F489733
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1084 | 473 | 2168 | 448 |
Family's Representative Sequence
| Representative Sequence | 3300003781|Ga0055536_1003090|Ga0055536_10030902 |
| Length | 503 |
| Sequence | MDGYPAALPGCLPAHPTGISAMTGTPASTLPTSAGTAVPAIDSPRPDLLPLPGSRPQVAGPVRGKLYIKTHGCQMNEYDSGKMADVLAAEEGLELTDDPAEADVLLMNTCSIREKAQEKVFSQLGYWKALKNNGRGVIIGVGGCVASQEGEAIIKRAPHVDLVFGPQTLHRLPELIRQRRESGKSQVDISFPEIEKFDRLPEPRAEGGSAFVSIMEGCSKYCSFCVVPYTRGTEVSRPFEDVVVEVAQLAAQGVREINLLGQNVNAYRGPYGEGDVADLGLLIRTIAEIDGVDRIRFTTSHPLEFSDSLVDAYRDVPQLANFLHLPVQAGSDRVLSAMKRGYTALEFKARIRKLRAVRPDISISSDFIVGFPGETEADFEKTMKLIEDVGFDHSFSFIYSRRPGTPAADLEDTISDAEKHARLSRLQARINEQAAAISQAMIGTVQTVLVEGPSRRDPNELTGKTENMRSVNFPGQARLVGQLVDVEITEAYSNSLRGRLVVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 246 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 247 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 249 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 250 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 252 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 254 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 255 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 257 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 258 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 260 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 261 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 262 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 263 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 264 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 265 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 267 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 268 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 269 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 270 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 271 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 272 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 277 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 280 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 289 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 292 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 294 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 295 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 296 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 299 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 304 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 305 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 306 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 307 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 308 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 309 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 310 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 311 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 312 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 359 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 360 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 361 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 362 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 369 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 370 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 371 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 372 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 373 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 374 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 375 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 376 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 377 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 378 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 379 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 380 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 410 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 413 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 414 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 415 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 423 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 427 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 428 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 429 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 432 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 433 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 434 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 435 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 436 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 437 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 438 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 439 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 440 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 441 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 442 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 443 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 444 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 445 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 446 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 447 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 448 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 449 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 450 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 451 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 452 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 453 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 454 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 455 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 456 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 457 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 458 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 459 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 460 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 461 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 462 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 463 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 464 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 465 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 466 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 467 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 468 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 469 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 470 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 471 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 472 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 473 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.94 |
| Metatranscriptomes | 0.18 |
| Isolates | 3.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 9.13 |
| Nodule | 0.09 |
| Rhizoplane | 3.04 |
| Rhizosphere | 83.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055536_1003090 | 3300003781 | Bacteria | 9068 |
| 2 | JGI25162J39368_1000136 | 3300002737 | Bacteria | 79587 |
| 3 | JGI25164J39214_1000260 | 3300002772 | Bacteria | 39803 |
| 4 | JGI25152J39213_1000074 | 3300002773 | Bacteria | 66463 |
| 5 | JGI25150J39212_1000056 | 3300002774 | Bacteria | 66462 |
| 6 | JGI25151J46595_10000178 | 3300003187 | Bacteria | 80734 |
| 7 | JGI25151J46595_10000430 | 3300003187 | Bacteria | 41709 |
| 8 | JGI25165J46597_1000222 | 3300003214 | Bacteria | 79609 |
| 9 | JGI25153J46596_10000131 | 3300003215 | Bacteria | 80734 |
| 10 | Ga0055526_1000008 | 3300003771 | Bacteria | 300059 |
| 11 | Ga0055526_1001472 | 3300003771 | Bacteria | 16701 |
| 12 | Ga0055526_1013160 | 3300003771 | Bacteria | 3529 |
| 13 | Ga0055537_1000343 | 3300003773 | Bacteria | 31889 |
| 14 | Ga0055537_1000713 | 3300003773 | Bacteria | 17195 |
| 15 | Ga0055524_1001290 | 3300003775 | Bacteria | 14699 |
| 16 | Ga0055524_1008350 | 3300003775 | Bacteria | 4307 |
| 17 | Ga0055536_1005503 | 3300003781 | Bacteria | 6170 |
| 18 | Ga0055536_1006485 | 3300003781 | Bacteria | 5447 |
| 19 | Ga0055536_1006496 | 3300003781 | Bacteria | 5437 |
| 20 | Ga0055534_1000003 | 3300003784 | Bacteria | 300063 |
| 21 | Ga0055534_1000717 | 3300003784 | Bacteria | 16215 |
| 22 | Ga0055528_1000019 | 3300003790 | Bacteria | 149715 |
| 23 | Ga0055528_1003920 | 3300003790 | Bacteria | 7308 |
| 24 | Ga0055530_10000036 | 3300003791 | Bacteria | 117493 |
| 25 | Ga0055530_10002049 | 3300003791 | Bacteria | 13576 |
| 26 | Ga0055530_10002228 | 3300003791 | Bacteria | 12767 |
| 27 | Ga0055530_10003987 | 3300003791 | Bacteria | 7964 |
| 28 | Ga0055540_1000072 | 3300003792 | Bacteria | 117493 |
| 29 | Ga0055531_10001707 | 3300003794 | Bacteria | 15749 |
| 30 | Ga0055531_10004113 | 3300003794 | Bacteria | 8993 |
| 31 | Ga0055531_10007124 | 3300003794 | Bacteria | 6170 |
| 32 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 33 | Ga0065707_10003200 | 3300005295 | Bacteria | 4167 |
| 34 | Ga0070658_10015935 | 3300005327 | Bacteria | 6011 |
| 35 | Ga0070658_10038645 | 3300005327 | Bacteria | 3848 |
| 36 | Ga0070683_100004250 | 3300005329 | Bacteria | 11747 |
| 37 | Ga0070683_100013072 | 3300005329 | Bacteria | 7229 |
| 38 | Ga0070683_100027452 | 3300005329 | Bacteria | 5134 |
| 39 | Ga0070690_100003693 | 3300005330 | Bacteria | 8428 |
| 40 | Ga0070690_100007788 | 3300005330 | Bacteria | 6139 |
| 41 | Ga0070690_100020584 | 3300005330 | Bacteria | 4020 |
| 42 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 43 | Ga0070670_100006153 | 3300005331 | Bacteria | 10144 |
| 44 | Ga0070670_100009718 | 3300005331 | Bacteria | 8213 |
| 45 | Ga0070670_100084272 | 3300005331 | Bacteria | 2731 |
| 46 | Ga0070670_100119198 | 3300005331 | Bacteria | 2276 |
| 47 | Ga0070677_10015431 | 3300005333 | Bacteria | 2706 |
| 48 | Ga0068869_100011009 | 3300005334 | Bacteria | 5924 |
| 49 | Ga0068869_100027051 | 3300005334 | Bacteria | 3996 |
| 50 | Ga0068869_100043138 | 3300005334 | Bacteria | 3238 |
| 51 | Ga0068869_100053905 | 3300005334 | Bacteria | 2926 |
| 52 | Ga0068869_100069021 | 3300005334 | Bacteria | 2612 |
| 53 | Ga0070666_10004787 | 3300005335 | Bacteria | 8275 |
| 54 | Ga0070666_10007365 | 3300005335 | Bacteria | 6779 |
| 55 | Ga0070666_10010051 | 3300005335 | Bacteria | 5907 |
| 56 | Ga0070666_10016249 | 3300005335 | Bacteria | 4760 |
| 57 | Ga0070666_10017293 | 3300005335 | Bacteria | 4621 |
| 58 | Ga0070680_100035809 | 3300005336 | Bacteria | 4008 |
| 59 | Ga0070680_100096487 | 3300005336 | Bacteria | 2451 |
| 60 | Ga0070680_100156843 | 3300005336 | Bacteria | 1912 |
| 61 | Ga0070680_100205416 | 3300005336 | Bacteria | 1661 |
| 62 | Ga0070682_100000380 | 3300005337 | Bacteria | 29800 |
| 63 | Ga0068868_100004418 | 3300005338 | Bacteria | 9858 |
| 64 | Ga0068868_100014076 | 3300005338 | Bacteria | 5888 |
| 65 | Ga0068868_100041521 | 3300005338 | Bacteria | 3584 |
| 66 | Ga0068868_100063241 | 3300005338 | Bacteria | 2936 |
| 67 | Ga0070660_100028013 | 3300005339 | Bacteria | 4211 |
| 68 | Ga0070660_100066755 | 3300005339 | Bacteria | 2801 |
| 69 | Ga0070660_100079329 | 3300005339 | Bacteria | 2575 |
| 70 | Ga0070689_100006598 | 3300005340 | Bacteria | 8054 |
| 71 | Ga0070689_100008044 | 3300005340 | Bacteria | 7405 |
| 72 | Ga0070689_100008330 | 3300005340 | Bacteria | 7299 |
| 73 | Ga0070689_100019537 | 3300005340 | Bacteria | 5011 |
| 74 | Ga0070689_100026938 | 3300005340 | Bacteria | 4331 |
| 75 | Ga0070689_100041828 | 3300005340 | Bacteria | 3517 |
| 76 | Ga0070689_100057648 | 3300005340 | Bacteria | 3015 |
| 77 | Ga0070691_10053731 | 3300005341 | Bacteria | 1928 |
| 78 | Ga0070687_100006690 | 3300005343 | Bacteria | 4744 |
| 79 | Ga0070661_100004439 | 3300005344 | Bacteria | 9668 |
| 80 | Ga0070661_100007342 | 3300005344 | Bacteria | 7603 |
| 81 | Ga0070661_100020822 | 3300005344 | Bacteria | 4679 |
| 82 | Ga0070661_100028288 | 3300005344 | Bacteria | 4042 |
| 83 | Ga0070661_100040918 | 3300005344 | Bacteria | 3381 |
| 84 | Ga0070692_10003861 | 3300005345 | Bacteria | 6174 |
| 85 | Ga0070692_10006651 | 3300005345 | Bacteria | 5032 |
| 86 | Ga0070692_10034034 | 3300005345 | Bacteria | 2571 |
| 87 | Ga0070669_100004277 | 3300005353 | Bacteria | 10313 |
| 88 | Ga0070669_100076355 | 3300005353 | Bacteria | 2487 |
| 89 | Ga0070669_100103978 | 3300005353 | Bacteria | 2147 |
| 90 | Ga0070669_100114814 | 3300005353 | Bacteria | 2047 |
| 91 | Ga0070675_100009894 | 3300005354 | Bacteria | 7434 |
| 92 | Ga0070675_100088797 | 3300005354 | Bacteria | 2587 |
| 93 | Ga0070671_100000022 | 3300005355 | Bacteria | 124364 |
| 94 | Ga0070671_100002957 | 3300005355 | Bacteria | 13218 |
| 95 | Ga0070671_100018536 | 3300005355 | Bacteria | 5655 |
| 96 | Ga0070671_100022375 | 3300005355 | Bacteria | 5162 |
| 97 | Ga0070671_100076762 | 3300005355 | Bacteria | 2791 |
| 98 | Ga0070673_100001706 | 3300005364 | Bacteria | 13051 |
| 99 | Ga0070673_100011790 | 3300005364 | Bacteria | 5980 |
| 100 | Ga0070673_100012540 | 3300005364 | Bacteria | 5823 |
| 101 | Ga0070673_100031437 | 3300005364 | Bacteria | 3983 |
| 102 | Ga0070673_100036017 | 3300005364 | Bacteria | 3757 |
| 103 | Ga0070688_100000292 | 3300005365 | Bacteria | 25676 |
| 104 | Ga0070688_100000882 | 3300005365 | Bacteria | 14934 |
| 105 | Ga0070688_100039128 | 3300005365 | Bacteria | 2901 |
| 106 | Ga0070659_100013147 | 3300005366 | Bacteria | 6155 |
| 107 | Ga0070667_100000007 | 3300005367 | Bacteria | 292130 |
| 108 | Ga0070667_100000150 | 3300005367 | Bacteria | 86639 |
| 109 | Ga0070667_100026515 | 3300005367 | Bacteria | 4821 |
| 110 | Ga0070709_10001553 | 3300005434 | Bacteria | 12395 |
| 111 | Ga0070714_100000332 | 3300005435 | Bacteria | 35550 |
| 112 | Ga0070714_100229316 | 3300005435 | Bacteria | 1710 |
| 113 | Ga0070713_100003519 | 3300005436 | Bacteria | 10347 |
| 114 | Ga0070713_100003782 | 3300005436 | Bacteria | 10019 |
| 115 | Ga0070713_100024900 | 3300005436 | Bacteria | 4671 |
| 116 | Ga0070713_100032686 | 3300005436 | Bacteria | 4158 |
| 117 | Ga0070710_10004468 | 3300005437 | Bacteria | 6620 |
| 118 | Ga0070701_10000319 | 3300005438 | Bacteria | 15741 |
| 119 | Ga0070701_10044853 | 3300005438 | Bacteria | 2266 |
| 120 | Ga0070711_100005649 | 3300005439 | Bacteria | 7490 |
| 121 | Ga0070711_100011627 | 3300005439 | Bacteria | 5470 |
| 122 | Ga0070711_100163499 | 3300005439 | Bacteria | 1690 |
| 123 | Ga0070705_100017497 | 3300005440 | Bacteria | 3742 |
| 124 | Ga0070705_100027675 | 3300005440 | Bacteria | 3098 |
| 125 | Ga0070705_100099519 | 3300005440 | Bacteria | 1832 |
| 126 | Ga0070700_100002665 | 3300005441 | Bacteria | 9128 |
| 127 | Ga0070700_100138762 | 3300005441 | Bacteria | 1650 |
| 128 | Ga0070694_100038329 | 3300005444 | Bacteria | 3185 |
| 129 | Ga0070694_100041113 | 3300005444 | Bacteria | 3083 |
| 130 | Ga0070694_100057539 | 3300005444 | Bacteria | 2643 |
| 131 | Ga0070694_100066611 | 3300005444 | Bacteria | 2471 |
| 132 | Ga0070708_100054686 | 3300005445 | Bacteria | 3546 |
| 133 | Ga0070708_100090993 | 3300005445 | Bacteria | 2778 |
| 134 | Ga0070663_100003494 | 3300005455 | Bacteria | 9066 |
| 135 | Ga0070663_100013809 | 3300005455 | Bacteria | 5166 |
| 136 | Ga0070663_100107051 | 3300005455 | Bacteria | 2095 |
| 137 | Ga0070678_100001364 | 3300005456 | Bacteria | 12980 |
| 138 | Ga0070678_100001708 | 3300005456 | Bacteria | 11795 |
| 139 | Ga0070678_100006602 | 3300005456 | Bacteria | 6820 |
| 140 | Ga0070662_100005429 | 3300005457 | Bacteria | 8142 |
| 141 | Ga0070662_100035331 | 3300005457 | Bacteria | 3529 |
| 142 | Ga0070662_100050051 | 3300005457 | Bacteria | 3014 |
| 143 | Ga0070662_100156998 | 3300005457 | Bacteria | 1777 |
| 144 | Ga0070662_100159289 | 3300005457 | Bacteria | 1764 |
| 145 | Ga0070681_10002119 | 3300005458 | Bacteria | 18014 |
| 146 | Ga0070681_10005255 | 3300005458 | Bacteria | 12504 |
| 147 | Ga0070681_10210658 | 3300005458 | Bacteria | 1860 |
| 148 | Ga0068867_100026979 | 3300005459 | Bacteria | 4127 |
| 149 | Ga0070685_10000148 | 3300005466 | Bacteria | 45956 |
| 150 | Ga0070685_10001092 | 3300005466 | Bacteria | 14518 |
| 151 | Ga0070685_10020262 | 3300005466 | Bacteria | 3599 |
| 152 | Ga0070706_100161198 | 3300005467 | Bacteria | 2094 |
| 153 | Ga0070706_100221170 | 3300005467 | Bacteria | 1767 |
| 154 | Ga0070707_100031393 | 3300005468 | Bacteria | 5060 |
| 155 | Ga0070698_100105258 | 3300005471 | Bacteria | 2791 |
| 156 | Ga0070698_100111171 | 3300005471 | Bacteria | 2705 |
| 157 | Ga0070699_100022242 | 3300005518 | Bacteria | 5463 |
| 158 | Ga0070699_100147439 | 3300005518 | Bacteria | 2079 |
| 159 | Ga0070679_100044336 | 3300005530 | Bacteria | 4431 |
| 160 | Ga0070684_100008392 | 3300005535 | Bacteria | 8071 |
| 161 | Ga0070684_100020377 | 3300005535 | Bacteria | 5502 |
| 162 | Ga0070697_100003127 | 3300005536 | Bacteria | 12721 |
| 163 | Ga0070697_100087221 | 3300005536 | Bacteria | 2576 |
| 164 | Ga0070697_100110115 | 3300005536 | Bacteria | 2294 |
| 165 | Ga0068853_100001036 | 3300005539 | Bacteria | 19626 |
| 166 | Ga0068853_100002186 | 3300005539 | Bacteria | 14576 |
| 167 | Ga0068853_100142979 | 3300005539 | Bacteria | 2149 |
| 168 | Ga0070672_100001829 | 3300005543 | Bacteria | 13270 |
| 169 | Ga0070672_100002876 | 3300005543 | Bacteria | 11063 |
| 170 | Ga0070686_100000740 | 3300005544 | Bacteria | 18920 |
| 171 | Ga0070686_100011553 | 3300005544 | Bacteria | 5010 |
| 172 | Ga0070686_100018117 | 3300005544 | Bacteria | 4127 |
| 173 | Ga0070686_100059326 | 3300005544 | Bacteria | 2465 |
| 174 | Ga0070695_100016539 | 3300005545 | Bacteria | 4466 |
| 175 | Ga0070695_100028709 | 3300005545 | Bacteria | 3453 |
| 176 | Ga0070696_100090501 | 3300005546 | Bacteria | 2177 |
| 177 | Ga0070696_100090912 | 3300005546 | Bacteria | 2173 |
| 178 | Ga0070696_100141385 | 3300005546 | Bacteria | 1759 |
| 179 | Ga0070693_100000355 | 3300005547 | Bacteria | 20822 |
| 180 | Ga0070693_100018554 | 3300005547 | Bacteria | 3637 |
| 181 | Ga0070665_100002349 | 3300005548 | Bacteria | 20939 |
| 182 | Ga0070665_100015445 | 3300005548 | Bacteria | 7669 |
| 183 | Ga0070665_100020180 | 3300005548 | Bacteria | 6690 |
| 184 | Ga0070665_100024535 | 3300005548 | Bacteria | 6075 |
| 185 | Ga0070665_100055246 | 3300005548 | Bacteria | 3982 |
| 186 | Ga0070665_100084976 | 3300005548 | Bacteria | 3170 |
| 187 | Ga0070704_100005685 | 3300005549 | Bacteria | 7284 |
| 188 | Ga0070704_100033773 | 3300005549 | Bacteria | 3462 |
| 189 | Ga0070704_100051353 | 3300005549 | Bacteria | 2903 |
| 190 | Ga0070704_100191315 | 3300005549 | Bacteria | 1645 |
| 191 | Ga0068855_100008633 | 3300005563 | Bacteria | 12311 |
| 192 | Ga0068855_100009797 | 3300005563 | Bacteria | 11560 |
| 193 | Ga0068855_100023835 | 3300005563 | Bacteria | 7331 |
| 194 | Ga0068855_100039911 | 3300005563 | Bacteria | 5572 |
| 195 | Ga0068855_100082958 | 3300005563 | Bacteria | 3714 |
| 196 | Ga0070664_100002191 | 3300005564 | Bacteria | 15697 |
| 197 | Ga0070664_100002880 | 3300005564 | Bacteria | 13941 |
| 198 | Ga0070664_100008398 | 3300005564 | Bacteria | 8351 |
| 199 | Ga0070664_100017980 | 3300005564 | Bacteria | 5804 |
| 200 | Ga0070664_100063715 | 3300005564 | Bacteria | 3143 |
| 201 | Ga0070664_100208628 | 3300005564 | Bacteria | 1745 |
| 202 | Ga0068857_100003513 | 3300005577 | Bacteria | 13093 |
| 203 | Ga0068857_100017944 | 3300005577 | Bacteria | 6207 |
| 204 | Ga0068854_100011844 | 3300005578 | Bacteria | 5695 |
| 205 | Ga0068854_100019777 | 3300005578 | Bacteria | 4544 |
| 206 | Ga0068854_100039035 | 3300005578 | Bacteria | 3342 |
| 207 | Ga0068854_100053310 | 3300005578 | Bacteria | 2904 |
| 208 | Ga0068854_100124579 | 3300005578 | Bacteria | 1961 |
| 209 | Ga0068856_100005841 | 3300005614 | Bacteria | 12128 |
| 210 | Ga0068856_100033965 | 3300005614 | Bacteria | 4994 |
| 211 | Ga0068856_100137761 | 3300005614 | Bacteria | 2447 |
| 212 | Ga0070702_100002726 | 3300005615 | Bacteria | 7718 |
| 213 | Ga0070702_100006583 | 3300005615 | Bacteria | 5509 |
| 214 | Ga0070702_100047510 | 3300005615 | Bacteria | 2438 |
| 215 | Ga0068852_100001889 | 3300005616 | Bacteria | 14267 |
| 216 | Ga0068852_100010864 | 3300005616 | Bacteria | 6822 |
| 217 | Ga0068852_100232838 | 3300005616 | Bacteria | 1757 |
| 218 | Ga0068859_100010871 | 3300005617 | Bacteria | 9159 |
| 219 | Ga0068859_100083482 | 3300005617 | Bacteria | 3238 |
| 220 | Ga0068859_100155567 | 3300005617 | Bacteria | 2363 |
| 221 | Ga0068859_100160028 | 3300005617 | Bacteria | 2331 |
| 222 | Ga0068859_100208277 | 3300005617 | Bacteria | 2041 |
| 223 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 224 | Ga0068864_100005774 | 3300005618 | Bacteria | 10157 |
| 225 | Ga0068864_100014149 | 3300005618 | Bacteria | 6622 |
| 226 | Ga0068864_100019036 | 3300005618 | Bacteria | 5739 |
| 227 | Ga0068866_10001916 | 3300005718 | Bacteria | 8694 |
| 228 | Ga0068866_10003766 | 3300005718 | Bacteria | 6217 |
| 229 | Ga0068861_100002552 | 3300005719 | Bacteria | 11909 |
| 230 | Ga0068861_100005187 | 3300005719 | Bacteria | 8784 |
| 231 | Ga0068861_100006869 | 3300005719 | Bacteria | 7771 |
| 232 | Ga0068861_100007103 | 3300005719 | Bacteria | 7662 |
| 233 | Ga0068861_100042029 | 3300005719 | Bacteria | 3425 |
| 234 | Ga0068861_100058879 | 3300005719 | Bacteria | 2939 |
| 235 | Ga0068851_10000872 | 3300005834 | Bacteria | 13006 |
| 236 | Ga0068851_10008908 | 3300005834 | Bacteria | 4653 |
| 237 | Ga0068851_10009765 | 3300005834 | Bacteria | 4469 |
| 238 | Ga0068870_10006457 | 3300005840 | Bacteria | 5171 |
| 239 | Ga0068863_100009028 | 3300005841 | Bacteria | 9736 |
| 240 | Ga0068863_100010280 | 3300005841 | Bacteria | 9093 |
| 241 | Ga0068863_100021142 | 3300005841 | Bacteria | 6215 |
| 242 | Ga0068863_100095539 | 3300005841 | Bacteria | 2821 |
| 243 | Ga0068863_100174063 | 3300005841 | Bacteria | 2065 |
| 244 | Ga0068863_100222846 | 3300005841 | Bacteria | 1817 |
| 245 | Ga0068858_100002485 | 3300005842 | Bacteria | 18611 |
| 246 | Ga0068858_100007459 | 3300005842 | Bacteria | 10571 |
| 247 | Ga0068858_100007973 | 3300005842 | Bacteria | 10206 |
| 248 | Ga0068858_100027261 | 3300005842 | Bacteria | 5308 |
| 249 | Ga0068858_100060543 | 3300005842 | Bacteria | 3499 |
| 250 | Ga0068858_100065191 | 3300005842 | Bacteria | 3370 |
| 251 | Ga0068860_100001638 | 3300005843 | Bacteria | 24006 |
| 252 | Ga0068860_100013859 | 3300005843 | Bacteria | 7905 |
| 253 | Ga0068860_100030834 | 3300005843 | Bacteria | 5155 |
| 254 | Ga0068860_100110409 | 3300005843 | Bacteria | 2628 |
| 255 | Ga0068862_100000452 | 3300005844 | Bacteria | 44564 |
| 256 | Ga0068862_100006537 | 3300005844 | Bacteria | 9673 |
| 257 | Ga0068862_100009412 | 3300005844 | Bacteria | 8081 |
| 258 | Ga0068862_100014383 | 3300005844 | Bacteria | 6565 |
| 259 | Ga0068862_100043953 | 3300005844 | Bacteria | 3810 |
| 260 | Ga0068862_100062042 | 3300005844 | Bacteria | 3214 |
| 261 | Ga0068862_100091519 | 3300005844 | Bacteria | 2649 |
| 262 | Ga0068862_100124290 | 3300005844 | Bacteria | 2277 |
| 263 | Ga0081538_10073395 | 3300005981 | Bacteria | 1870 |
| 264 | Ga0081540_1004336 | 3300005983 | Bacteria | 10868 |
| 265 | Ga0075365_10000122 | 3300006038 | Bacteria | 23481 |
| 266 | Ga0075363_100001163 | 3300006048 | Bacteria | 9653 |
| 267 | Ga0075364_10000213 | 3300006051 | Bacteria | 27332 |
| 268 | Ga0075364_10000562 | 3300006051 | Bacteria | 19043 |
| 269 | Ga0070715_10014203 | 3300006163 | Bacteria | 2944 |
| 270 | Ga0070716_100001077 | 3300006173 | Bacteria | 11962 |
| 271 | Ga0070716_100019418 | 3300006173 | Bacteria | 3552 |
| 272 | Ga0070712_100040974 | 3300006175 | Bacteria | 3177 |
| 273 | Ga0075367_10001536 | 3300006178 | Bacteria | 9978 |
| 274 | Ga0075369_10000212 | 3300006186 | Bacteria | 17155 |
| 275 | Ga0097621_100002878 | 3300006237 | Bacteria | 11808 |
| 276 | Ga0097621_100028624 | 3300006237 | Bacteria | 4392 |
| 277 | Ga0075370_10032942 | 3300006353 | Bacteria | 2899 |
| 278 | Ga0068871_100006555 | 3300006358 | Bacteria | 8249 |
| 279 | Ga0068871_100008816 | 3300006358 | Bacteria | 7265 |
| 280 | Ga0068871_100027588 | 3300006358 | Bacteria | 4442 |
| 281 | Ga0075428_100000982 | 3300006844 | Bacteria | 30234 |
| 282 | Ga0075428_100002975 | 3300006844 | Bacteria | 18464 |
| 283 | Ga0075430_100000566 | 3300006846 | Bacteria | 28123 |
| 284 | Ga0075430_100011327 | 3300006846 | Bacteria | 7564 |
| 285 | Ga0075430_100022826 | 3300006846 | Bacteria | 5321 |
| 286 | Ga0075430_100030371 | 3300006846 | Bacteria | 4589 |
| 287 | Ga0075430_100145781 | 3300006846 | Bacteria | 1972 |
| 288 | Ga0075430_100163607 | 3300006846 | Bacteria | 1852 |
| 289 | Ga0075431_100002345 | 3300006847 | Bacteria | 18184 |
| 290 | Ga0075431_100002432 | 3300006847 | Bacteria | 17917 |
| 291 | Ga0075431_100035882 | 3300006847 | Bacteria | 5105 |
| 292 | Ga0075431_100120469 | 3300006847 | Bacteria | 2707 |
| 293 | Ga0075433_10054163 | 3300006852 | Bacteria | 3499 |
| 294 | Ga0075434_100009366 | 3300006871 | Bacteria | 9130 |
| 295 | Ga0075434_100105823 | 3300006871 | Bacteria | 2823 |
| 296 | Ga0075434_100157039 | 3300006871 | Bacteria | 2294 |
| 297 | Ga0075429_100000015 | 3300006880 | Bacteria | 78823 |
| 298 | Ga0075429_100000217 | 3300006880 | Bacteria | 38727 |
| 299 | Ga0075429_100024442 | 3300006880 | Bacteria | 5242 |
| 300 | Ga0075429_100049651 | 3300006880 | Bacteria | 3649 |
| 301 | Ga0068865_100005740 | 3300006881 | Bacteria | 7543 |
| 302 | Ga0068865_100063933 | 3300006881 | Bacteria | 2588 |
| 303 | Ga0075436_100065816 | 3300006914 | Bacteria | 2504 |
| 304 | Ga0075436_100137968 | 3300006914 | Bacteria | 1713 |
| 305 | Ga0097620_100010870 | 3300006931 | Bacteria | 9159 |
| 306 | Ga0097620_100083480 | 3300006931 | Bacteria | 3238 |
| 307 | Ga0097620_100155574 | 3300006931 | Bacteria | 2363 |
| 308 | Ga0097620_100160027 | 3300006931 | Bacteria | 2331 |
| 309 | Ga0097620_100208260 | 3300006931 | Bacteria | 2041 |
| 310 | Ga0075435_100062780 | 3300007076 | Bacteria | 3016 |
| 311 | Ga0075435_100103983 | 3300007076 | Bacteria | 2356 |
| 312 | Ga0099794_10001346 | 3300007265 | Bacteria | 8525 |
| 313 | Ga0105251_10025919 | 3300009011 | Bacteria | 2991 |
| 314 | Ga0105240_10002074 | 3300009093 | Bacteria | 32842 |
| 315 | Ga0105240_10007281 | 3300009093 | Bacteria | 16108 |
| 316 | Ga0105240_10014161 | 3300009093 | Bacteria | 10895 |
| 317 | Ga0105240_10073166 | 3300009093 | Bacteria | 4233 |
| 318 | Ga0105240_10321353 | 3300009093 | Bacteria | 1764 |
| 319 | Ga0111539_10002751 | 3300009094 | Bacteria | 23328 |
| 320 | Ga0111539_10002953 | 3300009094 | Bacteria | 22574 |
| 321 | Ga0111539_10058516 | 3300009094 | Bacteria | 4572 |
| 322 | Ga0111539_10081464 | 3300009094 | Bacteria | 3807 |
| 323 | Ga0111539_10124594 | 3300009094 | Bacteria | 3020 |
| 324 | Ga0111539_10393720 | 3300009094 | Bacteria | 1614 |
| 325 | Ga0105245_10004129 | 3300009098 | Bacteria | 12897 |
| 326 | Ga0105245_10008792 | 3300009098 | Bacteria | 8809 |
| 327 | Ga0105245_10051378 | 3300009098 | Bacteria | 3696 |
| 328 | Ga0105245_10266813 | 3300009098 | Bacteria | 1668 |
| 329 | Ga0105247_10005141 | 3300009101 | Bacteria | 8280 |
| 330 | Ga0105247_10017181 | 3300009101 | Bacteria | 4342 |
| 331 | Ga0114129_10000248 | 3300009147 | Bacteria | 60807 |
| 332 | Ga0114129_10041162 | 3300009147 | Bacteria | 6512 |
| 333 | Ga0105243_10003141 | 3300009148 | Bacteria | 13568 |
| 334 | Ga0105243_10011531 | 3300009148 | Bacteria | 6687 |
| 335 | Ga0105243_10065919 | 3300009148 | Bacteria | 2911 |
| 336 | Ga0105241_10116676 | 3300009174 | Bacteria | 2144 |
| 337 | Ga0105241_10125335 | 3300009174 | Unclassified | 2073 |
| 338 | Ga0105242_10002322 | 3300009176 | Bacteria | 15001 |
| 339 | Ga0105242_10005056 | 3300009176 | Bacteria | 10185 |
| 340 | Ga0105242_10014096 | 3300009176 | Bacteria | 6189 |
| 341 | Ga0105248_10000246 | 3300009177 | Bacteria | 62735 |
| 342 | Ga0105248_10010195 | 3300009177 | Bacteria | 10348 |
| 343 | Ga0105248_10039245 | 3300009177 | Bacteria | 5302 |
| 344 | Ga0105248_10110131 | 3300009177 | Bacteria | 3105 |
| 345 | Ga0105248_10229774 | 3300009177 | Bacteria | 2088 |
| 346 | Ga0105248_10315134 | 3300009177 | Bacteria | 1762 |
| 347 | Ga0105237_10000231 | 3300009545 | Bacteria | 79368 |
| 348 | Ga0105237_10026395 | 3300009545 | Bacteria | 5936 |
| 349 | Ga0105237_10059158 | 3300009545 | Bacteria | 3834 |
| 350 | Ga0105237_10136504 | 3300009545 | Bacteria | 2447 |
| 351 | Ga0105238_10035805 | 3300009551 | Bacteria | 5045 |
| 352 | Ga0105238_10043127 | 3300009551 | Bacteria | 4565 |
| 353 | Ga0105249_10005115 | 3300009553 | Bacteria | 11306 |
| 354 | Ga0105249_10006419 | 3300009553 | Bacteria | 10222 |
| 355 | Ga0105249_10012784 | 3300009553 | Bacteria | 7403 |
| 356 | Ga0105249_10012863 | 3300009553 | Bacteria | 7385 |
| 357 | Ga0105249_10013252 | 3300009553 | Bacteria | 7276 |
| 358 | Ga0105249_10179243 | 3300009553 | Bacteria | 2060 |
| 359 | Ga0099796_10024514 | 3300010159 | Bacteria | 1895 |
| 360 | Ga0105239_10005689 | 3300010375 | Bacteria | 14562 |
| 361 | Ga0105239_10109140 | 3300010375 | Bacteria | 3066 |
| 362 | Ga0157373_10001374 | 3300013100 | Bacteria | 18676 |
| 363 | Ga0157371_10000429 | 3300013102 | Bacteria | 51605 |
| 364 | Ga0157371_10007777 | 3300013102 | Bacteria | 8615 |
| 365 | Ga0157371_10014829 | 3300013102 | Bacteria | 5868 |
| 366 | Ga0157370_10012042 | 3300013104 | Bacteria | 9003 |
| 367 | Ga0157370_10049463 | 3300013104 | Bacteria | 4023 |
| 368 | Ga0157374_10014292 | 3300013296 | Bacteria | 6946 |
| 369 | Ga0157374_10016690 | 3300013296 | Bacteria | 6458 |
| 370 | Ga0157374_10035124 | 3300013296 | Bacteria | 4585 |
| 371 | Ga0157374_10053996 | 3300013296 | Bacteria | 3747 |
| 372 | Ga0157378_10013710 | 3300013297 | Bacteria | 7088 |
| 373 | Ga0157378_10016375 | 3300013297 | Bacteria | 6491 |
| 374 | Ga0157378_10022130 | 3300013297 | Bacteria | 5594 |
| 375 | Ga0157378_10045867 | 3300013297 | Bacteria | 3885 |
| 376 | Ga0157378_10046570 | 3300013297 | Bacteria | 3854 |
| 377 | Ga0157378_10133048 | 3300013297 | Bacteria | 2304 |
| 378 | Ga0157378_10198705 | 3300013297 | Bacteria | 1895 |
| 379 | Ga0163162_10072809 | 3300013306 | Bacteria | 3491 |
| 380 | Ga0163162_10374648 | 3300013306 | Bacteria | 1557 |
| 381 | Ga0157372_10004213 | 3300013307 | Bacteria | 15389 |
| 382 | Ga0157372_10015001 | 3300013307 | Bacteria | 8292 |
| 383 | Ga0157372_10021657 | 3300013307 | Bacteria | 6948 |
| 384 | Ga0157372_10266499 | 3300013307 | Bacteria | 1989 |
| 385 | Ga0157375_10109230 | 3300013308 | Bacteria | 2862 |
| 386 | Ga0157375_10135352 | 3300013308 | Bacteria | 2587 |
| 387 | Ga0163163_10000835 | 3300014325 | Bacteria | 26202 |
| 388 | Ga0163163_10018597 | 3300014325 | Bacteria | 6509 |
| 389 | Ga0163163_10054458 | 3300014325 | Bacteria | 3952 |
| 390 | Ga0163163_10168564 | 3300014325 | Bacteria | 2236 |
| 391 | Ga0157380_10015682 | 3300014326 | Bacteria | 5571 |
| 392 | Ga0157380_10281250 | 3300014326 | Unclassified | 1522 |
| 393 | Ga0182008_10000269 | 3300014497 | Bacteria | 40734 |
| 394 | Ga0157377_10001111 | 3300014745 | Bacteria | 11384 |
| 395 | Ga0157377_10002019 | 3300014745 | Bacteria | 8896 |
| 396 | Ga0157377_10014693 | 3300014745 | Bacteria | 3988 |
| 397 | Ga0157379_10005419 | 3300014968 | Bacteria | 10960 |
| 398 | Ga0157379_10066007 | 3300014968 | Bacteria | 3235 |
| 399 | Ga0157376_10002756 | 3300014969 | Bacteria | 12000 |
| 400 | Ga0157376_10003114 | 3300014969 | Bacteria | 11397 |
| 401 | Ga0157376_10013527 | 3300014969 | Bacteria | 6092 |
| 402 | Ga0157376_10111927 | 3300014969 | Bacteria | 2404 |
| 403 | Ga0182006_1007044 | 3300015261 | Bacteria | 5172 |
| 404 | Ga0182007_10000127 | 3300015262 | Bacteria | 53385 |
| 405 | Ga0182005_1000168 | 3300015265 | Bacteria | 45063 |
| 406 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 407 | Ga0163161_10044445 | 3300017792 | Bacteria | 3199 |
| 408 | Ga0163161_10109759 | 3300017792 | Bacteria | 2061 |
| 409 | Ga0213876_10039093 | 3300021384 | Bacteria | 2506 |
| 410 | Ga0209760_100058 | 3300025207 | Bacteria | 98827 |
| 411 | Ga0207427_100063 | 3300025231 | Bacteria | 177711 |
| 412 | Ga0209437_100133 | 3300025233 | Bacteria | 178493 |
| 413 | Ga0207425_1000108 | 3300025245 | Bacteria | 77709 |
| 414 | Ga0207425_1004437 | 3300025245 | Bacteria | 4207 |
| 415 | Ga0209129_1000178 | 3300025258 | Bacteria | 92006 |
| 416 | Ga0209233_1000133 | 3300025261 | Bacteria | 202716 |
| 417 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 418 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 419 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 420 | Ga0209673_1000570 | 3300025273 | Bacteria | 58750 |
| 421 | Ga0209130_1003922 | 3300025284 | Bacteria | 5961 |
| 422 | Ga0209130_1017144 | 3300025284 | Bacteria | 1734 |
| 423 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 424 | Ga0209675_1000021 | 3300025291 | Bacteria | 334833 |
| 425 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 426 | Ga0209676_1000047 | 3300025292 | Bacteria | 408645 |
| 427 | Ga0209676_1000079 | 3300025292 | Bacteria | 290447 |
| 428 | Ga0209676_1001090 | 3300025292 | Bacteria | 30462 |
| 429 | Ga0209676_1007037 | 3300025292 | Bacteria | 5397 |
| 430 | Ga0209676_1007436 | 3300025292 | Bacteria | 5143 |
| 431 | Ga0209676_1010731 | 3300025292 | Bacteria | 3775 |
| 432 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 433 | Ga0209025_1000102 | 3300025294 | Bacteria | 228393 |
| 434 | Ga0209025_1003190 | 3300025294 | Bacteria | 15903 |
| 435 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 436 | Ga0209564_1000263 | 3300025295 | Bacteria | 112148 |
| 437 | Ga0209758_1000018 | 3300025297 | Bacteria | 753320 |
| 438 | Ga0209758_1021599 | 3300025297 | Bacteria | 2994 |
| 439 | Ga0209050_1000080 | 3300025298 | Bacteria | 275154 |
| 440 | Ga0209050_1000153 | 3300025298 | Bacteria | 160851 |
| 441 | Ga0209050_1000311 | 3300025298 | Bacteria | 98948 |
| 442 | Ga0209050_1002761 | 3300025298 | Bacteria | 14119 |
| 443 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 444 | Ga0209256_1002605 | 3300025299 | Bacteria | 14307 |
| 445 | Ga0209256_1002692 | 3300025299 | Bacteria | 13883 |
| 446 | Ga0209256_1004733 | 3300025299 | Bacteria | 8322 |
| 447 | Ga0209051_1000082 | 3300025303 | Bacteria | 193133 |
| 448 | Ga0209051_1006455 | 3300025303 | Bacteria | 6603 |
| 449 | Ga0209257_1000081 | 3300025304 | Bacteria | 306577 |
| 450 | Ga0209257_1000274 | 3300025304 | Bacteria | 117076 |
| 451 | Ga0209257_1000664 | 3300025304 | Bacteria | 54069 |
| 452 | Ga0209257_1001912 | 3300025304 | Bacteria | 22505 |
| 453 | Ga0209257_1002586 | 3300025304 | Bacteria | 17596 |
| 454 | Ga0209257_1007820 | 3300025304 | Bacteria | 6329 |
| 455 | Ga0209257_1009194 | 3300025304 | Bacteria | 5368 |
| 456 | Ga0207697_10000149 | 3300025315 | Bacteria | 34272 |
| 457 | Ga0207697_10020793 | 3300025315 | Bacteria | 2686 |
| 458 | Ga0207656_10003769 | 3300025321 | Bacteria | 5249 |
| 459 | Ga0207656_10012278 | 3300025321 | Bacteria | 3254 |
| 460 | Ga0207655_1033072 | 3300025728 | Bacteria | 2351 |
| 461 | Ga0207682_10000459 | 3300025893 | Bacteria | 18829 |
| 462 | Ga0207642_10001236 | 3300025899 | Bacteria | 7908 |
| 463 | Ga0207710_10027304 | 3300025900 | Bacteria | 2471 |
| 464 | Ga0207688_10001830 | 3300025901 | Bacteria | 11341 |
| 465 | Ga0207688_10007340 | 3300025901 | Bacteria | 5999 |
| 466 | Ga0207680_10036342 | 3300025903 | Bacteria | 2836 |
| 467 | Ga0207685_10045386 | 3300025905 | Bacteria | 1666 |
| 468 | Ga0207645_10001936 | 3300025907 | Bacteria | 16708 |
| 469 | Ga0207645_10100063 | 3300025907 | Bacteria | 1870 |
| 470 | Ga0207643_10000257 | 3300025908 | Bacteria | 36775 |
| 471 | Ga0207643_10002766 | 3300025908 | Bacteria | 9480 |
| 472 | Ga0207643_10009427 | 3300025908 | Bacteria | 5246 |
| 473 | Ga0207643_10043792 | 3300025908 | Bacteria | 2526 |
| 474 | Ga0207643_10047912 | 3300025908 | Bacteria | 2420 |
| 475 | Ga0207707_10010165 | 3300025912 | Bacteria | 8167 |
| 476 | Ga0207707_10012870 | 3300025912 | Bacteria | 7282 |
| 477 | Ga0207707_10048090 | 3300025912 | Bacteria | 3715 |
| 478 | Ga0207695_10001882 | 3300025913 | Bacteria | 32824 |
| 479 | Ga0207695_10006211 | 3300025913 | Bacteria | 15562 |
| 480 | Ga0207695_10011988 | 3300025913 | Bacteria | 10431 |
| 481 | Ga0207695_10015440 | 3300025913 | Bacteria | 8991 |
| 482 | Ga0207695_10207552 | 3300025913 | Bacteria | 1871 |
| 483 | Ga0207671_10008456 | 3300025914 | Bacteria | 8726 |
| 484 | Ga0207693_10002740 | 3300025915 | Bacteria | 15256 |
| 485 | Ga0207693_10020534 | 3300025915 | Bacteria | 5252 |
| 486 | Ga0207663_10005447 | 3300025916 | Bacteria | 6413 |
| 487 | Ga0207663_10018487 | 3300025916 | Bacteria | 3907 |
| 488 | Ga0207660_10027866 | 3300025917 | Bacteria | 3860 |
| 489 | Ga0207660_10033993 | 3300025917 | Bacteria | 3530 |
| 490 | Ga0207660_10124814 | 3300025917 | Bacteria | 1954 |
| 491 | Ga0207662_10009238 | 3300025918 | Bacteria | 5418 |
| 492 | Ga0207662_10012415 | 3300025918 | Bacteria | 4744 |
| 493 | Ga0207662_10024694 | 3300025918 | Bacteria | 3459 |
| 494 | Ga0207662_10085548 | 3300025918 | Bacteria | 1931 |
| 495 | Ga0207657_10001446 | 3300025919 | Bacteria | 25420 |
| 496 | Ga0207657_10017013 | 3300025919 | Bacteria | 6995 |
| 497 | Ga0207657_10051076 | 3300025919 | Bacteria | 3595 |
| 498 | Ga0207657_10113044 | 3300025919 | Bacteria | 2241 |
| 499 | Ga0207649_10023500 | 3300025920 | Bacteria | 3571 |
| 500 | Ga0207649_10067791 | 3300025920 | Bacteria | 2267 |
| 501 | Ga0207649_10102326 | 3300025920 | Bacteria | 1898 |
| 502 | Ga0207652_10018305 | 3300025921 | Bacteria | 5745 |
| 503 | Ga0207652_10215803 | 3300025921 | Bacteria | 1728 |
| 504 | Ga0207646_10105596 | 3300025922 | Bacteria | 2526 |
| 505 | Ga0207646_10154480 | 3300025922 | Bacteria | 2070 |
| 506 | Ga0207646_10176713 | 3300025922 | Bacteria | 1928 |
| 507 | Ga0207681_10003243 | 3300025923 | Bacteria | 10199 |
| 508 | Ga0207681_10008178 | 3300025923 | Bacteria | 6396 |
| 509 | Ga0207681_10011656 | 3300025923 | Bacteria | 5405 |
| 510 | Ga0207681_10034434 | 3300025923 | Bacteria | 3330 |
| 511 | Ga0207681_10066205 | 3300025923 | Bacteria | 2500 |
| 512 | Ga0207681_10073914 | 3300025923 | Bacteria | 2386 |
| 513 | Ga0207694_10026021 | 3300025924 | Bacteria | 4449 |
| 514 | Ga0207694_10095594 | 3300025924 | Bacteria | 2349 |
| 515 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 516 | Ga0207650_10001825 | 3300025925 | Bacteria | 15046 |
| 517 | Ga0207650_10002621 | 3300025925 | Bacteria | 12446 |
| 518 | Ga0207650_10085318 | 3300025925 | Bacteria | 2402 |
| 519 | Ga0207659_10003990 | 3300025926 | Bacteria | 8905 |
| 520 | Ga0207659_10014471 | 3300025926 | Bacteria | 5090 |
| 521 | Ga0207659_10071353 | 3300025926 | Bacteria | 2536 |
| 522 | Ga0207687_10006961 | 3300025927 | Bacteria | 7450 |
| 523 | Ga0207687_10026690 | 3300025927 | Bacteria | 3870 |
| 524 | Ga0207700_10003571 | 3300025928 | Bacteria | 9059 |
| 525 | Ga0207700_10020142 | 3300025928 | Bacteria | 4522 |
| 526 | Ga0207664_10000325 | 3300025929 | Bacteria | 35400 |
| 527 | Ga0207664_10003311 | 3300025929 | Bacteria | 10715 |
| 528 | Ga0207664_10100168 | 3300025929 | Bacteria | 2392 |
| 529 | Ga0207644_10000037 | 3300025931 | Bacteria | 124306 |
| 530 | Ga0207644_10002823 | 3300025931 | Bacteria | 11196 |
| 531 | Ga0207644_10003679 | 3300025931 | Bacteria | 9942 |
| 532 | Ga0207644_10032756 | 3300025931 | Bacteria | 3628 |
| 533 | Ga0207644_10071271 | 3300025931 | Bacteria | 2542 |
| 534 | Ga0207690_10133711 | 3300025932 | Bacteria | 1819 |
| 535 | Ga0207706_10000775 | 3300025933 | Bacteria | 33144 |
| 536 | Ga0207706_10007089 | 3300025933 | Bacteria | 10368 |
| 537 | Ga0207706_10041143 | 3300025933 | Bacteria | 4098 |
| 538 | Ga0207706_10108387 | 3300025933 | Bacteria | 2444 |
| 539 | Ga0207706_10181447 | 3300025933 | Bacteria | 1849 |
| 540 | Ga0207686_10004363 | 3300025934 | Bacteria | 7582 |
| 541 | Ga0207686_10012082 | 3300025934 | Bacteria | 4743 |
| 542 | Ga0207686_10036442 | 3300025934 | Bacteria | 2962 |
| 543 | Ga0207686_10043800 | 3300025934 | Bacteria | 2744 |
| 544 | Ga0207686_10109420 | 3300025934 | Bacteria | 1861 |
| 545 | Ga0207709_10000930 | 3300025935 | Bacteria | 22057 |
| 546 | Ga0207709_10007789 | 3300025935 | Bacteria | 5938 |
| 547 | Ga0207709_10029160 | 3300025935 | Bacteria | 3197 |
| 548 | Ga0207670_10009955 | 3300025936 | Bacteria | 5450 |
| 549 | Ga0207670_10055151 | 3300025936 | Bacteria | 2685 |
| 550 | Ga0207669_10009438 | 3300025937 | Bacteria | 4646 |
| 551 | Ga0207669_10031724 | 3300025937 | Bacteria | 2956 |
| 552 | Ga0207669_10168456 | 3300025937 | Bacteria | 1556 |
| 553 | Ga0207704_10001220 | 3300025938 | Bacteria | 11452 |
| 554 | Ga0207704_10005871 | 3300025938 | Bacteria | 5684 |
| 555 | Ga0207704_10017993 | 3300025938 | Bacteria | 3678 |
| 556 | Ga0207704_10024054 | 3300025938 | Bacteria | 3295 |
| 557 | Ga0207665_10003114 | 3300025939 | Bacteria | 11122 |
| 558 | Ga0207691_10001095 | 3300025940 | Bacteria | 26926 |
| 559 | Ga0207691_10001701 | 3300025940 | Bacteria | 21735 |
| 560 | Ga0207691_10003722 | 3300025940 | Bacteria | 14796 |
| 561 | Ga0207691_10005811 | 3300025940 | Bacteria | 11937 |
| 562 | Ga0207691_10025607 | 3300025940 | Bacteria | 5538 |
| 563 | Ga0207691_10046818 | 3300025940 | Bacteria | 3972 |
| 564 | Ga0207691_10142642 | 3300025940 | Bacteria | 2110 |
| 565 | Ga0207711_10000782 | 3300025941 | Bacteria | 31251 |
| 566 | Ga0207711_10003291 | 3300025941 | Bacteria | 14044 |
| 567 | Ga0207711_10003296 | 3300025941 | Bacteria | 14031 |
| 568 | Ga0207711_10006050 | 3300025941 | Bacteria | 10224 |
| 569 | Ga0207711_10064392 | 3300025941 | Bacteria | 3166 |
| 570 | Ga0207689_10000474 | 3300025942 | Bacteria | 37756 |
| 571 | Ga0207689_10002613 | 3300025942 | Bacteria | 16674 |
| 572 | Ga0207689_10003706 | 3300025942 | Bacteria | 13935 |
| 573 | Ga0207689_10030707 | 3300025942 | Bacteria | 4477 |
| 574 | Ga0207689_10038779 | 3300025942 | Bacteria | 3944 |
| 575 | Ga0207661_10036429 | 3300025944 | Bacteria | 3840 |
| 576 | Ga0207661_10070183 | 3300025944 | Bacteria | 2859 |
| 577 | Ga0207661_10166349 | 3300025944 | Bacteria | 1917 |
| 578 | Ga0207679_10037767 | 3300025945 | Bacteria | 3436 |
| 579 | Ga0207679_10051272 | 3300025945 | Bacteria | 3020 |
| 580 | Ga0207667_10004596 | 3300025949 | Bacteria | 16930 |
| 581 | Ga0207667_10055847 | 3300025949 | Bacteria | 4149 |
| 582 | Ga0207667_10144569 | 3300025949 | Bacteria | 2448 |
| 583 | Ga0207667_10187414 | 3300025949 | Bacteria | 2123 |
| 584 | Ga0207651_10002306 | 3300025960 | Bacteria | 9083 |
| 585 | Ga0207651_10014477 | 3300025960 | Bacteria | 4557 |
| 586 | Ga0207651_10015257 | 3300025960 | Bacteria | 4460 |
| 587 | Ga0207651_10032842 | 3300025960 | Bacteria | 3339 |
| 588 | Ga0207712_10000314 | 3300025961 | Bacteria | 44397 |
| 589 | Ga0207712_10010887 | 3300025961 | Bacteria | 5789 |
| 590 | Ga0207712_10058562 | 3300025961 | Bacteria | 2723 |
| 591 | Ga0207712_10113733 | 3300025961 | Bacteria | 2035 |
| 592 | Ga0207712_10131469 | 3300025961 | Bacteria | 1908 |
| 593 | Ga0207640_10007253 | 3300025981 | Bacteria | 6115 |
| 594 | Ga0207640_10007928 | 3300025981 | Bacteria | 5861 |
| 595 | Ga0207640_10069786 | 3300025981 | Bacteria | 2361 |
| 596 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 597 | Ga0207658_10000013 | 3300025986 | Bacteria | 220396 |
| 598 | Ga0207658_10006563 | 3300025986 | Bacteria | 7935 |
| 599 | Ga0207658_10022252 | 3300025986 | Bacteria | 4413 |
| 600 | Ga0207677_10000390 | 3300026023 | Bacteria | 30230 |
| 601 | Ga0207677_10045330 | 3300026023 | Bacteria | 2936 |
| 602 | Ga0207703_10002767 | 3300026035 | Bacteria | 15018 |
| 603 | Ga0207703_10009021 | 3300026035 | Bacteria | 7854 |
| 604 | Ga0207703_10013439 | 3300026035 | Bacteria | 6377 |
| 605 | Ga0207703_10016031 | 3300026035 | Bacteria | 5844 |
| 606 | Ga0207703_10017347 | 3300026035 | Bacteria | 5620 |
| 607 | Ga0207639_10000791 | 3300026041 | Bacteria | 21545 |
| 608 | Ga0207639_10001337 | 3300026041 | Bacteria | 16645 |
| 609 | Ga0207639_10002604 | 3300026041 | Bacteria | 12099 |
| 610 | Ga0207639_10006184 | 3300026041 | Bacteria | 8131 |
| 611 | Ga0207678_10000306 | 3300026067 | Bacteria | 44067 |
| 612 | Ga0207678_10001020 | 3300026067 | Bacteria | 25550 |
| 613 | Ga0207678_10007277 | 3300026067 | Bacteria | 9810 |
| 614 | Ga0207678_10092442 | 3300026067 | Bacteria | 2586 |
| 615 | Ga0207708_10000382 | 3300026075 | Bacteria | 34635 |
| 616 | Ga0207708_10001552 | 3300026075 | Bacteria | 17143 |
| 617 | Ga0207708_10008147 | 3300026075 | Bacteria | 7761 |
| 618 | Ga0207708_10070029 | 3300026075 | Bacteria | 2686 |
| 619 | Ga0207708_10072844 | 3300026075 | Bacteria | 2632 |
| 620 | Ga0207702_10022168 | 3300026078 | Bacteria | 5263 |
| 621 | Ga0207702_10101256 | 3300026078 | Bacteria | 2543 |
| 622 | Ga0207641_10008134 | 3300026088 | Bacteria | 8684 |
| 623 | Ga0207641_10010582 | 3300026088 | Bacteria | 7568 |
| 624 | Ga0207641_10039494 | 3300026088 | Bacteria | 3947 |
| 625 | Ga0207641_10047478 | 3300026088 | Bacteria | 3621 |
| 626 | Ga0207641_10079119 | 3300026088 | Bacteria | 2849 |
| 627 | Ga0207641_10130049 | 3300026088 | Bacteria | 2259 |
| 628 | Ga0207641_10202846 | 3300026088 | Bacteria | 1829 |
| 629 | Ga0207648_10001543 | 3300026089 | Bacteria | 25355 |
| 630 | Ga0207648_10004782 | 3300026089 | Bacteria | 13831 |
| 631 | Ga0207648_10011595 | 3300026089 | Bacteria | 8299 |
| 632 | Ga0207648_10023419 | 3300026089 | Bacteria | 5531 |
| 633 | Ga0207648_10040757 | 3300026089 | Bacteria | 4080 |
| 634 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 635 | Ga0207676_10004850 | 3300026095 | Bacteria | 9524 |
| 636 | Ga0207676_10044317 | 3300026095 | Bacteria | 3432 |
| 637 | Ga0207676_10120415 | 3300026095 | Bacteria | 2212 |
| 638 | Ga0207676_10169815 | 3300026095 | Bacteria | 1899 |
| 639 | Ga0207674_10000052 | 3300026116 | Bacteria | 115252 |
| 640 | Ga0207674_10002975 | 3300026116 | Bacteria | 21037 |
| 641 | Ga0207674_10005532 | 3300026116 | Bacteria | 15000 |
| 642 | Ga0207674_10064951 | 3300026116 | Bacteria | 3680 |
| 643 | Ga0207674_10131797 | 3300026116 | Bacteria | 2462 |
| 644 | Ga0207675_100000178 | 3300026118 | Bacteria | 57002 |
| 645 | Ga0207675_100000448 | 3300026118 | Bacteria | 40003 |
| 646 | Ga0207675_100001443 | 3300026118 | Bacteria | 23801 |
| 647 | Ga0207675_100008376 | 3300026118 | Bacteria | 9745 |
| 648 | Ga0207675_100014452 | 3300026118 | Bacteria | 7360 |
| 649 | Ga0207683_10000746 | 3300026121 | Bacteria | 29503 |
| 650 | Ga0207683_10001065 | 3300026121 | Bacteria | 25020 |
| 651 | Ga0207683_10001720 | 3300026121 | Bacteria | 19575 |
| 652 | Ga0207683_10005776 | 3300026121 | Bacteria | 10605 |
| 653 | Ga0207683_10006227 | 3300026121 | Bacteria | 10228 |
| 654 | Ga0207683_10022573 | 3300026121 | Bacteria | 5403 |
| 655 | Ga0207698_10013985 | 3300026142 | Bacteria | 5317 |
| 656 | Ga0207698_10016541 | 3300026142 | Bacteria | 4976 |
| 657 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 658 | Ga0209969_1000461 | 3300027360 | Bacteria | 5447 |
| 659 | Ga0209967_1002692 | 3300027364 | Bacteria | 2314 |
| 660 | Ga0209995_1000660 | 3300027471 | Bacteria | 5297 |
| 661 | Ga0209179_1003929 | 3300027512 | Bacteria | 2197 |
| 662 | Ga0209999_1005905 | 3300027543 | Bacteria | 2200 |
| 663 | Ga0209588_1003131 | 3300027671 | Bacteria | 4562 |
| 664 | Ga0209971_1000947 | 3300027682 | Bacteria | 7476 |
| 665 | Ga0209974_10002636 | 3300027876 | Bacteria | 6505 |
| 666 | Ga0209974_10004499 | 3300027876 | Bacteria | 4965 |
| 667 | Ga0209974_10030390 | 3300027876 | Bacteria | 1790 |
| 668 | Ga0207428_10008034 | 3300027907 | Bacteria | 9573 |
| 669 | Ga0207428_10030182 | 3300027907 | Bacteria | 4484 |
| 670 | Ga0268266_10012254 | 3300028379 | Bacteria | 7418 |
| 671 | Ga0268266_10137036 | 3300028379 | Bacteria | 2193 |
| 672 | Ga0268266_10164960 | 3300028379 | Bacteria | 2006 |
| 673 | Ga0268266_10168477 | 3300028379 | Bacteria | 1986 |
| 674 | Ga0268265_10000435 | 3300028380 | Bacteria | 44242 |
| 675 | Ga0268265_10002275 | 3300028380 | Bacteria | 14630 |
| 676 | Ga0268265_10003258 | 3300028380 | Bacteria | 11771 |
| 677 | Ga0268265_10011011 | 3300028380 | Bacteria | 6109 |
| 678 | Ga0268265_10066373 | 3300028380 | Bacteria | 2789 |
| 679 | Ga0268265_10122229 | 3300028380 | Bacteria | 2147 |
| 680 | Ga0268264_10018814 | 3300028381 | Bacteria | 5648 |
| 681 | Ga0268264_10037447 | 3300028381 | Bacteria | 3999 |
| 682 | Ga0268264_10087362 | 3300028381 | Bacteria | 2681 |
| 683 | Ga0268264_10113232 | 3300028381 | Bacteria | 2380 |
| 684 | Ga0268264_10114761 | 3300028381 | Bacteria | 2365 |
| 685 | Ga0265334_10000005 | 3300028573 | Bacteria | 242590 |
| 686 | Ga0265336_10000707 | 3300028666 | Bacteria | 17694 |
| 687 | Ga0265338_10059795 | 3300028800 | Bacteria | 3355 |
| 688 | Ga0265324_10000471 | 3300029957 | Bacteria | 28353 |
| 689 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 690 | Ga0316183_1012956 | 3300030742 | Bacteria | 4183 |
| 691 | Ga0265332_10002887 | 3300031238 | Bacteria | 8493 |
| 692 | Ga0265328_10024962 | 3300031239 | Bacteria | 2254 |
| 693 | Ga0265325_10001388 | 3300031241 | Bacteria | 17089 |
| 694 | Ga0265331_10003541 | 3300031250 | Bacteria | 10022 |
| 695 | Ga0265327_10000103 | 3300031251 | Bacteria | 185405 |
| 696 | Ga0265327_10000218 | 3300031251 | Bacteria | 116690 |
| 697 | Ga0265316_10018527 | 3300031344 | Bacteria | 5979 |
| 698 | Ga0265316_10039994 | 3300031344 | Bacteria | 3762 |
| 699 | Ga0265316_10098849 | 3300031344 | Bacteria | 2220 |
| 700 | Ga0307509_10001479 | 3300031507 | Bacteria | 39686 |
| 701 | Ga0307408_100000013 | 3300031548 | Bacteria | 386212 |
| 702 | Ga0307408_100117636 | 3300031548 | Bacteria | 2053 |
| 703 | Ga0265313_10000014 | 3300031595 | Bacteria | 156295 |
| 704 | Ga0316575_10000160 | 3300031665 | Bacteria | 17023 |
| 705 | Ga0316575_10009816 | 3300031665 | Bacteria | 3511 |
| 706 | Ga0316579_10030649 | 3300031691 | Bacteria | 2459 |
| 707 | Ga0265314_10001405 | 3300031711 | Bacteria | 26998 |
| 708 | Ga0316576_10005155 | 3300031727 | Bacteria | 7937 |
| 709 | Ga0316576_10007031 | 3300031727 | Bacteria | 7047 |
| 710 | Ga0316578_10017487 | 3300031728 | Bacteria | 3903 |
| 711 | Ga0316578_10035343 | 3300031728 | Bacteria | 2872 |
| 712 | Ga0307413_10001956 | 3300031824 | Bacteria | 8180 |
| 713 | Ga0307410_10000274 | 3300031852 | Bacteria | 19850 |
| 714 | Ga0307410_10015369 | 3300031852 | Bacteria | 4538 |
| 715 | Ga0307406_10018458 | 3300031901 | Bacteria | 4076 |
| 716 | Ga0307407_10000538 | 3300031903 | Bacteria | 11807 |
| 717 | Ga0307412_10178096 | 3300031911 | Bacteria | 1596 |
| 718 | Ga0307409_100050745 | 3300031995 | Bacteria | 3170 |
| 719 | Ga0307409_100213330 | 3300031995 | Bacteria | 1737 |
| 720 | Ga0307416_100045347 | 3300032002 | Bacteria | 3461 |
| 721 | Ga0307416_100191774 | 3300032002 | Bacteria | 1928 |
| 722 | Ga0307414_10009479 | 3300032004 | Bacteria | 5596 |
| 723 | Ga0307414_10010491 | 3300032004 | Bacteria | 5380 |
| 724 | Ga0307414_10044868 | 3300032004 | Bacteria | 3023 |
| 725 | Ga0307414_10264785 | 3300032004 | Bacteria | 1436 |
| 726 | Ga0307411_10008785 | 3300032005 | Bacteria | 5257 |
| 727 | Ga0307415_100101149 | 3300032126 | Bacteria | 2114 |
| 728 | Ga0316585_10023576 | 3300032137 | Bacteria | 1899 |
| 729 | Ga0316593_10011167 | 3300032168 | Bacteria | 2602 |
| 730 | Ga0316593_10021935 | 3300032168 | Bacteria | 2001 |
| 731 | Ga0373929_0011927 | 3300035085 | Bacteria | 1644 |
| 732 | Ga0373944_0018739 | 3300035089 | Bacteria | 1979 |
| 733 | Ga0373952_0001197 | 3300035092 | Bacteria | 4724 |
| 734 | Ga0373953_0009832 | 3300035117 | Bacteria | 3309 |
| 735 | Ga0373954_0023593 | 3300035118 | Bacteria | 2799 |
| 736 | Ga0373954_0026496 | 3300035118 | Bacteria | 2657 |
| 737 | Ga0373956_0000260 | 3300035119 | Bacteria | 21143 |
| 738 | Ga0373957_0005151 | 3300035120 | Bacteria | 4038 |
| 739 | Ga0373957_0006986 | 3300035120 | Bacteria | 3587 |
| 740 | Ga0373943_0019349 | 3300035170 | Bacteria | 3130 |
| 741 | Ga0373943_0065665 | 3300035170 | Bacteria | 1825 |
| 742 | Ga0373946_0056597 | 3300035171 | Bacteria | 1656 |
| 743 | Ga0373955_0007379 | 3300035172 | Bacteria | 5052 |
| 744 | Ga0373955_0008151 | 3300035172 | Bacteria | 4848 |
| 745 | Ga0373942_0010777 | 3300035207 | Bacteria | 2155 |
| 746 | Ga0373961_0027768 | 3300035241 | Bacteria | 1556 |
| 747 | Ga0316574_0004197 | 3300035398 | Bacteria | 7514 |
| 748 | Ga0316574_0004943 | 3300035398 | Bacteria | 7060 |
| 749 | Ga0316574_0005166 | 3300035398 | Bacteria | 6942 |
| 750 | Ga0316574_0028567 | 3300035398 | Bacteria | 3365 |
| 751 | Ga0316574_0143764 | 3300035398 | Bacteria | 1537 |
| 752 | Ga0373931_0007954 | 3300035691 | Bacteria | 5015 |
| 753 | Ga0373931_0064565 | 3300035691 | Bacteria | 1982 |
| 754 | Ga0373935_0019092 | 3300035692 | Bacteria | 4180 |
| 755 | Ga0373935_0172654 | 3300035692 | Bacteria | 1480 |
| 756 | Ga0373927_0007760 | 3300035695 | Bacteria | 7256 |
| 757 | Ga0373933_0005945 | 3300035724 | Bacteria | 6638 |
| 758 | Ga0373933_0021324 | 3300035724 | Bacteria | 3679 |
| 759 | Ga0373933_0042567 | 3300035724 | Bacteria | 2684 |
| 760 | Ga0373933_0147562 | 3300035724 | Bacteria | 1488 |
| 761 | Ga0373937_0000487 | 3300036401 | Bacteria | 36252 |
| 762 | Ga0373937_0010040 | 3300036401 | Bacteria | 8254 |
| 763 | Ga0373937_0012434 | 3300036401 | Bacteria | 7487 |
| 764 | Ga0373937_0035761 | 3300036401 | Bacteria | 4522 |
| 765 | Ga0316584_0057397 | 3300036712 | Bacteria | 2914 |
| 766 | Ga0373925_0012770 | 3300037068 | Bacteria | 6085 |
| 767 | Ga0373925_0021018 | 3300037068 | Bacteria | 4755 |
| 768 | Ga0373925_0033900 | 3300037068 | Bacteria | 3762 |
| 769 | Ga0395900_0007406 | 3300037418 | Bacteria | 11342 |
| 770 | Ga0395900_0103945 | 3300037418 | Bacteria | 2918 |
| 771 | Ga0395898_0030569 | 3300037466 | Bacteria | 5389 |
| 772 | Ga0395905_0003749 | 3300037471 | Bacteria | 16101 |
| 773 | Ga0395905_0027570 | 3300037471 | Bacteria | 5356 |
| 774 | Ga0395905_0044927 | 3300037471 | Bacteria | 4144 |
| 775 | Ga0436364_0432166 | 3300037853 | Bacteria | 2189 |
| 776 | Ga0395901_0012006 | 3300038443 | Bacteria | 8787 |
| 777 | Ga0395901_0068186 | 3300038443 | Bacteria | 3706 |
| 778 | Ga0237819_00915 | 3300038705 | Bacteria | 9135 |
| 779 | Ga0237819_03199 | 3300038705 | Bacteria | 2974 |
| 780 | Ga0400487_46050 | 3300039110 | Bacteria | 2405 |
| 781 | Ga0436365_0076061 | 3300039437 | Bacteria | 3598 |
| 782 | Ga0436361_0050017 | 3300039447 | Bacteria | 26618 |
| 783 | Ga0436363_1709594 | 3300039450 | Bacteria | 1577 |
| 784 | Ga0439465_0008504 | 3300041413 | Bacteria | 3239 |
| 785 | Ga0439437_000550 | 3300042000 | Bacteria | 3715 |
| 786 | Ga0439445_0007253 | 3300042004 | Bacteria | 2569 |
| 787 | Ga0439448_0020208 | 3300042005 | Bacteria | 2058 |
| 788 | Ga0450911_000012 | 3300042115 | Bacteria | 129546 |
| 789 | Ga0439446_0011478 | 3300042156 | Bacteria | 2405 |
| 790 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 791 | Ga0451577_0000402 | 3300042876 | Bacteria | 78514 |
| 792 | Ga0451577_0017088 | 3300042876 | Bacteria | 6709 |
| 793 | Ga0451577_0021269 | 3300042876 | Bacteria | 5938 |
| 794 | Ga0451577_0026706 | 3300042876 | Bacteria | 5229 |
| 795 | Ga0451577_0053334 | 3300042876 | Bacteria | 3610 |
| 796 | Ga0451577_0073138 | 3300042876 | Bacteria | 3059 |
| 797 | Ga0453683_0000011 | 3300044673 | Bacteria | 412765 |
| 798 | Ga0453683_0113823 | 3300044673 | Bacteria | 1702 |
| 799 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 800 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 801 | Ga0453684_0000065 | 3300044712 | Bacteria | 468481 |
| 802 | Ga0453684_0000136 | 3300044712 | Bacteria | 323402 |
| 803 | Ga0453684_0001174 | 3300044712 | Bacteria | 81261 |
| 804 | Ga0453684_0126052 | 3300044712 | Bacteria | 3081 |
| 805 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 806 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 807 | Ga0451576_0000131 | 3300045051 | Bacteria | 190667 |
| 808 | Ga0451576_0001381 | 3300045051 | Bacteria | 41721 |
| 809 | Ga0451576_0025176 | 3300045051 | Bacteria | 6415 |
| 810 | Ga0451576_0109027 | 3300045051 | Bacteria | 2881 |
| 811 | Ga0466967_0141310 | 3300045976 | Bacteria | 2243 |
| 812 | Ga0495592_0000449 | 3300046454 | Bacteria | 30874 |
| 813 | Ga0495592_0080837 | 3300046454 | Bacteria | 2350 |
| 814 | Ga0495638_0001128 | 3300046460 | Bacteria | 25882 |
| 815 | Ga0495651_0001710 | 3300046462 | Bacteria | 16956 |
| 816 | Ga0495651_0055429 | 3300046462 | Bacteria | 3046 |
| 817 | Ga0495580_0067725 | 3300046472 | Bacteria | 2498 |
| 818 | Ga0495580_0154162 | 3300046472 | Bacteria | 1591 |
| 819 | Ga0495582_0013485 | 3300046473 | Bacteria | 4500 |
| 820 | Ga0495639_0018316 | 3300046475 | Bacteria | 3047 |
| 821 | Ga0495662_0033484 | 3300046476 | Bacteria | 2482 |
| 822 | Ga0495664_0055171 | 3300046477 | Bacteria | 2364 |
| 823 | Ga0495594_0040143 | 3300046499 | Bacteria | 2560 |
| 824 | Ga0495606_0007681 | 3300046507 | Bacteria | 9560 |
| 825 | Ga0495608_0127296 | 3300046511 | Bacteria | 1631 |
| 826 | Ga0495628_0001138 | 3300046516 | Bacteria | 24250 |
| 827 | Ga0495628_0027455 | 3300046516 | Bacteria | 4632 |
| 828 | Ga0495628_0073782 | 3300046516 | Bacteria | 2658 |
| 829 | Ga0495630_0034416 | 3300046517 | Bacteria | 3783 |
| 830 | Ga0495648_0010210 | 3300046524 | Bacteria | 7172 |
| 831 | Ga0495663_0000429 | 3300046525 | Bacteria | 15363 |
| 832 | Ga0495663_0000891 | 3300046525 | Bacteria | 10055 |
| 833 | Ga0495652_0009506 | 3300046529 | Bacteria | 8829 |
| 834 | Ga0495652_0117524 | 3300046529 | Bacteria | 2127 |
| 835 | Ga0495654_0001417 | 3300046530 | Bacteria | 16578 |
| 836 | Ga0495665_0036691 | 3300046531 | Bacteria | 2616 |
| 837 | Ga0495640_0094458 | 3300046533 | Bacteria | 1969 |
| 838 | Ga0495621_0000016 | 3300046539 | Bacteria | 34269 |
| 839 | Ga0495621_0003268 | 3300046539 | Bacteria | 4456 |
| 840 | Ga0495621_0022890 | 3300046539 | Bacteria | 2075 |
| 841 | Ga0495621_0036649 | 3300046539 | Bacteria | 1703 |
| 842 | Ga0495645_0000567 | 3300046543 | Bacteria | 25287 |
| 843 | Ga0495645_0004604 | 3300046543 | Bacteria | 9412 |
| 844 | Ga0495633_0089538 | 3300046558 | Bacteria | 1431 |
| 845 | Ga0495667_0042455 | 3300046559 | Bacteria | 3015 |
| 846 | Ga0495635_0061737 | 3300046663 | Bacteria | 2573 |
| 847 | Ga0495661_0000093 | 3300046665 | Bacteria | 109808 |
| 848 | Ga0495657_0137967 | 3300046675 | Bacteria | 1522 |
| 849 | Ga0495599_0003542 | 3300046678 | Bacteria | 9142 |
| 850 | Ga0495646_0074552 | 3300046680 | Bacteria | 1991 |
| 851 | Ga0495647_0017940 | 3300046681 | Bacteria | 2511 |
| 852 | Ga0495647_0050195 | 3300046681 | Bacteria | 1618 |
| 853 | Ga0495658_0014018 | 3300046683 | Bacteria | 4086 |
| 854 | Ga0495613_0024840 | 3300046689 | Bacteria | 4465 |
| 855 | Ga0495671_0002983 | 3300046692 | Bacteria | 10514 |
| 856 | Ga0495600_0038582 | 3300046809 | Bacteria | 3109 |
| 857 | Ga0495581_0001860 | 3300047315 | Bacteria | 11810 |
| 858 | Ga0495604_0110347 | 3300047317 | Bacteria | 2007 |
| 859 | Ga0495636_0005078 | 3300047318 | Bacteria | 5169 |
| 860 | Ga0495674_0072954 | 3300047319 | Bacteria | 2960 |
| 861 | Ga0495672_0000134 | 3300047320 | Bacteria | 110142 |
| 862 | Ga0495672_0004693 | 3300047320 | Bacteria | 11058 |
| 863 | Ga0495672_0086663 | 3300047320 | Bacteria | 1731 |
| 864 | Ga0495680_0014464 | 3300047322 | Bacteria | 6832 |
| 865 | Ga0495684_0016945 | 3300047471 | Bacteria | 5613 |
| 866 | Ga0495593_0026222 | 3300047673 | Bacteria | 3220 |
| 867 | Ga0495602_0080127 | 3300048088 | Bacteria | 2752 |
| 868 | Ga0496100_0099654 | 3300048903 | Bacteria | 2000 |
| 869 | Ga0496100_0128154 | 3300048903 | Bacteria | 1784 |
| 870 | Ga0496101_0033519 | 3300048904 | Bacteria | 3622 |
| 871 | Ga0496101_0070560 | 3300048904 | Bacteria | 2559 |
| 872 | Ga0496101_0071353 | 3300048904 | Bacteria | 2546 |
| 873 | Ga0496102_0041999 | 3300048905 | Bacteria | 4143 |
| 874 | Ga0496103_0053346 | 3300048906 | Bacteria | 2506 |
| 875 | Ga0496104_0006723 | 3300048907 | Bacteria | 10124 |
| 876 | Ga0496104_0009610 | 3300048907 | Bacteria | 8612 |
| 877 | Ga0496105_0006614 | 3300048908 | Bacteria | 8923 |
| 878 | Ga0496105_0105344 | 3300048908 | Bacteria | 2328 |
| 879 | Ga0496106_0007884 | 3300048909 | Bacteria | 7871 |
| 880 | Ga0496106_0053112 | 3300048909 | Bacteria | 3060 |
| 881 | Ga0496108_0003143 | 3300048911 | Bacteria | 13277 |
| 882 | Ga0496108_0014932 | 3300048911 | Bacteria | 6338 |
| 883 | Ga0496108_0019745 | 3300048911 | Bacteria | 5536 |
| 884 | Ga0496109_0001481 | 3300048912 | Bacteria | 19497 |
| 885 | Ga0496109_0149381 | 3300048912 | Bacteria | 2187 |
| 886 | Ga0496109_0197925 | 3300048912 | Bacteria | 1889 |
| 887 | Ga0496110_0005552 | 3300048913 | Bacteria | 9899 |
| 888 | Ga0496110_0012614 | 3300048913 | Bacteria | 6951 |
| 889 | Ga0496111_0003169 | 3300048914 | Bacteria | 10132 |
| 890 | Ga0496112_0011093 | 3300048915 | Bacteria | 8212 |
| 891 | Ga0496114_0035421 | 3300048917 | Bacteria | 4121 |
| 892 | Ga0496115_0007091 | 3300048918 | Bacteria | 8234 |
| 893 | Ga0496115_0036524 | 3300048918 | Bacteria | 3891 |
| 894 | Ga0496115_0205269 | 3300048918 | Bacteria | 1628 |
| 895 | Ga0496116_0000008 | 3300048919 | Bacteria | 726753 |
| 896 | Ga0496117_0001343 | 3300048920 | Bacteria | 36067 |
| 897 | Ga0496117_0028830 | 3300048920 | Bacteria | 4291 |
| 898 | Ga0496118_0000145 | 3300048921 | Bacteria | 123886 |
| 899 | Ga0496118_0001486 | 3300048921 | Bacteria | 35102 |
| 900 | Ga0496118_0004832 | 3300048921 | Bacteria | 15713 |
| 901 | Ga0496120_0000525 | 3300048923 | Bacteria | 59273 |
| 902 | Ga0496121_0000012 | 3300048924 | Bacteria | 653131 |
| 903 | Ga0496121_0045105 | 3300048924 | Bacteria | 3792 |
| 904 | Ga0496121_0170810 | 3300048924 | Bacteria | 1580 |
| 905 | Ga0496122_0000062 | 3300048925 | Bacteria | 241387 |
| 906 | Ga0496122_0023731 | 3300048925 | Bacteria | 5392 |
| 907 | Ga0496123_0010330 | 3300048926 | Bacteria | 8272 |
| 908 | Ga0496123_0017728 | 3300048926 | Bacteria | 5710 |
| 909 | Ga0496124_0000255 | 3300048927 | Bacteria | 102645 |
| 910 | Ga0496124_0013804 | 3300048927 | Bacteria | 7857 |
| 911 | Ga0496124_0071694 | 3300048927 | Bacteria | 2870 |
| 912 | Ga0496125_0013402 | 3300048928 | Bacteria | 8062 |
| 913 | Ga0496126_0017269 | 3300048929 | Bacteria | 7190 |
| 914 | Ga0501031_0028864 | 3300049568 | Bacteria | 3616 |
| 915 | Ga0501034_0000273 | 3300049571 | Bacteria | 93198 |
| 916 | Ga0501034_0000571 | 3300049571 | Bacteria | 58421 |
| 917 | Ga0501034_0054294 | 3300049571 | Bacteria | 4034 |
| 918 | Ga0501036_0013100 | 3300049572 | Bacteria | 6890 |
| 919 | Ga0501036_0041825 | 3300049572 | Bacteria | 3878 |
| 920 | Ga0501036_0079955 | 3300049572 | Bacteria | 2764 |
| 921 | Ga0501036_0117894 | 3300049572 | Bacteria | 2242 |
| 922 | Ga0501037_0065601 | 3300049573 | Bacteria | 2645 |
| 923 | Ga0501038_0004369 | 3300049574 | Bacteria | 13151 |
| 924 | Ga0501038_0049384 | 3300049574 | Bacteria | 3638 |
| 925 | Ga0501038_0107633 | 3300049574 | Bacteria | 2313 |
| 926 | Ga0501039_0000126 | 3300049575 | Bacteria | 52890 |
| 927 | Ga0501039_0010087 | 3300049575 | Bacteria | 7197 |
| 928 | Ga0501039_0021369 | 3300049575 | Bacteria | 4966 |
| 929 | Ga0501039_0037554 | 3300049575 | Bacteria | 3739 |
| 930 | Ga0501040_0015976 | 3300049576 | Bacteria | 4964 |
| 931 | Ga0501040_0023276 | 3300049576 | Bacteria | 4153 |
| 932 | Ga0501040_0105094 | 3300049576 | Bacteria | 1972 |
| 933 | Ga0501041_0000283 | 3300049577 | Bacteria | 24387 |
| 934 | Ga0501041_0004904 | 3300049577 | Bacteria | 7772 |
| 935 | Ga0501041_0030700 | 3300049577 | Bacteria | 3244 |
| 936 | Ga0501041_0031447 | 3300049577 | Bacteria | 3207 |
| 937 | Ga0501041_0057553 | 3300049577 | Bacteria | 2377 |
| 938 | Ga0501042_0000022 | 3300049578 | Bacteria | 50211 |
| 939 | Ga0501042_0009519 | 3300049578 | Bacteria | 6479 |
| 940 | Ga0501043_0056571 | 3300049579 | Bacteria | 3081 |
| 941 | Ga0501047_0017694 | 3300049581 | Bacteria | 6828 |
| 942 | Ga0501068_0001639 | 3300049584 | Bacteria | 11952 |
| 943 | Ga0501068_0047424 | 3300049584 | Bacteria | 2592 |
| 944 | Ga0501068_0049744 | 3300049584 | Bacteria | 2532 |
| 945 | Ga0501068_0052322 | 3300049584 | Bacteria | 2471 |
| 946 | Ga0501069_0029361 | 3300049585 | Bacteria | 3017 |
| 947 | Ga0501070_0026718 | 3300049586 | Bacteria | 4842 |
| 948 | Ga0501070_0075477 | 3300049586 | Bacteria | 2791 |
| 949 | Ga0501070_0099865 | 3300049586 | Bacteria | 2401 |
| 950 | Ga0501070_0142883 | 3300049586 | Bacteria | 1976 |
| 951 | Ga0501071_0029929 | 3300049587 | Bacteria | 3847 |
| 952 | Ga0501071_0072462 | 3300049587 | Bacteria | 2512 |
| 953 | Ga0501071_0087967 | 3300049587 | Bacteria | 2279 |
| 954 | Ga0501072_0002838 | 3300049588 | Bacteria | 12999 |
| 955 | Ga0501072_0060665 | 3300049588 | Bacteria | 2982 |
| 956 | Ga0501072_0078424 | 3300049588 | Bacteria | 2615 |
| 957 | Ga0501073_0003036 | 3300049589 | Bacteria | 12589 |
| 958 | Ga0501073_0015610 | 3300049589 | Bacteria | 5510 |
| 959 | Ga0501074_0008184 | 3300049590 | Bacteria | 7578 |
| 960 | Ga0501074_0016754 | 3300049590 | Bacteria | 5318 |
| 961 | Ga0501074_0035483 | 3300049590 | Bacteria | 3613 |
| 962 | Ga0501074_0043599 | 3300049590 | Bacteria | 3247 |
| 963 | Ga0501075_0000128 | 3300049591 | Bacteria | 37407 |
| 964 | Ga0501075_0001228 | 3300049591 | Bacteria | 16603 |
| 965 | Ga0501075_0034527 | 3300049591 | Bacteria | 3766 |
| 966 | Ga0501076_0000135 | 3300049592 | Bacteria | 41430 |
| 967 | Ga0501076_0018908 | 3300049592 | Bacteria | 5257 |
| 968 | Ga0501076_0032101 | 3300049592 | Bacteria | 4097 |
| 969 | Ga0501077_0056282 | 3300049593 | Bacteria | 2496 |
| 970 | Ga0501077_0091211 | 3300049593 | Bacteria | 1931 |
| 971 | Ga0501079_0000027 | 3300049741 | Bacteria | 60858 |
| 972 | Ga0501079_0035468 | 3300049741 | Bacteria | 3839 |
| 973 | Ga0501079_0050763 | 3300049741 | Bacteria | 3201 |
| 974 | Ga0501079_0051902 | 3300049741 | Bacteria | 3167 |
| 975 | Ga0501080_0013617 | 3300049742 | Bacteria | 7489 |
| 976 | Ga0501080_0025658 | 3300049742 | Bacteria | 5474 |
| 977 | Ga0501080_0036276 | 3300049742 | Bacteria | 4603 |
| 978 | Ga0501080_0036955 | 3300049742 | Bacteria | 4559 |
| 979 | Ga0501080_0069238 | 3300049742 | Bacteria | 3281 |
| 980 | Ga0501081_0015302 | 3300049743 | Bacteria | 5060 |
| 981 | Ga0501081_0023649 | 3300049743 | Bacteria | 4120 |
| 982 | Ga0501081_0046535 | 3300049743 | Bacteria | 2982 |
| 983 | Ga0501083_0008802 | 3300049744 | Bacteria | 7126 |
| 984 | Ga0501083_0030314 | 3300049744 | Bacteria | 3717 |
| 985 | Ga0501083_0085102 | 3300049744 | Bacteria | 2092 |
| 986 | Ga0501280_002654 | 3300049776 | Bacteria | 2916 |
| 987 | Ga0501035_0224906 | 3300049822 | Bacteria | 1601 |
| 988 | Ga0501045_0004429 | 3300049824 | Bacteria | 9690 |
| 989 | Ga0501045_0195914 | 3300049824 | Bacteria | 1505 |
| 990 | nmdc:mga03683_3263_c1 | 3300050489 | Bacteria | 4598 |
| 991 | nmdc:mga03n38_609_c1 | 3300050490 | Bacteria | 9144 |
| 992 | nmdc:mga00v17_121_c1 | 3300050491 | Bacteria | 45916 |
| 993 | nmdc:mga00v17_158_c1 | 3300050491 | Bacteria | 40080 |
| 994 | nmdc:mga00v17_1845_c1 | 3300050491 | Bacteria | 10942 |
| 995 | nmdc:mga0yw44_187_c1 | 3300050492 | Bacteria | 21904 |
| 996 | nmdc:mga0k408_40587_c1 | 3300050493 | Bacteria | 2678 |
| 997 | nmdc:mga0k408_5171_c2 | 3300050493 | Bacteria | 2440 |
| 998 | nmdc:mga06z11_622_c1 | 3300050494 | Bacteria | 12894 |
| 999 | nmdc:mga06z11_879_c1 | 3300050494 | Bacteria | 10969 |
| 1000 | nmdc:mga07m45_456_c1 | 3300050496 | Bacteria | 17161 |
| 1001 | nmdc:mga05p37_133_c1 | 3300050507 | Bacteria | 68369 |
| 1002 | nmdc:mga05p37_1706_c1 | 3300050507 | Bacteria | 25587 |
| 1003 | nmdc:mga05p37_8018_c1 | 3300050507 | Bacteria | 12468 |
| 1004 | nmdc:mga09592_1764_c1 | 3300050508 | Bacteria | 17372 |
| 1005 | nmdc:mga09592_26_c1 | 3300050508 | Bacteria | 84260 |
| 1006 | nmdc:mga09592_40987_c1 | 3300050508 | Bacteria | 3892 |
| 1007 | nmdc:mga0qj67_103581_c1 | 3300050509 | Bacteria | 2296 |
| 1008 | nmdc:mga0qj67_165691_c1 | 3300050509 | Bacteria | 1794 |
| 1009 | nmdc:mga0qj67_40531_c1 | 3300050509 | Bacteria | 3660 |
| 1010 | nmdc:mga0qj67_43602_c1 | 3300050509 | Bacteria | 3533 |
| 1011 | nmdc:mga0qj67_573_c1 | 3300050509 | Bacteria | 25116 |
| 1012 | nmdc:mga06r32_1651_c1 | 3300050510 | Bacteria | 20142 |
| 1013 | nmdc:mga06r32_169948_c1 | 3300050510 | Bacteria | 2164 |
| 1014 | nmdc:mga06r32_22223_c1 | 3300050510 | Bacteria | 5862 |
| 1015 | nmdc:mga06r32_40_c1 | 3300050510 | Bacteria | 79168 |
| 1016 | nmdc:mga06r32_584_c1 | 3300050510 | Bacteria | 31769 |
| 1017 | nmdc:mga08y16_19070_c1 | 3300050511 | Bacteria | 7226 |
| 1018 | nmdc:mga08y16_232000_c1 | 3300050511 | Bacteria | 1909 |
| 1019 | nmdc:mga08y16_27121_c1 | 3300050511 | Bacteria | 6037 |
| 1020 | nmdc:mga0n895_182812_c1 | 3300050512 | Bacteria | 2128 |
| 1021 | nmdc:mga0n895_338503_c1 | 3300050512 | Bacteria | 1524 |
| 1022 | nmdc:mga0n895_61001_c1 | 3300050512 | Bacteria | 3722 |
| 1023 | nmdc:mga0a205_247855_c1 | 3300050515 | Bacteria | 1661 |
| 1024 | nmdc:mga0a205_61236_c1 | 3300050515 | Bacteria | 3635 |
| 1025 | nmdc:mga0a205_65285_c1 | 3300050515 | Bacteria | 3516 |
| 1026 | nmdc:mga0sz30_369_c2 | 3300050516 | Bacteria | 16436 |
| 1027 | Ga0495601_0022354 | 3300053077 | Bacteria | 3881 |
| 1028 | Ga0495601_0054667 | 3300053077 | Bacteria | 2526 |
| 1029 | Ga0495612_0047257 | 3300053078 | Bacteria | 1764 |
| 1030 | Ga0495595_0049803 | 3300053084 | Bacteria | 1938 |
| 1031 | Ga0500643_013356 | 3300053087 | Bacteria | 2903 |
| 1032 | Ga0500651_0000636 | 3300053093 | Bacteria | 17469 |
| 1033 | Ga0500634_0000070 | 3300053161 | Bacteria | 40723 |
| 1034 | Ga0501084_0007572 | 3300054114 | Bacteria | 8952 |
| 1035 | Ga0501082_0004029 | 3300060353 | Bacteria | 12824 |
| 1036 | Ga0501082_0028682 | 3300060353 | Bacteria | 4794 |
| 1037 | Ga0501082_0044053 | 3300060353 | Bacteria | 3849 |
| 1038 | Ga0501082_0099393 | 3300060353 | Bacteria | 2515 |
| 1039 | Ga0501082_0248610 | 3300060353 | Bacteria | 1548 |
| 1040 | Ga0530510_0000111 | 3300061734 | Bacteria | 45793 |
| 1041 | Ga0530510_0004913 | 3300061734 | Bacteria | 9234 |
| 1042 | Ga0530510_0048773 | 3300061734 | Bacteria | 3061 |
| 1043 | 2547375481 | 2547132103 | Bacteria | 5115736 |
| 1044 | 2572255408 | 2571042365 | Bacteria | 3289345 |
| 1045 | 2578458922 | 2576861471 | Bacteria | 4648976 |
| 1046 | 2599945047 | 2599185302 | Bacteria | 5954930 |
| 1047 | 2599955224 | 2599185304 | Bacteria | 5951361 |
| 1048 | 2599983957 | 2599185309 | Bacteria | 5969593 |
| 1049 | 2599990325 | 2599185310 | Bacteria | 6014457 |
| 1050 | 2600001733 | 2599185312 | Bacteria | 5912071 |
| 1051 | 2600048859 | 2599185320 | Bacteria | 5963263 |
| 1052 | 2643881520 | 2643221573 | Bacteria | 4784121 |
| 1053 | 2644662656 | 2643221720 | Bacteria | 4694283 |
| 1054 | 2644698390 | 2643221728 | Bacteria | 4797149 |
| 1055 | 2765578442 | 2765235840 | Bacteria | 4663337 |
| 1056 | 2808857279 | 2808606361 | Bacteria | 6136259 |
| 1057 | 2808905290 | 2808606373 | Bacteria | 4423627 |
| 1058 | 2808926415 | 2808606376 | Bacteria | 6248667 |
| 1059 | 2808937417 | 2808606378 | Bacteria | 6177535 |
| 1060 | 2808948576 | 2808606380 | Bacteria | 6248705 |
| 1061 | 2808965747 | 2808606383 | Bacteria | 6138645 |
| 1062 | 2809000654 | 2808606389 | Bacteria | 6138126 |
| 1063 | 2816516459 | 2816332141 | Bacteria | 4436036 |
| 1064 | 2842781544 | 2842780639 | Bacteria | 4337790 |
| 1065 | 2843691361 | 2843690924 | Bacteria | 5169057 |
| 1066 | 2852651273 | 2852649853 | Bacteria | 4036942 |
| 1067 | 2857446762 | 2857442823 | Bacteria | 4562550 |
| 1068 | 2894414537 | 2894414249 | Bacteria | 4405451 |
| 1069 | 2919498195 | 2919497567 | Bacteria | 4408621 |
| 1070 | 2919516898 | 2919513703 | Bacteria | 3844312 |
| 1071 | 2919675534 | 2919675420 | Bacteria | 3969095 |
| 1072 | 2923517634 | 2923516293 | Bacteria | 3716336 |
| 1073 | 2939590568 | 2939589442 | Bacteria | 4214238 |
| 1074 | 2939622736 | 2939622612 | Bacteria | 4698046 |
| 1075 | 2946007427 | 2946006987 | Bacteria | 6705746 |
| 1076 | 2961067169 | 2961064222 | Bacteria | 4749990 |
| 1077 | 2974309385 | 2974307012 | Bacteria | 4172388 |
| 1078 | 2977250105 | 2977247770 | Bacteria | 4160543 |
| 1079 | 2984515405 | 2984514374 | Bacteria | 4172479 |
| 1080 | 2998344551 | 2998344455 | Bacteria | 4222996 |
| 1081 | 8002869610 | 8002869464 | Bacteria | 3588529 |
| 1082 | 8003016643 | 8003014200 | Bacteria | 4059994 |
| 1083 | 8034966989 | 8034962539 | Bacteria | 4884839 |
| 1084 | 8054732065 | 8054727385 | Bacteria | 7558670 |
| 1085 | Ga0055536_1003090 | |||
| 1086 | JGI25162J39368_1000136 | |||
| 1087 | JGI25164J39214_1000260 | |||
| 1088 | JGI25152J39213_1000074 | |||
| 1089 | JGI25150J39212_1000056 | |||
| 1090 | JGI25151J46595_10000178 | |||
| 1091 | JGI25151J46595_10000430 | |||
| 1092 | JGI25165J46597_1000222 | |||
| 1093 | JGI25153J46596_10000131 | |||
| 1094 | Ga0055526_1000008 | |||
| 1095 | Ga0055526_1001472 | |||
| 1096 | Ga0055526_1013160 | |||
| 1097 | Ga0055537_1000343 | |||
| 1098 | Ga0055537_1000713 | |||
| 1099 | Ga0055524_1001290 | |||
| 1100 | Ga0055524_1008350 | |||
| 1101 | Ga0055536_1005503 | |||
| 1102 | Ga0055536_1006485 | |||
| 1103 | Ga0055536_1006496 | |||
| 1104 | Ga0055534_1000003 | |||
| 1105 | Ga0055534_1000717 | |||
| 1106 | Ga0055528_1000019 | |||
| 1107 | Ga0055528_1003920 | |||
| 1108 | Ga0055530_10000036 | |||
| 1109 | Ga0055530_10002049 | |||
| 1110 | Ga0055530_10002228 | |||
| 1111 | Ga0055530_10003987 | |||
| 1112 | Ga0055540_1000072 | |||
| 1113 | Ga0055531_10001707 | |||
| 1114 | Ga0055531_10004113 | |||
| 1115 | Ga0055531_10007124 | |||
| 1116 | Ga0058692_1000002 | |||
| 1117 | Ga0065707_10003200 | |||
| 1118 | Ga0070658_10015935 | |||
| 1119 | Ga0070658_10038645 | |||
| 1120 | Ga0070683_100004250 | |||
| 1121 | Ga0070683_100013072 | |||
| 1122 | Ga0070683_100027452 | |||
| 1123 | Ga0070690_100003693 | |||
| 1124 | Ga0070690_100007788 | |||
| 1125 | Ga0070690_100020584 | |||
| 1126 | Ga0070670_100000002 | |||
| 1127 | Ga0070670_100006153 | |||
| 1128 | Ga0070670_100009718 | |||
| 1129 | Ga0070670_100084272 | |||
| 1130 | Ga0070670_100119198 | |||
| 1131 | Ga0070677_10015431 | |||
| 1132 | Ga0068869_100011009 | |||
| 1133 | Ga0068869_100027051 | |||
| 1134 | Ga0068869_100043138 | |||
| 1135 | Ga0068869_100053905 | |||
| 1136 | Ga0068869_100069021 | |||
| 1137 | Ga0070666_10004787 | |||
| 1138 | Ga0070666_10007365 | |||
| 1139 | Ga0070666_10010051 | |||
| 1140 | Ga0070666_10016249 | |||
| 1141 | Ga0070666_10017293 | |||
| 1142 | Ga0070680_100035809 | |||
| 1143 | Ga0070680_100096487 | |||
| 1144 | Ga0070680_100156843 | |||
| 1145 | Ga0070680_100205416 | |||
| 1146 | Ga0070682_100000380 | |||
| 1147 | Ga0068868_100004418 | |||
| 1148 | Ga0068868_100014076 | |||
| 1149 | Ga0068868_100041521 | |||
| 1150 | Ga0068868_100063241 | |||
| 1151 | Ga0070660_100028013 | |||
| 1152 | Ga0070660_100066755 | |||
| 1153 | Ga0070660_100079329 | |||
| 1154 | Ga0070689_100006598 | |||
| 1155 | Ga0070689_100008044 | |||
| 1156 | Ga0070689_100008330 | |||
| 1157 | Ga0070689_100019537 | |||
| 1158 | Ga0070689_100026938 | |||
| 1159 | Ga0070689_100041828 | |||
| 1160 | Ga0070689_100057648 | |||
| 1161 | Ga0070691_10053731 | |||
| 1162 | Ga0070687_100006690 | |||
| 1163 | Ga0070661_100004439 | |||
| 1164 | Ga0070661_100007342 | |||
| 1165 | Ga0070661_100020822 | |||
| 1166 | Ga0070661_100028288 | |||
| 1167 | Ga0070661_100040918 | |||
| 1168 | Ga0070692_10003861 | |||
| 1169 | Ga0070692_10006651 | |||
| 1170 | Ga0070692_10034034 | |||
| 1171 | Ga0070669_100004277 | |||
| 1172 | Ga0070669_100076355 | |||
| 1173 | Ga0070669_100103978 | |||
| 1174 | Ga0070669_100114814 | |||
| 1175 | Ga0070675_100009894 | |||
| 1176 | Ga0070675_100088797 | |||
| 1177 | Ga0070671_100000022 | |||
| 1178 | Ga0070671_100002957 | |||
| 1179 | Ga0070671_100018536 | |||
| 1180 | Ga0070671_100022375 | |||
| 1181 | Ga0070671_100076762 | |||
| 1182 | Ga0070673_100001706 | |||
| 1183 | Ga0070673_100011790 | |||
| 1184 | Ga0070673_100012540 | |||
| 1185 | Ga0070673_100031437 | |||
| 1186 | Ga0070673_100036017 | |||
| 1187 | Ga0070688_100000292 | |||
| 1188 | Ga0070688_100000882 | |||
| 1189 | Ga0070688_100039128 | |||
| 1190 | Ga0070659_100013147 | |||
| 1191 | Ga0070667_100000007 | |||
| 1192 | Ga0070667_100000150 | |||
| 1193 | Ga0070667_100026515 | |||
| 1194 | Ga0070709_10001553 | |||
| 1195 | Ga0070714_100000332 | |||
| 1196 | Ga0070714_100229316 | |||
| 1197 | Ga0070713_100003519 | |||
| 1198 | Ga0070713_100003782 | |||
| 1199 | Ga0070713_100024900 | |||
| 1200 | Ga0070713_100032686 | |||
| 1201 | Ga0070710_10004468 | |||
| 1202 | Ga0070701_10000319 | |||
| 1203 | Ga0070701_10044853 | |||
| 1204 | Ga0070711_100005649 | |||
| 1205 | Ga0070711_100011627 | |||
| 1206 | Ga0070711_100163499 | |||
| 1207 | Ga0070705_100017497 | |||
| 1208 | Ga0070705_100027675 | |||
| 1209 | Ga0070705_100099519 | |||
| 1210 | Ga0070700_100002665 | |||
| 1211 | Ga0070700_100138762 | |||
| 1212 | Ga0070694_100038329 | |||
| 1213 | Ga0070694_100041113 | |||
| 1214 | Ga0070694_100057539 | |||
| 1215 | Ga0070694_100066611 | |||
| 1216 | Ga0070708_100054686 | |||
| 1217 | Ga0070708_100090993 | |||
| 1218 | Ga0070663_100003494 | |||
| 1219 | Ga0070663_100013809 | |||
| 1220 | Ga0070663_100107051 | |||
| 1221 | Ga0070678_100001364 | |||
| 1222 | Ga0070678_100001708 | |||
| 1223 | Ga0070678_100006602 | |||
| 1224 | Ga0070662_100005429 | |||
| 1225 | Ga0070662_100035331 | |||
| 1226 | Ga0070662_100050051 | |||
| 1227 | Ga0070662_100156998 | |||
| 1228 | Ga0070662_100159289 | |||
| 1229 | Ga0070681_10002119 | |||
| 1230 | Ga0070681_10005255 | |||
| 1231 | Ga0070681_10210658 | |||
| 1232 | Ga0068867_100026979 | |||
| 1233 | Ga0070685_10000148 | |||
| 1234 | Ga0070685_10001092 | |||
| 1235 | Ga0070685_10020262 | |||
| 1236 | Ga0070706_100161198 | |||
| 1237 | Ga0070706_100221170 | |||
| 1238 | Ga0070707_100031393 | |||
| 1239 | Ga0070698_100105258 | |||
| 1240 | Ga0070698_100111171 | |||
| 1241 | Ga0070699_100022242 | |||
| 1242 | Ga0070699_100147439 | |||
| 1243 | Ga0070679_100044336 | |||
| 1244 | Ga0070684_100008392 | |||
| 1245 | Ga0070684_100020377 | |||
| 1246 | Ga0070697_100003127 | |||
| 1247 | Ga0070697_100087221 | |||
| 1248 | Ga0070697_100110115 | |||
| 1249 | Ga0068853_100001036 | |||
| 1250 | Ga0068853_100002186 | |||
| 1251 | Ga0068853_100142979 | |||
| 1252 | Ga0070672_100001829 | |||
| 1253 | Ga0070672_100002876 | |||
| 1254 | Ga0070686_100000740 | |||
| 1255 | Ga0070686_100011553 | |||
| 1256 | Ga0070686_100018117 | |||
| 1257 | Ga0070686_100059326 | |||
| 1258 | Ga0070695_100016539 | |||
| 1259 | Ga0070695_100028709 | |||
| 1260 | Ga0070696_100090501 | |||
| 1261 | Ga0070696_100090912 | |||
| 1262 | Ga0070696_100141385 | |||
| 1263 | Ga0070693_100000355 | |||
| 1264 | Ga0070693_100018554 | |||
| 1265 | Ga0070665_100002349 | |||
| 1266 | Ga0070665_100015445 | |||
| 1267 | Ga0070665_100020180 | |||
| 1268 | Ga0070665_100024535 | |||
| 1269 | Ga0070665_100055246 | |||
| 1270 | Ga0070665_100084976 | |||
| 1271 | Ga0070704_100005685 | |||
| 1272 | Ga0070704_100033773 | |||
| 1273 | Ga0070704_100051353 | |||
| 1274 | Ga0070704_100191315 | |||
| 1275 | Ga0068855_100008633 | |||
| 1276 | Ga0068855_100009797 | |||
| 1277 | Ga0068855_100023835 | |||
| 1278 | Ga0068855_100039911 | |||
| 1279 | Ga0068855_100082958 | |||
| 1280 | Ga0070664_100002191 | |||
| 1281 | Ga0070664_100002880 | |||
| 1282 | Ga0070664_100008398 | |||
| 1283 | Ga0070664_100017980 | |||
| 1284 | Ga0070664_100063715 | |||
| 1285 | Ga0070664_100208628 | |||
| 1286 | Ga0068857_100003513 | |||
| 1287 | Ga0068857_100017944 | |||
| 1288 | Ga0068854_100011844 | |||
| 1289 | Ga0068854_100019777 | |||
| 1290 | Ga0068854_100039035 | |||
| 1291 | Ga0068854_100053310 | |||
| 1292 | Ga0068854_100124579 | |||
| 1293 | Ga0068856_100005841 | |||
| 1294 | Ga0068856_100033965 | |||
| 1295 | Ga0068856_100137761 | |||
| 1296 | Ga0070702_100002726 | |||
| 1297 | Ga0070702_100006583 | |||
| 1298 | Ga0070702_100047510 | |||
| 1299 | Ga0068852_100001889 | |||
| 1300 | Ga0068852_100010864 | |||
| 1301 | Ga0068852_100232838 | |||
| 1302 | Ga0068859_100010871 | |||
| 1303 | Ga0068859_100083482 | |||
| 1304 | Ga0068859_100155567 | |||
| 1305 | Ga0068859_100160028 | |||
| 1306 | Ga0068859_100208277 | |||
| 1307 | Ga0068864_100000003 | |||
| 1308 | Ga0068864_100005774 | |||
| 1309 | Ga0068864_100014149 | |||
| 1310 | Ga0068864_100019036 | |||
| 1311 | Ga0068866_10001916 | |||
| 1312 | Ga0068866_10003766 | |||
| 1313 | Ga0068861_100002552 | |||
| 1314 | Ga0068861_100005187 | |||
| 1315 | Ga0068861_100006869 | |||
| 1316 | Ga0068861_100007103 | |||
| 1317 | Ga0068861_100042029 | |||
| 1318 | Ga0068861_100058879 | |||
| 1319 | Ga0068851_10000872 | |||
| 1320 | Ga0068851_10008908 | |||
| 1321 | Ga0068851_10009765 | |||
| 1322 | Ga0068870_10006457 | |||
| 1323 | Ga0068863_100009028 | |||
| 1324 | Ga0068863_100010280 | |||
| 1325 | Ga0068863_100021142 | |||
| 1326 | Ga0068863_100095539 | |||
| 1327 | Ga0068863_100174063 | |||
| 1328 | Ga0068863_100222846 | |||
| 1329 | Ga0068858_100002485 | |||
| 1330 | Ga0068858_100007459 | |||
| 1331 | Ga0068858_100007973 | |||
| 1332 | Ga0068858_100027261 | |||
| 1333 | Ga0068858_100060543 | |||
| 1334 | Ga0068858_100065191 | |||
| 1335 | Ga0068860_100001638 | |||
| 1336 | Ga0068860_100013859 | |||
| 1337 | Ga0068860_100030834 | |||
| 1338 | Ga0068860_100110409 | |||
| 1339 | Ga0068862_100000452 | |||
| 1340 | Ga0068862_100006537 | |||
| 1341 | Ga0068862_100009412 | |||
| 1342 | Ga0068862_100014383 | |||
| 1343 | Ga0068862_100043953 | |||
| 1344 | Ga0068862_100062042 | |||
| 1345 | Ga0068862_100091519 | |||
| 1346 | Ga0068862_100124290 | |||
| 1347 | Ga0081538_10073395 | |||
| 1348 | Ga0081540_1004336 | |||
| 1349 | Ga0075365_10000122 | |||
| 1350 | Ga0075363_100001163 | |||
| 1351 | Ga0075364_10000213 | |||
| 1352 | Ga0075364_10000562 | |||
| 1353 | Ga0070715_10014203 | |||
| 1354 | Ga0070716_100001077 | |||
| 1355 | Ga0070716_100019418 | |||
| 1356 | Ga0070712_100040974 | |||
| 1357 | Ga0075367_10001536 | |||
| 1358 | Ga0075369_10000212 | |||
| 1359 | Ga0097621_100002878 | |||
| 1360 | Ga0097621_100028624 | |||
| 1361 | Ga0075370_10032942 | |||
| 1362 | Ga0068871_100006555 | |||
| 1363 | Ga0068871_100008816 | |||
| 1364 | Ga0068871_100027588 | |||
| 1365 | Ga0075428_100000982 | |||
| 1366 | Ga0075428_100002975 | |||
| 1367 | Ga0075430_100000566 | |||
| 1368 | Ga0075430_100011327 | |||
| 1369 | Ga0075430_100022826 | |||
| 1370 | Ga0075430_100030371 | |||
| 1371 | Ga0075430_100145781 | |||
| 1372 | Ga0075430_100163607 | |||
| 1373 | Ga0075431_100002345 | |||
| 1374 | Ga0075431_100002432 | |||
| 1375 | Ga0075431_100035882 | |||
| 1376 | Ga0075431_100120469 | |||
| 1377 | Ga0075433_10054163 | |||
| 1378 | Ga0075434_100009366 | |||
| 1379 | Ga0075434_100105823 | |||
| 1380 | Ga0075434_100157039 | |||
| 1381 | Ga0075429_100000015 | |||
| 1382 | Ga0075429_100000217 | |||
| 1383 | Ga0075429_100024442 | |||
| 1384 | Ga0075429_100049651 | |||
| 1385 | Ga0068865_100005740 | |||
| 1386 | Ga0068865_100063933 | |||
| 1387 | Ga0075436_100065816 | |||
| 1388 | Ga0075436_100137968 | |||
| 1389 | Ga0097620_100010870 | |||
| 1390 | Ga0097620_100083480 | |||
| 1391 | Ga0097620_100155574 | |||
| 1392 | Ga0097620_100160027 | |||
| 1393 | Ga0097620_100208260 | |||
| 1394 | Ga0075435_100062780 | |||
| 1395 | Ga0075435_100103983 | |||
| 1396 | Ga0099794_10001346 | |||
| 1397 | Ga0105251_10025919 | |||
| 1398 | Ga0105240_10002074 | |||
| 1399 | Ga0105240_10007281 | |||
| 1400 | Ga0105240_10014161 | |||
| 1401 | Ga0105240_10073166 | |||
| 1402 | Ga0105240_10321353 | |||
| 1403 | Ga0111539_10002751 | |||
| 1404 | Ga0111539_10002953 | |||
| 1405 | Ga0111539_10058516 | |||
| 1406 | Ga0111539_10081464 | |||
| 1407 | Ga0111539_10124594 | |||
| 1408 | Ga0111539_10393720 | |||
| 1409 | Ga0105245_10004129 | |||
| 1410 | Ga0105245_10008792 | |||
| 1411 | Ga0105245_10051378 | |||
| 1412 | Ga0105245_10266813 | |||
| 1413 | Ga0105247_10005141 | |||
| 1414 | Ga0105247_10017181 | |||
| 1415 | Ga0114129_10000248 | |||
| 1416 | Ga0114129_10041162 | |||
| 1417 | Ga0105243_10003141 | |||
| 1418 | Ga0105243_10011531 | |||
| 1419 | Ga0105243_10065919 | |||
| 1420 | Ga0105241_10116676 | |||
| 1421 | Ga0105241_10125335 | |||
| 1422 | Ga0105242_10002322 | |||
| 1423 | Ga0105242_10005056 | |||
| 1424 | Ga0105242_10014096 | |||
| 1425 | Ga0105248_10000246 | |||
| 1426 | Ga0105248_10010195 | |||
| 1427 | Ga0105248_10039245 | |||
| 1428 | Ga0105248_10110131 | |||
| 1429 | Ga0105248_10229774 | |||
| 1430 | Ga0105248_10315134 | |||
| 1431 | Ga0105237_10000231 | |||
| 1432 | Ga0105237_10026395 | |||
| 1433 | Ga0105237_10059158 | |||
| 1434 | Ga0105237_10136504 | |||
| 1435 | Ga0105238_10035805 | |||
| 1436 | Ga0105238_10043127 | |||
| 1437 | Ga0105249_10005115 | |||
| 1438 | Ga0105249_10006419 | |||
| 1439 | Ga0105249_10012784 | |||
| 1440 | Ga0105249_10012863 | |||
| 1441 | Ga0105249_10013252 | |||
| 1442 | Ga0105249_10179243 | |||
| 1443 | Ga0099796_10024514 | |||
| 1444 | Ga0105239_10005689 | |||
| 1445 | Ga0105239_10109140 | |||
| 1446 | Ga0157373_10001374 | |||
| 1447 | Ga0157371_10000429 | |||
| 1448 | Ga0157371_10007777 | |||
| 1449 | Ga0157371_10014829 | |||
| 1450 | Ga0157370_10012042 | |||
| 1451 | Ga0157370_10049463 | |||
| 1452 | Ga0157374_10014292 | |||
| 1453 | Ga0157374_10016690 | |||
| 1454 | Ga0157374_10035124 | |||
| 1455 | Ga0157374_10053996 | |||
| 1456 | Ga0157378_10013710 | |||
| 1457 | Ga0157378_10016375 | |||
| 1458 | Ga0157378_10022130 | |||
| 1459 | Ga0157378_10045867 | |||
| 1460 | Ga0157378_10046570 | |||
| 1461 | Ga0157378_10133048 | |||
| 1462 | Ga0157378_10198705 | |||
| 1463 | Ga0163162_10072809 | |||
| 1464 | Ga0163162_10374648 | |||
| 1465 | Ga0157372_10004213 | |||
| 1466 | Ga0157372_10015001 | |||
| 1467 | Ga0157372_10021657 | |||
| 1468 | Ga0157372_10266499 | |||
| 1469 | Ga0157375_10109230 | |||
| 1470 | Ga0157375_10135352 | |||
| 1471 | Ga0163163_10000835 | |||
| 1472 | Ga0163163_10018597 | |||
| 1473 | Ga0163163_10054458 | |||
| 1474 | Ga0163163_10168564 | |||
| 1475 | Ga0157380_10015682 | |||
| 1476 | Ga0157380_10281250 | |||
| 1477 | Ga0182008_10000269 | |||
| 1478 | Ga0157377_10001111 | |||
| 1479 | Ga0157377_10002019 | |||
| 1480 | Ga0157377_10014693 | |||
| 1481 | Ga0157379_10005419 | |||
| 1482 | Ga0157379_10066007 | |||
| 1483 | Ga0157376_10002756 | |||
| 1484 | Ga0157376_10003114 | |||
| 1485 | Ga0157376_10013527 | |||
| 1486 | Ga0157376_10111927 | |||
| 1487 | Ga0182006_1007044 | |||
| 1488 | Ga0182007_10000127 | |||
| 1489 | Ga0182005_1000168 | |||
| 1490 | Ga0183360_10001 | |||
| 1491 | Ga0163161_10044445 | |||
| 1492 | Ga0163161_10109759 | |||
| 1493 | Ga0213876_10039093 | |||
| 1494 | Ga0209760_100058 | |||
| 1495 | Ga0207427_100063 | |||
| 1496 | Ga0209437_100133 | |||
| 1497 | Ga0207425_1000108 | |||
| 1498 | Ga0207425_1004437 | |||
| 1499 | Ga0209129_1000178 | |||
| 1500 | Ga0209233_1000133 | |||
| 1501 | Ga0209565_1000001 | |||
| 1502 | Ga0209565_1000014 | |||
| 1503 | Ga0209673_1000001 | |||
| 1504 | Ga0209673_1000570 | |||
| 1505 | Ga0209130_1003922 | |||
| 1506 | Ga0209130_1017144 | |||
| 1507 | Ga0209675_1000001 | |||
| 1508 | Ga0209675_1000021 | |||
| 1509 | Ga0209676_1000027 | |||
| 1510 | Ga0209676_1000047 | |||
| 1511 | Ga0209676_1000079 | |||
| 1512 | Ga0209676_1001090 | |||
| 1513 | Ga0209676_1007037 | |||
| 1514 | Ga0209676_1007436 | |||
| 1515 | Ga0209676_1010731 | |||
| 1516 | Ga0209025_1000012 | |||
| 1517 | Ga0209025_1000102 | |||
| 1518 | Ga0209025_1003190 | |||
| 1519 | Ga0209564_1000001 | |||
| 1520 | Ga0209564_1000263 | |||
| 1521 | Ga0209758_1000018 | |||
| 1522 | Ga0209758_1021599 | |||
| 1523 | Ga0209050_1000080 | |||
| 1524 | Ga0209050_1000153 | |||
| 1525 | Ga0209050_1000311 | |||
| 1526 | Ga0209050_1002761 | |||
| 1527 | Ga0209256_1000002 | |||
| 1528 | Ga0209256_1002605 | |||
| 1529 | Ga0209256_1002692 | |||
| 1530 | Ga0209256_1004733 | |||
| 1531 | Ga0209051_1000082 | |||
| 1532 | Ga0209051_1006455 | |||
| 1533 | Ga0209257_1000081 | |||
| 1534 | Ga0209257_1000274 | |||
| 1535 | Ga0209257_1000664 | |||
| 1536 | Ga0209257_1001912 | |||
| 1537 | Ga0209257_1002586 | |||
| 1538 | Ga0209257_1007820 | |||
| 1539 | Ga0209257_1009194 | |||
| 1540 | Ga0207697_10000149 | |||
| 1541 | Ga0207697_10020793 | |||
| 1542 | Ga0207656_10003769 | |||
| 1543 | Ga0207656_10012278 | |||
| 1544 | Ga0207655_1033072 | |||
| 1545 | Ga0207682_10000459 | |||
| 1546 | Ga0207642_10001236 | |||
| 1547 | Ga0207710_10027304 | |||
| 1548 | Ga0207688_10001830 | |||
| 1549 | Ga0207688_10007340 | |||
| 1550 | Ga0207680_10036342 | |||
| 1551 | Ga0207685_10045386 | |||
| 1552 | Ga0207645_10001936 | |||
| 1553 | Ga0207645_10100063 | |||
| 1554 | Ga0207643_10000257 | |||
| 1555 | Ga0207643_10002766 | |||
| 1556 | Ga0207643_10009427 | |||
| 1557 | Ga0207643_10043792 | |||
| 1558 | Ga0207643_10047912 | |||
| 1559 | Ga0207707_10010165 | |||
| 1560 | Ga0207707_10012870 | |||
| 1561 | Ga0207707_10048090 | |||
| 1562 | Ga0207695_10001882 | |||
| 1563 | Ga0207695_10006211 | |||
| 1564 | Ga0207695_10011988 | |||
| 1565 | Ga0207695_10015440 | |||
| 1566 | Ga0207695_10207552 | |||
| 1567 | Ga0207671_10008456 | |||
| 1568 | Ga0207693_10002740 | |||
| 1569 | Ga0207693_10020534 | |||
| 1570 | Ga0207663_10005447 | |||
| 1571 | Ga0207663_10018487 | |||
| 1572 | Ga0207660_10027866 | |||
| 1573 | Ga0207660_10033993 | |||
| 1574 | Ga0207660_10124814 | |||
| 1575 | Ga0207662_10009238 | |||
| 1576 | Ga0207662_10012415 | |||
| 1577 | Ga0207662_10024694 | |||
| 1578 | Ga0207662_10085548 | |||
| 1579 | Ga0207657_10001446 | |||
| 1580 | Ga0207657_10017013 | |||
| 1581 | Ga0207657_10051076 | |||
| 1582 | Ga0207657_10113044 | |||
| 1583 | Ga0207649_10023500 | |||
| 1584 | Ga0207649_10067791 | |||
| 1585 | Ga0207649_10102326 | |||
| 1586 | Ga0207652_10018305 | |||
| 1587 | Ga0207652_10215803 | |||
| 1588 | Ga0207646_10105596 | |||
| 1589 | Ga0207646_10154480 | |||
| 1590 | Ga0207646_10176713 | |||
| 1591 | Ga0207681_10003243 | |||
| 1592 | Ga0207681_10008178 | |||
| 1593 | Ga0207681_10011656 | |||
| 1594 | Ga0207681_10034434 | |||
| 1595 | Ga0207681_10066205 | |||
| 1596 | Ga0207681_10073914 | |||
| 1597 | Ga0207694_10026021 | |||
| 1598 | Ga0207694_10095594 | |||
| 1599 | Ga0207650_10000003 | |||
| 1600 | Ga0207650_10001825 | |||
| 1601 | Ga0207650_10002621 | |||
| 1602 | Ga0207650_10085318 | |||
| 1603 | Ga0207659_10003990 | |||
| 1604 | Ga0207659_10014471 | |||
| 1605 | Ga0207659_10071353 | |||
| 1606 | Ga0207687_10006961 | |||
| 1607 | Ga0207687_10026690 | |||
| 1608 | Ga0207700_10003571 | |||
| 1609 | Ga0207700_10020142 | |||
| 1610 | Ga0207664_10000325 | |||
| 1611 | Ga0207664_10003311 | |||
| 1612 | Ga0207664_10100168 | |||
| 1613 | Ga0207644_10000037 | |||
| 1614 | Ga0207644_10002823 | |||
| 1615 | Ga0207644_10003679 | |||
| 1616 | Ga0207644_10032756 | |||
| 1617 | Ga0207644_10071271 | |||
| 1618 | Ga0207690_10133711 | |||
| 1619 | Ga0207706_10000775 | |||
| 1620 | Ga0207706_10007089 | |||
| 1621 | Ga0207706_10041143 | |||
| 1622 | Ga0207706_10108387 | |||
| 1623 | Ga0207706_10181447 | |||
| 1624 | Ga0207686_10004363 | |||
| 1625 | Ga0207686_10012082 | |||
| 1626 | Ga0207686_10036442 | |||
| 1627 | Ga0207686_10043800 | |||
| 1628 | Ga0207686_10109420 | |||
| 1629 | Ga0207709_10000930 | |||
| 1630 | Ga0207709_10007789 | |||
| 1631 | Ga0207709_10029160 | |||
| 1632 | Ga0207670_10009955 | |||
| 1633 | Ga0207670_10055151 | |||
| 1634 | Ga0207669_10009438 | |||
| 1635 | Ga0207669_10031724 | |||
| 1636 | Ga0207669_10168456 | |||
| 1637 | Ga0207704_10001220 | |||
| 1638 | Ga0207704_10005871 | |||
| 1639 | Ga0207704_10017993 | |||
| 1640 | Ga0207704_10024054 | |||
| 1641 | Ga0207665_10003114 | |||
| 1642 | Ga0207691_10001095 | |||
| 1643 | Ga0207691_10001701 | |||
| 1644 | Ga0207691_10003722 | |||
| 1645 | Ga0207691_10005811 | |||
| 1646 | Ga0207691_10025607 | |||
| 1647 | Ga0207691_10046818 | |||
| 1648 | Ga0207691_10142642 | |||
| 1649 | Ga0207711_10000782 | |||
| 1650 | Ga0207711_10003291 | |||
| 1651 | Ga0207711_10003296 | |||
| 1652 | Ga0207711_10006050 | |||
| 1653 | Ga0207711_10064392 | |||
| 1654 | Ga0207689_10000474 | |||
| 1655 | Ga0207689_10002613 | |||
| 1656 | Ga0207689_10003706 | |||
| 1657 | Ga0207689_10030707 | |||
| 1658 | Ga0207689_10038779 | |||
| 1659 | Ga0207661_10036429 | |||
| 1660 | Ga0207661_10070183 | |||
| 1661 | Ga0207661_10166349 | |||
| 1662 | Ga0207679_10037767 | |||
| 1663 | Ga0207679_10051272 | |||
| 1664 | Ga0207667_10004596 | |||
| 1665 | Ga0207667_10055847 | |||
| 1666 | Ga0207667_10144569 | |||
| 1667 | Ga0207667_10187414 | |||
| 1668 | Ga0207651_10002306 | |||
| 1669 | Ga0207651_10014477 | |||
| 1670 | Ga0207651_10015257 | |||
| 1671 | Ga0207651_10032842 | |||
| 1672 | Ga0207712_10000314 | |||
| 1673 | Ga0207712_10010887 | |||
| 1674 | Ga0207712_10058562 | |||
| 1675 | Ga0207712_10113733 | |||
| 1676 | Ga0207712_10131469 | |||
| 1677 | Ga0207640_10007253 | |||
| 1678 | Ga0207640_10007928 | |||
| 1679 | Ga0207640_10069786 | |||
| 1680 | Ga0207658_10000004 | |||
| 1681 | Ga0207658_10000013 | |||
| 1682 | Ga0207658_10006563 | |||
| 1683 | Ga0207658_10022252 | |||
| 1684 | Ga0207677_10000390 | |||
| 1685 | Ga0207677_10045330 | |||
| 1686 | Ga0207703_10002767 | |||
| 1687 | Ga0207703_10009021 | |||
| 1688 | Ga0207703_10013439 | |||
| 1689 | Ga0207703_10016031 | |||
| 1690 | Ga0207703_10017347 | |||
| 1691 | Ga0207639_10000791 | |||
| 1692 | Ga0207639_10001337 | |||
| 1693 | Ga0207639_10002604 | |||
| 1694 | Ga0207639_10006184 | |||
| 1695 | Ga0207678_10000306 | |||
| 1696 | Ga0207678_10001020 | |||
| 1697 | Ga0207678_10007277 | |||
| 1698 | Ga0207678_10092442 | |||
| 1699 | Ga0207708_10000382 | |||
| 1700 | Ga0207708_10001552 | |||
| 1701 | Ga0207708_10008147 | |||
| 1702 | Ga0207708_10070029 | |||
| 1703 | Ga0207708_10072844 | |||
| 1704 | Ga0207702_10022168 | |||
| 1705 | Ga0207702_10101256 | |||
| 1706 | Ga0207641_10008134 | |||
| 1707 | Ga0207641_10010582 | |||
| 1708 | Ga0207641_10039494 | |||
| 1709 | Ga0207641_10047478 | |||
| 1710 | Ga0207641_10079119 | |||
| 1711 | Ga0207641_10130049 | |||
| 1712 | Ga0207641_10202846 | |||
| 1713 | Ga0207648_10001543 | |||
| 1714 | Ga0207648_10004782 | |||
| 1715 | Ga0207648_10011595 | |||
| 1716 | Ga0207648_10023419 | |||
| 1717 | Ga0207648_10040757 | |||
| 1718 | Ga0207676_10000003 | |||
| 1719 | Ga0207676_10004850 | |||
| 1720 | Ga0207676_10044317 | |||
| 1721 | Ga0207676_10120415 | |||
| 1722 | Ga0207676_10169815 | |||
| 1723 | Ga0207674_10000052 | |||
| 1724 | Ga0207674_10002975 | |||
| 1725 | Ga0207674_10005532 | |||
| 1726 | Ga0207674_10064951 | |||
| 1727 | Ga0207674_10131797 | |||
| 1728 | Ga0207675_100000178 | |||
| 1729 | Ga0207675_100000448 | |||
| 1730 | Ga0207675_100001443 | |||
| 1731 | Ga0207675_100008376 | |||
| 1732 | Ga0207675_100014452 | |||
| 1733 | Ga0207683_10000746 | |||
| 1734 | Ga0207683_10001065 | |||
| 1735 | Ga0207683_10001720 | |||
| 1736 | Ga0207683_10005776 | |||
| 1737 | Ga0207683_10006227 | |||
| 1738 | Ga0207683_10022573 | |||
| 1739 | Ga0207698_10013985 | |||
| 1740 | Ga0207698_10016541 | |||
| 1741 | Ga0209371_1000004 | |||
| 1742 | Ga0209969_1000461 | |||
| 1743 | Ga0209967_1002692 | |||
| 1744 | Ga0209995_1000660 | |||
| 1745 | Ga0209179_1003929 | |||
| 1746 | Ga0209999_1005905 | |||
| 1747 | Ga0209588_1003131 | |||
| 1748 | Ga0209971_1000947 | |||
| 1749 | Ga0209974_10002636 | |||
| 1750 | Ga0209974_10004499 | |||
| 1751 | Ga0209974_10030390 | |||
| 1752 | Ga0207428_10008034 | |||
| 1753 | Ga0207428_10030182 | |||
| 1754 | Ga0268266_10012254 | |||
| 1755 | Ga0268266_10137036 | |||
| 1756 | Ga0268266_10164960 | |||
| 1757 | Ga0268266_10168477 | |||
| 1758 | Ga0268265_10000435 | |||
| 1759 | Ga0268265_10002275 | |||
| 1760 | Ga0268265_10003258 | |||
| 1761 | Ga0268265_10011011 | |||
| 1762 | Ga0268265_10066373 | |||
| 1763 | Ga0268265_10122229 | |||
| 1764 | Ga0268264_10018814 | |||
| 1765 | Ga0268264_10037447 | |||
| 1766 | Ga0268264_10087362 | |||
| 1767 | Ga0268264_10113232 | |||
| 1768 | Ga0268264_10114761 | |||
| 1769 | Ga0265334_10000005 | |||
| 1770 | Ga0265336_10000707 | |||
| 1771 | Ga0265338_10059795 | |||
| 1772 | Ga0265324_10000471 | |||
| 1773 | Ga0268256_1000005 | |||
| 1774 | Ga0316183_1012956 | |||
| 1775 | Ga0265332_10002887 | |||
| 1776 | Ga0265328_10024962 | |||
| 1777 | Ga0265325_10001388 | |||
| 1778 | Ga0265331_10003541 | |||
| 1779 | Ga0265327_10000103 | |||
| 1780 | Ga0265327_10000218 | |||
| 1781 | Ga0265316_10018527 | |||
| 1782 | Ga0265316_10039994 | |||
| 1783 | Ga0265316_10098849 | |||
| 1784 | Ga0307509_10001479 | |||
| 1785 | Ga0307408_100000013 | |||
| 1786 | Ga0307408_100117636 | |||
| 1787 | Ga0265313_10000014 | |||
| 1788 | Ga0316575_10000160 | |||
| 1789 | Ga0316575_10009816 | |||
| 1790 | Ga0316579_10030649 | |||
| 1791 | Ga0265314_10001405 | |||
| 1792 | Ga0316576_10005155 | |||
| 1793 | Ga0316576_10007031 | |||
| 1794 | Ga0316578_10017487 | |||
| 1795 | Ga0316578_10035343 | |||
| 1796 | Ga0307413_10001956 | |||
| 1797 | Ga0307410_10000274 | |||
| 1798 | Ga0307410_10015369 | |||
| 1799 | Ga0307406_10018458 | |||
| 1800 | Ga0307407_10000538 | |||
| 1801 | Ga0307412_10178096 | |||
| 1802 | Ga0307409_100050745 | |||
| 1803 | Ga0307409_100213330 | |||
| 1804 | Ga0307416_100045347 | |||
| 1805 | Ga0307416_100191774 | |||
| 1806 | Ga0307414_10009479 | |||
| 1807 | Ga0307414_10010491 | |||
| 1808 | Ga0307414_10044868 | |||
| 1809 | Ga0307414_10264785 | |||
| 1810 | Ga0307411_10008785 | |||
| 1811 | Ga0307415_100101149 | |||
| 1812 | Ga0316585_10023576 | |||
| 1813 | Ga0316593_10011167 | |||
| 1814 | Ga0316593_10021935 | |||
| 1815 | Ga0373929_0011927 | |||
| 1816 | Ga0373944_0018739 | |||
| 1817 | Ga0373952_0001197 | |||
| 1818 | Ga0373953_0009832 | |||
| 1819 | Ga0373954_0023593 | |||
| 1820 | Ga0373954_0026496 | |||
| 1821 | Ga0373956_0000260 | |||
| 1822 | Ga0373957_0005151 | |||
| 1823 | Ga0373957_0006986 | |||
| 1824 | Ga0373943_0019349 | |||
| 1825 | Ga0373943_0065665 | |||
| 1826 | Ga0373946_0056597 | |||
| 1827 | Ga0373955_0007379 | |||
| 1828 | Ga0373955_0008151 | |||
| 1829 | Ga0373942_0010777 | |||
| 1830 | Ga0373961_0027768 | |||
| 1831 | Ga0316574_0004197 | |||
| 1832 | Ga0316574_0004943 | |||
| 1833 | Ga0316574_0005166 | |||
| 1834 | Ga0316574_0028567 | |||
| 1835 | Ga0316574_0143764 | |||
| 1836 | Ga0373931_0007954 | |||
| 1837 | Ga0373931_0064565 | |||
| 1838 | Ga0373935_0019092 | |||
| 1839 | Ga0373935_0172654 | |||
| 1840 | Ga0373927_0007760 | |||
| 1841 | Ga0373933_0005945 | |||
| 1842 | Ga0373933_0021324 | |||
| 1843 | Ga0373933_0042567 | |||
| 1844 | Ga0373933_0147562 | |||
| 1845 | Ga0373937_0000487 | |||
| 1846 | Ga0373937_0010040 | |||
| 1847 | Ga0373937_0012434 | |||
| 1848 | Ga0373937_0035761 | |||
| 1849 | Ga0316584_0057397 | |||
| 1850 | Ga0373925_0012770 | |||
| 1851 | Ga0373925_0021018 | |||
| 1852 | Ga0373925_0033900 | |||
| 1853 | Ga0395900_0007406 | |||
| 1854 | Ga0395900_0103945 | |||
| 1855 | Ga0395898_0030569 | |||
| 1856 | Ga0395905_0003749 | |||
| 1857 | Ga0395905_0027570 | |||
| 1858 | Ga0395905_0044927 | |||
| 1859 | Ga0436364_0432166 | |||
| 1860 | Ga0395901_0012006 | |||
| 1861 | Ga0395901_0068186 | |||
| 1862 | Ga0237819_00915 | |||
| 1863 | Ga0237819_03199 | |||
| 1864 | Ga0400487_46050 | |||
| 1865 | Ga0436365_0076061 | |||
| 1866 | Ga0436361_0050017 | |||
| 1867 | Ga0436363_1709594 | |||
| 1868 | Ga0439465_0008504 | |||
| 1869 | Ga0439437_000550 | |||
| 1870 | Ga0439445_0007253 | |||
| 1871 | Ga0439448_0020208 | |||
| 1872 | Ga0450911_000012 | |||
| 1873 | Ga0439446_0011478 | |||
| 1874 | Ga0451577_0000002 | |||
| 1875 | Ga0451577_0000402 | |||
| 1876 | Ga0451577_0017088 | |||
| 1877 | Ga0451577_0021269 | |||
| 1878 | Ga0451577_0026706 | |||
| 1879 | Ga0451577_0053334 | |||
| 1880 | Ga0451577_0073138 | |||
| 1881 | Ga0453683_0000011 | |||
| 1882 | Ga0453683_0113823 | |||
| 1883 | Ga0453684_0000002 | |||
| 1884 | Ga0453684_0000040 | |||
| 1885 | Ga0453684_0000065 | |||
| 1886 | Ga0453684_0000136 | |||
| 1887 | Ga0453684_0001174 | |||
| 1888 | Ga0453684_0126052 | |||
| 1889 | Ga0451576_0000004 | |||
| 1890 | Ga0451576_0000025 | |||
| 1891 | Ga0451576_0000131 | |||
| 1892 | Ga0451576_0001381 | |||
| 1893 | Ga0451576_0025176 | |||
| 1894 | Ga0451576_0109027 | |||
| 1895 | Ga0466967_0141310 | |||
| 1896 | Ga0495592_0000449 | |||
| 1897 | Ga0495592_0080837 | |||
| 1898 | Ga0495638_0001128 | |||
| 1899 | Ga0495651_0001710 | |||
| 1900 | Ga0495651_0055429 | |||
| 1901 | Ga0495580_0067725 | |||
| 1902 | Ga0495580_0154162 | |||
| 1903 | Ga0495582_0013485 | |||
| 1904 | Ga0495639_0018316 | |||
| 1905 | Ga0495662_0033484 | |||
| 1906 | Ga0495664_0055171 | |||
| 1907 | Ga0495594_0040143 | |||
| 1908 | Ga0495606_0007681 | |||
| 1909 | Ga0495608_0127296 | |||
| 1910 | Ga0495628_0001138 | |||
| 1911 | Ga0495628_0027455 | |||
| 1912 | Ga0495628_0073782 | |||
| 1913 | Ga0495630_0034416 | |||
| 1914 | Ga0495648_0010210 | |||
| 1915 | Ga0495663_0000429 | |||
| 1916 | Ga0495663_0000891 | |||
| 1917 | Ga0495652_0009506 | |||
| 1918 | Ga0495652_0117524 | |||
| 1919 | Ga0495654_0001417 | |||
| 1920 | Ga0495665_0036691 | |||
| 1921 | Ga0495640_0094458 | |||
| 1922 | Ga0495621_0000016 | |||
| 1923 | Ga0495621_0003268 | |||
| 1924 | Ga0495621_0022890 | |||
| 1925 | Ga0495621_0036649 | |||
| 1926 | Ga0495645_0000567 | |||
| 1927 | Ga0495645_0004604 | |||
| 1928 | Ga0495633_0089538 | |||
| 1929 | Ga0495667_0042455 | |||
| 1930 | Ga0495635_0061737 | |||
| 1931 | Ga0495661_0000093 | |||
| 1932 | Ga0495657_0137967 | |||
| 1933 | Ga0495599_0003542 | |||
| 1934 | Ga0495646_0074552 | |||
| 1935 | Ga0495647_0017940 | |||
| 1936 | Ga0495647_0050195 | |||
| 1937 | Ga0495658_0014018 | |||
| 1938 | Ga0495613_0024840 | |||
| 1939 | Ga0495671_0002983 | |||
| 1940 | Ga0495600_0038582 | |||
| 1941 | Ga0495581_0001860 | |||
| 1942 | Ga0495604_0110347 | |||
| 1943 | Ga0495636_0005078 | |||
| 1944 | Ga0495674_0072954 | |||
| 1945 | Ga0495672_0000134 | |||
| 1946 | Ga0495672_0004693 | |||
| 1947 | Ga0495672_0086663 | |||
| 1948 | Ga0495680_0014464 | |||
| 1949 | Ga0495684_0016945 | |||
| 1950 | Ga0495593_0026222 | |||
| 1951 | Ga0495602_0080127 | |||
| 1952 | Ga0496100_0099654 | |||
| 1953 | Ga0496100_0128154 | |||
| 1954 | Ga0496101_0033519 | |||
| 1955 | Ga0496101_0070560 | |||
| 1956 | Ga0496101_0071353 | |||
| 1957 | Ga0496102_0041999 | |||
| 1958 | Ga0496103_0053346 | |||
| 1959 | Ga0496104_0006723 | |||
| 1960 | Ga0496104_0009610 | |||
| 1961 | Ga0496105_0006614 | |||
| 1962 | Ga0496105_0105344 | |||
| 1963 | Ga0496106_0007884 | |||
| 1964 | Ga0496106_0053112 | |||
| 1965 | Ga0496108_0003143 | |||
| 1966 | Ga0496108_0014932 | |||
| 1967 | Ga0496108_0019745 | |||
| 1968 | Ga0496109_0001481 | |||
| 1969 | Ga0496109_0149381 | |||
| 1970 | Ga0496109_0197925 | |||
| 1971 | Ga0496110_0005552 | |||
| 1972 | Ga0496110_0012614 | |||
| 1973 | Ga0496111_0003169 | |||
| 1974 | Ga0496112_0011093 | |||
| 1975 | Ga0496114_0035421 | |||
| 1976 | Ga0496115_0007091 | |||
| 1977 | Ga0496115_0036524 | |||
| 1978 | Ga0496115_0205269 | |||
| 1979 | Ga0496116_0000008 | |||
| 1980 | Ga0496117_0001343 | |||
| 1981 | Ga0496117_0028830 | |||
| 1982 | Ga0496118_0000145 | |||
| 1983 | Ga0496118_0001486 | |||
| 1984 | Ga0496118_0004832 | |||
| 1985 | Ga0496120_0000525 | |||
| 1986 | Ga0496121_0000012 | |||
| 1987 | Ga0496121_0045105 | |||
| 1988 | Ga0496121_0170810 | |||
| 1989 | Ga0496122_0000062 | |||
| 1990 | Ga0496122_0023731 | |||
| 1991 | Ga0496123_0010330 | |||
| 1992 | Ga0496123_0017728 | |||
| 1993 | Ga0496124_0000255 | |||
| 1994 | Ga0496124_0013804 | |||
| 1995 | Ga0496124_0071694 | |||
| 1996 | Ga0496125_0013402 | |||
| 1997 | Ga0496126_0017269 | |||
| 1998 | Ga0501031_0028864 | |||
| 1999 | Ga0501034_0000273 | |||
| 2000 | Ga0501034_0000571 | |||
| 2001 | Ga0501034_0054294 | |||
| 2002 | Ga0501036_0013100 | |||
| 2003 | Ga0501036_0041825 | |||
| 2004 | Ga0501036_0079955 | |||
| 2005 | Ga0501036_0117894 | |||
| 2006 | Ga0501037_0065601 | |||
| 2007 | Ga0501038_0004369 | |||
| 2008 | Ga0501038_0049384 | |||
| 2009 | Ga0501038_0107633 | |||
| 2010 | Ga0501039_0000126 | |||
| 2011 | Ga0501039_0010087 | |||
| 2012 | Ga0501039_0021369 | |||
| 2013 | Ga0501039_0037554 | |||
| 2014 | Ga0501040_0015976 | |||
| 2015 | Ga0501040_0023276 | |||
| 2016 | Ga0501040_0105094 | |||
| 2017 | Ga0501041_0000283 | |||
| 2018 | Ga0501041_0004904 | |||
| 2019 | Ga0501041_0030700 | |||
| 2020 | Ga0501041_0031447 | |||
| 2021 | Ga0501041_0057553 | |||
| 2022 | Ga0501042_0000022 | |||
| 2023 | Ga0501042_0009519 | |||
| 2024 | Ga0501043_0056571 | |||
| 2025 | Ga0501047_0017694 | |||
| 2026 | Ga0501068_0001639 | |||
| 2027 | Ga0501068_0047424 | |||
| 2028 | Ga0501068_0049744 | |||
| 2029 | Ga0501068_0052322 | |||
| 2030 | Ga0501069_0029361 | |||
| 2031 | Ga0501070_0026718 | |||
| 2032 | Ga0501070_0075477 | |||
| 2033 | Ga0501070_0099865 | |||
| 2034 | Ga0501070_0142883 | |||
| 2035 | Ga0501071_0029929 | |||
| 2036 | Ga0501071_0072462 | |||
| 2037 | Ga0501071_0087967 | |||
| 2038 | Ga0501072_0002838 | |||
| 2039 | Ga0501072_0060665 | |||
| 2040 | Ga0501072_0078424 | |||
| 2041 | Ga0501073_0003036 | |||
| 2042 | Ga0501073_0015610 | |||
| 2043 | Ga0501074_0008184 | |||
| 2044 | Ga0501074_0016754 | |||
| 2045 | Ga0501074_0035483 | |||
| 2046 | Ga0501074_0043599 | |||
| 2047 | Ga0501075_0000128 | |||
| 2048 | Ga0501075_0001228 | |||
| 2049 | Ga0501075_0034527 | |||
| 2050 | Ga0501076_0000135 | |||
| 2051 | Ga0501076_0018908 | |||
| 2052 | Ga0501076_0032101 | |||
| 2053 | Ga0501077_0056282 | |||
| 2054 | Ga0501077_0091211 | |||
| 2055 | Ga0501079_0000027 | |||
| 2056 | Ga0501079_0035468 | |||
| 2057 | Ga0501079_0050763 | |||
| 2058 | Ga0501079_0051902 | |||
| 2059 | Ga0501080_0013617 | |||
| 2060 | Ga0501080_0025658 | |||
| 2061 | Ga0501080_0036276 | |||
| 2062 | Ga0501080_0036955 | |||
| 2063 | Ga0501080_0069238 | |||
| 2064 | Ga0501081_0015302 | |||
| 2065 | Ga0501081_0023649 | |||
| 2066 | Ga0501081_0046535 | |||
| 2067 | Ga0501083_0008802 | |||
| 2068 | Ga0501083_0030314 | |||
| 2069 | Ga0501083_0085102 | |||
| 2070 | Ga0501280_002654 | |||
| 2071 | Ga0501035_0224906 | |||
| 2072 | Ga0501045_0004429 | |||
| 2073 | Ga0501045_0195914 | |||
| 2074 | nmdc:mga03683_3263_c1 | |||
| 2075 | nmdc:mga03n38_609_c1 | |||
| 2076 | nmdc:mga00v17_121_c1 | |||
| 2077 | nmdc:mga00v17_158_c1 | |||
| 2078 | nmdc:mga00v17_1845_c1 | |||
| 2079 | nmdc:mga0yw44_187_c1 | |||
| 2080 | nmdc:mga0k408_40587_c1 | |||
| 2081 | nmdc:mga0k408_5171_c2 | |||
| 2082 | nmdc:mga06z11_622_c1 | |||
| 2083 | nmdc:mga06z11_879_c1 | |||
| 2084 | nmdc:mga07m45_456_c1 | |||
| 2085 | nmdc:mga05p37_133_c1 | |||
| 2086 | nmdc:mga05p37_1706_c1 | |||
| 2087 | nmdc:mga05p37_8018_c1 | |||
| 2088 | nmdc:mga09592_1764_c1 | |||
| 2089 | nmdc:mga09592_26_c1 | |||
| 2090 | nmdc:mga09592_40987_c1 | |||
| 2091 | nmdc:mga0qj67_103581_c1 | |||
| 2092 | nmdc:mga0qj67_165691_c1 | |||
| 2093 | nmdc:mga0qj67_40531_c1 | |||
| 2094 | nmdc:mga0qj67_43602_c1 | |||
| 2095 | nmdc:mga0qj67_573_c1 | |||
| 2096 | nmdc:mga06r32_1651_c1 | |||
| 2097 | nmdc:mga06r32_169948_c1 | |||
| 2098 | nmdc:mga06r32_22223_c1 | |||
| 2099 | nmdc:mga06r32_40_c1 | |||
| 2100 | nmdc:mga06r32_584_c1 | |||
| 2101 | nmdc:mga08y16_19070_c1 | |||
| 2102 | nmdc:mga08y16_232000_c1 | |||
| 2103 | nmdc:mga08y16_27121_c1 | |||
| 2104 | nmdc:mga0n895_182812_c1 | |||
| 2105 | nmdc:mga0n895_338503_c1 | |||
| 2106 | nmdc:mga0n895_61001_c1 | |||
| 2107 | nmdc:mga0a205_247855_c1 | |||
| 2108 | nmdc:mga0a205_61236_c1 | |||
| 2109 | nmdc:mga0a205_65285_c1 | |||
| 2110 | nmdc:mga0sz30_369_c2 | |||
| 2111 | Ga0495601_0022354 | |||
| 2112 | Ga0495601_0054667 | |||
| 2113 | Ga0495612_0047257 | |||
| 2114 | Ga0495595_0049803 | |||
| 2115 | Ga0500643_013356 | |||
| 2116 | Ga0500651_0000636 | |||
| 2117 | Ga0500634_0000070 | |||
| 2118 | Ga0501084_0007572 | |||
| 2119 | Ga0501082_0004029 | |||
| 2120 | Ga0501082_0028682 | |||
| 2121 | Ga0501082_0044053 | |||
| 2122 | Ga0501082_0099393 | |||
| 2123 | Ga0501082_0248610 | |||
| 2124 | Ga0530510_0000111 | |||
| 2125 | Ga0530510_0004913 | |||
| 2126 | Ga0530510_0048773 | |||
| 2127 | 2547375481 | |||
| 2128 | 2572255408 | |||
| 2129 | 2578458922 | |||
| 2130 | 2599945047 | |||
| 2131 | 2599955224 | |||
| 2132 | 2599983957 | |||
| 2133 | 2599990325 | |||
| 2134 | 2600001733 | |||
| 2135 | 2600048859 | |||
| 2136 | 2643881520 | |||
| 2137 | 2644662656 | |||
| 2138 | 2644698390 | |||
| 2139 | 2765578442 | |||
| 2140 | 2808857279 | |||
| 2141 | 2808905290 | |||
| 2142 | 2808926415 | |||
| 2143 | 2808937417 | |||
| 2144 | 2808948576 | |||
| 2145 | 2808965747 | |||
| 2146 | 2809000654 | |||
| 2147 | 2816516459 | |||
| 2148 | 2842781544 | |||
| 2149 | 2843691361 | |||
| 2150 | 2852651273 | |||
| 2151 | 2857446762 | |||
| 2152 | 2894414537 | |||
| 2153 | 2919498195 | |||
| 2154 | 2919516898 | |||
| 2155 | 2919675534 | |||
| 2156 | 2923517634 | |||
| 2157 | 2939590568 | |||
| 2158 | 2939622736 | |||
| 2159 | 2946007427 | |||
| 2160 | 2961067169 | |||
| 2161 | 2974309385 | |||
| 2162 | 2977250105 | |||
| 2163 | 2984515405 | |||
| 2164 | 2998344551 | |||
| 2165 | 8002869610 | |||
| 2166 | 8003016643 | |||
| 2167 | 8034966989 | |||
| 2168 | 8054732065 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mjx-assembly1.cif.gz_A | miab in the complex with 5'-deoxyadenosine, methionine and rna | 0.9139 | 19 | 447 |
| 7mjz-assembly1.cif.gz_A | the structure of miab with pentasulfide bridge | 0.906 | 19 | 449 |
| 7mjx-assembly1.cif.gz_A | miab in the complex with 5'-deoxyadenosine, methionine and rna | 0.8862 | 19 | 447 |
| 7mjz-assembly1.cif.gz_A | the structure of miab with pentasulfide bridge | 0.8795 | 19 | 449 |
| 2qgq-assembly1.cif.gz_A | crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 | 0.8598 | 162 | 447 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEI1_3_129_3.40.50.12160 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain | 0.9977 | 19 | 145 | 3.40.50.12160 |
| af_P0AEI1_378_440_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9971 | 384 | 447 | 2.40.50.140 |
| af_P0AEI1_3_129_3.40.50.12160 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain | 0.99 | 19 | 145 | 3.40.50.12160 |
| af_P0AEI1_378_440_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9815 | 384 | 447 | 2.40.50.140 |
| af_Q2FZ02_442_504_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9668 | 385 | 447 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E2N0H9-F1-model_v4 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | 0.9952 | 17 | 137 |
GO:0005829
GO:0035597 GO:0046872 GO:0051539 |
| AF-A0A2M7XLY8-F1-model_v4 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | 0.9946 | 276 | 375 |
GO:0005829
GO:0035597 GO:0051539 |
| AF-A0A6I5RNI4-F1-model_v4 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | 0.9932 | 17 | 196 |
GO:0005829
GO:0035597 GO:0046872 GO:0051539 |
| AF-A0A2N5ABG4-F1-model_v4 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | 0.9921 | 17 | 116 |
GO:0005829
GO:0035597 GO:0046872 GO:0051539 |
| AF-A0A2R7PI60-F1-model_v4 | deleted | 0.9902 | 17 | 122 |
|