bacteria 1556
747 Ga0316574_0004197 3300035398 Bacteria 7514
748 Ga0316574_0004943 3300035398 Bacteria 7060
749 Ga0316574_0005166 3300035398 Bacteria 6942
750 Ga0316574_0028567 3300035398 Bacteria 3365
751 Ga0316574_0143764 3300035398 Bacteria 1537
752 Ga0373931_0007954 3300035691 Bacteria 5015
753 Ga0373931_0064565 3300035691 Bacteria 1982
754 Ga0373935_0019092 3300035692 Bacteria 4180
755 Ga0373935_0172654 3300035692 Bacteria 1480
756 Ga0373927_0007760 3300035695 Bacteria 7256
757 Ga0373933_0005945 3300035724 Bacteria 6638
758 Ga0373933_0021324 3300035724 Bacteria 3679
759 Ga0373933_0042567 3300035724 Bacteria 2684
760 Ga0373933_0147562 3300035724 Bacteria 1488
761 Ga0373937_0000487 3300036401 Bacteria 36252
762 Ga0373937_0010040 3300036401 Bacteria 8254
763 Ga0373937_0012434 3300036401 Bacteria 7487
764 Ga0373937_0035761 3300036401 Bacteria 4522
765 Ga0316584_0057397 3300036712 Bacteria 2914
766 Ga0373925_0012770 3300037068 Bacteria 6085
767 Ga0373925_0021018 3300037068 Bacteria 4755
768 Ga0373925_0033900 3300037068 Bacteria 3762
769 Ga0395900_0007406 3300037418 Bacteria 11342
770 Ga0395900_0103945 3300037418 Bacteria 2918
771 Ga0395898_0030569 3300037466 Bacteria 5389
772 Ga0395905_0003749 3300037471 Bacteria 16101
773 Ga0395905_0027570 3300037471 Bacteria 5356
774 Ga0395905_0044927 3300037471 Bacteria 4144
775 Ga0436364_0432166 3300037853 Bacteria 2189
776 Ga0395901_0012006 3300038443 Bacteria 8787
777 Ga0395901_0068186 3300038443 Bacteria 3706
778 Ga0237819_00915 3300038705 Bacteria 9135
779 Ga0237819_03199 3300038705 Bacteria 2974
780 Ga0400487_46050 3300039110 Bacteria 2405
781 Ga0436365_0076061 3300039437 Bacteria 3598
782 Ga0436361_0050017 3300039447 Bacteria 26618
783 Ga0436363_1709594 3300039450 Bacteria 1577
784 Ga0439465_0008504 3300041413 Bacteria 3239
785 Ga0439437_000550 3300042000 Bacteria 3715
786 Ga0439445_0007253 3300042004 Bacteria 2569
787 Ga0439448_0020208 3300042005 Bacteria 2058
788 Ga0450911_000012 3300042115 Bacteria 129546
789 Ga0439446_0011478 3300042156 Bacteria 2405
790 Ga0451577_0000002 3300042876 Bacteria 1731375
791 Ga0451577_0000402 3300042876 Bacteria 78514
792 Ga0451577_0017088 3300042876 Bacteria 6709
793 Ga0451577_0021269 3300042876 Bacteria 5938
794 Ga0451577_0026706 3300042876 Bacteria 5229
795 Ga0451577_0053334 3300042876 Bacteria 3610
796 Ga0451577_0073138 3300042876 Bacteria 3059
797 Ga0453683_0000011 3300044673 Bacteria 412765
798 Ga0453683_0113823 3300044673 Bacteria 1702
799 Ga0453684_0000002 3300044712 Bacteria 1731375
800 Ga0453684_0000040 3300044712 Bacteria 690210
801 Ga0453684_0000065 3300044712 Bacteria 468481
802 Ga0453684_0000136 3300044712 Bacteria 323402
803 Ga0453684_0001174 3300044712 Bacteria 81261
804 Ga0453684_0126052 3300044712 Bacteria 3081
805 Ga0451576_0000004 3300045051 Bacteria 1312238
806 Ga0451576_0000025 3300045051 Bacteria 427980
807 Ga0451576_0000131 3300045051 Bacteria 190667
808 Ga0451576_0001381 3300045051 Bacteria 41721
809 Ga0451576_0025176 3300045051 Bacteria 6415
810 Ga0451576_0109027 3300045051 Bacteria 2881
811 Ga0466967_0141310 3300045976 Bacteria 2243
812 Ga0495592_0000449 3300046454 Bacteria 30874
813 Ga0495592_0080837 3300046454 Bacteria 2350
814 Ga0495638_0001128 3300046460 Bacteria 25882
815 Ga0495651_0001710 3300046462 Bacteria 16956
816 Ga0495651_0055429 3300046462 Bacteria 3046
817 Ga0495580_0067725 3300046472 Bacteria 2498
818 Ga0495580_0154162 3300046472 Bacteria 1591
819 Ga0495582_0013485 3300046473 Bacteria 4500
820 Ga0495639_0018316 3300046475 Bacteria 3047
821 Ga0495662_0033484 3300046476 Bacteria 2482
822 Ga0495664_0055171 3300046477 Bacteria 2364
823 Ga0495594_0040143 3300046499 Bacteria 2560
824 Ga0495606_0007681 3300046507 Bacteria 9560
825 Ga0495608_0127296 3300046511 Bacteria 1631
826 Ga0495628_0001138 3300046516 Bacteria 24250
827 Ga0495628_0027455 3300046516 Bacteria 4632
828 Ga0495628_0073782 3300046516 Bacteria 2658
829 Ga0495630_0034416 3300046517 Bacteria 3783
830 Ga0495648_0010210 3300046524 Bacteria 7172
831 Ga0495663_0000429 3300046525 Bacteria 15363
832 Ga0495663_0000891 3300046525 Bacteria 10055
833 Ga0495652_0009506 3300046529 Bacteria 8829
834 Ga0495652_0117524 3300046529 Bacteria 2127
835 Ga0495654_0001417 3300046530 Bacteria 16578
836 Ga0495665_0036691 3300046531 Bacteria 2616
837 Ga0495640_0094458 3300046533 Bacteria 1969
838 Ga0495621_0000016 3300046539 Bacteria 34269
839 Ga0495621_0003268 3300046539 Bacteria 4456
840 Ga0495621_0022890 3300046539 Bacteria 2075
841 Ga0495621_0036649 3300046539 Bacteria 1703
842 Ga0495645_0000567 3300046543 Bacteria 25287
843 Ga0495645_0004604 3300046543 Bacteria 9412
844 Ga0495633_0089538 3300046558 Bacteria 1431
845 Ga0495667_0042455 3300046559 Bacteria 3015
846 Ga0495635_0061737 3300046663 Bacteria 2573
847 Ga0495661_0000093 3300046665 Bacteria 109808
848 Ga0495657_0137967 3300046675 Bacteria 1522
849 Ga0495599_0003542 3300046678 Bacteria 9142
850 Ga0495646_0074552 3300046680 Bacteria 1991
851 Ga0495647_0017940 3300046681 Bacteria 2511
852 Ga0495647_0050195 3300046681 Bacteria 1618
853 Ga0495658_0014018 3300046683 Bacteria 4086
854 Ga0495613_0024840 3300046689 Bacteria 4465
855 Ga0495671_0002983 3300046692 Bacteria 10514
856 Ga0495600_0038582 3300046809 Bacteria 3109
857 Ga0495581_0001860 3300047315 Bacteria 11810
858 Ga0495604_0110347 3300047317 Bacteria 2007
859 Ga0495636_0005078 3300047318 Bacteria 5169
860 Ga0495674_0072954 3300047319 Bacteria 2960
861 Ga0495672_0000134 3300047320 Bacteria 110142
862 Ga0495672_0004693 3300047320 Bacteria 11058
863 Ga0495672_0086663 3300047320 Bacteria 1731
864 Ga0495680_0014464 3300047322 Bacteria 6832
865 Ga0495684_0016945 3300047471 Bacteria 5613
866 Ga0495593_0026222 3300047673 Bacteria 3220
867 Ga0495602_0080127 3300048088 Bacteria 2752
868 Ga0496100_0099654 3300048903 Bacteria 2000
869 Ga0496100_0128154 3300048903 Bacteria 1784
870 Ga0496101_0033519 3300048904 Bacteria 3622
871 Ga0496101_0070560 3300048904 Bacteria 2559
872 Ga0496101_0071353 3300048904 Bacteria 2546
873 Ga0496102_0041999 3300048905 Bacteria 4143
874 Ga0496103_0053346 3300048906 Bacteria 2506
875 Ga0496104_0006723 3300048907 Bacteria 10124
876 Ga0496104_0009610 3300048907 Bacteria 8612
877 Ga0496105_0006614 3300048908 Bacteria 8923
878 Ga0496105_0105344 3300048908 Bacteria 2328
879 Ga0496106_0007884 3300048909 Bacteria 7871
880 Ga0496106_0053112 3300048909 Bacteria 3060
881 Ga0496108_0003143 3300048911 Bacteria 13277
882 Ga0496108_0014932 3300048911 Bacteria 6338
883 Ga0496108_0019745 3300048911 Bacteria 5536
884 Ga0496109_0001481 3300048912 Bacteria 19497
885 Ga0496109_0149381 3300048912 Bacteria 2187
886 Ga0496109_0197925 3300048912 Bacteria 1889
887 Ga0496110_0005552 3300048913 Bacteria 9899
888 Ga0496110_0012614 3300048913 Bacteria 6951
889 Ga0496111_0003169 3300048914 Bacteria 10132
890 Ga0496112_0011093 3300048915 Bacteria 8212
891 Ga0496114_0035421 3300048917 Bacteria 4121
892 Ga0496115_0007091 3300048918 Bacteria 8234
893 Ga0496115_0036524 3300048918 Bacteria 3891
894 Ga0496115_0205269 3300048918 Bacteria 1628
895 Ga0496116_0000008 3300048919 Bacteria 726753
896 Ga0496117_0001343 3300048920 Bacteria 36067
897 Ga0496117_0028830 3300048920 Bacteria 4291
898 Ga0496118_0000145 3300048921 Bacteria 123886
899 Ga0496118_0001486 3300048921 Bacteria 35102
900 Ga0496118_0004832 3300048921 Bacteria 15713
901 Ga0496120_0000525 3300048923 Bacteria 59273
902 Ga0496121_0000012 3300048924 Bacteria 653131
903 Ga0496121_0045105 3300048924 Bacteria 3792
904 Ga0496121_0170810 3300048924 Bacteria 1580
905 Ga0496122_0000062 3300048925 Bacteria 241387
906 Ga0496122_0023731 3300048925 Bacteria 5392
907 Ga0496123_0010330 3300048926 Bacteria 8272
908 Ga0496123_0017728 3300048926 Bacteria 5710
909 Ga0496124_0000255 3300048927 Bacteria 102645
910 Ga0496124_0013804 3300048927 Bacteria 7857
911 Ga0496124_0071694 3300048927 Bacteria 2870
912 Ga0496125_0013402 3300048928 Bacteria 8062
913 Ga0496126_0017269 3300048929 Bacteria 7190
914 Ga0501031_0028864 3300049568 Bacteria 3616
915 Ga0501034_0000273 3300049571 Bacteria 93198
916 Ga0501034_0000571 3300049571 Bacteria 58421
917 Ga0501034_0054294 3300049571 Bacteria 4034
918 Ga0501036_0013100 3300049572 Bacteria 6890
919 Ga0501036_0041825 3300049572 Bacteria 3878
920 Ga0501036_0079955 3300049572 Bacteria 2764
921 Ga0501036_0117894 3300049572 Bacteria 2242
922 Ga0501037_0065601 3300049573 Bacteria 2645
923 Ga0501038_0004369 3300049574 Bacteria 13151
924 Ga0501038_0049384 3300049574 Bacteria 3638
925 Ga0501038_0107633 3300049574 Bacteria 2313
926 Ga0501039_0000126 3300049575 Bacteria 52890
927 Ga0501039_0010087 3300049575 Bacteria 7197
928 Ga0501039_0021369 3300049575 Bacteria 4966
929 Ga0501039_0037554 3300049575 Bacteria 3739
930 Ga0501040_0015976 3300049576 Bacteria 4964
931 Ga0501040_0023276 3300049576 Bacteria 4153
932 Ga0501040_0105094 3300049576 Bacteria 1972
933 Ga0501041_0000283 3300049577 Bacteria 24387
934 Ga0501041_0004904 3300049577 Bacteria 7772
935 Ga0501041_0030700 3300049577 Bacteria 3244
936 Ga0501041_0031447 3300049577 Bacteria 3207
937 Ga0501041_0057553 3300049577 Bacteria 2377
938 Ga0501042_0000022 3300049578 Bacteria 50211
939 Ga0501042_0009519 3300049578 Bacteria 6479
940 Ga0501043_0056571 3300049579 Bacteria 3081
941 Ga0501047_0017694 3300049581 Bacteria 6828
942 Ga0501068_0001639 3300049584 Bacteria 11952
943 Ga0501068_0047424 3300049584 Bacteria 2592
944 Ga0501068_0049744 3300049584 Bacteria 2532
945 Ga0501068_0052322 3300049584 Bacteria 2471
946 Ga0501069_0029361 3300049585 Bacteria 3017
947 Ga0501070_0026718 3300049586 Bacteria 4842
948 Ga0501070_0075477 3300049586 Bacteria 2791
949 Ga0501070_0099865 3300049586 Bacteria 2401
950 Ga0501070_0142883 3300049586 Bacteria 1976
951 Ga0501071_0029929 3300049587 Bacteria 3847
952 Ga0501071_0072462 3300049587 Bacteria 2512
953 Ga0501071_0087967 3300049587 Bacteria 2279
954 Ga0501072_0002838 3300049588 Bacteria 12999
955 Ga0501072_0060665 3300049588 Bacteria 2982
956 Ga0501072_0078424 3300049588 Bacteria 2615
957 Ga0501073_0003036 3300049589 Bacteria 12589
958 Ga0501073_0015610 3300049589 Bacteria 5510
959 Ga0501074_0008184 3300049590 Bacteria 7578
960 Ga0501074_0016754 3300049590 Bacteria 5318
961 Ga0501074_0035483 3300049590 Bacteria 3613
962 Ga0501074_0043599 3300049590 Bacteria 3247
963 Ga0501075_0000128 3300049591 Bacteria 37407
964 Ga0501075_0001228 3300049591 Bacteria 16603
965 Ga0501075_0034527 3300049591 Bacteria 3766
966 Ga0501076_0000135 3300049592 Bacteria 41430
967 Ga0501076_0018908 3300049592 Bacteria 5257
968 Ga0501076_0032101 3300049592 Bacteria 4097
969 Ga0501077_0056282 3300049593 Bacteria 2496
970 Ga0501077_0091211 3300049593 Bacteria 1931
971 Ga0501079_0000027 3300049741 Bacteria 60858
972 Ga0501079_0035468 3300049741 Bacteria 3839
973 Ga0501079_0050763 3300049741 Bacteria 3201
974 Ga0501079_0051902 3300049741 Bacteria 3167
975 Ga0501080_0013617 3300049742 Bacteria 7489
976 Ga0501080_0025658 3300049742 Bacteria 5474
977 Ga0501080_0036276 3300049742 Bacteria 4603
978 Ga0501080_0036955 3300049742 Bacteria 4559
979 Ga0501080_0069238 3300049742 Bacteria 3281
980 Ga0501081_0015302 3300049743 Bacteria 5060
981 Ga0501081_0023649 3300049743 Bacteria 4120
982 Ga0501081_0046535 3300049743 Bacteria 2982
983 Ga0501083_0008802 3300049744 Bacteria 7126
984 Ga0501083_0030314 3300049744 Bacteria 3717
985 Ga0501083_0085102 3300049744 Bacteria 2092
986 Ga0501280_002654 3300049776 Bacteria 2916
987 Ga0501035_0224906 3300049822 Bacteria 1601
988 Ga0501045_0004429 3300049824 Bacteria 9690
989 Ga0501045_0195914 3300049824 Bacteria 1505
990 nmdc:mga03683_3263_c1 3300050489 Bacteria 4598
991 nmdc:mga03n38_609_c1 3300050490 Bacteria 9144
992 nmdc:mga00v17_121_c1 3300050491 Bacteria 45916
993 nmdc:mga00v17_158_c1 3300050491 Bacteria 40080
994 nmdc:mga00v17_1845_c1 3300050491 Bacteria 10942
995 nmdc:mga0yw44_187_c1 3300050492 Bacteria 21904
996 nmdc:mga0k408_40587_c1 3300050493 Bacteria 2678
997 nmdc:mga0k408_5171_c2 3300050493 Bacteria 2440
998 nmdc:mga06z11_622_c1 3300050494 Bacteria 12894
999 nmdc:mga06z11_879_c1 3300050494 Bacteria 10969
1000 nmdc:mga07m45_456_c1 3300050496 Bacteria 17161
1001 nmdc:mga05p37_133_c1 3300050507 Bacteria 68369
1002 nmdc:mga05p37_1706_c1 3300050507 Bacteria 25587
1003 nmdc:mga05p37_8018_c1 3300050507 Bacteria 12468
1004 nmdc:mga09592_1764_c1 3300050508 Bacteria 17372
1005 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
1006 nmdc:mga09592_40987_c1 3300050508 Bacteria 3892
1007 nmdc:mga0qj67_103581_c1 3300050509 Bacteria 2296
1008 nmdc:mga0qj67_165691_c1 3300050509 Bacteria 1794
1009 nmdc:mga0qj67_40531_c1 3300050509 Bacteria 3660
1010 nmdc:mga0qj67_43602_c1 3300050509 Bacteria 3533
1011 nmdc:mga0qj67_573_c1 3300050509 Bacteria 25116
1012 nmdc:mga06r32_1651_c1 3300050510 Bacteria 20142
1013 nmdc:mga06r32_169948_c1 3300050510 Bacteria 2164
1014 nmdc:mga06r32_22223_c1 3300050510 Bacteria 5862
1015 nmdc:mga06r32_40_c1 3300050510 Bacteria 79168
1016 nmdc:mga06r32_584_c1 3300050510 Bacteria 31769
1017 nmdc:mga08y16_19070_c1 3300050511 Bacteria 7226
1018 nmdc:mga08y16_232000_c1 3300050511 Bacteria 1909
1019 nmdc:mga08y16_27121_c1 3300050511 Bacteria 6037
1020 nmdc:mga0n895_182812_c1 3300050512 Bacteria 2128
1021 nmdc:mga0n895_338503_c1 3300050512 Bacteria 1524
1022 nmdc:mga0n895_61001_c1 3300050512 Bacteria 3722
1023 nmdc:mga0a205_247855_c1 3300050515 Bacteria 1661
1024 nmdc:mga0a205_61236_c1 3300050515 Bacteria 3635
1025 nmdc:mga0a205_65285_c1 3300050515 Bacteria 3516
1026 nmdc:mga0sz30_369_c2 3300050516 Bacteria 16436
1027 Ga0495601_0022354 3300053077 Bacteria 3881
1028 Ga0495601_0054667 3300053077 Bacteria 2526
1029 Ga0495612_0047257 3300053078 Bacteria 1764
1030 Ga0495595_0049803 3300053084 Bacteria 1938
1031 Ga0500643_013356 3300053087 Bacteria 2903
1032 Ga0500651_0000636 3300053093 Bacteria 17469
1033 Ga0500634_0000070 3300053161 Bacteria 40723
1034 Ga0501084_0007572 3300054114 Bacteria 8952
1035 Ga0501082_0004029 3300060353 Bacteria 12824
1036 Ga0501082_0028682 3300060353 Bacteria 4794
1037 Ga0501082_0044053 3300060353 Bacteria 3849
1038 Ga0501082_0099393 3300060353 Bacteria 2515
1039 Ga0501082_0248610 3300060353 Bacteria 1548
1040 Ga0530510_0000111 3300061734 Bacteria 45793
1041 Ga0530510_0004913 3300061734 Bacteria 9234
1042 Ga0530510_0048773 3300061734 Bacteria 3061
1043 2547375481 2547132103 Bacteria 5115736
1044 2572255408 2571042365 Bacteria 3289345
1045 2578458922 2576861471 Bacteria 4648976
1046 2599945047 2599185302 Bacteria 5954930
1047 2599955224 2599185304 Bacteria 5951361
1048 2599983957 2599185309 Bacteria 5969593
1049 2599990325 2599185310 Bacteria 6014457
1050 2600001733 2599185312 Bacteria 5912071
1051 2600048859 2599185320 Bacteria 5963263
1052 2643881520 2643221573 Bacteria 4784121
1053 2644662656 2643221720 Bacteria 4694283
1054 2644698390 2643221728 Bacteria 4797149
1055 2765578442 2765235840 Bacteria 4663337
1056 2808857279 2808606361 Bacteria 6136259
1057 2808905290 2808606373 Bacteria 4423627
1058 2808926415 2808606376 Bacteria 6248667
1059 2808937417 2808606378 Bacteria 6177535
1060 2808948576 2808606380 Bacteria 6248705
1061 2808965747 2808606383 Bacteria 6138645
1062 2809000654 2808606389 Bacteria 6138126
1063 2816516459 2816332141 Bacteria 4436036
1064 2842781544 2842780639 Bacteria 4337790
1065 2843691361 2843690924 Bacteria 5169057
1066 2852651273 2852649853 Bacteria 4036942
1067 2857446762 2857442823 Bacteria 4562550
1068 2894414537 2894414249 Bacteria 4405451
1069 2919498195 2919497567 Bacteria 4408621
1070 2919516898 2919513703 Bacteria 3844312
1071 2919675534 2919675420 Bacteria 3969095
1072 2923517634 2923516293 Bacteria 3716336
1073 2939590568 2939589442 Bacteria 4214238
1074 2939622736 2939622612 Bacteria 4698046
1075 2946007427 2946006987 Bacteria 6705746
1076 2961067169 2961064222 Bacteria 4749990
1077 2974309385 2974307012 Bacteria 4172388
1078 2977250105 2977247770 Bacteria 4160543
1079 2984515405 2984514374 Bacteria 4172479
1080 2998344551 2998344455 Bacteria 4222996
1081 8002869610 8002869464 Bacteria 3588529
1082 8003016643 8003014200 Bacteria 4059994
1083 8034966989 8034962539 Bacteria 4884839
1084 8054732065 8054727385 Bacteria 7558670
1085 Ga0055536_1003090
1086 JGI25162J39368_1000136
1087 JGI25164J39214_1000260
1088 JGI25152J39213_1000074
1089 JGI25150J39212_1000056
1090 JGI25151J46595_10000178
1091 JGI25151J46595_10000430
1092 JGI25165J46597_1000222
1093 JGI25153J46596_10000131
1094 Ga0055526_1000008
1095 Ga0055526_1001472
1096 Ga0055526_1013160
1097 Ga0055537_1000343
1098 Ga0055537_1000713
1099 Ga0055524_1001290
1100 Ga0055524_1008350
1101 Ga0055536_1005503
1102 Ga0055536_1006485
1103 Ga0055536_1006496
1104 Ga0055534_1000003
1105 Ga0055534_1000717
1106 Ga0055528_1000019
1107 Ga0055528_1003920
1108 Ga0055530_10000036
1109 Ga0055530_10002049
1110 Ga0055530_10002228
1111 Ga0055530_10003987
1112 Ga0055540_1000072
1113 Ga0055531_10001707
1114 Ga0055531_10004113
1115 Ga0055531_10007124
1116 Ga0058692_1000002
1117 Ga0065707_10003200
1118 Ga0070658_10015935
1119 Ga0070658_10038645
1120 Ga0070683_100004250
1121 Ga0070683_100013072
1122 Ga0070683_100027452
1123 Ga0070690_100003693
1124 Ga0070690_100007788
1125 Ga0070690_100020584
1126 Ga0070670_100000002
1127 Ga0070670_100006153
1128 Ga0070670_100009718
1129 Ga0070670_100084272
1130 Ga0070670_100119198
1131 Ga0070677_10015431
1132 Ga0068869_100011009
1133 Ga0068869_100027051
1134 Ga0068869_100043138
1135 Ga0068869_100053905
1136 Ga0068869_100069021
1137 Ga0070666_10004787
1138 Ga0070666_10007365
1139 Ga0070666_10010051
1140 Ga0070666_10016249
1141 Ga0070666_10017293
1142 Ga0070680_100035809
1143 Ga0070680_100096487
1144 Ga0070680_100156843
1145 Ga0070680_100205416
1146 Ga0070682_100000380
1147 Ga0068868_100004418
1148 Ga0068868_100014076
1149 Ga0068868_100041521
1150 Ga0068868_100063241
1151 Ga0070660_100028013
1152 Ga0070660_100066755
1153 Ga0070660_100079329
1154 Ga0070689_100006598
1155 Ga0070689_100008044
1156 Ga0070689_100008330
1157 Ga0070689_100019537
1158 Ga0070689_100026938
1159 Ga0070689_100041828
1160 Ga0070689_100057648
1161 Ga0070691_10053731
1162 Ga0070687_100006690
1163 Ga0070661_100004439
1164 Ga0070661_100007342
1165 Ga0070661_100020822
1166 Ga0070661_100028288
1167 Ga0070661_100040918
1168 Ga0070692_10003861
1169 Ga0070692_10006651
1170 Ga0070692_10034034
1171 Ga0070669_100004277
1172 Ga0070669_100076355
1173 Ga0070669_100103978
1174 Ga0070669_100114814
1175 Ga0070675_100009894
1176 Ga0070675_100088797
1177 Ga0070671_100000022
1178 Ga0070671_100002957
1179 Ga0070671_100018536
1180 Ga0070671_100022375
1181 Ga0070671_100076762
1182 Ga0070673_100001706
1183 Ga0070673_100011790
1184 Ga0070673_100012540
1185 Ga0070673_100031437
1186 Ga0070673_100036017
1187 Ga0070688_100000292
1188 Ga0070688_100000882
1189 Ga0070688_100039128
1190 Ga0070659_100013147
1191 Ga0070667_100000007
1192 Ga0070667_100000150
1193 Ga0070667_100026515
1194 Ga0070709_10001553
1195 Ga0070714_100000332
1196 Ga0070714_100229316
1197 Ga0070713_100003519
1198 Ga0070713_100003782
1199 Ga0070713_100024900
1200 Ga0070713_100032686
1201 Ga0070710_10004468
1202 Ga0070701_10000319
1203 Ga0070701_10044853
1204 Ga0070711_100005649
1205 Ga0070711_100011627
1206 Ga0070711_100163499
1207 Ga0070705_100017497
1208 Ga0070705_100027675
1209 Ga0070705_100099519
1210 Ga0070700_100002665
1211 Ga0070700_100138762
1212 Ga0070694_100038329
1213 Ga0070694_100041113
1214 Ga0070694_100057539
1215 Ga0070694_100066611
1216 Ga0070708_100054686
1217 Ga0070708_100090993
1218 Ga0070663_100003494
1219 Ga0070663_100013809
1220 Ga0070663_100107051
1221 Ga0070678_100001364
1222 Ga0070678_100001708
1223 Ga0070678_100006602
1224 Ga0070662_100005429
1225 Ga0070662_100035331
1226 Ga0070662_100050051
1227 Ga0070662_100156998
1228 Ga0070662_100159289
1229 Ga0070681_10002119
1230 Ga0070681_10005255
1231 Ga0070681_10210658
1232 Ga0068867_100026979
1233 Ga0070685_10000148
1234 Ga0070685_10001092
1235 Ga0070685_10020262
1236 Ga0070706_100161198
1237 Ga0070706_100221170
1238 Ga0070707_100031393
1239 Ga0070698_100105258
1240 Ga0070698_100111171
1241 Ga0070699_100022242
1242 Ga0070699_100147439
1243 Ga0070679_100044336
1244 Ga0070684_100008392
1245 Ga0070684_100020377
1246 Ga0070697_100003127
1247 Ga0070697_100087221
1248 Ga0070697_100110115
1249 Ga0068853_100001036
1250 Ga0068853_100002186
1251 Ga0068853_100142979
1252 Ga0070672_100001829
1253 Ga0070672_100002876
1254 Ga0070686_100000740
1255 Ga0070686_100011553
1256 Ga0070686_100018117
1257 Ga0070686_100059326
1258 Ga0070695_100016539
1259 Ga0070695_100028709
1260 Ga0070696_100090501
1261 Ga0070696_100090912
1262 Ga0070696_100141385
1263 Ga0070693_100000355
1264 Ga0070693_100018554
1265 Ga0070665_100002349
1266 Ga0070665_100015445
1267 Ga0070665_100020180
1268 Ga0070665_100024535
1269 Ga0070665_100055246
1270 Ga0070665_100084976
1271 Ga0070704_100005685
1272 Ga0070704_100033773
1273 Ga0070704_100051353
1274 Ga0070704_100191315
1275 Ga0068855_100008633
1276 Ga0068855_100009797
1277 Ga0068855_100023835
1278 Ga0068855_100039911
1279 Ga0068855_100082958
1280 Ga0070664_100002191
1281 Ga0070664_100002880
1282 Ga0070664_100008398
1283 Ga0070664_100017980
1284 Ga0070664_100063715
1285 Ga0070664_100208628
1286 Ga0068857_100003513
1287 Ga0068857_100017944
1288 Ga0068854_100011844
1289 Ga0068854_100019777
1290 Ga0068854_100039035
1291 Ga0068854_100053310
1292 Ga0068854_100124579
1293 Ga0068856_100005841
1294 Ga0068856_100033965
1295 Ga0068856_100137761
1296 Ga0070702_100002726
1297 Ga0070702_100006583
1298 Ga0070702_100047510
1299 Ga0068852_100001889
1300 Ga0068852_100010864
1301 Ga0068852_100232838
1302 Ga0068859_100010871
1303 Ga0068859_100083482
1304 Ga0068859_100155567
1305 Ga0068859_100160028
1306 Ga0068859_100208277
1307 Ga0068864_100000003
1308 Ga0068864_100005774
1309 Ga0068864_100014149
1310 Ga0068864_100019036
1311 Ga0068866_10001916
1312 Ga0068866_10003766
1313 Ga0068861_100002552
1314 Ga0068861_100005187
1315 Ga0068861_100006869
1316 Ga0068861_100007103
1317 Ga0068861_100042029
1318 Ga0068861_100058879
1319 Ga0068851_10000872
1320 Ga0068851_10008908
1321 Ga0068851_10009765
1322 Ga0068870_10006457
1323 Ga0068863_100009028
1324 Ga0068863_100010280
1325 Ga0068863_100021142
1326 Ga0068863_100095539
1327 Ga0068863_100174063
1328 Ga0068863_100222846
1329 Ga0068858_100002485
1330 Ga0068858_100007459
1331 Ga0068858_100007973
1332 Ga0068858_100027261
1333 Ga0068858_100060543
1334 Ga0068858_100065191
1335 Ga0068860_100001638
1336 Ga0068860_100013859
1337 Ga0068860_100030834
1338 Ga0068860_100110409
1339 Ga0068862_100000452
1340 Ga0068862_100006537
1341 Ga0068862_100009412
1342 Ga0068862_100014383
1343 Ga0068862_100043953
1344 Ga0068862_100062042
1345 Ga0068862_100091519
1346 Ga0068862_100124290
1347 Ga0081538_10073395
1348 Ga0081540_1004336
1349 Ga0075365_10000122
1350 Ga0075363_100001163
1351 Ga0075364_10000213
1352 Ga0075364_10000562
1353 Ga0070715_10014203
1354 Ga0070716_100001077
1355 Ga0070716_100019418
1356 Ga0070712_100040974
1357 Ga0075367_10001536
1358 Ga0075369_10000212
1359 Ga0097621_100002878
1360 Ga0097621_100028624
1361 Ga0075370_10032942
1362 Ga0068871_100006555
1363 Ga0068871_100008816
1364 Ga0068871_100027588
1365 Ga0075428_100000982
1366 Ga0075428_100002975
1367 Ga0075430_100000566
1368 Ga0075430_100011327
1369 Ga0075430_100022826
1370 Ga0075430_100030371
1371 Ga0075430_100145781
1372 Ga0075430_100163607
1373 Ga0075431_100002345
1374 Ga0075431_100002432
1375 Ga0075431_100035882
1376 Ga0075431_100120469
1377 Ga0075433_10054163
1378 Ga0075434_100009366
1379 Ga0075434_100105823
1380 Ga0075434_100157039
1381 Ga0075429_100000015
1382 Ga0075429_100000217
1383 Ga0075429_100024442
1384 Ga0075429_100049651
1385 Ga0068865_100005740
1386 Ga0068865_100063933
1387 Ga0075436_100065816
1388 Ga0075436_100137968
1389 Ga0097620_100010870
1390 Ga0097620_100083480
1391 Ga0097620_100155574
1392 Ga0097620_100160027
1393 Ga0097620_100208260
1394 Ga0075435_100062780
1395 Ga0075435_100103983
1396 Ga0099794_10001346
1397 Ga0105251_10025919
1398 Ga0105240_10002074
1399 Ga0105240_10007281
1400 Ga0105240_10014161
1401 Ga0105240_10073166
1402 Ga0105240_10321353
1403 Ga0111539_10002751
1404 Ga0111539_10002953
1405 Ga0111539_10058516
1406 Ga0111539_10081464
1407 Ga0111539_10124594
1408 Ga0111539_10393720
1409 Ga0105245_10004129
1410 Ga0105245_10008792
1411 Ga0105245_10051378
1412 Ga0105245_10266813
1413 Ga0105247_10005141
1414 Ga0105247_10017181
1415 Ga0114129_10000248
1416 Ga0114129_10041162
1417 Ga0105243_10003141
1418 Ga0105243_10011531
1419 Ga0105243_10065919
1420 Ga0105241_10116676
1421 Ga0105241_10125335
1422 Ga0105242_10002322
1423 Ga0105242_10005056
1424 Ga0105242_10014096
1425 Ga0105248_10000246
1426 Ga0105248_10010195
1427 Ga0105248_10039245
1428 Ga0105248_10110131
1429 Ga0105248_10229774
1430 Ga0105248_10315134
1431 Ga0105237_10000231
1432 Ga0105237_10026395
1433 Ga0105237_10059158
1434 Ga0105237_10136504
1435 Ga0105238_10035805
1436 Ga0105238_10043127
1437 Ga0105249_10005115
1438 Ga0105249_10006419
1439 Ga0105249_10012784
1440 Ga0105249_10012863
1441 Ga0105249_10013252
1442 Ga0105249_10179243
1443 Ga0099796_10024514
1444 Ga0105239_10005689
1445 Ga0105239_10109140
1446 Ga0157373_10001374
1447 Ga0157371_10000429
1448 Ga0157371_10007777
1449 Ga0157371_10014829
1450 Ga0157370_10012042
1451 Ga0157370_10049463
1452 Ga0157374_10014292
1453 Ga0157374_10016690
1454 Ga0157374_10035124
1455 Ga0157374_10053996
1456 Ga0157378_10013710
1457 Ga0157378_10016375
1458 Ga0157378_10022130
1459 Ga0157378_10045867
1460 Ga0157378_10046570
1461 Ga0157378_10133048
1462 Ga0157378_10198705
1463 Ga0163162_10072809
1464 Ga0163162_10374648
1465 Ga0157372_10004213
1466 Ga0157372_10015001
1467 Ga0157372_10021657
1468 Ga0157372_10266499
1469 Ga0157375_10109230
1470 Ga0157375_10135352
1471 Ga0163163_10000835
1472 Ga0163163_10018597
1473 Ga0163163_10054458
1474 Ga0163163_10168564
1475 Ga0157380_10015682
1476 Ga0157380_10281250
1477 Ga0182008_10000269
1478 Ga0157377_10001111
1479 Ga0157377_10002019
1480 Ga0157377_10014693
1481 Ga0157379_10005419
1482 Ga0157379_10066007
1483 Ga0157376_10002756
1484 Ga0157376_10003114
1485 Ga0157376_10013527
1486 Ga0157376_10111927
1487 Ga0182006_1007044
1488 Ga0182007_10000127
1489 Ga0182005_1000168
1490 Ga0183360_10001
1491 Ga0163161_10044445
1492 Ga0163161_10109759
1493 Ga0213876_10039093
1494 Ga0209760_100058
1495 Ga0207427_100063
1496 Ga0209437_100133
1497 Ga0207425_1000108
1498 Ga0207425_1004437
1499 Ga0209129_1000178
1500 Ga0209233_1000133
1501 Ga0209565_1000001
1502 Ga0209565_1000014
1503 Ga0209673_1000001
1504 Ga0209673_1000570
1505 Ga0209130_1003922
1506 Ga0209130_1017144
1507 Ga0209675_1000001
1508 Ga0209675_1000021
1509 Ga0209676_1000027
1510 Ga0209676_1000047
1511 Ga0209676_1000079
1512 Ga0209676_1001090
1513 Ga0209676_1007037
1514 Ga0209676_1007436
1515 Ga0209676_1010731
1516 Ga0209025_1000012
1517 Ga0209025_1000102
1518 Ga0209025_1003190
1519 Ga0209564_1000001
1520 Ga0209564_1000263
1521 Ga0209758_1000018
1522 Ga0209758_1021599
1523 Ga0209050_1000080
1524 Ga0209050_1000153
1525 Ga0209050_1000311
1526 Ga0209050_1002761
1527 Ga0209256_1000002
1528 Ga0209256_1002605
1529 Ga0209256_1002692
1530 Ga0209256_1004733
1531 Ga0209051_1000082
1532 Ga0209051_1006455
1533 Ga0209257_1000081
1534 Ga0209257_1000274
1535 Ga0209257_1000664
1536 Ga0209257_1001912
1537 Ga0209257_1002586
1538 Ga0209257_1007820
1539 Ga0209257_1009194
1540 Ga0207697_10000149
1541 Ga0207697_10020793
1542 Ga0207656_10003769
1543 Ga0207656_10012278
1544 Ga0207655_1033072
1545 Ga0207682_10000459
1546 Ga0207642_10001236
1547 Ga0207710_10027304
1548 Ga0207688_10001830
1549 Ga0207688_10007340
1550 Ga0207680_10036342
1551 Ga0207685_10045386
1552 Ga0207645_10001936
1553 Ga0207645_10100063
1554 Ga0207643_10000257
1555 Ga0207643_10002766
1556 Ga0207643_10009427
1557 Ga0207643_10043792
1558 Ga0207643_10047912
1559 Ga0207707_10010165
1560 Ga0207707_10012870
1561 Ga0207707_10048090
1562 Ga0207695_10001882
1563 Ga0207695_10006211
1564 Ga0207695_10011988
1565 Ga0207695_10015440
1566 Ga0207695_10207552
1567 Ga0207671_10008456
1568 Ga0207693_10002740
1569 Ga0207693_10020534
1570 Ga0207663_10005447
1571 Ga0207663_10018487
1572 Ga0207660_10027866
1573 Ga0207660_10033993
1574 Ga0207660_10124814
1575 Ga0207662_10009238
1576 Ga0207662_10012415
1577 Ga0207662_10024694
1578 Ga0207662_10085548
1579 Ga0207657_10001446
1580 Ga0207657_10017013
1581 Ga0207657_10051076
1582 Ga0207657_10113044
1583 Ga0207649_10023500
1584 Ga0207649_10067791
1585 Ga0207649_10102326
1586 Ga0207652_10018305
1587 Ga0207652_10215803
1588 Ga0207646_10105596
1589 Ga0207646_10154480
1590 Ga0207646_10176713
1591 Ga0207681_10003243
1592 Ga0207681_10008178
1593 Ga0207681_10011656
1594 Ga0207681_10034434
1595 Ga0207681_10066205
1596 Ga0207681_10073914
1597 Ga0207694_10026021
1598 Ga0207694_10095594
1599 Ga0207650_10000003
1600 Ga0207650_10001825
1601 Ga0207650_10002621
1602 Ga0207650_10085318
1603 Ga0207659_10003990
1604 Ga0207659_10014471
1605 Ga0207659_10071353
1606 Ga0207687_10006961
1607 Ga0207687_10026690
1608 Ga0207700_10003571
1609 Ga0207700_10020142
1610 Ga0207664_10000325
1611 Ga0207664_10003311
1612 Ga0207664_10100168
1613 Ga0207644_10000037
1614 Ga0207644_10002823
1615 Ga0207644_10003679
1616 Ga0207644_10032756
1617 Ga0207644_10071271
1618 Ga0207690_10133711
1619 Ga0207706_10000775
1620 Ga0207706_10007089
1621 Ga0207706_10041143
1622 Ga0207706_10108387
1623 Ga0207706_10181447
1624 Ga0207686_10004363
1625 Ga0207686_10012082
1626 Ga0207686_10036442
1627 Ga0207686_10043800
1628 Ga0207686_10109420
1629 Ga0207709_10000930
1630 Ga0207709_10007789
1631 Ga0207709_10029160
1632 Ga0207670_10009955
1633 Ga0207670_10055151
1634 Ga0207669_10009438
1635 Ga0207669_10031724
1636 Ga0207669_10168456
1637 Ga0207704_10001220
1638 Ga0207704_10005871
1639 Ga0207704_10017993
1640 Ga0207704_10024054
1641 Ga0207665_10003114
1642 Ga0207691_10001095
1643 Ga0207691_10001701
1644 Ga0207691_10003722
1645 Ga0207691_10005811
1646 Ga0207691_10025607
1647 Ga0207691_10046818
1648 Ga0207691_10142642
1649 Ga0207711_10000782
1650 Ga0207711_10003291
1651 Ga0207711_10003296
1652 Ga0207711_10006050
1653 Ga0207711_10064392
1654 Ga0207689_10000474
1655 Ga0207689_10002613
1656 Ga0207689_10003706
1657 Ga0207689_10030707
1658 Ga0207689_10038779
1659 Ga0207661_10036429
1660 Ga0207661_10070183
1661 Ga0207661_10166349
1662 Ga0207679_10037767
1663 Ga0207679_10051272
1664 Ga0207667_10004596
1665 Ga0207667_10055847
1666 Ga0207667_10144569
1667 Ga0207667_10187414
1668 Ga0207651_10002306
1669 Ga0207651_10014477
1670 Ga0207651_10015257
1671 Ga0207651_10032842
1672 Ga0207712_10000314
1673 Ga0207712_10010887
1674 Ga0207712_10058562
1675 Ga0207712_10113733
1676 Ga0207712_10131469
1677 Ga0207640_10007253
1678 Ga0207640_10007928
1679 Ga0207640_10069786
1680 Ga0207658_10000004
1681 Ga0207658_10000013
1682 Ga0207658_10006563
1683 Ga0207658_10022252
1684 Ga0207677_10000390
1685 Ga0207677_10045330
1686 Ga0207703_10002767
1687 Ga0207703_10009021
1688 Ga0207703_10013439
1689 Ga0207703_10016031
1690 Ga0207703_10017347
1691 Ga0207639_10000791
1692 Ga0207639_10001337
1693 Ga0207639_10002604
1694 Ga0207639_10006184
1695 Ga0207678_10000306
1696 Ga0207678_10001020
1697 Ga0207678_10007277
1698 Ga0207678_10092442
1699 Ga0207708_10000382
1700 Ga0207708_10001552
1701 Ga0207708_10008147
1702 Ga0207708_10070029
1703 Ga0207708_10072844
1704 Ga0207702_10022168
1705 Ga0207702_10101256
1706 Ga0207641_10008134
1707 Ga0207641_10010582
1708 Ga0207641_10039494
1709 Ga0207641_10047478
1710 Ga0207641_10079119
1711 Ga0207641_10130049
1712 Ga0207641_10202846
1713 Ga0207648_10001543
1714 Ga0207648_10004782
1715 Ga0207648_10011595
1716 Ga0207648_10023419
1717 Ga0207648_10040757
1718 Ga0207676_10000003
1719 Ga0207676_10004850
1720 Ga0207676_10044317
1721 Ga0207676_10120415
1722 Ga0207676_10169815
1723 Ga0207674_10000052
1724 Ga0207674_10002975
1725 Ga0207674_10005532
1726 Ga0207674_10064951
1727 Ga0207674_10131797
1728 Ga0207675_100000178
1729 Ga0207675_100000448
1730 Ga0207675_100001443
1731 Ga0207675_100008376
1732 Ga0207675_100014452
1733 Ga0207683_10000746
1734 Ga0207683_10001065
1735 Ga0207683_10001720
1736 Ga0207683_10005776
1737 Ga0207683_10006227
1738 Ga0207683_10022573
1739 Ga0207698_10013985
1740 Ga0207698_10016541
1741 Ga0209371_1000004
1742 Ga0209969_1000461
1743 Ga0209967_1002692
1744 Ga0209995_1000660
1745 Ga0209179_1003929
1746 Ga0209999_1005905
1747 Ga0209588_1003131
1748 Ga0209971_1000947
1749 Ga0209974_10002636
1750 Ga0209974_10004499
1751 Ga0209974_10030390
1752 Ga0207428_10008034
1753 Ga0207428_10030182
1754 Ga0268266_10012254
1755 Ga0268266_10137036
1756 Ga0268266_10164960
1757 Ga0268266_10168477
1758 Ga0268265_10000435
1759 Ga0268265_10002275
1760 Ga0268265_10003258
1761 Ga0268265_10011011
1762 Ga0268265_10066373
1763 Ga0268265_10122229
1764 Ga0268264_10018814
1765 Ga0268264_10037447
1766 Ga0268264_10087362
1767 Ga0268264_10113232
1768 Ga0268264_10114761
1769 Ga0265334_10000005
1770 Ga0265336_10000707
1771 Ga0265338_10059795
1772 Ga0265324_10000471
1773 Ga0268256_1000005
1774 Ga0316183_1012956
1775 Ga0265332_10002887
1776 Ga0265328_10024962
1777 Ga0265325_10001388
1778 Ga0265331_10003541
1779 Ga0265327_10000103
1780 Ga0265327_10000218
1781 Ga0265316_10018527
1782 Ga0265316_10039994
1783 Ga0265316_10098849
1784 Ga0307509_10001479
1785 Ga0307408_100000013
1786 Ga0307408_100117636
1787 Ga0265313_10000014
1788 Ga0316575_10000160
1789 Ga0316575_10009816
1790 Ga0316579_10030649
1791 Ga0265314_10001405
1792 Ga0316576_10005155
1793 Ga0316576_10007031
1794 Ga0316578_10017487
1795 Ga0316578_10035343
1796 Ga0307413_10001956
1797 Ga0307410_10000274
1798 Ga0307410_10015369
1799 Ga0307406_10018458
1800 Ga0307407_10000538
1801 Ga0307412_10178096
1802 Ga0307409_100050745
1803 Ga0307409_100213330
1804 Ga0307416_100045347
1805 Ga0307416_100191774
1806 Ga0307414_10009479
1807 Ga0307414_10010491
1808 Ga0307414_10044868
1809 Ga0307414_10264785
1810 Ga0307411_10008785
1811 Ga0307415_100101149
1812 Ga0316585_10023576
1813 Ga0316593_10011167
1814 Ga0316593_10021935
1815 Ga0373929_0011927
1816 Ga0373944_0018739
1817 Ga0373952_0001197
1818 Ga0373953_0009832
1819 Ga0373954_0023593
1820 Ga0373954_0026496
1821 Ga0373956_0000260
1822 Ga0373957_0005151
1823 Ga0373957_0006986
1824 Ga0373943_0019349
1825 Ga0373943_0065665
1826 Ga0373946_0056597
1827 Ga0373955_0007379
1828 Ga0373955_0008151
1829 Ga0373942_0010777
1830 Ga0373961_0027768
1831 Ga0316574_0004197
1832 Ga0316574_0004943
1833 Ga0316574_0005166
1834 Ga0316574_0028567
1835 Ga0316574_0143764
1836 Ga0373931_0007954
1837 Ga0373931_0064565
1838 Ga0373935_0019092
1839 Ga0373935_0172654
1840 Ga0373927_0007760
1841 Ga0373933_0005945
1842 Ga0373933_0021324
1843 Ga0373933_0042567
1844 Ga0373933_0147562
1845 Ga0373937_0000487
1846 Ga0373937_0010040
1847 Ga0373937_0012434
1848 Ga0373937_0035761
1849 Ga0316584_0057397
1850 Ga0373925_0012770
1851 Ga0373925_0021018
1852 Ga0373925_0033900
1853 Ga0395900_0007406
1854 Ga0395900_0103945
1855 Ga0395898_0030569
1856 Ga0395905_0003749
1857 Ga0395905_0027570
1858 Ga0395905_0044927
1859 Ga0436364_0432166
1860 Ga0395901_0012006
1861 Ga0395901_0068186
1862 Ga0237819_00915
1863 Ga0237819_03199
1864 Ga0400487_46050
1865 Ga0436365_0076061
1866 Ga0436361_0050017
1867 Ga0436363_1709594
1868 Ga0439465_0008504
1869 Ga0439437_000550
1870 Ga0439445_0007253
1871 Ga0439448_0020208
1872 Ga0450911_000012
1873 Ga0439446_0011478
1874 Ga0451577_0000002
1875 Ga0451577_0000402
1876 Ga0451577_0017088
1877 Ga0451577_0021269
1878 Ga0451577_0026706
1879 Ga0451577_0053334
1880 Ga0451577_0073138
1881 Ga0453683_0000011
1882 Ga0453683_0113823
1883 Ga0453684_0000002
1884 Ga0453684_0000040
1885 Ga0453684_0000065
1886 Ga0453684_0000136
1887 Ga0453684_0001174
1888 Ga0453684_0126052
1889 Ga0451576_0000004
1890 Ga0451576_0000025
1891 Ga0451576_0000131
1892 Ga0451576_0001381
1893 Ga0451576_0025176
1894 Ga0451576_0109027
1895 Ga0466967_0141310
1896 Ga0495592_0000449
1897 Ga0495592_0080837
1898 Ga0495638_0001128
1899 Ga0495651_0001710
1900 Ga0495651_0055429
1901 Ga0495580_0067725
1902 Ga0495580_0154162
1903 Ga0495582_0013485
1904 Ga0495639_0018316
1905 Ga0495662_0033484
1906 Ga0495664_0055171
1907 Ga0495594_0040143
1908 Ga0495606_0007681
1909 Ga0495608_0127296
1910 Ga0495628_0001138
1911 Ga0495628_0027455
1912 Ga0495628_0073782
1913 Ga0495630_0034416
1914 Ga0495648_0010210
1915 Ga0495663_0000429
1916 Ga0495663_0000891
1917 Ga0495652_0009506
1918 Ga0495652_0117524
1919 Ga0495654_0001417
1920 Ga0495665_0036691
1921 Ga0495640_0094458
1922 Ga0495621_0000016
1923 Ga0495621_0003268
1924 Ga0495621_0022890
1925 Ga0495621_0036649
1926 Ga0495645_0000567
1927 Ga0495645_0004604
1928 Ga0495633_0089538
1929 Ga0495667_0042455
1930 Ga0495635_0061737
1931 Ga0495661_0000093
1932 Ga0495657_0137967
1933 Ga0495599_0003542
1934 Ga0495646_0074552
1935 Ga0495647_0017940
1936 Ga0495647_0050195
1937 Ga0495658_0014018
1938 Ga0495613_0024840
1939 Ga0495671_0002983
1940 Ga0495600_0038582
1941 Ga0495581_0001860
1942 Ga0495604_0110347
1943 Ga0495636_0005078
1944 Ga0495674_0072954
1945 Ga0495672_0000134
1946 Ga0495672_0004693
1947 Ga0495672_0086663
1948 Ga0495680_0014464
1949 Ga0495684_0016945
1950 Ga0495593_0026222
1951 Ga0495602_0080127
1952 Ga0496100_0099654
1953 Ga0496100_0128154
1954 Ga0496101_0033519
1955 Ga0496101_0070560
1956 Ga0496101_0071353
1957 Ga0496102_0041999
1958 Ga0496103_0053346
1959 Ga0496104_0006723
1960 Ga0496104_0009610
1961 Ga0496105_0006614
1962 Ga0496105_0105344
1963 Ga0496106_0007884
1964 Ga0496106_0053112
1965 Ga0496108_0003143
1966 Ga0496108_0014932
1967 Ga0496108_0019745
1968 Ga0496109_0001481
1969 Ga0496109_0149381
1970 Ga0496109_0197925
1971 Ga0496110_0005552
1972 Ga0496110_0012614
1973 Ga0496111_0003169
1974 Ga0496112_0011093
1975 Ga0496114_0035421
1976 Ga0496115_0007091
1977 Ga0496115_0036524
1978 Ga0496115_0205269
1979 Ga0496116_0000008
1980 Ga0496117_0001343
1981 Ga0496117_0028830
1982 Ga0496118_0000145
1983 Ga0496118_0001486
1984 Ga0496118_0004832
1985 Ga0496120_0000525
1986 Ga0496121_0000012
1987 Ga0496121_0045105
1988 Ga0496121_0170810
1989 Ga0496122_0000062
1990 Ga0496122_0023731
1991 Ga0496123_0010330
1992 Ga0496123_0017728
1993 Ga0496124_0000255
1994 Ga0496124_0013804
1995 Ga0496124_0071694
1996 Ga0496125_0013402
1997 Ga0496126_0017269
1998 Ga0501031_0028864
1999 Ga0501034_0000273
2000 Ga0501034_0000571
2001 Ga0501034_0054294
2002 Ga0501036_0013100
2003 Ga0501036_0041825
2004 Ga0501036_0079955
2005 Ga0501036_0117894
2006 Ga0501037_0065601
2007 Ga0501038_0004369
2008 Ga0501038_0049384
2009 Ga0501038_0107633
2010 Ga0501039_0000126
2011 Ga0501039_0010087
2012 Ga0501039_0021369
2013 Ga0501039_0037554
2014 Ga0501040_0015976
2015 Ga0501040_0023276
2016 Ga0501040_0105094
2017 Ga0501041_0000283
2018 Ga0501041_0004904
2019 Ga0501041_0030700
2020 Ga0501041_0031447
2021 Ga0501041_0057553
2022 Ga0501042_0000022
2023 Ga0501042_0009519
2024 Ga0501043_0056571
2025 Ga0501047_0017694
2026 Ga0501068_0001639
2027 Ga0501068_0047424
2028 Ga0501068_0049744
2029 Ga0501068_0052322
2030 Ga0501069_0029361
2031 Ga0501070_0026718
2032 Ga0501070_0075477
2033 Ga0501070_0099865
2034 Ga0501070_0142883
2035 Ga0501071_0029929
2036 Ga0501071_0072462
2037 Ga0501071_0087967
2038 Ga0501072_0002838
2039 Ga0501072_0060665
2040 Ga0501072_0078424
2041 Ga0501073_0003036
2042 Ga0501073_0015610
2043 Ga0501074_0008184
2044 Ga0501074_0016754
2045 Ga0501074_0035483
2046 Ga0501074_0043599
2047 Ga0501075_0000128
2048 Ga0501075_0001228
2049 Ga0501075_0034527
2050 Ga0501076_0000135
2051 Ga0501076_0018908
2052 Ga0501076_0032101
2053 Ga0501077_0056282
2054 Ga0501077_0091211
2055 Ga0501079_0000027
2056 Ga0501079_0035468
2057 Ga0501079_0050763
2058 Ga0501079_0051902
2059 Ga0501080_0013617
2060 Ga0501080_0025658
2061 Ga0501080_0036276
2062 Ga0501080_0036955
2063 Ga0501080_0069238
2064 Ga0501081_0015302
2065 Ga0501081_0023649
2066 Ga0501081_0046535
2067 Ga0501083_0008802
2068 Ga0501083_0030314
2069 Ga0501083_0085102
2070 Ga0501280_002654
2071 Ga0501035_0224906
2072 Ga0501045_0004429
2073 Ga0501045_0195914
2074 nmdc:mga03683_3263_c1
2075 nmdc:mga03n38_609_c1
2076 nmdc:mga00v17_121_c1
2077 nmdc:mga00v17_158_c1
2078 nmdc:mga00v17_1845_c1
2079 nmdc:mga0yw44_187_c1
2080 nmdc:mga0k408_40587_c1
2081 nmdc:mga0k408_5171_c2
2082 nmdc:mga06z11_622_c1
2083 nmdc:mga06z11_879_c1
2084 nmdc:mga07m45_456_c1
2085 nmdc:mga05p37_133_c1
2086 nmdc:mga05p37_1706_c1
2087 nmdc:mga05p37_8018_c1
2088 nmdc:mga09592_1764_c1
2089 nmdc:mga09592_26_c1
2090 nmdc:mga09592_40987_c1
2091 nmdc:mga0qj67_103581_c1
2092 nmdc:mga0qj67_165691_c1
2093 nmdc:mga0qj67_40531_c1
2094 nmdc:mga0qj67_43602_c1
2095 nmdc:mga0qj67_573_c1
2096 nmdc:mga06r32_1651_c1
2097 nmdc:mga06r32_169948_c1
2098 nmdc:mga06r32_22223_c1
2099 nmdc:mga06r32_40_c1
2100 nmdc:mga06r32_584_c1
2101 nmdc:mga08y16_19070_c1
2102 nmdc:mga08y16_232000_c1
2103 nmdc:mga08y16_27121_c1
2104 nmdc:mga0n895_182812_c1
2105 nmdc:mga0n895_338503_c1
2106 nmdc:mga0n895_61001_c1
2107 nmdc:mga0a205_247855_c1
2108 nmdc:mga0a205_61236_c1
2109 nmdc:mga0a205_65285_c1
2110 nmdc:mga0sz30_369_c2
2111 Ga0495601_0022354
2112 Ga0495601_0054667
2113 Ga0495612_0047257
2114 Ga0495595_0049803
2115 Ga0500643_013356
2116 Ga0500651_0000636
2117 Ga0500634_0000070
2118 Ga0501084_0007572
2119 Ga0501082_0004029
2120 Ga0501082_0028682
2121 Ga0501082_0044053
2122 Ga0501082_0099393
2123 Ga0501082_0248610
2124 Ga0530510_0000111
2125 Ga0530510_0004913
2126 Ga0530510_0048773
2127 2547375481
2128 2572255408
2129 2578458922
2130 2599945047
2131 2599955224
2132 2599983957
2133 2599990325
2134 2600001733
2135 2600048859
2136 2643881520
2137 2644662656
2138 2644698390
2139 2765578442
2140 2808857279
2141 2808905290
2142 2808926415
2143 2808937417
2144 2808948576
2145 2808965747
2146 2809000654
2147 2816516459
2148 2842781544
2149 2843691361
2150 2852651273
2151 2857446762
2152 2894414537
2153 2919498195
2154 2919516898
2155 2919675534
2156 2923517634
2157 2939590568
2158 2939622736
2159 2946007427
2160 2961067169
2161 2974309385
2162 2977250105
2163 2984515405
2164 2998344551
2165 8002869610
2166 8003016643
2167 8034966989
2168 8054732065

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

212

386

0.97

PF00919

UPF0004

Uncharacterized protein family UPF0004

65

165

0.96

PF01938

TRAM

TRAM domain

439

501

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.9139 19 447
7mjz-assembly1.cif.gz_A the structure of miab with pentasulfide bridge 0.906 19 449
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.8862 19 447
7mjz-assembly1.cif.gz_A the structure of miab with pentasulfide bridge 0.8795 19 449
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.8598 162 447
ID Description Score Start End Superfamily
af_P0AEI1_3_129_3.40.50.12160 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain 0.9977 19 145 3.40.50.12160
af_P0AEI1_378_440_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9971 384 447 2.40.50.140
af_P0AEI1_3_129_3.40.50.12160 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain 0.99 19 145 3.40.50.12160
af_P0AEI1_378_440_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9815 384 447 2.40.50.140
af_Q2FZ02_442_504_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9668 385 447 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2E2N0H9-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9952 17 137 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-A0A2M7XLY8-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9946 276 375 GO:0005829
GO:0035597
GO:0051539
AF-A0A6I5RNI4-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9932 17 196 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-A0A2N5ABG4-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9921 17 116 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-A0A2R7PI60-F1-model_v4 deleted 0.9902 17 122

Map