F489736
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1084 | 629 | 2168 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10125164|Ga0070681_101251643 |
| Length | 327 |
| Sequence | MRPLTQVSLLPTAVMPSPTRGEGAATGAGEEKKSSGENAHMPINYEQLMALKNLGQKYAYGDREVMLYAYGIGMGNDPMDEKELAFVNETSADPRPLKVVPTFASVAAWGAGPGEMNLNRVMVVDGERDITFHKPLATSANITADSTVLAAFDKGKDKGAVIRHQTVLKDAASGEKLATLVASRFARGDGGFGGPSEGQPEPHAMPNRAPDRTVDIVTRPDQALIYRLCGDRNPLHSDPGFAKKAGFPKPILHGMCTYGITCRGVLQTYADYDPSAFRQHAARFSSPVYPGDTVTMEMWKDGNVISFEAKVKARNVTVIKSGKTVLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 74 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 75 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 103 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 104 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 105 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 184 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 198 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 320 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 323 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 375 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 378 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 379 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 381 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 382 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 383 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 384 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 386 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 390 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 391 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 392 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 393 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 395 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 397 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 398 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 400 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 402 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 404 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 406 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 407 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 408 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 409 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 410 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 411 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 412 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 413 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 414 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 415 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 416 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 417 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 418 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 419 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 420 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 421 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 422 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 423 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 424 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 425 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 426 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 427 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 428 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 429 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 430 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 431 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 432 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 433 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 434 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 435 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 436 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 437 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 438 | 2791355199 | |||
| 439 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 440 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 441 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 442 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 443 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 444 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 445 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 446 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 447 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 448 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 449 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 450 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 451 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 452 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 453 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 454 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 455 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 456 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 457 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 458 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 459 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 460 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 461 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 462 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 463 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 464 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 465 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 466 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 467 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 468 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 469 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 470 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 471 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 472 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 473 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 474 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 475 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 476 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 477 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 478 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 479 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 480 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 481 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 482 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 483 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 484 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 485 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 486 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 487 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 488 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 489 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 490 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 491 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 492 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 493 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 494 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 495 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 496 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 497 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 498 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 499 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 500 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 501 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 502 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 503 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 504 | 2904699407 | |||
| 505 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 506 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 507 | 2906610324 | |||
| 508 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 509 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 510 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 511 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 512 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 513 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 514 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 515 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 516 | 2922368715 | |||
| 517 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 518 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 519 | 2922425934 | |||
| 520 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 521 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 522 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 523 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 524 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 525 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 526 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 527 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 528 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 529 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 530 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 531 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 532 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 533 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 534 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 535 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 536 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 537 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 538 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 539 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 540 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 541 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 542 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 543 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 544 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 545 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 546 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 547 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 548 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 549 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 550 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 551 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 552 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 553 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 554 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 555 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 556 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 557 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 558 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 559 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 560 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 561 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 562 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 563 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 564 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 565 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 566 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 567 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 568 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 569 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 570 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 571 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 572 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 573 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 574 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 575 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 576 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 577 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 578 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 579 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 580 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 581 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 582 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 583 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 584 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 585 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 586 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 587 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 588 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 589 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 590 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 591 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 592 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 593 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 594 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 595 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 596 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 597 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 598 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 599 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 600 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 601 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 602 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 603 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 604 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 605 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 606 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 607 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 608 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 609 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 610 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 611 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 612 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 613 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 614 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 615 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 616 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 617 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 618 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 619 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 620 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 621 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 622 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 623 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 624 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 625 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 626 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 627 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 628 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 629 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.22 |
| Metatranscriptomes | 0.09 |
| Isolates | 21.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.67 |
| Nodule | 18.82 |
| Rhizoplane | 5.26 |
| Rhizosphere | 57.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070681_10125164 | 3300005458 | Bacteria | 2503 |
| 2 | JGI24740J21852_10011523 | 3300001979 | Bacteria | 3364 |
| 3 | JGI24739J22299_10002438 | 3300001989 | Bacteria | 7177 |
| 4 | JGI24737J22298_10004854 | 3300001990 | Bacteria | 4663 |
| 5 | JGI25406J46586_10001179 | 3300003203 | Bacteria | 12300 |
| 6 | JGI25153J46596_10005204 | 3300003215 | Bacteria | 6846 |
| 7 | JGI25153J46596_10007403 | 3300003215 | Bacteria | 5405 |
| 8 | JGI25160J50197_1010719 | 3300003354 | Bacteria | 3294 |
| 9 | JGI25160J50197_1020474 | 3300003354 | Bacteria | 1994 |
| 10 | Ga0055542_1016876 | 3300003762 | Bacteria | 1141 |
| 11 | Ga0055531_10019315 | 3300003794 | Bacteria | 2764 |
| 12 | Ga0065165_1001478 | 3300005262 | Bacteria | 25070 |
| 13 | Ga0065165_1033961 | 3300005262 | Bacteria | 1582 |
| 14 | Ga0070683_100014448 | 3300005329 | Bacteria | 6906 |
| 15 | Ga0068869_100101705 | 3300005334 | Bacteria | 2174 |
| 16 | Ga0070680_100006838 | 3300005336 | Bacteria | 8693 |
| 17 | Ga0070680_100178987 | 3300005336 | Bacteria | 1786 |
| 18 | Ga0070680_100329943 | 3300005336 | Bacteria | 1296 |
| 19 | Ga0070682_100133581 | 3300005337 | Bacteria | 1682 |
| 20 | Ga0070682_100168088 | 3300005337 | Bacteria | 1521 |
| 21 | Ga0068868_100027083 | 3300005338 | Bacteria | 4371 |
| 22 | Ga0068868_100098904 | 3300005338 | Bacteria | 2359 |
| 23 | Ga0070660_100000712 | 3300005339 | Bacteria | 22019 |
| 24 | Ga0070660_100382026 | 3300005339 | Bacteria | 1163 |
| 25 | Ga0070660_100383745 | 3300005339 | Bacteria | 1160 |
| 26 | Ga0070661_100260617 | 3300005344 | Bacteria | 1340 |
| 27 | Ga0070668_100180001 | 3300005347 | Bacteria | 1726 |
| 28 | Ga0070668_100453793 | 3300005347 | Bacteria | 1103 |
| 29 | Ga0070674_100294431 | 3300005356 | Bacteria | 1291 |
| 30 | Ga0070673_100447284 | 3300005364 | Bacteria | 1162 |
| 31 | Ga0070673_100660345 | 3300005364 | Bacteria | 958 |
| 32 | Ga0070667_100424558 | 3300005367 | Bacteria | 1212 |
| 33 | Ga0070667_100499957 | 3300005367 | Bacteria | 1114 |
| 34 | Ga0070709_10000551 | 3300005434 | Bacteria | 21925 |
| 35 | Ga0070709_10105298 | 3300005434 | Bacteria | 1886 |
| 36 | Ga0070714_100397026 | 3300005435 | Bacteria | 1303 |
| 37 | Ga0070713_100226282 | 3300005436 | Bacteria | 1698 |
| 38 | Ga0070713_100586841 | 3300005436 | Bacteria | 1058 |
| 39 | Ga0070710_10001238 | 3300005437 | Bacteria | 12107 |
| 40 | Ga0070710_10001820 | 3300005437 | Bacteria | 10067 |
| 41 | Ga0070710_10102745 | 3300005437 | Bacteria | 1705 |
| 42 | Ga0070710_10268015 | 3300005437 | Bacteria | 1103 |
| 43 | Ga0070701_10051860 | 3300005438 | Bacteria | 2129 |
| 44 | Ga0070711_100002350 | 3300005439 | Bacteria | 10755 |
| 45 | Ga0070711_100003473 | 3300005439 | Bacteria | 9187 |
| 46 | Ga0070711_100079148 | 3300005439 | Bacteria | 2337 |
| 47 | Ga0070711_100305852 | 3300005439 | Bacteria | 1266 |
| 48 | Ga0070711_100372393 | 3300005439 | Bacteria | 1153 |
| 49 | Ga0070694_100328072 | 3300005444 | Bacteria | 1180 |
| 50 | Ga0070708_100046602 | 3300005445 | Bacteria | 3826 |
| 51 | Ga0070708_100490488 | 3300005445 | Bacteria | 1159 |
| 52 | Ga0070663_100040475 | 3300005455 | Bacteria | 3263 |
| 53 | Ga0070663_100054123 | 3300005455 | Bacteria | 2867 |
| 54 | Ga0070663_100054938 | 3300005455 | Bacteria | 2848 |
| 55 | Ga0070663_100103558 | 3300005455 | Bacteria | 2127 |
| 56 | Ga0070663_100170693 | 3300005455 | Bacteria | 1681 |
| 57 | Ga0070678_100039966 | 3300005456 | Bacteria | 3315 |
| 58 | Ga0070678_100132998 | 3300005456 | Bacteria | 1979 |
| 59 | Ga0070678_100260387 | 3300005456 | Bacteria | 1458 |
| 60 | Ga0070662_100027262 | 3300005457 | Bacteria | 3963 |
| 61 | Ga0070662_100099029 | 3300005457 | Bacteria | 2203 |
| 62 | Ga0070681_10110287 | 3300005458 | Bacteria | 2691 |
| 63 | Ga0070681_10122346 | 3300005458 | Bacteria | 2535 |
| 64 | Ga0070681_10419940 | 3300005458 | Bacteria | 1249 |
| 65 | Ga0068867_100021615 | 3300005459 | Bacteria | 4592 |
| 66 | Ga0070706_100228573 | 3300005467 | Bacteria | 1737 |
| 67 | Ga0070707_100086015 | 3300005468 | Bacteria | 3040 |
| 68 | Ga0070698_100036324 | 3300005471 | Bacteria | 5090 |
| 69 | Ga0070698_100210116 | 3300005471 | Bacteria | 1881 |
| 70 | Ga0070698_100498268 | 3300005471 | Bacteria | 1156 |
| 71 | Ga0070679_100022733 | 3300005530 | Bacteria | 6131 |
| 72 | Ga0068853_100005063 | 3300005539 | Bacteria | 10282 |
| 73 | Ga0068853_100006754 | 3300005539 | Bacteria | 9141 |
| 74 | Ga0068853_100012289 | 3300005539 | Bacteria | 6962 |
| 75 | Ga0068853_100186409 | 3300005539 | Bacteria | 1883 |
| 76 | Ga0070665_100026061 | 3300005548 | Bacteria | 5888 |
| 77 | Ga0070665_100047830 | 3300005548 | Bacteria | 4293 |
| 78 | Ga0070665_100082828 | 3300005548 | Bacteria | 3213 |
| 79 | Ga0070665_100146919 | 3300005548 | Bacteria | 2361 |
| 80 | Ga0068855_100021262 | 3300005563 | Bacteria | 7779 |
| 81 | Ga0068855_100064535 | 3300005563 | Bacteria | 4270 |
| 82 | Ga0068855_100187454 | 3300005563 | Bacteria | 2336 |
| 83 | Ga0068855_100188165 | 3300005563 | Bacteria | 2330 |
| 84 | Ga0068855_100305708 | 3300005563 | Bacteria | 1760 |
| 85 | Ga0068855_100310782 | 3300005563 | Bacteria | 1744 |
| 86 | Ga0068855_100566108 | 3300005563 | Bacteria | 1229 |
| 87 | Ga0068857_100004213 | 3300005577 | Bacteria | 12115 |
| 88 | Ga0068857_100010308 | 3300005577 | Bacteria | 8117 |
| 89 | Ga0068857_100187082 | 3300005577 | Bacteria | 1885 |
| 90 | Ga0068857_100245940 | 3300005577 | Bacteria | 1639 |
| 91 | Ga0068857_100562039 | 3300005577 | Bacteria | 1075 |
| 92 | Ga0068854_100006781 | 3300005578 | Bacteria | 7298 |
| 93 | Ga0068854_100064356 | 3300005578 | Bacteria | 2664 |
| 94 | Ga0068854_100083015 | 3300005578 | Bacteria | 2369 |
| 95 | Ga0068856_100000680 | 3300005614 | Bacteria | 36872 |
| 96 | Ga0068856_100005799 | 3300005614 | Bacteria | 12168 |
| 97 | Ga0068856_100014113 | 3300005614 | Bacteria | 7725 |
| 98 | Ga0068856_100204010 | 3300005614 | Bacteria | 1992 |
| 99 | Ga0070702_100034742 | 3300005615 | Bacteria | 2780 |
| 100 | Ga0068852_100002663 | 3300005616 | Bacteria | 12346 |
| 101 | Ga0068852_100026836 | 3300005616 | Bacteria | 4687 |
| 102 | Ga0068852_100159343 | 3300005616 | Bacteria | 2106 |
| 103 | Ga0068859_100520475 | 3300005617 | Bacteria | 1284 |
| 104 | Ga0068864_100089844 | 3300005618 | Bacteria | 2707 |
| 105 | Ga0068861_100197148 | 3300005719 | Bacteria | 1687 |
| 106 | Ga0068851_10005696 | 3300005834 | Bacteria | 5663 |
| 107 | Ga0068851_10024772 | 3300005834 | Bacteria | 2940 |
| 108 | Ga0068851_10052686 | 3300005834 | Bacteria | 2070 |
| 109 | Ga0068858_100125234 | 3300005842 | Bacteria | 2405 |
| 110 | Ga0068858_100266066 | 3300005842 | Bacteria | 1631 |
| 111 | Ga0068860_100073802 | 3300005843 | Bacteria | 3243 |
| 112 | Ga0068862_100303885 | 3300005844 | Bacteria | 1468 |
| 113 | Ga0081455_10000992 | 3300005937 | Bacteria | 36052 |
| 114 | Ga0081455_10092423 | 3300005937 | Bacteria | 2448 |
| 115 | Ga0081455_10141514 | 3300005937 | Bacteria | 1868 |
| 116 | Ga0081538_10063422 | 3300005981 | Bacteria | 2098 |
| 117 | Ga0081540_1014248 | 3300005983 | Bacteria | 5106 |
| 118 | Ga0081540_1059502 | 3300005983 | Bacteria | 1834 |
| 119 | Ga0081540_1073290 | 3300005983 | Bacteria | 1574 |
| 120 | Ga0081540_1083716 | 3300005983 | Bacteria | 1426 |
| 121 | Ga0081540_1099546 | 3300005983 | Bacteria | 1256 |
| 122 | Ga0081540_1116501 | 3300005983 | Bacteria | 1118 |
| 123 | Ga0081539_10000897 | 3300005985 | Bacteria | 56772 |
| 124 | Ga0081539_10008354 | 3300005985 | Bacteria | 9047 |
| 125 | Ga0070717_10064707 | 3300006028 | Bacteria | 3038 |
| 126 | Ga0075365_10102146 | 3300006038 | Bacteria | 1964 |
| 127 | Ga0075368_10093412 | 3300006042 | Bacteria | 1231 |
| 128 | Ga0075363_100054846 | 3300006048 | Bacteria | 2133 |
| 129 | Ga0070715_10126896 | 3300006163 | Bacteria | 1223 |
| 130 | Ga0070716_100019469 | 3300006173 | Bacteria | 3548 |
| 131 | Ga0070716_100035052 | 3300006173 | Bacteria | 2756 |
| 132 | Ga0070716_100264459 | 3300006173 | Bacteria | 1179 |
| 133 | Ga0070712_100062581 | 3300006175 | Bacteria | 2631 |
| 134 | Ga0070712_100202109 | 3300006175 | Bacteria | 1562 |
| 135 | Ga0070712_100283348 | 3300006175 | Bacteria | 1335 |
| 136 | Ga0075367_10031433 | 3300006178 | Bacteria | 3048 |
| 137 | Ga0075367_10082594 | 3300006178 | Bacteria | 1945 |
| 138 | Ga0075367_10083956 | 3300006178 | Bacteria | 1930 |
| 139 | Ga0075369_10036513 | 3300006186 | Bacteria | 2091 |
| 140 | Ga0075366_10110069 | 3300006195 | Bacteria | 1656 |
| 141 | Ga0097621_100127508 | 3300006237 | Bacteria | 2163 |
| 142 | Ga0097621_100262800 | 3300006237 | Bacteria | 1515 |
| 143 | Ga0097621_100437272 | 3300006237 | Bacteria | 1177 |
| 144 | Ga0075370_10159321 | 3300006353 | Bacteria | 1324 |
| 145 | Ga0068871_100220918 | 3300006358 | Bacteria | 1641 |
| 146 | Ga0068871_100341907 | 3300006358 | Bacteria | 1322 |
| 147 | Ga0068865_100089419 | 3300006881 | Bacteria | 2230 |
| 148 | Ga0068865_100156347 | 3300006881 | Bacteria | 1735 |
| 149 | Ga0075436_100028108 | 3300006914 | Bacteria | 3871 |
| 150 | Ga0097620_100520457 | 3300006931 | Bacteria | 1284 |
| 151 | Ga0099825_1039902 | 3300006941 | Bacteria | 1418 |
| 152 | Ga0099824_1009535 | 3300006942 | Bacteria | 11905 |
| 153 | Ga0099824_1029734 | 3300006942 | Bacteria | 2285 |
| 154 | Ga0099824_1031717 | 3300006942 | Bacteria | 1971 |
| 155 | Ga0099823_1019354 | 3300006944 | Bacteria | 6504 |
| 156 | Ga0099794_10154006 | 3300007265 | Bacteria | 1167 |
| 157 | Ga0105240_10002310 | 3300009093 | Bacteria | 30856 |
| 158 | Ga0105240_10012829 | 3300009093 | Bacteria | 11544 |
| 159 | Ga0105240_10050635 | 3300009093 | Bacteria | 5234 |
| 160 | Ga0105240_10056950 | 3300009093 | Bacteria | 4887 |
| 161 | Ga0105240_10319942 | 3300009093 | Bacteria | 1769 |
| 162 | Ga0105240_10543246 | 3300009093 | Bacteria | 1287 |
| 163 | Ga0111539_10215700 | 3300009094 | Bacteria | 2235 |
| 164 | Ga0105245_10248688 | 3300009098 | Bacteria | 1726 |
| 165 | Ga0105245_10266516 | 3300009098 | Bacteria | 1669 |
| 166 | Ga0105245_10350566 | 3300009098 | Bacteria | 1462 |
| 167 | Ga0105241_10000959 | 3300009174 | Bacteria | 21816 |
| 168 | Ga0105241_10041926 | 3300009174 | Bacteria | 3460 |
| 169 | Ga0105241_10074708 | 3300009174 | Bacteria | 2640 |
| 170 | Ga0105242_10521080 | 3300009176 | Bacteria | 1134 |
| 171 | Ga0105248_10246252 | 3300009177 | Bacteria | 2012 |
| 172 | Ga0105248_10284689 | 3300009177 | Bacteria | 1861 |
| 173 | Ga0105248_10682701 | 3300009177 | Bacteria | 1159 |
| 174 | Ga0105237_10002162 | 3300009545 | Bacteria | 24710 |
| 175 | Ga0105237_10044143 | 3300009545 | Bacteria | 4489 |
| 176 | Ga0105237_10085641 | 3300009545 | Bacteria | 3141 |
| 177 | Ga0105237_10102084 | 3300009545 | Bacteria | 2860 |
| 178 | Ga0105237_10126794 | 3300009545 | Bacteria | 2547 |
| 179 | Ga0105237_10212943 | 3300009545 | Bacteria | 1932 |
| 180 | Ga0105237_10484908 | 3300009545 | Bacteria | 1242 |
| 181 | Ga0105237_10513597 | 3300009545 | Bacteria | 1205 |
| 182 | Ga0105238_10008888 | 3300009551 | Bacteria | 10053 |
| 183 | Ga0105238_10019184 | 3300009551 | Bacteria | 6967 |
| 184 | Ga0105238_10088428 | 3300009551 | Bacteria | 3084 |
| 185 | Ga0105238_10441205 | 3300009551 | Bacteria | 1298 |
| 186 | Ga0105249_10191479 | 3300009553 | Bacteria | 1996 |
| 187 | Ga0099796_10034706 | 3300010159 | Bacteria | 1668 |
| 188 | Ga0099796_10063877 | 3300010159 | Bacteria | 1312 |
| 189 | Ga0105239_10017424 | 3300010375 | Bacteria | 7944 |
| 190 | Ga0105239_10050009 | 3300010375 | Bacteria | 4584 |
| 191 | Ga0105239_10069482 | 3300010375 | Bacteria | 3870 |
| 192 | Ga0105239_10225560 | 3300010375 | Bacteria | 2102 |
| 193 | Ga0105239_10329332 | 3300010375 | Bacteria | 1723 |
| 194 | Ga0105239_10467520 | 3300010375 | Bacteria | 1432 |
| 195 | Ga0105246_10082519 | 3300011119 | Bacteria | 2294 |
| 196 | Ga0105246_10131724 | 3300011119 | Bacteria | 1868 |
| 197 | Ga0105246_10134725 | 3300011119 | Bacteria | 1850 |
| 198 | Ga0157371_10117560 | 3300013102 | Bacteria | 1890 |
| 199 | Ga0157370_10135233 | 3300013104 | Bacteria | 2298 |
| 200 | Ga0157369_10028215 | 3300013105 | Bacteria | 6213 |
| 201 | Ga0157369_10049560 | 3300013105 | Bacteria | 4553 |
| 202 | Ga0157369_10055146 | 3300013105 | Bacteria | 4291 |
| 203 | Ga0157369_10089917 | 3300013105 | Bacteria | 3278 |
| 204 | Ga0157374_10049880 | 3300013296 | Bacteria | 3888 |
| 205 | Ga0157374_10170182 | 3300013296 | Bacteria | 2125 |
| 206 | Ga0157378_10026868 | 3300013297 | Bacteria | 5076 |
| 207 | Ga0157378_10330451 | 3300013297 | Bacteria | 1483 |
| 208 | Ga0163162_10259940 | 3300013306 | Bacteria | 1868 |
| 209 | Ga0157372_10099634 | 3300013307 | Bacteria | 3315 |
| 210 | Ga0157375_10343049 | 3300013308 | Bacteria | 1659 |
| 211 | Ga0157375_10579787 | 3300013308 | Bacteria | 1282 |
| 212 | Ga0163163_10154003 | 3300014325 | Bacteria | 2342 |
| 213 | Ga0163163_10556450 | 3300014325 | Bacteria | 1210 |
| 214 | Ga0182008_10160050 | 3300014497 | Bacteria | 1133 |
| 215 | Ga0157379_10079142 | 3300014968 | Bacteria | 2944 |
| 216 | Ga0157379_10394059 | 3300014968 | Bacteria | 1272 |
| 217 | Ga0157376_10030274 | 3300014969 | Bacteria | 4321 |
| 218 | Ga0163161_10289709 | 3300017792 | Bacteria | 1287 |
| 219 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 220 | Ga0214544_1000377 | 3300021320 | Bacteria | 78659 |
| 221 | Ga0214544_1010618 | 3300021320 | Bacteria | 13405 |
| 222 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 223 | Ga0214542_1004323 | 3300021321 | Bacteria | 28299 |
| 224 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 225 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 226 | Ga0213876_10007884 | 3300021384 | Bacteria | 5775 |
| 227 | Ga0209563_105457 | 3300025230 | Bacteria | 2304 |
| 228 | Ga0209677_100615 | 3300025253 | Bacteria | 19096 |
| 229 | Ga0209677_107210 | 3300025253 | Bacteria | 2420 |
| 230 | Ga0209148_1000354 | 3300025254 | Bacteria | 59155 |
| 231 | Ga0209233_1007060 | 3300025261 | Bacteria | 3583 |
| 232 | Ga0209233_1012516 | 3300025261 | Bacteria | 2459 |
| 233 | Ga0209455_1003303 | 3300025272 | Bacteria | 5789 |
| 234 | Ga0209455_1007239 | 3300025272 | Bacteria | 3159 |
| 235 | Ga0209564_1007319 | 3300025295 | Bacteria | 5725 |
| 236 | Ga0209564_1018146 | 3300025295 | Bacteria | 2699 |
| 237 | Ga0209758_1000164 | 3300025297 | Bacteria | 151759 |
| 238 | Ga0209758_1000216 | 3300025297 | Bacteria | 125352 |
| 239 | Ga0209758_1000375 | 3300025297 | Bacteria | 77872 |
| 240 | Ga0209758_1001489 | 3300025297 | Bacteria | 27341 |
| 241 | Ga0209758_1003612 | 3300025297 | Bacteria | 13840 |
| 242 | Ga0209758_1017929 | 3300025297 | Bacteria | 3496 |
| 243 | Ga0207426_1004590 | 3300025302 | Bacteria | 6664 |
| 244 | Ga0207426_1008861 | 3300025302 | Bacteria | 4025 |
| 245 | Ga0207426_1010488 | 3300025302 | Bacteria | 3591 |
| 246 | Ga0209257_1000782 | 3300025304 | Bacteria | 46895 |
| 247 | Ga0207697_10073638 | 3300025315 | Bacteria | 1434 |
| 248 | Ga0207656_10009951 | 3300025321 | Bacteria | 3543 |
| 249 | Ga0207692_10000660 | 3300025898 | Bacteria | 12148 |
| 250 | Ga0207692_10083384 | 3300025898 | Bacteria | 1715 |
| 251 | Ga0207692_10169253 | 3300025898 | Bacteria | 1265 |
| 252 | Ga0207642_10095691 | 3300025899 | Bacteria | 1478 |
| 253 | Ga0207680_10282965 | 3300025903 | Bacteria | 1152 |
| 254 | Ga0207647_10070224 | 3300025904 | Bacteria | 2116 |
| 255 | Ga0207685_10083403 | 3300025905 | Bacteria | 1328 |
| 256 | Ga0207699_10000526 | 3300025906 | Bacteria | 18963 |
| 257 | Ga0207699_10051147 | 3300025906 | Bacteria | 2440 |
| 258 | Ga0207643_10247328 | 3300025908 | Bacteria | 1098 |
| 259 | Ga0207705_10252279 | 3300025909 | Bacteria | 1346 |
| 260 | Ga0207684_10218985 | 3300025910 | Bacteria | 1643 |
| 261 | Ga0207654_10001069 | 3300025911 | Bacteria | 14896 |
| 262 | Ga0207654_10084014 | 3300025911 | Bacteria | 1924 |
| 263 | Ga0207654_10251938 | 3300025911 | Bacteria | 1184 |
| 264 | Ga0207707_10001083 | 3300025912 | Bacteria | 26026 |
| 265 | Ga0207707_10084099 | 3300025912 | Bacteria | 2779 |
| 266 | Ga0207707_10153348 | 3300025912 | Bacteria | 2014 |
| 267 | Ga0207695_10000599 | 3300025913 | Bacteria | 72238 |
| 268 | Ga0207695_10002303 | 3300025913 | Bacteria | 28471 |
| 269 | Ga0207695_10097380 | 3300025913 | Bacteria | 2943 |
| 270 | Ga0207671_10001926 | 3300025914 | Bacteria | 23032 |
| 271 | Ga0207671_10153502 | 3300025914 | Bacteria | 1780 |
| 272 | Ga0207671_10203983 | 3300025914 | Bacteria | 1545 |
| 273 | Ga0207693_10048687 | 3300025915 | Bacteria | 3328 |
| 274 | Ga0207693_10080556 | 3300025915 | Bacteria | 2549 |
| 275 | Ga0207693_10153555 | 3300025915 | Bacteria | 1811 |
| 276 | Ga0207663_10000334 | 3300025916 | Bacteria | 20607 |
| 277 | Ga0207663_10004028 | 3300025916 | Bacteria | 7281 |
| 278 | Ga0207663_10114199 | 3300025916 | Bacteria | 1838 |
| 279 | Ga0207663_10286511 | 3300025916 | Bacteria | 1226 |
| 280 | Ga0207660_10003821 | 3300025917 | Bacteria | 9815 |
| 281 | Ga0207657_10116870 | 3300025919 | Bacteria | 2197 |
| 282 | Ga0207652_10003147 | 3300025921 | Bacteria | 13749 |
| 283 | Ga0207652_10272665 | 3300025921 | Bacteria | 1526 |
| 284 | Ga0207694_10000640 | 3300025924 | Bacteria | 31572 |
| 285 | Ga0207694_10018292 | 3300025924 | Bacteria | 5296 |
| 286 | Ga0207694_10181998 | 3300025924 | Bacteria | 1704 |
| 287 | Ga0207694_10245181 | 3300025924 | Bacteria | 1465 |
| 288 | Ga0207650_10269903 | 3300025925 | Bacteria | 1382 |
| 289 | Ga0207659_10348342 | 3300025926 | Bacteria | 1228 |
| 290 | Ga0207687_10096376 | 3300025927 | Bacteria | 2168 |
| 291 | Ga0207700_10001731 | 3300025928 | Bacteria | 12395 |
| 292 | Ga0207700_10099458 | 3300025928 | Bacteria | 2316 |
| 293 | Ga0207664_10093811 | 3300025929 | Bacteria | 2466 |
| 294 | Ga0207690_10041561 | 3300025932 | Bacteria | 3013 |
| 295 | Ga0207706_10128708 | 3300025933 | Bacteria | 2226 |
| 296 | Ga0207706_10318437 | 3300025933 | Bacteria | 1354 |
| 297 | Ga0207669_10065091 | 3300025937 | Bacteria | 2259 |
| 298 | Ga0207669_10260233 | 3300025937 | Bacteria | 1297 |
| 299 | Ga0207665_10005331 | 3300025939 | Bacteria | 8593 |
| 300 | Ga0207665_10029760 | 3300025939 | Bacteria | 3608 |
| 301 | Ga0207665_10260855 | 3300025939 | Bacteria | 1284 |
| 302 | Ga0207691_10098715 | 3300025940 | Bacteria | 2608 |
| 303 | Ga0207691_10109822 | 3300025940 | Bacteria | 2453 |
| 304 | Ga0207711_10080851 | 3300025941 | Bacteria | 2839 |
| 305 | Ga0207711_10123220 | 3300025941 | Bacteria | 2316 |
| 306 | Ga0207711_10151693 | 3300025941 | Bacteria | 2091 |
| 307 | Ga0207689_10119784 | 3300025942 | Bacteria | 2165 |
| 308 | Ga0207689_10143780 | 3300025942 | Bacteria | 1965 |
| 309 | Ga0207661_10009663 | 3300025944 | Bacteria | 6926 |
| 310 | Ga0207661_10350874 | 3300025944 | Bacteria | 1331 |
| 311 | Ga0207679_10266372 | 3300025945 | Bacteria | 1463 |
| 312 | Ga0207679_10318459 | 3300025945 | Bacteria | 1346 |
| 313 | Ga0207667_10006331 | 3300025949 | Bacteria | 14348 |
| 314 | Ga0207667_10031140 | 3300025949 | Bacteria | 5761 |
| 315 | Ga0207667_10034299 | 3300025949 | Bacteria | 5451 |
| 316 | Ga0207667_10062492 | 3300025949 | Bacteria | 3893 |
| 317 | Ga0207667_10081956 | 3300025949 | Bacteria | 3342 |
| 318 | Ga0207667_10165217 | 3300025949 | Bacteria | 2276 |
| 319 | Ga0207651_10431192 | 3300025960 | Bacteria | 1127 |
| 320 | Ga0207651_10503661 | 3300025960 | Bacteria | 1047 |
| 321 | Ga0207668_10312832 | 3300025972 | Bacteria | 1300 |
| 322 | Ga0207640_10014814 | 3300025981 | Bacteria | 4497 |
| 323 | Ga0207640_10028091 | 3300025981 | Bacteria | 3435 |
| 324 | Ga0207640_10033085 | 3300025981 | Bacteria | 3213 |
| 325 | Ga0207658_10413671 | 3300025986 | Bacteria | 1188 |
| 326 | Ga0207677_10007171 | 3300026023 | Bacteria | 6139 |
| 327 | Ga0207677_10021221 | 3300026023 | Bacteria | 3964 |
| 328 | Ga0207703_10069128 | 3300026035 | Bacteria | 2911 |
| 329 | Ga0207703_10205038 | 3300026035 | Bacteria | 1754 |
| 330 | Ga0207703_10426163 | 3300026035 | Bacteria | 1235 |
| 331 | Ga0207639_10104159 | 3300026041 | Bacteria | 2300 |
| 332 | Ga0207639_10139753 | 3300026041 | Bacteria | 2016 |
| 333 | Ga0207639_10210980 | 3300026041 | Bacteria | 1672 |
| 334 | Ga0207639_10305423 | 3300026041 | Bacteria | 1408 |
| 335 | Ga0207678_10077063 | 3300026067 | Bacteria | 2856 |
| 336 | Ga0207678_10117067 | 3300026067 | Bacteria | 2274 |
| 337 | Ga0207678_10203255 | 3300026067 | Bacteria | 1694 |
| 338 | Ga0207678_10239632 | 3300026067 | Bacteria | 1553 |
| 339 | Ga0207678_10369377 | 3300026067 | Bacteria | 1239 |
| 340 | Ga0207708_10223844 | 3300026075 | Bacteria | 1508 |
| 341 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 342 | Ga0207702_10000433 | 3300026078 | Bacteria | 47747 |
| 343 | Ga0207702_10137009 | 3300026078 | Bacteria | 2210 |
| 344 | Ga0207702_10271682 | 3300026078 | Bacteria | 1599 |
| 345 | Ga0207641_10277531 | 3300026088 | Bacteria | 1575 |
| 346 | Ga0207648_10031150 | 3300026089 | Bacteria | 4716 |
| 347 | Ga0207676_10132085 | 3300026095 | Bacteria | 2124 |
| 348 | Ga0207674_10005368 | 3300026116 | Bacteria | 15246 |
| 349 | Ga0207674_10010019 | 3300026116 | Bacteria | 10782 |
| 350 | Ga0207674_10024060 | 3300026116 | Bacteria | 6514 |
| 351 | Ga0207674_10032073 | 3300026116 | Bacteria | 5511 |
| 352 | Ga0207674_10532359 | 3300026116 | Bacteria | 1135 |
| 353 | Ga0207675_100240562 | 3300026118 | Bacteria | 1749 |
| 354 | Ga0207675_100312045 | 3300026118 | Bacteria | 1534 |
| 355 | Ga0207683_10150547 | 3300026121 | Bacteria | 2100 |
| 356 | Ga0207683_10210190 | 3300026121 | Bacteria | 1771 |
| 357 | Ga0207698_10057969 | 3300026142 | Bacteria | 2999 |
| 358 | Ga0207698_10230693 | 3300026142 | Bacteria | 1680 |
| 359 | Ga0207698_10238256 | 3300026142 | Bacteria | 1656 |
| 360 | Ga0209389_1000024 | 3300027296 | Bacteria | 150002 |
| 361 | Ga0209389_1000155 | 3300027296 | Bacteria | 57647 |
| 362 | Ga0209389_1000211 | 3300027296 | Bacteria | 41258 |
| 363 | Ga0209389_1000640 | 3300027296 | Bacteria | 21616 |
| 364 | Ga0209589_1000030 | 3300027357 | Bacteria | 147457 |
| 365 | Ga0209589_1000505 | 3300027357 | Bacteria | 55405 |
| 366 | Ga0209589_1005433 | 3300027357 | Bacteria | 21616 |
| 367 | Ga0209489_100052 | 3300027361 | Bacteria | 150002 |
| 368 | Ga0209489_100056 | 3300027361 | Bacteria | 147457 |
| 369 | Ga0209489_102067 | 3300027361 | Bacteria | 41258 |
| 370 | Ga0209489_105575 | 3300027361 | Bacteria | 21616 |
| 371 | Ga0209700_100059 | 3300027363 | Bacteria | 147457 |
| 372 | Ga0209700_104170 | 3300027363 | Bacteria | 26475 |
| 373 | Ga0268266_10000988 | 3300028379 | Bacteria | 35821 |
| 374 | Ga0268266_10002854 | 3300028379 | Bacteria | 18005 |
| 375 | Ga0268266_10006878 | 3300028379 | Bacteria | 10351 |
| 376 | Ga0268266_10038850 | 3300028379 | Bacteria | 4052 |
| 377 | Ga0268266_10054630 | 3300028379 | Bacteria | 3432 |
| 378 | Ga0268266_10058934 | 3300028379 | Bacteria | 3307 |
| 379 | Ga0265337_1008853 | 3300028556 | Bacteria | 3627 |
| 380 | Ga0265326_10004742 | 3300028558 | Bacteria | 4324 |
| 381 | Ga0265334_10005352 | 3300028573 | Bacteria | 5605 |
| 382 | Ga0265318_10047005 | 3300028577 | Bacteria | 1628 |
| 383 | Ga0265323_10000916 | 3300028653 | Bacteria | 15563 |
| 384 | Ga0265322_10005772 | 3300028654 | Bacteria | 3652 |
| 385 | Ga0307517_10000125 | 3300028786 | Bacteria | 115466 |
| 386 | Ga0265338_10000131 | 3300028800 | Bacteria | 137627 |
| 387 | Ga0265324_10003680 | 3300029957 | Bacteria | 7193 |
| 388 | Ga0307511_10043073 | 3300030521 | Bacteria | 3779 |
| 389 | Ga0307511_10083723 | 3300030521 | Bacteria | 2220 |
| 390 | Ga0265330_10087640 | 3300031235 | Bacteria | 1337 |
| 391 | Ga0265332_10063051 | 3300031238 | Bacteria | 1584 |
| 392 | Ga0265328_10027971 | 3300031239 | Bacteria | 2111 |
| 393 | Ga0265325_10002689 | 3300031241 | Bacteria | 11892 |
| 394 | Ga0265339_10003134 | 3300031249 | Bacteria | 11644 |
| 395 | Ga0265339_10096648 | 3300031249 | Bacteria | 1541 |
| 396 | Ga0307513_10086146 | 3300031456 | Bacteria | 3222 |
| 397 | Ga0307508_10001153 | 3300031616 | Bacteria | 30369 |
| 398 | Ga0265314_10087479 | 3300031711 | Bacteria | 2037 |
| 399 | Ga0265342_10002981 | 3300031712 | Bacteria | 14213 |
| 400 | Ga0265342_10016343 | 3300031712 | Bacteria | 4855 |
| 401 | Ga0307516_10008305 | 3300031730 | Bacteria | 11768 |
| 402 | Ga0307516_10020167 | 3300031730 | Bacteria | 6894 |
| 403 | Ga0307516_10022528 | 3300031730 | Bacteria | 6466 |
| 404 | Ga0307516_10088342 | 3300031730 | Bacteria | 2932 |
| 405 | Ga0307409_100050870 | 3300031995 | Bacteria | 3167 |
| 406 | Ga0307415_100177137 | 3300032126 | Bacteria | 1669 |
| 407 | Ga0307510_10159135 | 3300033180 | Bacteria | 1859 |
| 408 | Ga0307510_10209965 | 3300033180 | Bacteria | 1470 |
| 409 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 410 | Ga0373929_0047139 | 3300035085 | Bacteria | 976 |
| 411 | Ga0373934_0018122 | 3300035086 | Bacteria | 2693 |
| 412 | Ga0373944_0018687 | 3300035089 | Bacteria | 1982 |
| 413 | Ga0373944_0090705 | 3300035089 | Bacteria | 1021 |
| 414 | Ga0373949_0034817 | 3300035090 | Bacteria | 1216 |
| 415 | Ga0373952_0018394 | 3300035092 | Bacteria | 1446 |
| 416 | Ga0373923_0014986 | 3300035111 | Bacteria | 2919 |
| 417 | Ga0373923_0106587 | 3300035111 | Bacteria | 1241 |
| 418 | Ga0373936_0028140 | 3300035113 | Bacteria | 2208 |
| 419 | Ga0373953_0000108 | 3300035117 | Bacteria | 20124 |
| 420 | Ga0373954_0000085 | 3300035118 | Bacteria | 31872 |
| 421 | Ga0373954_0015097 | 3300035118 | Bacteria | 3451 |
| 422 | Ga0373956_0000272 | 3300035119 | Bacteria | 20783 |
| 423 | Ga0373957_0000129 | 3300035120 | Bacteria | 18551 |
| 424 | Ga0373943_0021381 | 3300035170 | Bacteria | 2988 |
| 425 | Ga0373943_0085068 | 3300035170 | Bacteria | 1628 |
| 426 | Ga0373943_0128098 | 3300035170 | Bacteria | 1356 |
| 427 | Ga0373955_0000288 | 3300035172 | Bacteria | 20919 |
| 428 | Ga0373955_0224572 | 3300035172 | Bacteria | 1122 |
| 429 | Ga0373924_0031425 | 3300035410 | Bacteria | 2135 |
| 430 | Ga0373924_0088967 | 3300035410 | Bacteria | 1319 |
| 431 | Ga0373935_0002679 | 3300035692 | Bacteria | 10244 |
| 432 | Ga0373935_0218992 | 3300035692 | Bacteria | 1321 |
| 433 | Ga0373927_0001471 | 3300035695 | Bacteria | 17726 |
| 434 | Ga0373927_0002486 | 3300035695 | Bacteria | 13456 |
| 435 | Ga0373927_0026490 | 3300035695 | Bacteria | 3789 |
| 436 | Ga0373927_0048040 | 3300035695 | Bacteria | 2760 |
| 437 | Ga0373927_0057389 | 3300035695 | Bacteria | 2518 |
| 438 | Ga0373927_0118893 | 3300035695 | Bacteria | 1724 |
| 439 | Ga0373927_0197968 | 3300035695 | Bacteria | 1319 |
| 440 | Ga0373933_0000059 | 3300035724 | Bacteria | 65716 |
| 441 | Ga0373933_0000913 | 3300035724 | Bacteria | 18054 |
| 442 | Ga0373933_0073167 | 3300035724 | Bacteria | 2088 |
| 443 | Ga0373933_0099772 | 3300035724 | Bacteria | 1800 |
| 444 | Ga0373933_0291395 | 3300035724 | Bacteria | 1055 |
| 445 | Ga0373947_0003788 | 3300035725 | Bacteria | 8912 |
| 446 | Ga0373947_0009239 | 3300035725 | Bacteria | 5666 |
| 447 | Ga0373947_0055013 | 3300035725 | Bacteria | 2403 |
| 448 | Ga0373937_0005718 | 3300036401 | Bacteria | 10679 |
| 449 | Ga0373937_0027472 | 3300036401 | Bacteria | 5146 |
| 450 | Ga0373937_0105710 | 3300036401 | Bacteria | 2616 |
| 451 | Ga0373937_0126085 | 3300036401 | Bacteria | 2388 |
| 452 | Ga0372808_007420 | 3300036459 | Bacteria | 1498 |
| 453 | Ga0373925_0052859 | 3300037068 | Bacteria | 3035 |
| 454 | Ga0373925_0066632 | 3300037068 | Bacteria | 2714 |
| 455 | Ga0373925_0072085 | 3300037068 | Bacteria | 2613 |
| 456 | Ga0373925_0079134 | 3300037068 | Bacteria | 2497 |
| 457 | Ga0395899_0056493 | 3300037312 | Bacteria | 2901 |
| 458 | Ga0395900_0062423 | 3300037418 | Bacteria | 3830 |
| 459 | Ga0395900_0330185 | 3300037418 | Bacteria | 1503 |
| 460 | Ga0395898_0063425 | 3300037466 | Bacteria | 3586 |
| 461 | Ga0395898_0463974 | 3300037466 | Bacteria | 1205 |
| 462 | Ga0395905_0095024 | 3300037471 | Bacteria | 2797 |
| 463 | Ga0436364_0719526 | 3300037853 | Bacteria | 3689 |
| 464 | Ga0436364_1199883 | 3300037853 | Bacteria | 966 |
| 465 | Ga0395901_0016140 | 3300038443 | Bacteria | 7606 |
| 466 | Ga0395901_0074704 | 3300038443 | Bacteria | 3536 |
| 467 | Ga0436365_1415912 | 3300039437 | Bacteria | 2365 |
| 468 | Ga0436365_1448063 | 3300039437 | Bacteria | 945 |
| 469 | Ga0436360_0103168 | 3300039438 | Bacteria | 1021 |
| 470 | Ga0436360_0502120 | 3300039438 | Bacteria | 2872 |
| 471 | Ga0436361_0718487 | 3300039447 | Bacteria | 2883 |
| 472 | Ga0436363_0572275 | 3300039450 | Bacteria | 1015 |
| 473 | Ga0436363_1138394 | 3300039450 | Bacteria | 9676 |
| 474 | Ga0436362_0588858 | 3300039453 | Bacteria | 1242 |
| 475 | Ga0436362_1135664 | 3300039453 | Bacteria | 1470 |
| 476 | Ga0439465_0047711 | 3300041413 | Bacteria | 1397 |
| 477 | Ga0451807_0959335 | 3300041486 | Bacteria | 1048 |
| 478 | Ga0466972_0000156 | 3300044658 | Bacteria | 55040 |
| 479 | Ga0466966_0000726 | 3300044684 | Bacteria | 20952 |
| 480 | Ga0466961_0000568 | 3300044693 | Bacteria | 23491 |
| 481 | Ga0466968_0117291 | 3300044735 | Bacteria | 1202 |
| 482 | Ga0466970_0224827 | 3300044765 | Bacteria | 1048 |
| 483 | Ga0466959_0026424 | 3300045049 | Bacteria | 4303 |
| 484 | Ga0466959_0146821 | 3300045049 | Bacteria | 1664 |
| 485 | Ga0466967_0230944 | 3300045976 | Bacteria | 1762 |
| 486 | Ga0466967_0249513 | 3300045976 | Bacteria | 1695 |
| 487 | Ga0466967_0316191 | 3300045976 | Bacteria | 1505 |
| 488 | Ga0466967_0354002 | 3300045976 | Bacteria | 1422 |
| 489 | Ga0495617_030660 | 3300046452 | Bacteria | 1807 |
| 490 | Ga0495592_0000795 | 3300046454 | Bacteria | 21828 |
| 491 | Ga0495592_0047014 | 3300046454 | Bacteria | 3215 |
| 492 | Ga0495592_0347685 | 3300046454 | Bacteria | 951 |
| 493 | Ga0495603_0000387 | 3300046455 | Bacteria | 24105 |
| 494 | Ga0495603_0090832 | 3300046455 | Bacteria | 1786 |
| 495 | Ga0495603_0231947 | 3300046455 | Bacteria | 1064 |
| 496 | Ga0495629_0000582 | 3300046459 | Bacteria | 29684 |
| 497 | Ga0495629_0001668 | 3300046459 | Bacteria | 17432 |
| 498 | Ga0495629_0004581 | 3300046459 | Bacteria | 10343 |
| 499 | Ga0495629_0055578 | 3300046459 | Bacteria | 2768 |
| 500 | Ga0495629_0109204 | 3300046459 | Bacteria | 1929 |
| 501 | Ga0495638_0004069 | 3300046460 | Bacteria | 11214 |
| 502 | Ga0495638_0042559 | 3300046460 | Bacteria | 2868 |
| 503 | Ga0495641_0161172 | 3300046461 | Bacteria | 1003 |
| 504 | Ga0495651_0002961 | 3300046462 | Bacteria | 13121 |
| 505 | Ga0495651_0029419 | 3300046462 | Bacteria | 4283 |
| 506 | Ga0495651_0046661 | 3300046462 | Bacteria | 3353 |
| 507 | Ga0495651_0081381 | 3300046462 | Bacteria | 2444 |
| 508 | Ga0495580_0010768 | 3300046472 | Bacteria | 7103 |
| 509 | Ga0495580_0357621 | 3300046472 | Bacteria | 988 |
| 510 | Ga0495582_0005882 | 3300046473 | Bacteria | 6835 |
| 511 | Ga0495639_0000739 | 3300046475 | Bacteria | 14934 |
| 512 | Ga0495662_0000148 | 3300046476 | Bacteria | 27496 |
| 513 | Ga0495664_0032458 | 3300046477 | Bacteria | 3064 |
| 514 | Ga0495664_0042962 | 3300046477 | Bacteria | 2678 |
| 515 | Ga0495664_0046873 | 3300046477 | Bacteria | 2564 |
| 516 | Ga0495664_0121846 | 3300046477 | Bacteria | 1577 |
| 517 | Ga0495585_0062622 | 3300046492 | Bacteria | 2043 |
| 518 | Ga0495594_0000312 | 3300046499 | Bacteria | 23910 |
| 519 | Ga0495583_0062036 | 3300046506 | Bacteria | 1666 |
| 520 | Ga0495606_0012913 | 3300046507 | Bacteria | 6647 |
| 521 | Ga0495606_0207274 | 3300046507 | Bacteria | 1113 |
| 522 | Ga0495608_0000569 | 3300046511 | Bacteria | 25372 |
| 523 | Ga0495608_0024234 | 3300046511 | Bacteria | 4151 |
| 524 | Ga0495610_0096773 | 3300046512 | Bacteria | 1329 |
| 525 | Ga0495616_0120349 | 3300046513 | Bacteria | 1213 |
| 526 | Ga0495618_0188957 | 3300046514 | Bacteria | 1307 |
| 527 | Ga0495618_0325398 | 3300046514 | Bacteria | 951 |
| 528 | Ga0495628_0151514 | 3300046516 | Bacteria | 1766 |
| 529 | Ga0495628_0272963 | 3300046516 | Bacteria | 1257 |
| 530 | Ga0495630_0038844 | 3300046517 | Bacteria | 3560 |
| 531 | Ga0495630_0283363 | 3300046517 | Bacteria | 1266 |
| 532 | Ga0495630_0336395 | 3300046517 | Bacteria | 1155 |
| 533 | Ga0495632_0049519 | 3300046519 | Bacteria | 2076 |
| 534 | Ga0495632_0069446 | 3300046519 | Bacteria | 1696 |
| 535 | Ga0495644_0019687 | 3300046523 | Bacteria | 2577 |
| 536 | Ga0495648_0000855 | 3300046524 | Bacteria | 32117 |
| 537 | Ga0495652_0002837 | 3300046529 | Bacteria | 17453 |
| 538 | Ga0495652_0025766 | 3300046529 | Bacteria | 5198 |
| 539 | Ga0495652_0030800 | 3300046529 | Bacteria | 4702 |
| 540 | Ga0495652_0093268 | 3300046529 | Bacteria | 2458 |
| 541 | Ga0495652_0238641 | 3300046529 | Bacteria | 1354 |
| 542 | Ga0495665_0000248 | 3300046531 | Bacteria | 27116 |
| 543 | Ga0495665_0133121 | 3300046531 | Bacteria | 1301 |
| 544 | Ga0495640_0004111 | 3300046533 | Bacteria | 11641 |
| 545 | Ga0495640_0006732 | 3300046533 | Bacteria | 9069 |
| 546 | Ga0495640_0170172 | 3300046533 | Bacteria | 1392 |
| 547 | Ga0495587_0038566 | 3300046536 | Bacteria | 2863 |
| 548 | Ga0495587_0041046 | 3300046536 | Bacteria | 2761 |
| 549 | Ga0495587_0054884 | 3300046536 | Bacteria | 2347 |
| 550 | Ga0495587_0208428 | 3300046536 | Bacteria | 1104 |
| 551 | Ga0495598_0005352 | 3300046537 | Bacteria | 2839 |
| 552 | Ga0495609_0052373 | 3300046538 | Bacteria | 1816 |
| 553 | Ga0495645_0053996 | 3300046543 | Bacteria | 2920 |
| 554 | Ga0495622_0002046 | 3300046557 | Bacteria | 9854 |
| 555 | Ga0495622_0072451 | 3300046557 | Bacteria | 1589 |
| 556 | Ga0495667_0000128 | 3300046559 | Bacteria | 54804 |
| 557 | Ga0495667_0025774 | 3300046559 | Bacteria | 3961 |
| 558 | Ga0495667_0119898 | 3300046559 | Bacteria | 1699 |
| 559 | Ga0495668_0040133 | 3300046616 | Bacteria | 2611 |
| 560 | Ga0495634_0016372 | 3300046642 | Bacteria | 5303 |
| 561 | Ga0495634_0023145 | 3300046642 | Bacteria | 4369 |
| 562 | Ga0495634_0032372 | 3300046642 | Bacteria | 3596 |
| 563 | Ga0495634_0299504 | 3300046642 | Bacteria | 972 |
| 564 | Ga0495611_0205614 | 3300046648 | Bacteria | 917 |
| 565 | Ga0495635_0001128 | 3300046663 | Bacteria | 17791 |
| 566 | Ga0495635_0006917 | 3300046663 | Bacteria | 7923 |
| 567 | Ga0495635_0008480 | 3300046663 | Bacteria | 7178 |
| 568 | Ga0495635_0020698 | 3300046663 | Bacteria | 4582 |
| 569 | Ga0495635_0048370 | 3300046663 | Bacteria | 2932 |
| 570 | Ga0495588_0055966 | 3300046674 | Bacteria | 2036 |
| 571 | Ga0495657_0000445 | 3300046675 | Bacteria | 38585 |
| 572 | Ga0495657_0003126 | 3300046675 | Bacteria | 13671 |
| 573 | Ga0495657_0139924 | 3300046675 | Bacteria | 1509 |
| 574 | Ga0495599_0001045 | 3300046678 | Bacteria | 15553 |
| 575 | Ga0495599_0070958 | 3300046678 | Bacteria | 2174 |
| 576 | Ga0495599_0165706 | 3300046678 | Bacteria | 1365 |
| 577 | Ga0495623_0006786 | 3300046679 | Bacteria | 7448 |
| 578 | Ga0495623_0123410 | 3300046679 | Bacteria | 1557 |
| 579 | Ga0495623_0173364 | 3300046679 | Bacteria | 1258 |
| 580 | Ga0495646_0000412 | 3300046680 | Bacteria | 22576 |
| 581 | Ga0495646_0036082 | 3300046680 | Bacteria | 3065 |
| 582 | Ga0495646_0047180 | 3300046680 | Bacteria | 2623 |
| 583 | Ga0495647_0000541 | 3300046681 | Bacteria | 11104 |
| 584 | Ga0495647_0118920 | 3300046681 | Bacteria | 1110 |
| 585 | Ga0495658_0002607 | 3300046683 | Bacteria | 9063 |
| 586 | Ga0495658_0167850 | 3300046683 | Bacteria | 1357 |
| 587 | Ga0495658_0211245 | 3300046683 | Bacteria | 1213 |
| 588 | Ga0495669_0028177 | 3300046684 | Bacteria | 2459 |
| 589 | Ga0495669_0066111 | 3300046684 | Bacteria | 1642 |
| 590 | Ga0495613_0057546 | 3300046689 | Bacteria | 2854 |
| 591 | Ga0495613_0130551 | 3300046689 | Bacteria | 1799 |
| 592 | Ga0495613_0320357 | 3300046689 | Bacteria | 1070 |
| 593 | Ga0495624_0001790 | 3300046690 | Bacteria | 16446 |
| 594 | Ga0495624_0046460 | 3300046690 | Bacteria | 2760 |
| 595 | Ga0495624_0096496 | 3300046690 | Bacteria | 1821 |
| 596 | Ga0495671_0078623 | 3300046692 | Bacteria | 1617 |
| 597 | Ga0495671_0199259 | 3300046692 | Bacteria | 971 |
| 598 | Ga0495649_0023836 | 3300046694 | Bacteria | 3417 |
| 599 | Ga0495600_0005826 | 3300046809 | Bacteria | 7449 |
| 600 | Ga0495600_0105268 | 3300046809 | Bacteria | 1838 |
| 601 | Ga0495600_0207300 | 3300046809 | Bacteria | 1257 |
| 602 | Ga0495600_0233811 | 3300046809 | Bacteria | 1173 |
| 603 | Ga0495581_0001004 | 3300047315 | Bacteria | 15232 |
| 604 | Ga0495581_0204851 | 3300047315 | Bacteria | 1154 |
| 605 | Ga0495581_0224650 | 3300047315 | Bacteria | 1098 |
| 606 | Ga0495604_0007172 | 3300047317 | Bacteria | 8829 |
| 607 | Ga0495604_0020987 | 3300047317 | Bacteria | 5212 |
| 608 | Ga0495604_0051018 | 3300047317 | Bacteria | 3210 |
| 609 | Ga0495604_0195480 | 3300047317 | Bacteria | 1407 |
| 610 | Ga0495674_0002207 | 3300047319 | Bacteria | 19142 |
| 611 | Ga0495674_0037127 | 3300047319 | Bacteria | 4379 |
| 612 | Ga0495674_0065961 | 3300047319 | Bacteria | 3142 |
| 613 | Ga0495674_0083959 | 3300047319 | Bacteria | 2730 |
| 614 | Ga0495674_0202145 | 3300047319 | Bacteria | 1648 |
| 615 | Ga0495674_0276948 | 3300047319 | Bacteria | 1375 |
| 616 | Ga0495672_0002625 | 3300047320 | Bacteria | 16239 |
| 617 | Ga0495672_0049186 | 3300047320 | Bacteria | 2496 |
| 618 | Ga0495676_0042833 | 3300047321 | Bacteria | 3712 |
| 619 | Ga0495676_0115712 | 3300047321 | Bacteria | 1960 |
| 620 | Ga0495680_0000424 | 3300047322 | Bacteria | 47310 |
| 621 | Ga0495680_0001973 | 3300047322 | Bacteria | 21554 |
| 622 | Ga0495683_0177531 | 3300047323 | Bacteria | 975 |
| 623 | Ga0495687_021307 | 3300047443 | Bacteria | 3139 |
| 624 | Ga0495675_0000345 | 3300047444 | Bacteria | 32608 |
| 625 | Ga0495673_0041536 | 3300047469 | Bacteria | 2070 |
| 626 | Ga0495684_0000650 | 3300047471 | Bacteria | 27935 |
| 627 | Ga0495684_0287001 | 3300047471 | Bacteria | 1186 |
| 628 | Ga0495593_0000312 | 3300047673 | Bacteria | 26693 |
| 629 | Ga0495593_0022184 | 3300047673 | Bacteria | 3542 |
| 630 | Ga0495593_0028064 | 3300047673 | Bacteria | 3093 |
| 631 | Ga0495602_0005890 | 3300048088 | Bacteria | 12875 |
| 632 | Ga0495602_0009316 | 3300048088 | Bacteria | 10219 |
| 633 | Ga0495602_0040539 | 3300048088 | Bacteria | 4267 |
| 634 | Ga0496100_0190348 | 3300048903 | Bacteria | 1489 |
| 635 | Ga0496100_0390399 | 3300048903 | Bacteria | 1058 |
| 636 | Ga0496101_0002458 | 3300048904 | Bacteria | 11379 |
| 637 | Ga0496101_0126377 | 3300048904 | Bacteria | 1938 |
| 638 | Ga0496101_0332118 | 3300048904 | Bacteria | 1193 |
| 639 | Ga0496102_0007740 | 3300048905 | Bacteria | 9181 |
| 640 | Ga0496102_0251522 | 3300048905 | Bacteria | 1666 |
| 641 | Ga0496102_0737284 | 3300048905 | Bacteria | 908 |
| 642 | Ga0496103_0161136 | 3300048906 | Bacteria | 1439 |
| 643 | Ga0496103_0209215 | 3300048906 | Bacteria | 1254 |
| 644 | Ga0496104_0016290 | 3300048907 | Bacteria | 6748 |
| 645 | Ga0496104_0130252 | 3300048907 | Bacteria | 2416 |
| 646 | Ga0496104_0307322 | 3300048907 | Bacteria | 1498 |
| 647 | Ga0496104_0419600 | 3300048907 | Bacteria | 1250 |
| 648 | Ga0496105_0079917 | 3300048908 | Bacteria | 2700 |
| 649 | Ga0496105_0093731 | 3300048908 | Bacteria | 2480 |
| 650 | Ga0496105_0195336 | 3300048908 | Bacteria | 1653 |
| 651 | Ga0496105_0219817 | 3300048908 | Bacteria | 1547 |
| 652 | Ga0496105_0424641 | 3300048908 | Bacteria | 1052 |
| 653 | Ga0496106_0001555 | 3300048909 | Bacteria | 17284 |
| 654 | Ga0496106_0037643 | 3300048909 | Bacteria | 3620 |
| 655 | Ga0496106_0408441 | 3300048909 | Bacteria | 1091 |
| 656 | Ga0496107_0016340 | 3300048910 | Bacteria | 5210 |
| 657 | Ga0496107_0111146 | 3300048910 | Bacteria | 2014 |
| 658 | Ga0496107_0124980 | 3300048910 | Bacteria | 1897 |
| 659 | Ga0496108_0018817 | 3300048911 | Bacteria | 5662 |
| 660 | Ga0496108_0180465 | 3300048911 | Bacteria | 1828 |
| 661 | Ga0496108_0233840 | 3300048911 | Bacteria | 1598 |
| 662 | Ga0496108_0236366 | 3300048911 | Bacteria | 1589 |
| 663 | Ga0496109_0191432 | 3300048912 | Bacteria | 1922 |
| 664 | Ga0496109_0250489 | 3300048912 | Bacteria | 1668 |
| 665 | Ga0496109_0644428 | 3300048912 | Bacteria | 996 |
| 666 | Ga0496110_0006609 | 3300048913 | Bacteria | 9210 |
| 667 | Ga0496110_0016649 | 3300048913 | Bacteria | 6141 |
| 668 | Ga0496110_0017235 | 3300048913 | Bacteria | 6041 |
| 669 | Ga0496110_0046914 | 3300048913 | Bacteria | 3781 |
| 670 | Ga0496110_0259289 | 3300048913 | Bacteria | 1582 |
| 671 | Ga0496111_0189031 | 3300048914 | Bacteria | 1531 |
| 672 | Ga0496111_0273019 | 3300048914 | Bacteria | 1254 |
| 673 | Ga0496112_0004442 | 3300048915 | Bacteria | 11884 |
| 674 | Ga0496112_0045152 | 3300048915 | Bacteria | 4319 |
| 675 | Ga0496112_0087914 | 3300048915 | Bacteria | 3075 |
| 676 | Ga0496112_0158469 | 3300048915 | Bacteria | 2230 |
| 677 | Ga0496112_0353149 | 3300048915 | Bacteria | 1412 |
| 678 | Ga0496113_0035990 | 3300048916 | Bacteria | 3625 |
| 679 | Ga0496113_0095857 | 3300048916 | Bacteria | 2293 |
| 680 | Ga0496113_0370531 | 3300048916 | Bacteria | 1149 |
| 681 | Ga0496114_0153421 | 3300048917 | Bacteria | 1999 |
| 682 | Ga0496114_0216261 | 3300048917 | Bacteria | 1682 |
| 683 | Ga0496115_0039633 | 3300048918 | Bacteria | 3742 |
| 684 | Ga0496115_0047649 | 3300048918 | Bacteria | 3428 |
| 685 | Ga0496115_0074206 | 3300048918 | Bacteria | 2762 |
| 686 | Ga0496115_0174197 | 3300048918 | Bacteria | 1779 |
| 687 | Ga0496115_0189297 | 3300048918 | Bacteria | 1700 |
| 688 | Ga0496115_0275930 | 3300048918 | Bacteria | 1380 |
| 689 | Ga0496116_0054912 | 3300048919 | Bacteria | 2620 |
| 690 | Ga0496117_0005820 | 3300048920 | Bacteria | 12770 |
| 691 | Ga0496118_0143814 | 3300048921 | Bacteria | 1506 |
| 692 | Ga0496119_0042379 | 3300048922 | Bacteria | 2886 |
| 693 | Ga0496120_0174875 | 3300048923 | Bacteria | 1059 |
| 694 | Ga0496121_0005416 | 3300048924 | Bacteria | 16386 |
| 695 | Ga0496121_0020142 | 3300048924 | Bacteria | 6622 |
| 696 | Ga0496121_0043518 | 3300048924 | Bacteria | 3888 |
| 697 | Ga0496121_0079700 | 3300048924 | Bacteria | 2599 |
| 698 | Ga0496121_0106396 | 3300048924 | Bacteria | 2150 |
| 699 | Ga0496121_0114380 | 3300048924 | Bacteria | 2051 |
| 700 | Ga0496121_0204254 | 3300048924 | Bacteria | 1405 |
| 701 | Ga0496121_0249902 | 3300048924 | Bacteria | 1230 |
| 702 | Ga0496121_0251554 | 3300048924 | Bacteria | 1225 |
| 703 | Ga0496121_0366095 | 3300048924 | Bacteria | 955 |
| 704 | Ga0496123_0177808 | 3300048926 | Bacteria | 1115 |
| 705 | Ga0496124_0103550 | 3300048927 | Bacteria | 2302 |
| 706 | Ga0496124_0151043 | 3300048927 | Bacteria | 1822 |
| 707 | Ga0496125_0000125 | 3300048928 | Bacteria | 169979 |
| 708 | Ga0496125_0068712 | 3300048928 | Bacteria | 2785 |
| 709 | Ga0496125_0089160 | 3300048928 | Bacteria | 2321 |
| 710 | Ga0496125_0124327 | 3300048928 | Bacteria | 1832 |
| 711 | Ga0496126_0020161 | 3300048929 | Bacteria | 6544 |
| 712 | Ga0496126_0025338 | 3300048929 | Bacteria | 5707 |
| 713 | Ga0496126_0080306 | 3300048929 | Bacteria | 2886 |
| 714 | Ga0496126_0114795 | 3300048929 | Bacteria | 2342 |
| 715 | Ga0496126_0139981 | 3300048929 | Bacteria | 2084 |
| 716 | Ga0496126_0168436 | 3300048929 | Bacteria | 1868 |
| 717 | Ga0496126_0185840 | 3300048929 | Bacteria | 1762 |
| 718 | Ga0496126_0258762 | 3300048929 | Bacteria | 1448 |
| 719 | Ga0496126_0277437 | 3300048929 | Bacteria | 1389 |
| 720 | Ga0501032_0000345 | 3300049569 | Bacteria | 38831 |
| 721 | Ga0501033_0000094 | 3300049570 | Bacteria | 84669 |
| 722 | Ga0501033_0487703 | 3300049570 | Bacteria | 853 |
| 723 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 724 | Ga0501036_0000115 | 3300049572 | Bacteria | 49866 |
| 725 | Ga0501036_0010504 | 3300049572 | Bacteria | 7649 |
| 726 | Ga0501037_0000174 | 3300049573 | Bacteria | 60960 |
| 727 | Ga0501038_0000052 | 3300049574 | Bacteria | 94841 |
| 728 | Ga0501038_0038840 | 3300049574 | Bacteria | 4167 |
| 729 | Ga0501039_0000156 | 3300049575 | Bacteria | 47049 |
| 730 | Ga0501039_0017265 | 3300049575 | Bacteria | 5536 |
| 731 | Ga0501041_0039440 | 3300049577 | Bacteria | 2866 |
| 732 | Ga0501042_0018861 | 3300049578 | Bacteria | 4782 |
| 733 | Ga0501043_0003891 | 3300049579 | Bacteria | 12258 |
| 734 | Ga0501046_0000133 | 3300049580 | Bacteria | 79467 |
| 735 | Ga0501046_0065558 | 3300049580 | Bacteria | 2833 |
| 736 | Ga0501046_0125475 | 3300049580 | Bacteria | 1950 |
| 737 | Ga0501047_0000440 | 3300049581 | Bacteria | 46007 |
| 738 | Ga0501047_0054289 | 3300049581 | Bacteria | 3875 |
| 739 | Ga0501048_0000072 | 3300049582 | Bacteria | 51953 |
| 740 | Ga0501048_0021700 | 3300049582 | Bacteria | 4699 |
| 741 | Ga0501067_0000076 | 3300049583 | Bacteria | 56529 |
| 742 | Ga0501068_0009421 | 3300049584 | Bacteria | 5463 |
| 743 | Ga0501068_0228803 | 3300049584 | Bacteria | 1182 |
| 744 | Ga0501069_0001017 | 3300049585 | Bacteria | 13364 |
| 745 | Ga0501070_0011558 | 3300049586 | Bacteria | 7452 |
| 746 | Ga0501070_0031178 | 3300049586 | Bacteria | 4466 |
| 747 | Ga0501070_0137618 | 3300049586 | Bacteria | 2016 |
| 748 | Ga0501070_0570941 | 3300049586 | Bacteria | 904 |
| 749 | Ga0501071_0007624 | 3300049587 | Bacteria | 7129 |
| 750 | Ga0501071_0152494 | 3300049587 | Bacteria | 1724 |
| 751 | Ga0501072_0001658 | 3300049588 | Bacteria | 16605 |
| 752 | Ga0501073_0000099 | 3300049589 | Bacteria | 55207 |
| 753 | Ga0501073_0159198 | 3300049589 | Bacteria | 1565 |
| 754 | Ga0501074_0002372 | 3300049590 | Bacteria | 13118 |
| 755 | Ga0501075_0001234 | 3300049591 | Bacteria | 16573 |
| 756 | Ga0501076_0004477 | 3300049592 | Bacteria | 9948 |
| 757 | Ga0501077_0006293 | 3300049593 | Bacteria | 7265 |
| 758 | Ga0501079_0006707 | 3300049741 | Bacteria | 8660 |
| 759 | Ga0501079_0049613 | 3300049741 | Bacteria | 3239 |
| 760 | Ga0501080_0000658 | 3300049742 | Bacteria | 27440 |
| 761 | Ga0501080_0054618 | 3300049742 | Bacteria | 3719 |
| 762 | Ga0501081_0004963 | 3300049743 | Bacteria | 8563 |
| 763 | Ga0501083_0001450 | 3300049744 | Bacteria | 16195 |
| 764 | Ga0501035_0000255 | 3300049822 | Bacteria | 63841 |
| 765 | Ga0501044_0000141 | 3300049823 | Bacteria | 88569 |
| 766 | Ga0501044_0168232 | 3300049823 | Bacteria | 2165 |
| 767 | Ga0501045_0000154 | 3300049824 | Bacteria | 36954 |
| 768 | Ga0501045_0098387 | 3300049824 | Bacteria | 2164 |
| 769 | nmdc:mga03n38_70079_c1 | 3300050490 | Bacteria | 1621 |
| 770 | nmdc:mga00v17_163824_c1 | 3300050491 | Bacteria | 1432 |
| 771 | nmdc:mga0yw44_62255_c1 | 3300050492 | Bacteria | 2291 |
| 772 | nmdc:mga0k408_21847_c1 | 3300050493 | Bacteria | 3599 |
| 773 | nmdc:mga06z11_164606_c1 | 3300050494 | Bacteria | 1270 |
| 774 | nmdc:mga06z11_234038_c1 | 3300050494 | Bacteria | 1077 |
| 775 | nmdc:mga06z11_87491_c1 | 3300050494 | Bacteria | 1685 |
| 776 | nmdc:mga07m45_14594_c1 | 3300050496 | Bacteria | 4189 |
| 777 | nmdc:mga07m45_1811_c1 | 3300050496 | Bacteria | 9847 |
| 778 | nmdc:mga07m45_81575_c1 | 3300050496 | Bacteria | 1847 |
| 779 | nmdc:mga0n895_393539_c1 | 3300050512 | Bacteria | 1402 |
| 780 | nmdc:mga0n895_592801_c1 | 3300050512 | Bacteria | 1111 |
| 781 | nmdc:mga0rr50_474607_c1 | 3300050513 | Bacteria | 1062 |
| 782 | nmdc:mga08x19_74815_c1 | 3300050514 | Bacteria | 2213 |
| 783 | nmdc:mga0sz30_155939_c1 | 3300050516 | Bacteria | 1011 |
| 784 | nmdc:mga0sz30_24098_c1 | 3300050516 | Bacteria | 2482 |
| 785 | nmdc:mga0sz30_25283_c1 | 3300050516 | Bacteria | 2428 |
| 786 | nmdc:mga0sz30_26366_c1 | 3300050516 | Bacteria | 2382 |
| 787 | Ga0495601_0055403 | 3300053077 | Bacteria | 2510 |
| 788 | Ga0495601_0069346 | 3300053077 | Bacteria | 2249 |
| 789 | Ga0495601_0091126 | 3300053077 | Bacteria | 1962 |
| 790 | Ga0495601_0131960 | 3300053077 | Bacteria | 1627 |
| 791 | Ga0500635_0105709 | 3300053080 | Bacteria | 1040 |
| 792 | Ga0495595_0000309 | 3300053084 | Bacteria | 19034 |
| 793 | Ga0495595_0007183 | 3300053084 | Bacteria | 4552 |
| 794 | Ga0495595_0056018 | 3300053084 | Bacteria | 1836 |
| 795 | Ga0495619_0013528 | 3300053085 | Bacteria | 5141 |
| 796 | Ga0495619_0035622 | 3300053085 | Bacteria | 3237 |
| 797 | Ga0495619_0170546 | 3300053085 | Bacteria | 1505 |
| 798 | Ga0495619_0178639 | 3300053085 | Bacteria | 1468 |
| 799 | Ga0500643_000114 | 3300053087 | Bacteria | 84221 |
| 800 | Ga0500566_0000100 | 3300053094 | Bacteria | 43788 |
| 801 | Ga0500566_0005210 | 3300053094 | Bacteria | 7740 |
| 802 | Ga0500566_0097165 | 3300053094 | Bacteria | 1620 |
| 803 | Ga0500641_0015238 | 3300053096 | Bacteria | 2849 |
| 804 | Ga0500641_0021580 | 3300053096 | Bacteria | 2457 |
| 805 | Ga0500555_014686 | 3300053103 | Bacteria | 2258 |
| 806 | Ga0500557_000010 | 3300053105 | Bacteria | 118251 |
| 807 | Ga0500572_000176 | 3300053111 | Bacteria | 22627 |
| 808 | Ga0500572_067088 | 3300053111 | Bacteria | 1101 |
| 809 | Ga0500591_050717 | 3300053115 | Bacteria | 1946 |
| 810 | Ga0500595_008586 | 3300053119 | Bacteria | 4169 |
| 811 | Ga0500595_017295 | 3300053119 | Bacteria | 2664 |
| 812 | Ga0500595_101989 | 3300053119 | Bacteria | 821 |
| 813 | Ga0500614_000141 | 3300053123 | Bacteria | 17860 |
| 814 | Ga0500642_0000334 | 3300053130 | Bacteria | 16200 |
| 815 | Ga0500559_0000509 | 3300053136 | Bacteria | 27329 |
| 816 | Ga0500559_0003396 | 3300053136 | Bacteria | 7846 |
| 817 | Ga0500559_0010805 | 3300053136 | Bacteria | 3914 |
| 818 | Ga0500559_0011256 | 3300053136 | Bacteria | 3823 |
| 819 | Ga0500568_0021512 | 3300053139 | Bacteria | 2773 |
| 820 | Ga0500590_074000 | 3300053148 | Bacteria | 1687 |
| 821 | Ga0500603_000017 | 3300053150 | Bacteria | 56324 |
| 822 | Ga0500616_0000085 | 3300053153 | Bacteria | 193192 |
| 823 | Ga0500616_0047694 | 3300053153 | Bacteria | 2274 |
| 824 | Ga0500619_101013 | 3300053154 | Bacteria | 978 |
| 825 | Ga0500620_065145 | 3300053155 | Bacteria | 1246 |
| 826 | Ga0500622_0028142 | 3300053156 | Bacteria | 2959 |
| 827 | Ga0500630_138936 | 3300053159 | Bacteria | 1048 |
| 828 | Ga0500638_045908 | 3300053162 | Bacteria | 2119 |
| 829 | Ga0500639_000525 | 3300053163 | Bacteria | 19105 |
| 830 | Ga0500636_0000695 | 3300053177 | Bacteria | 18042 |
| 831 | Ga0500636_0054333 | 3300053177 | Bacteria | 2347 |
| 832 | Ga0500637_0000099 | 3300053178 | Bacteria | 31315 |
| 833 | Ga0500637_0186977 | 3300053178 | Bacteria | 1185 |
| 834 | Ga0500625_003061 | 3300053729 | Bacteria | 6484 |
| 835 | Ga0500645_035495 | 3300053730 | Bacteria | 1485 |
| 836 | Ga0500645_060255 | 3300053730 | Bacteria | 1098 |
| 837 | Ga0500609_005927 | 3300053731 | Bacteria | 1666 |
| 838 | Ga0500596_002494 | 3300053735 | Bacteria | 3629 |
| 839 | Ga0500601_001196 | 3300053737 | Bacteria | 2889 |
| 840 | Ga0501084_0006070 | 3300054114 | Bacteria | 9938 |
| 841 | Ga0501084_0078641 | 3300054114 | Bacteria | 2764 |
| 842 | Ga0500661_001939 | 3300055283 | Bacteria | 3904 |
| 843 | Ga0501082_0004101 | 3300060353 | Bacteria | 12720 |
| 844 | Ga0466962_0089194 | 3300061719 | Bacteria | 1477 |
| 845 | Ga0530510_0012192 | 3300061734 | Bacteria | 6034 |
| 846 | 2507509720 | 2507262055 | Bacteria | 8048963 |
| 847 | 2508543737 | 2508501009 | Bacteria | 7784016 |
| 848 | 2508698476 | 2508501042 | Bacteria | 8719808 |
| 849 | 2509149568 | 2508501128 | Bacteria | 8613869 |
| 850 | 2511399120 | 2511231028 | Bacteria | 8046582 |
| 851 | 2513629166 | 2513237092 | Bacteria | 8341956 |
| 852 | 2513644827 | 2513237094 | Bacteria | 8789602 |
| 853 | 2513646218 | 2513237095 | Bacteria | 8976980 |
| 854 | 2513661079 | 2513237096 | Bacteria | 8722461 |
| 855 | 2513673719 | 2513237098 | Bacteria | 9902361 |
| 856 | 2513695851 | 2513237101 | Bacteria | 7952346 |
| 857 | 2513701784 | 2513237102 | Bacteria | 7703324 |
| 858 | 2513857457 | 2513237137 | Bacteria | 9558895 |
| 859 | 2513893902 | 2513237141 | Bacteria | 8496279 |
| 860 | 2513922764 | 2513237145 | Bacteria | 8979722 |
| 861 | 2514011536 | 2513237161 | Bacteria | 8871253 |
| 862 | 2514017558 | 2513237161 | Bacteria | 8871253 |
| 863 | 2514017672 | 2513237161 | Bacteria | 8871253 |
| 864 | 2515630069 | 2515154112 | Bacteria | 8294334 |
| 865 | 2517103584 | 2517093001 | Bacteria | 9002274 |
| 866 | 2517893414 | 2517572143 | Bacteria | 9484767 |
| 867 | 2524442173 | 2524023205 | Bacteria | 8918781 |
| 868 | 2524470070 | 2524023210 | Bacteria | 9029266 |
| 869 | 2524537920 | 2524023228 | Bacteria | 10118060 |
| 870 | 2528854144 | 2528768022 | Bacteria | 10457665 |
| 871 | 2617349242 | 2617270735 | Bacteria | 9163226 |
| 872 | 2617378232 | 2617270741 | Bacteria | 8201522 |
| 873 | 2671118063 | 2667528175 | Bacteria | 7532676 |
| 874 | 2723846088 | 2721755755 | Bacteria | 8322773 |
| 875 | 2728747816 | 2728368998 | Bacteria | 8720350 |
| 876 | 2745079438 | 2744054633 | Bacteria | 8678936 |
| 877 | 2793060308 | 2791355196 | Bacteria | 7323613 |
| 878 | 2793071824 | 2791355197 | Bacteria | 8420563 |
| 879 | 2793076742 | |||
| 880 | 2805917669 | 2802429603 | Bacteria | 8777136 |
| 881 | 2818241443 | 2816332527 | Bacteria | 8933356 |
| 882 | 2824602175 | 2824600985 | Bacteria | 8488197 |
| 883 | 2824610163 | 2824609381 | Bacteria | 8672835 |
| 884 | 2824623824 | 2824617872 | Bacteria | 8814715 |
| 885 | 2824627762 | 2824626560 | Bacteria | 8813858 |
| 886 | 2824639298 | 2824635225 | Bacteria | 8785348 |
| 887 | 2824646869 | 2824644064 | Bacteria | 8743947 |
| 888 | 2824656141 | 2824653114 | Bacteria | 8493680 |
| 889 | 2824669097 | 2824661429 | Bacteria | 9877870 |
| 890 | 2824672860 | 2824671348 | Bacteria | 8369588 |
| 891 | 2824683984 | 2824679649 | Bacteria | 8248951 |
| 892 | 2824691011 | 2824687955 | Bacteria | 8360029 |
| 893 | 2824698419 | 2824696289 | Bacteria | 8335049 |
| 894 | 2824711602 | 2824704595 | Bacteria | 9667483 |
| 895 | 2824717920 | 2824714736 | Bacteria | 8717648 |
| 896 | 2824727657 | 2824723954 | Bacteria | 8758240 |
| 897 | 2824736718 | 2824732956 | Bacteria | 7810675 |
| 898 | 2824746875 | 2824746037 | Bacteria | 7911610 |
| 899 | 2824761665 | 2824753945 | Bacteria | 9787441 |
| 900 | 2824771280 | 2824763712 | Bacteria | 9792355 |
| 901 | 2838130028 | 2838122688 | Bacteria | 8803140 |
| 902 | 2841941183 | 2841941048 | Bacteria | 8688029 |
| 903 | 2841952790 | 2841949485 | Bacteria | 8680857 |
| 904 | 2841962301 | 2841957949 | Bacteria | 8652217 |
| 905 | 2841967338 | 2841966195 | Bacteria | 8673214 |
| 906 | 2841979265 | 2841974524 | Bacteria | 8931498 |
| 907 | 2841990838 | 2841983080 | Bacteria | 8395090 |
| 908 | 2842038680 | 2842038055 | Bacteria | 8002051 |
| 909 | 2842048375 | 2842045827 | Bacteria | 8006841 |
| 910 | 2844318078 | 2844315083 | Bacteria | 8138177 |
| 911 | 2847934887 | 2847930680 | Bacteria | 9342022 |
| 912 | 2847945454 | 2847939898 | Bacteria | 8606328 |
| 913 | 2849080360 | 2849076700 | Bacteria | 7039503 |
| 914 | 2857510290 | 2857509624 | Bacteria | 7472071 |
| 915 | 2874592385 | 2874590934 | Bacteria | 8299676 |
| 916 | 2874595170 | 2874590934 | Bacteria | 8299676 |
| 917 | 2874608972 | 2874604998 | Bacteria | 7834745 |
| 918 | 2874613136 | 2874612657 | Bacteria | 8252029 |
| 919 | 2874621618 | 2874620515 | Bacteria | 8290088 |
| 920 | 2874636592 | 2874628541 | Bacteria | 8630250 |
| 921 | 2874651031 | 2874645413 | Bacteria | 8214782 |
| 922 | 2876762492 | 2876761206 | Bacteria | 10111113 |
| 923 | 2876772663 | 2876771140 | Bacteria | 8287509 |
| 924 | 2876775106 | 2876771140 | Bacteria | 8287509 |
| 925 | 2876819997 | 2876818435 | Bacteria | 8274608 |
| 926 | 2876823921 | 2876818435 | Bacteria | 8274608 |
| 927 | 2879076430 | 2879074833 | Bacteria | 8279565 |
| 928 | 2879080549 | 2879074833 | Bacteria | 8279565 |
| 929 | 2879086277 | 2879083081 | Bacteria | 8587928 |
| 930 | 2879109400 | 2879099564 | Bacteria | 10442239 |
| 931 | 2879110612 | 2879110137 | Bacteria | 8907982 |
| 932 | 2879134845 | 2879127579 | Bacteria | 8294491 |
| 933 | 2879149156 | 2879142872 | Bacteria | 8267021 |
| 934 | 2881366281 | 2881364244 | Bacteria | 7710352 |
| 935 | 2881666226 | 2881665667 | Bacteria | 8175609 |
| 936 | 2885372875 | 2885366525 | Bacteria | 8326213 |
| 937 | 2885377296 | 2885374607 | Bacteria | 8927485 |
| 938 | 2885389899 | 2885383462 | Bacteria | 9473874 |
| 939 | 2885413005 | 2885409591 | Bacteria | 9235467 |
| 940 | 2888382881 | 2888378607 | Bacteria | 9652610 |
| 941 | 2888394922 | 2888388044 | Bacteria | 7304136 |
| 942 | 2888423355 | 2888419890 | Bacteria | 7857137 |
| 943 | 2889041032 | 2889033259 | Bacteria | 9099371 |
| 944 | 2903729615 | 2903727486 | Bacteria | 8281579 |
| 945 | 2903755593 | 2903748898 | Bacteria | 9972761 |
| 946 | 2903774909 | 2903768456 | Bacteria | 9749579 |
| 947 | 2904668666 | 2904666416 | Bacteria | 8226587 |
| 948 | 2904696748 | 2904690495 | Bacteria | 9412302 |
| 949 | 2904701741 | |||
| 950 | 2904716718 | 2904711408 | Bacteria | 9771557 |
| 951 | 2906605761 | 2906602504 | Bacteria | 8295279 |
| 952 | 2906617384 | |||
| 953 | 2906628215 | 2906626472 | Bacteria | 8826946 |
| 954 | 2906640632 | 2906635258 | Bacteria | 8601019 |
| 955 | 2906649432 | 2906643746 | Bacteria | 8722424 |
| 956 | 2906665852 | 2906660503 | Bacteria | 8595048 |
| 957 | 2908743819 | 2908739725 | Bacteria | 8628932 |
| 958 | 2908761535 | 2908756301 | Bacteria | 8864324 |
| 959 | 2908778996 | 2908775508 | Bacteria | 8092255 |
| 960 | 2922368010 | 2922361189 | Bacteria | 7436256 |
| 961 | 2922373087 | |||
| 962 | 2922392110 | 2922386360 | Bacteria | 7017218 |
| 963 | 2922395286 | 2922393267 | Bacteria | 8285685 |
| 964 | 2922429055 | |||
| 965 | 2929615848 | 2929615660 | Bacteria | 9193770 |
| 966 | 2929630461 | 2929624759 | Bacteria | 9339455 |
| 967 | 2932792509 | 2932784394 | Bacteria | 9704911 |
| 968 | 2932800345 | 2932794094 | Bacteria | 7915132 |
| 969 | 2932804519 | 2932801729 | Bacteria | 7987968 |
| 970 | 2932814030 | 2932809354 | Bacteria | 9135765 |
| 971 | 2932819479 | 2932818245 | Bacteria | 9955613 |
| 972 | 2932833813 | 2932828146 | Bacteria | 9745859 |
| 973 | 2933578866 | 2933577622 | Bacteria | 9116884 |
| 974 | 2935611420 | 2935608549 | Bacteria | 8203142 |
| 975 | 2935618661 | 2935616580 | Bacteria | 9032984 |
| 976 | 2935634388 | 2935630451 | Bacteria | 8169952 |
| 977 | 2935638143 | 2935630451 | Bacteria | 8169952 |
| 978 | 2935644500 | 2935638405 | Bacteria | 10015038 |
| 979 | 2935648804 | 2935648319 | Bacteria | 8801166 |
| 980 | 2935657113 | 2935656913 | Bacteria | 8965014 |
| 981 | 2935673609 | 2935665750 | Bacteria | 9571747 |
| 982 | 2935688000 | 2935684952 | Bacteria | 9590419 |
| 983 | 2935701388 | 2935694250 | Bacteria | 9291695 |
| 984 | 2935708357 | 2935703347 | Bacteria | 10242284 |
| 985 | 2935715020 | 2935713505 | Bacteria | 9608509 |
| 986 | 2935726415 | 2935722832 | Bacteria | 9608746 |
| 987 | 2935733838 | 2935732158 | Bacteria | 9706831 |
| 988 | 2935743217 | 2935741537 | Bacteria | 9707219 |
| 989 | 2935754744 | 2935750917 | Bacteria | 9590372 |
| 990 | 2935765451 | 2935760218 | Bacteria | 9817913 |
| 991 | 2935776271 | 2935769743 | Bacteria | 7878163 |
| 992 | 2935779595 | 2935777560 | Bacteria | 8077691 |
| 993 | 2935790260 | 2935785616 | Bacteria | 7962367 |
| 994 | 2935798843 | 2935793552 | Bacteria | 8012592 |
| 995 | 2935805405 | 2935801545 | Bacteria | 9301974 |
| 996 | 2935816698 | 2935810662 | Bacteria | 9401221 |
| 997 | 2935820897 | 2935819856 | Bacteria | 8261050 |
| 998 | 2935827773 | 2935819856 | Bacteria | 8261050 |
| 999 | 2935833751 | 2935827899 | Bacteria | 10038562 |
| 1000 | 2935839563 | 2935837841 | Bacteria | 9454360 |
| 1001 | 2935850843 | 2935847175 | Bacteria | 8228321 |
| 1002 | 2935855063 | 2935847175 | Bacteria | 8228321 |
| 1003 | 2935857026 | 2935855204 | Bacteria | 9035059 |
| 1004 | 2935871150 | 2935864058 | Bacteria | 9784707 |
| 1005 | 2935876347 | 2935873716 | Bacteria | 9632195 |
| 1006 | 2935889713 | 2935883170 | Bacteria | 7964738 |
| 1007 | 2935913789 | 2935908558 | Bacteria | 8568796 |
| 1008 | 2935920221 | 2935916978 | Bacteria | 9113783 |
| 1009 | 2935930560 | 2935926038 | Bacteria | 8601059 |
| 1010 | 2935939467 | 2935934488 | Bacteria | 8602579 |
| 1011 | 2935946416 | 2935942939 | Bacteria | 8599779 |
| 1012 | 2935955745 | 2935951376 | Bacteria | 8602333 |
| 1013 | 2935964667 | 2935959822 | Bacteria | 7869783 |
| 1014 | 2935972545 | 2935967501 | Bacteria | 8603075 |
| 1015 | 2935981622 | 2935975950 | Bacteria | 8347125 |
| 1016 | 2935984008 | 2935975950 | Bacteria | 8347125 |
| 1017 | 2935992049 | 2935984226 | Bacteria | 8302647 |
| 1018 | 2935997684 | 2935992306 | Bacteria | 9802711 |
| 1019 | 2936007202 | 2936002035 | Bacteria | 9362176 |
| 1020 | 2936011714 | 2936011229 | Bacteria | 8801034 |
| 1021 | 2936020309 | 2936019824 | Bacteria | 8804134 |
| 1022 | 2936029004 | 2936028420 | Bacteria | 8965941 |
| 1023 | 2936043040 | 2936037263 | Bacteria | 9446081 |
| 1024 | 2936047032 | 2936046547 | Bacteria | 8903709 |
| 1025 | 2936058088 | 2936055302 | Bacteria | 8785755 |
| 1026 | 2940559879 | 2940556831 | Bacteria | 9590747 |
| 1027 | 2941511278 | 2941507105 | Bacteria | 8166816 |
| 1028 | 2941514784 | 2941507105 | Bacteria | 8166816 |
| 1029 | 2941518662 | 2941515067 | Bacteria | 8166720 |
| 1030 | 2941522758 | 2941515067 | Bacteria | 8166720 |
| 1031 | 2941530398 | 2941523033 | Bacteria | 8169134 |
| 1032 | 2941530677 | 2941523033 | Bacteria | 8169134 |
| 1033 | 2941536028 | 2941531003 | Bacteria | 7653939 |
| 1034 | 2941540252 | 2941538514 | Bacteria | 9402094 |
| 1035 | 3005479210 | 3005474847 | Bacteria | 9259049 |
| 1036 | 3005482318 | 3005474847 | Bacteria | 9259049 |
| 1037 | 3005489838 | 3005483717 | Bacteria | 7877331 |
| 1038 | 3005512650 | 3005506211 | Bacteria | 6943378 |
| 1039 | 3005590413 | 3005587118 | Bacteria | 7794411 |
| 1040 | 3005598129 | 3005594810 | Bacteria | 8716512 |
| 1041 | 3005713807 | 3005710791 | Bacteria | 7622528 |
| 1042 | 3005721316 | 3005718088 | Bacteria | 8283608 |
| 1043 | 8006942139 | 8006933436 | Bacteria | 10410654 |
| 1044 | 8006964447 | 8006964411 | Bacteria | 8966052 |
| 1045 | 8006981875 | 8006973647 | Bacteria | 10679141 |
| 1046 | 8006986947 | 8006984368 | Bacteria | 9651211 |
| 1047 | 8006992259 | 8006984368 | Bacteria | 9651211 |
| 1048 | 8006996164 | 8006994254 | Bacteria | 8309700 |
| 1049 | 8016514621 | 8016511872 | Bacteria | 9921665 |
| 1050 | 8016530725 | 8016522445 | Bacteria | 8156687 |
| 1051 | 8016540292 | 8016539877 | Bacteria | 8155419 |
| 1052 | 8016552939 | 8016548790 | Bacteria | 8155074 |
| 1053 | 8016561316 | 8016557553 | Bacteria | 8154380 |
| 1054 | 8016574360 | 8016566248 | Bacteria | 8158151 |
| 1055 | 8016578457 | 8016575299 | Bacteria | 8154085 |
| 1056 | 8016584772 | 8016583857 | Bacteria | 10421953 |
| 1057 | 8016591312 | 8016583857 | Bacteria | 10421953 |
| 1058 | 8016599174 | 8016595262 | Bacteria | 8149947 |
| 1059 | 8016611873 | 8016603502 | Bacteria | 8731218 |
| 1060 | 8016621933 | 8016613128 | Bacteria | 8794220 |
| 1061 | 8016627917 | 8016622563 | Bacteria | 7999408 |
| 1062 | 8016632242 | 8016630954 | Bacteria | 9217207 |
| 1063 | 8017061810 | 8017057580 | Bacteria | 10023680 |
| 1064 | 8019535738 | 8019530166 | Bacteria | 8155624 |
| 1065 | 8019543743 | 8019538911 | Bacteria | 7872763 |
| 1066 | 8019555028 | 8019547302 | Bacteria | 7996444 |
| 1067 | 8019557870 | 8019555841 | Bacteria | 9642137 |
| 1068 | 8019567419 | 8019565922 | Bacteria | 9639779 |
| 1069 | 8019581339 | 8019576017 | Bacteria | 10049540 |
| 1070 | 8019602270 | 8019597564 | Bacteria | 10041141 |
| 1071 | 8019616292 | 8019608314 | Bacteria | 10042931 |
| 1072 | 8019626896 | 8019619141 | Bacteria | 9218857 |
| 1073 | 8019635622 | 8019629233 | Bacteria | 8687553 |
| 1074 | 8019644063 | 8019638758 | Bacteria | 9062356 |
| 1075 | 8019657052 | 8019648815 | Bacteria | 10014479 |
| 1076 | 8019663419 | 8019659431 | Bacteria | 8577854 |
| 1077 | 8019673034 | 8019668869 | Bacteria | 8791617 |
| 1078 | 8019683109 | 8019678201 | Bacteria | 8863603 |
| 1079 | 8019688800 | 8019687851 | Bacteria | 8712826 |
| 1080 | 8055747495 | 8055742211 | Bacteria | 9226248 |
| 1081 | 8056680545 | 8056673599 | Bacteria | 7871253 |
| 1082 | 8056683886 | 8056681323 | Bacteria | 8472857 |
| 1083 | 8056694236 | 8056689827 | Bacteria | 6712655 |
| 1084 | 8056972431 | 8056967851 | Bacteria | 9038162 |
| 1085 | Ga0070681_10125164 | |||
| 1086 | JGI24740J21852_10011523 | |||
| 1087 | JGI24739J22299_10002438 | |||
| 1088 | JGI24737J22298_10004854 | |||
| 1089 | JGI25406J46586_10001179 | |||
| 1090 | JGI25153J46596_10005204 | |||
| 1091 | JGI25153J46596_10007403 | |||
| 1092 | JGI25160J50197_1010719 | |||
| 1093 | JGI25160J50197_1020474 | |||
| 1094 | Ga0055542_1016876 | |||
| 1095 | Ga0055531_10019315 | |||
| 1096 | Ga0065165_1001478 | |||
| 1097 | Ga0065165_1033961 | |||
| 1098 | Ga0070683_100014448 | |||
| 1099 | Ga0068869_100101705 | |||
| 1100 | Ga0070680_100006838 | |||
| 1101 | Ga0070680_100178987 | |||
| 1102 | Ga0070680_100329943 | |||
| 1103 | Ga0070682_100133581 | |||
| 1104 | Ga0070682_100168088 | |||
| 1105 | Ga0068868_100027083 | |||
| 1106 | Ga0068868_100098904 | |||
| 1107 | Ga0070660_100000712 | |||
| 1108 | Ga0070660_100382026 | |||
| 1109 | Ga0070660_100383745 | |||
| 1110 | Ga0070661_100260617 | |||
| 1111 | Ga0070668_100180001 | |||
| 1112 | Ga0070668_100453793 | |||
| 1113 | Ga0070674_100294431 | |||
| 1114 | Ga0070673_100447284 | |||
| 1115 | Ga0070673_100660345 | |||
| 1116 | Ga0070667_100424558 | |||
| 1117 | Ga0070667_100499957 | |||
| 1118 | Ga0070709_10000551 | |||
| 1119 | Ga0070709_10105298 | |||
| 1120 | Ga0070714_100397026 | |||
| 1121 | Ga0070713_100226282 | |||
| 1122 | Ga0070713_100586841 | |||
| 1123 | Ga0070710_10001238 | |||
| 1124 | Ga0070710_10001820 | |||
| 1125 | Ga0070710_10102745 | |||
| 1126 | Ga0070710_10268015 | |||
| 1127 | Ga0070701_10051860 | |||
| 1128 | Ga0070711_100002350 | |||
| 1129 | Ga0070711_100003473 | |||
| 1130 | Ga0070711_100079148 | |||
| 1131 | Ga0070711_100305852 | |||
| 1132 | Ga0070711_100372393 | |||
| 1133 | Ga0070694_100328072 | |||
| 1134 | Ga0070708_100046602 | |||
| 1135 | Ga0070708_100490488 | |||
| 1136 | Ga0070663_100040475 | |||
| 1137 | Ga0070663_100054123 | |||
| 1138 | Ga0070663_100054938 | |||
| 1139 | Ga0070663_100103558 | |||
| 1140 | Ga0070663_100170693 | |||
| 1141 | Ga0070678_100039966 | |||
| 1142 | Ga0070678_100132998 | |||
| 1143 | Ga0070678_100260387 | |||
| 1144 | Ga0070662_100027262 | |||
| 1145 | Ga0070662_100099029 | |||
| 1146 | Ga0070681_10110287 | |||
| 1147 | Ga0070681_10122346 | |||
| 1148 | Ga0070681_10419940 | |||
| 1149 | Ga0068867_100021615 | |||
| 1150 | Ga0070706_100228573 | |||
| 1151 | Ga0070707_100086015 | |||
| 1152 | Ga0070698_100036324 | |||
| 1153 | Ga0070698_100210116 | |||
| 1154 | Ga0070698_100498268 | |||
| 1155 | Ga0070679_100022733 | |||
| 1156 | Ga0068853_100005063 | |||
| 1157 | Ga0068853_100006754 | |||
| 1158 | Ga0068853_100012289 | |||
| 1159 | Ga0068853_100186409 | |||
| 1160 | Ga0070665_100026061 | |||
| 1161 | Ga0070665_100047830 | |||
| 1162 | Ga0070665_100082828 | |||
| 1163 | Ga0070665_100146919 | |||
| 1164 | Ga0068855_100021262 | |||
| 1165 | Ga0068855_100064535 | |||
| 1166 | Ga0068855_100187454 | |||
| 1167 | Ga0068855_100188165 | |||
| 1168 | Ga0068855_100305708 | |||
| 1169 | Ga0068855_100310782 | |||
| 1170 | Ga0068855_100566108 | |||
| 1171 | Ga0068857_100004213 | |||
| 1172 | Ga0068857_100010308 | |||
| 1173 | Ga0068857_100187082 | |||
| 1174 | Ga0068857_100245940 | |||
| 1175 | Ga0068857_100562039 | |||
| 1176 | Ga0068854_100006781 | |||
| 1177 | Ga0068854_100064356 | |||
| 1178 | Ga0068854_100083015 | |||
| 1179 | Ga0068856_100000680 | |||
| 1180 | Ga0068856_100005799 | |||
| 1181 | Ga0068856_100014113 | |||
| 1182 | Ga0068856_100204010 | |||
| 1183 | Ga0070702_100034742 | |||
| 1184 | Ga0068852_100002663 | |||
| 1185 | Ga0068852_100026836 | |||
| 1186 | Ga0068852_100159343 | |||
| 1187 | Ga0068859_100520475 | |||
| 1188 | Ga0068864_100089844 | |||
| 1189 | Ga0068861_100197148 | |||
| 1190 | Ga0068851_10005696 | |||
| 1191 | Ga0068851_10024772 | |||
| 1192 | Ga0068851_10052686 | |||
| 1193 | Ga0068858_100125234 | |||
| 1194 | Ga0068858_100266066 | |||
| 1195 | Ga0068860_100073802 | |||
| 1196 | Ga0068862_100303885 | |||
| 1197 | Ga0081455_10000992 | |||
| 1198 | Ga0081455_10092423 | |||
| 1199 | Ga0081455_10141514 | |||
| 1200 | Ga0081538_10063422 | |||
| 1201 | Ga0081540_1014248 | |||
| 1202 | Ga0081540_1059502 | |||
| 1203 | Ga0081540_1073290 | |||
| 1204 | Ga0081540_1083716 | |||
| 1205 | Ga0081540_1099546 | |||
| 1206 | Ga0081540_1116501 | |||
| 1207 | Ga0081539_10000897 | |||
| 1208 | Ga0081539_10008354 | |||
| 1209 | Ga0070717_10064707 | |||
| 1210 | Ga0075365_10102146 | |||
| 1211 | Ga0075368_10093412 | |||
| 1212 | Ga0075363_100054846 | |||
| 1213 | Ga0070715_10126896 | |||
| 1214 | Ga0070716_100019469 | |||
| 1215 | Ga0070716_100035052 | |||
| 1216 | Ga0070716_100264459 | |||
| 1217 | Ga0070712_100062581 | |||
| 1218 | Ga0070712_100202109 | |||
| 1219 | Ga0070712_100283348 | |||
| 1220 | Ga0075367_10031433 | |||
| 1221 | Ga0075367_10082594 | |||
| 1222 | Ga0075367_10083956 | |||
| 1223 | Ga0075369_10036513 | |||
| 1224 | Ga0075366_10110069 | |||
| 1225 | Ga0097621_100127508 | |||
| 1226 | Ga0097621_100262800 | |||
| 1227 | Ga0097621_100437272 | |||
| 1228 | Ga0075370_10159321 | |||
| 1229 | Ga0068871_100220918 | |||
| 1230 | Ga0068871_100341907 | |||
| 1231 | Ga0068865_100089419 | |||
| 1232 | Ga0068865_100156347 | |||
| 1233 | Ga0075436_100028108 | |||
| 1234 | Ga0097620_100520457 | |||
| 1235 | Ga0099825_1039902 | |||
| 1236 | Ga0099824_1009535 | |||
| 1237 | Ga0099824_1029734 | |||
| 1238 | Ga0099824_1031717 | |||
| 1239 | Ga0099823_1019354 | |||
| 1240 | Ga0099794_10154006 | |||
| 1241 | Ga0105240_10002310 | |||
| 1242 | Ga0105240_10012829 | |||
| 1243 | Ga0105240_10050635 | |||
| 1244 | Ga0105240_10056950 | |||
| 1245 | Ga0105240_10319942 | |||
| 1246 | Ga0105240_10543246 | |||
| 1247 | Ga0111539_10215700 | |||
| 1248 | Ga0105245_10248688 | |||
| 1249 | Ga0105245_10266516 | |||
| 1250 | Ga0105245_10350566 | |||
| 1251 | Ga0105241_10000959 | |||
| 1252 | Ga0105241_10041926 | |||
| 1253 | Ga0105241_10074708 | |||
| 1254 | Ga0105242_10521080 | |||
| 1255 | Ga0105248_10246252 | |||
| 1256 | Ga0105248_10284689 | |||
| 1257 | Ga0105248_10682701 | |||
| 1258 | Ga0105237_10002162 | |||
| 1259 | Ga0105237_10044143 | |||
| 1260 | Ga0105237_10085641 | |||
| 1261 | Ga0105237_10102084 | |||
| 1262 | Ga0105237_10126794 | |||
| 1263 | Ga0105237_10212943 | |||
| 1264 | Ga0105237_10484908 | |||
| 1265 | Ga0105237_10513597 | |||
| 1266 | Ga0105238_10008888 | |||
| 1267 | Ga0105238_10019184 | |||
| 1268 | Ga0105238_10088428 | |||
| 1269 | Ga0105238_10441205 | |||
| 1270 | Ga0105249_10191479 | |||
| 1271 | Ga0099796_10034706 | |||
| 1272 | Ga0099796_10063877 | |||
| 1273 | Ga0105239_10017424 | |||
| 1274 | Ga0105239_10050009 | |||
| 1275 | Ga0105239_10069482 | |||
| 1276 | Ga0105239_10225560 | |||
| 1277 | Ga0105239_10329332 | |||
| 1278 | Ga0105239_10467520 | |||
| 1279 | Ga0105246_10082519 | |||
| 1280 | Ga0105246_10131724 | |||
| 1281 | Ga0105246_10134725 | |||
| 1282 | Ga0157371_10117560 | |||
| 1283 | Ga0157370_10135233 | |||
| 1284 | Ga0157369_10028215 | |||
| 1285 | Ga0157369_10049560 | |||
| 1286 | Ga0157369_10055146 | |||
| 1287 | Ga0157369_10089917 | |||
| 1288 | Ga0157374_10049880 | |||
| 1289 | Ga0157374_10170182 | |||
| 1290 | Ga0157378_10026868 | |||
| 1291 | Ga0157378_10330451 | |||
| 1292 | Ga0163162_10259940 | |||
| 1293 | Ga0157372_10099634 | |||
| 1294 | Ga0157375_10343049 | |||
| 1295 | Ga0157375_10579787 | |||
| 1296 | Ga0163163_10154003 | |||
| 1297 | Ga0163163_10556450 | |||
| 1298 | Ga0182008_10160050 | |||
| 1299 | Ga0157379_10079142 | |||
| 1300 | Ga0157379_10394059 | |||
| 1301 | Ga0157376_10030274 | |||
| 1302 | Ga0163161_10289709 | |||
| 1303 | Ga0214544_1000006 | |||
| 1304 | Ga0214544_1000377 | |||
| 1305 | Ga0214544_1010618 | |||
| 1306 | Ga0214542_1000002 | |||
| 1307 | Ga0214542_1004323 | |||
| 1308 | Ga0214545_1000002 | |||
| 1309 | Ga0214543_1000017 | |||
| 1310 | Ga0213876_10007884 | |||
| 1311 | Ga0209563_105457 | |||
| 1312 | Ga0209677_100615 | |||
| 1313 | Ga0209677_107210 | |||
| 1314 | Ga0209148_1000354 | |||
| 1315 | Ga0209233_1007060 | |||
| 1316 | Ga0209233_1012516 | |||
| 1317 | Ga0209455_1003303 | |||
| 1318 | Ga0209455_1007239 | |||
| 1319 | Ga0209564_1007319 | |||
| 1320 | Ga0209564_1018146 | |||
| 1321 | Ga0209758_1000164 | |||
| 1322 | Ga0209758_1000216 | |||
| 1323 | Ga0209758_1000375 | |||
| 1324 | Ga0209758_1001489 | |||
| 1325 | Ga0209758_1003612 | |||
| 1326 | Ga0209758_1017929 | |||
| 1327 | Ga0207426_1004590 | |||
| 1328 | Ga0207426_1008861 | |||
| 1329 | Ga0207426_1010488 | |||
| 1330 | Ga0209257_1000782 | |||
| 1331 | Ga0207697_10073638 | |||
| 1332 | Ga0207656_10009951 | |||
| 1333 | Ga0207692_10000660 | |||
| 1334 | Ga0207692_10083384 | |||
| 1335 | Ga0207692_10169253 | |||
| 1336 | Ga0207642_10095691 | |||
| 1337 | Ga0207680_10282965 | |||
| 1338 | Ga0207647_10070224 | |||
| 1339 | Ga0207685_10083403 | |||
| 1340 | Ga0207699_10000526 | |||
| 1341 | Ga0207699_10051147 | |||
| 1342 | Ga0207643_10247328 | |||
| 1343 | Ga0207705_10252279 | |||
| 1344 | Ga0207684_10218985 | |||
| 1345 | Ga0207654_10001069 | |||
| 1346 | Ga0207654_10084014 | |||
| 1347 | Ga0207654_10251938 | |||
| 1348 | Ga0207707_10001083 | |||
| 1349 | Ga0207707_10084099 | |||
| 1350 | Ga0207707_10153348 | |||
| 1351 | Ga0207695_10000599 | |||
| 1352 | Ga0207695_10002303 | |||
| 1353 | Ga0207695_10097380 | |||
| 1354 | Ga0207671_10001926 | |||
| 1355 | Ga0207671_10153502 | |||
| 1356 | Ga0207671_10203983 | |||
| 1357 | Ga0207693_10048687 | |||
| 1358 | Ga0207693_10080556 | |||
| 1359 | Ga0207693_10153555 | |||
| 1360 | Ga0207663_10000334 | |||
| 1361 | Ga0207663_10004028 | |||
| 1362 | Ga0207663_10114199 | |||
| 1363 | Ga0207663_10286511 | |||
| 1364 | Ga0207660_10003821 | |||
| 1365 | Ga0207657_10116870 | |||
| 1366 | Ga0207652_10003147 | |||
| 1367 | Ga0207652_10272665 | |||
| 1368 | Ga0207694_10000640 | |||
| 1369 | Ga0207694_10018292 | |||
| 1370 | Ga0207694_10181998 | |||
| 1371 | Ga0207694_10245181 | |||
| 1372 | Ga0207650_10269903 | |||
| 1373 | Ga0207659_10348342 | |||
| 1374 | Ga0207687_10096376 | |||
| 1375 | Ga0207700_10001731 | |||
| 1376 | Ga0207700_10099458 | |||
| 1377 | Ga0207664_10093811 | |||
| 1378 | Ga0207690_10041561 | |||
| 1379 | Ga0207706_10128708 | |||
| 1380 | Ga0207706_10318437 | |||
| 1381 | Ga0207669_10065091 | |||
| 1382 | Ga0207669_10260233 | |||
| 1383 | Ga0207665_10005331 | |||
| 1384 | Ga0207665_10029760 | |||
| 1385 | Ga0207665_10260855 | |||
| 1386 | Ga0207691_10098715 | |||
| 1387 | Ga0207691_10109822 | |||
| 1388 | Ga0207711_10080851 | |||
| 1389 | Ga0207711_10123220 | |||
| 1390 | Ga0207711_10151693 | |||
| 1391 | Ga0207689_10119784 | |||
| 1392 | Ga0207689_10143780 | |||
| 1393 | Ga0207661_10009663 | |||
| 1394 | Ga0207661_10350874 | |||
| 1395 | Ga0207679_10266372 | |||
| 1396 | Ga0207679_10318459 | |||
| 1397 | Ga0207667_10006331 | |||
| 1398 | Ga0207667_10031140 | |||
| 1399 | Ga0207667_10034299 | |||
| 1400 | Ga0207667_10062492 | |||
| 1401 | Ga0207667_10081956 | |||
| 1402 | Ga0207667_10165217 | |||
| 1403 | Ga0207651_10431192 | |||
| 1404 | Ga0207651_10503661 | |||
| 1405 | Ga0207668_10312832 | |||
| 1406 | Ga0207640_10014814 | |||
| 1407 | Ga0207640_10028091 | |||
| 1408 | Ga0207640_10033085 | |||
| 1409 | Ga0207658_10413671 | |||
| 1410 | Ga0207677_10007171 | |||
| 1411 | Ga0207677_10021221 | |||
| 1412 | Ga0207703_10069128 | |||
| 1413 | Ga0207703_10205038 | |||
| 1414 | Ga0207703_10426163 | |||
| 1415 | Ga0207639_10104159 | |||
| 1416 | Ga0207639_10139753 | |||
| 1417 | Ga0207639_10210980 | |||
| 1418 | Ga0207639_10305423 | |||
| 1419 | Ga0207678_10077063 | |||
| 1420 | Ga0207678_10117067 | |||
| 1421 | Ga0207678_10203255 | |||
| 1422 | Ga0207678_10239632 | |||
| 1423 | Ga0207678_10369377 | |||
| 1424 | Ga0207708_10223844 | |||
| 1425 | Ga0207702_10000005 | |||
| 1426 | Ga0207702_10000433 | |||
| 1427 | Ga0207702_10137009 | |||
| 1428 | Ga0207702_10271682 | |||
| 1429 | Ga0207641_10277531 | |||
| 1430 | Ga0207648_10031150 | |||
| 1431 | Ga0207676_10132085 | |||
| 1432 | Ga0207674_10005368 | |||
| 1433 | Ga0207674_10010019 | |||
| 1434 | Ga0207674_10024060 | |||
| 1435 | Ga0207674_10032073 | |||
| 1436 | Ga0207674_10532359 | |||
| 1437 | Ga0207675_100240562 | |||
| 1438 | Ga0207675_100312045 | |||
| 1439 | Ga0207683_10150547 | |||
| 1440 | Ga0207683_10210190 | |||
| 1441 | Ga0207698_10057969 | |||
| 1442 | Ga0207698_10230693 | |||
| 1443 | Ga0207698_10238256 | |||
| 1444 | Ga0209389_1000024 | |||
| 1445 | Ga0209389_1000155 | |||
| 1446 | Ga0209389_1000211 | |||
| 1447 | Ga0209389_1000640 | |||
| 1448 | Ga0209589_1000030 | |||
| 1449 | Ga0209589_1000505 | |||
| 1450 | Ga0209589_1005433 | |||
| 1451 | Ga0209489_100052 | |||
| 1452 | Ga0209489_100056 | |||
| 1453 | Ga0209489_102067 | |||
| 1454 | Ga0209489_105575 | |||
| 1455 | Ga0209700_100059 | |||
| 1456 | Ga0209700_104170 | |||
| 1457 | Ga0268266_10000988 | |||
| 1458 | Ga0268266_10002854 | |||
| 1459 | Ga0268266_10006878 | |||
| 1460 | Ga0268266_10038850 | |||
| 1461 | Ga0268266_10054630 | |||
| 1462 | Ga0268266_10058934 | |||
| 1463 | Ga0265337_1008853 | |||
| 1464 | Ga0265326_10004742 | |||
| 1465 | Ga0265334_10005352 | |||
| 1466 | Ga0265318_10047005 | |||
| 1467 | Ga0265323_10000916 | |||
| 1468 | Ga0265322_10005772 | |||
| 1469 | Ga0307517_10000125 | |||
| 1470 | Ga0265338_10000131 | |||
| 1471 | Ga0265324_10003680 | |||
| 1472 | Ga0307511_10043073 | |||
| 1473 | Ga0307511_10083723 | |||
| 1474 | Ga0265330_10087640 | |||
| 1475 | Ga0265332_10063051 | |||
| 1476 | Ga0265328_10027971 | |||
| 1477 | Ga0265325_10002689 | |||
| 1478 | Ga0265339_10003134 | |||
| 1479 | Ga0265339_10096648 | |||
| 1480 | Ga0307513_10086146 | |||
| 1481 | Ga0307508_10001153 | |||
| 1482 | Ga0265314_10087479 | |||
| 1483 | Ga0265342_10002981 | |||
| 1484 | Ga0265342_10016343 | |||
| 1485 | Ga0307516_10008305 | |||
| 1486 | Ga0307516_10020167 | |||
| 1487 | Ga0307516_10022528 | |||
| 1488 | Ga0307516_10088342 | |||
| 1489 | Ga0307409_100050870 | |||
| 1490 | Ga0307415_100177137 | |||
| 1491 | Ga0307510_10159135 | |||
| 1492 | Ga0307510_10209965 | |||
| 1493 | Ga0315911_1000009 | |||
| 1494 | Ga0373929_0047139 | |||
| 1495 | Ga0373934_0018122 | |||
| 1496 | Ga0373944_0018687 | |||
| 1497 | Ga0373944_0090705 | |||
| 1498 | Ga0373949_0034817 | |||
| 1499 | Ga0373952_0018394 | |||
| 1500 | Ga0373923_0014986 | |||
| 1501 | Ga0373923_0106587 | |||
| 1502 | Ga0373936_0028140 | |||
| 1503 | Ga0373953_0000108 | |||
| 1504 | Ga0373954_0000085 | |||
| 1505 | Ga0373954_0015097 | |||
| 1506 | Ga0373956_0000272 | |||
| 1507 | Ga0373957_0000129 | |||
| 1508 | Ga0373943_0021381 | |||
| 1509 | Ga0373943_0085068 | |||
| 1510 | Ga0373943_0128098 | |||
| 1511 | Ga0373955_0000288 | |||
| 1512 | Ga0373955_0224572 | |||
| 1513 | Ga0373924_0031425 | |||
| 1514 | Ga0373924_0088967 | |||
| 1515 | Ga0373935_0002679 | |||
| 1516 | Ga0373935_0218992 | |||
| 1517 | Ga0373927_0001471 | |||
| 1518 | Ga0373927_0002486 | |||
| 1519 | Ga0373927_0026490 | |||
| 1520 | Ga0373927_0048040 | |||
| 1521 | Ga0373927_0057389 | |||
| 1522 | Ga0373927_0118893 | |||
| 1523 | Ga0373927_0197968 | |||
| 1524 | Ga0373933_0000059 | |||
| 1525 | Ga0373933_0000913 | |||
| 1526 | Ga0373933_0073167 | |||
| 1527 | Ga0373933_0099772 | |||
| 1528 | Ga0373933_0291395 | |||
| 1529 | Ga0373947_0003788 | |||
| 1530 | Ga0373947_0009239 | |||
| 1531 | Ga0373947_0055013 | |||
| 1532 | Ga0373937_0005718 | |||
| 1533 | Ga0373937_0027472 | |||
| 1534 | Ga0373937_0105710 | |||
| 1535 | Ga0373937_0126085 | |||
| 1536 | Ga0372808_007420 | |||
| 1537 | Ga0373925_0052859 | |||
| 1538 | Ga0373925_0066632 | |||
| 1539 | Ga0373925_0072085 | |||
| 1540 | Ga0373925_0079134 | |||
| 1541 | Ga0395899_0056493 | |||
| 1542 | Ga0395900_0062423 | |||
| 1543 | Ga0395900_0330185 | |||
| 1544 | Ga0395898_0063425 | |||
| 1545 | Ga0395898_0463974 | |||
| 1546 | Ga0395905_0095024 | |||
| 1547 | Ga0436364_0719526 | |||
| 1548 | Ga0436364_1199883 | |||
| 1549 | Ga0395901_0016140 | |||
| 1550 | Ga0395901_0074704 | |||
| 1551 | Ga0436365_1415912 | |||
| 1552 | Ga0436365_1448063 | |||
| 1553 | Ga0436360_0103168 | |||
| 1554 | Ga0436360_0502120 | |||
| 1555 | Ga0436361_0718487 | |||
| 1556 | Ga0436363_0572275 | |||
| 1557 | Ga0436363_1138394 | |||
| 1558 | Ga0436362_0588858 | |||
| 1559 | Ga0436362_1135664 | |||
| 1560 | Ga0439465_0047711 | |||
| 1561 | Ga0451807_0959335 | |||
| 1562 | Ga0466972_0000156 | |||
| 1563 | Ga0466966_0000726 | |||
| 1564 | Ga0466961_0000568 | |||
| 1565 | Ga0466968_0117291 | |||
| 1566 | Ga0466970_0224827 | |||
| 1567 | Ga0466959_0026424 | |||
| 1568 | Ga0466959_0146821 | |||
| 1569 | Ga0466967_0230944 | |||
| 1570 | Ga0466967_0249513 | |||
| 1571 | Ga0466967_0316191 | |||
| 1572 | Ga0466967_0354002 | |||
| 1573 | Ga0495617_030660 | |||
| 1574 | Ga0495592_0000795 | |||
| 1575 | Ga0495592_0047014 | |||
| 1576 | Ga0495592_0347685 | |||
| 1577 | Ga0495603_0000387 | |||
| 1578 | Ga0495603_0090832 | |||
| 1579 | Ga0495603_0231947 | |||
| 1580 | Ga0495629_0000582 | |||
| 1581 | Ga0495629_0001668 | |||
| 1582 | Ga0495629_0004581 | |||
| 1583 | Ga0495629_0055578 | |||
| 1584 | Ga0495629_0109204 | |||
| 1585 | Ga0495638_0004069 | |||
| 1586 | Ga0495638_0042559 | |||
| 1587 | Ga0495641_0161172 | |||
| 1588 | Ga0495651_0002961 | |||
| 1589 | Ga0495651_0029419 | |||
| 1590 | Ga0495651_0046661 | |||
| 1591 | Ga0495651_0081381 | |||
| 1592 | Ga0495580_0010768 | |||
| 1593 | Ga0495580_0357621 | |||
| 1594 | Ga0495582_0005882 | |||
| 1595 | Ga0495639_0000739 | |||
| 1596 | Ga0495662_0000148 | |||
| 1597 | Ga0495664_0032458 | |||
| 1598 | Ga0495664_0042962 | |||
| 1599 | Ga0495664_0046873 | |||
| 1600 | Ga0495664_0121846 | |||
| 1601 | Ga0495585_0062622 | |||
| 1602 | Ga0495594_0000312 | |||
| 1603 | Ga0495583_0062036 | |||
| 1604 | Ga0495606_0012913 | |||
| 1605 | Ga0495606_0207274 | |||
| 1606 | Ga0495608_0000569 | |||
| 1607 | Ga0495608_0024234 | |||
| 1608 | Ga0495610_0096773 | |||
| 1609 | Ga0495616_0120349 | |||
| 1610 | Ga0495618_0188957 | |||
| 1611 | Ga0495618_0325398 | |||
| 1612 | Ga0495628_0151514 | |||
| 1613 | Ga0495628_0272963 | |||
| 1614 | Ga0495630_0038844 | |||
| 1615 | Ga0495630_0283363 | |||
| 1616 | Ga0495630_0336395 | |||
| 1617 | Ga0495632_0049519 | |||
| 1618 | Ga0495632_0069446 | |||
| 1619 | Ga0495644_0019687 | |||
| 1620 | Ga0495648_0000855 | |||
| 1621 | Ga0495652_0002837 | |||
| 1622 | Ga0495652_0025766 | |||
| 1623 | Ga0495652_0030800 | |||
| 1624 | Ga0495652_0093268 | |||
| 1625 | Ga0495652_0238641 | |||
| 1626 | Ga0495665_0000248 | |||
| 1627 | Ga0495665_0133121 | |||
| 1628 | Ga0495640_0004111 | |||
| 1629 | Ga0495640_0006732 | |||
| 1630 | Ga0495640_0170172 | |||
| 1631 | Ga0495587_0038566 | |||
| 1632 | Ga0495587_0041046 | |||
| 1633 | Ga0495587_0054884 | |||
| 1634 | Ga0495587_0208428 | |||
| 1635 | Ga0495598_0005352 | |||
| 1636 | Ga0495609_0052373 | |||
| 1637 | Ga0495645_0053996 | |||
| 1638 | Ga0495622_0002046 | |||
| 1639 | Ga0495622_0072451 | |||
| 1640 | Ga0495667_0000128 | |||
| 1641 | Ga0495667_0025774 | |||
| 1642 | Ga0495667_0119898 | |||
| 1643 | Ga0495668_0040133 | |||
| 1644 | Ga0495634_0016372 | |||
| 1645 | Ga0495634_0023145 | |||
| 1646 | Ga0495634_0032372 | |||
| 1647 | Ga0495634_0299504 | |||
| 1648 | Ga0495611_0205614 | |||
| 1649 | Ga0495635_0001128 | |||
| 1650 | Ga0495635_0006917 | |||
| 1651 | Ga0495635_0008480 | |||
| 1652 | Ga0495635_0020698 | |||
| 1653 | Ga0495635_0048370 | |||
| 1654 | Ga0495588_0055966 | |||
| 1655 | Ga0495657_0000445 | |||
| 1656 | Ga0495657_0003126 | |||
| 1657 | Ga0495657_0139924 | |||
| 1658 | Ga0495599_0001045 | |||
| 1659 | Ga0495599_0070958 | |||
| 1660 | Ga0495599_0165706 | |||
| 1661 | Ga0495623_0006786 | |||
| 1662 | Ga0495623_0123410 | |||
| 1663 | Ga0495623_0173364 | |||
| 1664 | Ga0495646_0000412 | |||
| 1665 | Ga0495646_0036082 | |||
| 1666 | Ga0495646_0047180 | |||
| 1667 | Ga0495647_0000541 | |||
| 1668 | Ga0495647_0118920 | |||
| 1669 | Ga0495658_0002607 | |||
| 1670 | Ga0495658_0167850 | |||
| 1671 | Ga0495658_0211245 | |||
| 1672 | Ga0495669_0028177 | |||
| 1673 | Ga0495669_0066111 | |||
| 1674 | Ga0495613_0057546 | |||
| 1675 | Ga0495613_0130551 | |||
| 1676 | Ga0495613_0320357 | |||
| 1677 | Ga0495624_0001790 | |||
| 1678 | Ga0495624_0046460 | |||
| 1679 | Ga0495624_0096496 | |||
| 1680 | Ga0495671_0078623 | |||
| 1681 | Ga0495671_0199259 | |||
| 1682 | Ga0495649_0023836 | |||
| 1683 | Ga0495600_0005826 | |||
| 1684 | Ga0495600_0105268 | |||
| 1685 | Ga0495600_0207300 | |||
| 1686 | Ga0495600_0233811 | |||
| 1687 | Ga0495581_0001004 | |||
| 1688 | Ga0495581_0204851 | |||
| 1689 | Ga0495581_0224650 | |||
| 1690 | Ga0495604_0007172 | |||
| 1691 | Ga0495604_0020987 | |||
| 1692 | Ga0495604_0051018 | |||
| 1693 | Ga0495604_0195480 | |||
| 1694 | Ga0495674_0002207 | |||
| 1695 | Ga0495674_0037127 | |||
| 1696 | Ga0495674_0065961 | |||
| 1697 | Ga0495674_0083959 | |||
| 1698 | Ga0495674_0202145 | |||
| 1699 | Ga0495674_0276948 | |||
| 1700 | Ga0495672_0002625 | |||
| 1701 | Ga0495672_0049186 | |||
| 1702 | Ga0495676_0042833 | |||
| 1703 | Ga0495676_0115712 | |||
| 1704 | Ga0495680_0000424 | |||
| 1705 | Ga0495680_0001973 | |||
| 1706 | Ga0495683_0177531 | |||
| 1707 | Ga0495687_021307 | |||
| 1708 | Ga0495675_0000345 | |||
| 1709 | Ga0495673_0041536 | |||
| 1710 | Ga0495684_0000650 | |||
| 1711 | Ga0495684_0287001 | |||
| 1712 | Ga0495593_0000312 | |||
| 1713 | Ga0495593_0022184 | |||
| 1714 | Ga0495593_0028064 | |||
| 1715 | Ga0495602_0005890 | |||
| 1716 | Ga0495602_0009316 | |||
| 1717 | Ga0495602_0040539 | |||
| 1718 | Ga0496100_0190348 | |||
| 1719 | Ga0496100_0390399 | |||
| 1720 | Ga0496101_0002458 | |||
| 1721 | Ga0496101_0126377 | |||
| 1722 | Ga0496101_0332118 | |||
| 1723 | Ga0496102_0007740 | |||
| 1724 | Ga0496102_0251522 | |||
| 1725 | Ga0496102_0737284 | |||
| 1726 | Ga0496103_0161136 | |||
| 1727 | Ga0496103_0209215 | |||
| 1728 | Ga0496104_0016290 | |||
| 1729 | Ga0496104_0130252 | |||
| 1730 | Ga0496104_0307322 | |||
| 1731 | Ga0496104_0419600 | |||
| 1732 | Ga0496105_0079917 | |||
| 1733 | Ga0496105_0093731 | |||
| 1734 | Ga0496105_0195336 | |||
| 1735 | Ga0496105_0219817 | |||
| 1736 | Ga0496105_0424641 | |||
| 1737 | Ga0496106_0001555 | |||
| 1738 | Ga0496106_0037643 | |||
| 1739 | Ga0496106_0408441 | |||
| 1740 | Ga0496107_0016340 | |||
| 1741 | Ga0496107_0111146 | |||
| 1742 | Ga0496107_0124980 | |||
| 1743 | Ga0496108_0018817 | |||
| 1744 | Ga0496108_0180465 | |||
| 1745 | Ga0496108_0233840 | |||
| 1746 | Ga0496108_0236366 | |||
| 1747 | Ga0496109_0191432 | |||
| 1748 | Ga0496109_0250489 | |||
| 1749 | Ga0496109_0644428 | |||
| 1750 | Ga0496110_0006609 | |||
| 1751 | Ga0496110_0016649 | |||
| 1752 | Ga0496110_0017235 | |||
| 1753 | Ga0496110_0046914 | |||
| 1754 | Ga0496110_0259289 | |||
| 1755 | Ga0496111_0189031 | |||
| 1756 | Ga0496111_0273019 | |||
| 1757 | Ga0496112_0004442 | |||
| 1758 | Ga0496112_0045152 | |||
| 1759 | Ga0496112_0087914 | |||
| 1760 | Ga0496112_0158469 | |||
| 1761 | Ga0496112_0353149 | |||
| 1762 | Ga0496113_0035990 | |||
| 1763 | Ga0496113_0095857 | |||
| 1764 | Ga0496113_0370531 | |||
| 1765 | Ga0496114_0153421 | |||
| 1766 | Ga0496114_0216261 | |||
| 1767 | Ga0496115_0039633 | |||
| 1768 | Ga0496115_0047649 | |||
| 1769 | Ga0496115_0074206 | |||
| 1770 | Ga0496115_0174197 | |||
| 1771 | Ga0496115_0189297 | |||
| 1772 | Ga0496115_0275930 | |||
| 1773 | Ga0496116_0054912 | |||
| 1774 | Ga0496117_0005820 | |||
| 1775 | Ga0496118_0143814 | |||
| 1776 | Ga0496119_0042379 | |||
| 1777 | Ga0496120_0174875 | |||
| 1778 | Ga0496121_0005416 | |||
| 1779 | Ga0496121_0020142 | |||
| 1780 | Ga0496121_0043518 | |||
| 1781 | Ga0496121_0079700 | |||
| 1782 | Ga0496121_0106396 | |||
| 1783 | Ga0496121_0114380 | |||
| 1784 | Ga0496121_0204254 | |||
| 1785 | Ga0496121_0249902 | |||
| 1786 | Ga0496121_0251554 | |||
| 1787 | Ga0496121_0366095 | |||
| 1788 | Ga0496123_0177808 | |||
| 1789 | Ga0496124_0103550 | |||
| 1790 | Ga0496124_0151043 | |||
| 1791 | Ga0496125_0000125 | |||
| 1792 | Ga0496125_0068712 | |||
| 1793 | Ga0496125_0089160 | |||
| 1794 | Ga0496125_0124327 | |||
| 1795 | Ga0496126_0020161 | |||
| 1796 | Ga0496126_0025338 | |||
| 1797 | Ga0496126_0080306 | |||
| 1798 | Ga0496126_0114795 | |||
| 1799 | Ga0496126_0139981 | |||
| 1800 | Ga0496126_0168436 | |||
| 1801 | Ga0496126_0185840 | |||
| 1802 | Ga0496126_0258762 | |||
| 1803 | Ga0496126_0277437 | |||
| 1804 | Ga0501032_0000345 | |||
| 1805 | Ga0501033_0000094 | |||
| 1806 | Ga0501033_0487703 | |||
| 1807 | Ga0501034_0000021 | |||
| 1808 | Ga0501036_0000115 | |||
| 1809 | Ga0501036_0010504 | |||
| 1810 | Ga0501037_0000174 | |||
| 1811 | Ga0501038_0000052 | |||
| 1812 | Ga0501038_0038840 | |||
| 1813 | Ga0501039_0000156 | |||
| 1814 | Ga0501039_0017265 | |||
| 1815 | Ga0501041_0039440 | |||
| 1816 | Ga0501042_0018861 | |||
| 1817 | Ga0501043_0003891 | |||
| 1818 | Ga0501046_0000133 | |||
| 1819 | Ga0501046_0065558 | |||
| 1820 | Ga0501046_0125475 | |||
| 1821 | Ga0501047_0000440 | |||
| 1822 | Ga0501047_0054289 | |||
| 1823 | Ga0501048_0000072 | |||
| 1824 | Ga0501048_0021700 | |||
| 1825 | Ga0501067_0000076 | |||
| 1826 | Ga0501068_0009421 | |||
| 1827 | Ga0501068_0228803 | |||
| 1828 | Ga0501069_0001017 | |||
| 1829 | Ga0501070_0011558 | |||
| 1830 | Ga0501070_0031178 | |||
| 1831 | Ga0501070_0137618 | |||
| 1832 | Ga0501070_0570941 | |||
| 1833 | Ga0501071_0007624 | |||
| 1834 | Ga0501071_0152494 | |||
| 1835 | Ga0501072_0001658 | |||
| 1836 | Ga0501073_0000099 | |||
| 1837 | Ga0501073_0159198 | |||
| 1838 | Ga0501074_0002372 | |||
| 1839 | Ga0501075_0001234 | |||
| 1840 | Ga0501076_0004477 | |||
| 1841 | Ga0501077_0006293 | |||
| 1842 | Ga0501079_0006707 | |||
| 1843 | Ga0501079_0049613 | |||
| 1844 | Ga0501080_0000658 | |||
| 1845 | Ga0501080_0054618 | |||
| 1846 | Ga0501081_0004963 | |||
| 1847 | Ga0501083_0001450 | |||
| 1848 | Ga0501035_0000255 | |||
| 1849 | Ga0501044_0000141 | |||
| 1850 | Ga0501044_0168232 | |||
| 1851 | Ga0501045_0000154 | |||
| 1852 | Ga0501045_0098387 | |||
| 1853 | nmdc:mga03n38_70079_c1 | |||
| 1854 | nmdc:mga00v17_163824_c1 | |||
| 1855 | nmdc:mga0yw44_62255_c1 | |||
| 1856 | nmdc:mga0k408_21847_c1 | |||
| 1857 | nmdc:mga06z11_164606_c1 | |||
| 1858 | nmdc:mga06z11_234038_c1 | |||
| 1859 | nmdc:mga06z11_87491_c1 | |||
| 1860 | nmdc:mga07m45_14594_c1 | |||
| 1861 | nmdc:mga07m45_1811_c1 | |||
| 1862 | nmdc:mga07m45_81575_c1 | |||
| 1863 | nmdc:mga0n895_393539_c1 | |||
| 1864 | nmdc:mga0n895_592801_c1 | |||
| 1865 | nmdc:mga0rr50_474607_c1 | |||
| 1866 | nmdc:mga08x19_74815_c1 | |||
| 1867 | nmdc:mga0sz30_155939_c1 | |||
| 1868 | nmdc:mga0sz30_24098_c1 | |||
| 1869 | nmdc:mga0sz30_25283_c1 | |||
| 1870 | nmdc:mga0sz30_26366_c1 | |||
| 1871 | Ga0495601_0055403 | |||
| 1872 | Ga0495601_0069346 | |||
| 1873 | Ga0495601_0091126 | |||
| 1874 | Ga0495601_0131960 | |||
| 1875 | Ga0500635_0105709 | |||
| 1876 | Ga0495595_0000309 | |||
| 1877 | Ga0495595_0007183 | |||
| 1878 | Ga0495595_0056018 | |||
| 1879 | Ga0495619_0013528 | |||
| 1880 | Ga0495619_0035622 | |||
| 1881 | Ga0495619_0170546 | |||
| 1882 | Ga0495619_0178639 | |||
| 1883 | Ga0500643_000114 | |||
| 1884 | Ga0500566_0000100 | |||
| 1885 | Ga0500566_0005210 | |||
| 1886 | Ga0500566_0097165 | |||
| 1887 | Ga0500641_0015238 | |||
| 1888 | Ga0500641_0021580 | |||
| 1889 | Ga0500555_014686 | |||
| 1890 | Ga0500557_000010 | |||
| 1891 | Ga0500572_000176 | |||
| 1892 | Ga0500572_067088 | |||
| 1893 | Ga0500591_050717 | |||
| 1894 | Ga0500595_008586 | |||
| 1895 | Ga0500595_017295 | |||
| 1896 | Ga0500595_101989 | |||
| 1897 | Ga0500614_000141 | |||
| 1898 | Ga0500642_0000334 | |||
| 1899 | Ga0500559_0000509 | |||
| 1900 | Ga0500559_0003396 | |||
| 1901 | Ga0500559_0010805 | |||
| 1902 | Ga0500559_0011256 | |||
| 1903 | Ga0500568_0021512 | |||
| 1904 | Ga0500590_074000 | |||
| 1905 | Ga0500603_000017 | |||
| 1906 | Ga0500616_0000085 | |||
| 1907 | Ga0500616_0047694 | |||
| 1908 | Ga0500619_101013 | |||
| 1909 | Ga0500620_065145 | |||
| 1910 | Ga0500622_0028142 | |||
| 1911 | Ga0500630_138936 | |||
| 1912 | Ga0500638_045908 | |||
| 1913 | Ga0500639_000525 | |||
| 1914 | Ga0500636_0000695 | |||
| 1915 | Ga0500636_0054333 | |||
| 1916 | Ga0500637_0000099 | |||
| 1917 | Ga0500637_0186977 | |||
| 1918 | Ga0500625_003061 | |||
| 1919 | Ga0500645_035495 | |||
| 1920 | Ga0500645_060255 | |||
| 1921 | Ga0500609_005927 | |||
| 1922 | Ga0500596_002494 | |||
| 1923 | Ga0500601_001196 | |||
| 1924 | Ga0501084_0006070 | |||
| 1925 | Ga0501084_0078641 | |||
| 1926 | Ga0500661_001939 | |||
| 1927 | Ga0501082_0004101 | |||
| 1928 | Ga0466962_0089194 | |||
| 1929 | Ga0530510_0012192 | |||
| 1930 | 2507509720 | |||
| 1931 | 2508543737 | |||
| 1932 | 2508698476 | |||
| 1933 | 2509149568 | |||
| 1934 | 2511399120 | |||
| 1935 | 2513629166 | |||
| 1936 | 2513644827 | |||
| 1937 | 2513646218 | |||
| 1938 | 2513661079 | |||
| 1939 | 2513673719 | |||
| 1940 | 2513695851 | |||
| 1941 | 2513701784 | |||
| 1942 | 2513857457 | |||
| 1943 | 2513893902 | |||
| 1944 | 2513922764 | |||
| 1945 | 2514011536 | |||
| 1946 | 2514017558 | |||
| 1947 | 2514017672 | |||
| 1948 | 2515630069 | |||
| 1949 | 2517103584 | |||
| 1950 | 2517893414 | |||
| 1951 | 2524442173 | |||
| 1952 | 2524470070 | |||
| 1953 | 2524537920 | |||
| 1954 | 2528854144 | |||
| 1955 | 2617349242 | |||
| 1956 | 2617378232 | |||
| 1957 | 2671118063 | |||
| 1958 | 2723846088 | |||
| 1959 | 2728747816 | |||
| 1960 | 2745079438 | |||
| 1961 | 2793060308 | |||
| 1962 | 2793071824 | |||
| 1963 | 2793076742 | |||
| 1964 | 2805917669 | |||
| 1965 | 2818241443 | |||
| 1966 | 2824602175 | |||
| 1967 | 2824610163 | |||
| 1968 | 2824623824 | |||
| 1969 | 2824627762 | |||
| 1970 | 2824639298 | |||
| 1971 | 2824646869 | |||
| 1972 | 2824656141 | |||
| 1973 | 2824669097 | |||
| 1974 | 2824672860 | |||
| 1975 | 2824683984 | |||
| 1976 | 2824691011 | |||
| 1977 | 2824698419 | |||
| 1978 | 2824711602 | |||
| 1979 | 2824717920 | |||
| 1980 | 2824727657 | |||
| 1981 | 2824736718 | |||
| 1982 | 2824746875 | |||
| 1983 | 2824761665 | |||
| 1984 | 2824771280 | |||
| 1985 | 2838130028 | |||
| 1986 | 2841941183 | |||
| 1987 | 2841952790 | |||
| 1988 | 2841962301 | |||
| 1989 | 2841967338 | |||
| 1990 | 2841979265 | |||
| 1991 | 2841990838 | |||
| 1992 | 2842038680 | |||
| 1993 | 2842048375 | |||
| 1994 | 2844318078 | |||
| 1995 | 2847934887 | |||
| 1996 | 2847945454 | |||
| 1997 | 2849080360 | |||
| 1998 | 2857510290 | |||
| 1999 | 2874592385 | |||
| 2000 | 2874595170 | |||
| 2001 | 2874608972 | |||
| 2002 | 2874613136 | |||
| 2003 | 2874621618 | |||
| 2004 | 2874636592 | |||
| 2005 | 2874651031 | |||
| 2006 | 2876762492 | |||
| 2007 | 2876772663 | |||
| 2008 | 2876775106 | |||
| 2009 | 2876819997 | |||
| 2010 | 2876823921 | |||
| 2011 | 2879076430 | |||
| 2012 | 2879080549 | |||
| 2013 | 2879086277 | |||
| 2014 | 2879109400 | |||
| 2015 | 2879110612 | |||
| 2016 | 2879134845 | |||
| 2017 | 2879149156 | |||
| 2018 | 2881366281 | |||
| 2019 | 2881666226 | |||
| 2020 | 2885372875 | |||
| 2021 | 2885377296 | |||
| 2022 | 2885389899 | |||
| 2023 | 2885413005 | |||
| 2024 | 2888382881 | |||
| 2025 | 2888394922 | |||
| 2026 | 2888423355 | |||
| 2027 | 2889041032 | |||
| 2028 | 2903729615 | |||
| 2029 | 2903755593 | |||
| 2030 | 2903774909 | |||
| 2031 | 2904668666 | |||
| 2032 | 2904696748 | |||
| 2033 | 2904701741 | |||
| 2034 | 2904716718 | |||
| 2035 | 2906605761 | |||
| 2036 | 2906617384 | |||
| 2037 | 2906628215 | |||
| 2038 | 2906640632 | |||
| 2039 | 2906649432 | |||
| 2040 | 2906665852 | |||
| 2041 | 2908743819 | |||
| 2042 | 2908761535 | |||
| 2043 | 2908778996 | |||
| 2044 | 2922368010 | |||
| 2045 | 2922373087 | |||
| 2046 | 2922392110 | |||
| 2047 | 2922395286 | |||
| 2048 | 2922429055 | |||
| 2049 | 2929615848 | |||
| 2050 | 2929630461 | |||
| 2051 | 2932792509 | |||
| 2052 | 2932800345 | |||
| 2053 | 2932804519 | |||
| 2054 | 2932814030 | |||
| 2055 | 2932819479 | |||
| 2056 | 2932833813 | |||
| 2057 | 2933578866 | |||
| 2058 | 2935611420 | |||
| 2059 | 2935618661 | |||
| 2060 | 2935634388 | |||
| 2061 | 2935638143 | |||
| 2062 | 2935644500 | |||
| 2063 | 2935648804 | |||
| 2064 | 2935657113 | |||
| 2065 | 2935673609 | |||
| 2066 | 2935688000 | |||
| 2067 | 2935701388 | |||
| 2068 | 2935708357 | |||
| 2069 | 2935715020 | |||
| 2070 | 2935726415 | |||
| 2071 | 2935733838 | |||
| 2072 | 2935743217 | |||
| 2073 | 2935754744 | |||
| 2074 | 2935765451 | |||
| 2075 | 2935776271 | |||
| 2076 | 2935779595 | |||
| 2077 | 2935790260 | |||
| 2078 | 2935798843 | |||
| 2079 | 2935805405 | |||
| 2080 | 2935816698 | |||
| 2081 | 2935820897 | |||
| 2082 | 2935827773 | |||
| 2083 | 2935833751 | |||
| 2084 | 2935839563 | |||
| 2085 | 2935850843 | |||
| 2086 | 2935855063 | |||
| 2087 | 2935857026 | |||
| 2088 | 2935871150 | |||
| 2089 | 2935876347 | |||
| 2090 | 2935889713 | |||
| 2091 | 2935913789 | |||
| 2092 | 2935920221 | |||
| 2093 | 2935930560 | |||
| 2094 | 2935939467 | |||
| 2095 | 2935946416 | |||
| 2096 | 2935955745 | |||
| 2097 | 2935964667 | |||
| 2098 | 2935972545 | |||
| 2099 | 2935981622 | |||
| 2100 | 2935984008 | |||
| 2101 | 2935992049 | |||
| 2102 | 2935997684 | |||
| 2103 | 2936007202 | |||
| 2104 | 2936011714 | |||
| 2105 | 2936020309 | |||
| 2106 | 2936029004 | |||
| 2107 | 2936043040 | |||
| 2108 | 2936047032 | |||
| 2109 | 2936058088 | |||
| 2110 | 2940559879 | |||
| 2111 | 2941511278 | |||
| 2112 | 2941514784 | |||
| 2113 | 2941518662 | |||
| 2114 | 2941522758 | |||
| 2115 | 2941530398 | |||
| 2116 | 2941530677 | |||
| 2117 | 2941536028 | |||
| 2118 | 2941540252 | |||
| 2119 | 3005479210 | |||
| 2120 | 3005482318 | |||
| 2121 | 3005489838 | |||
| 2122 | 3005512650 | |||
| 2123 | 3005590413 | |||
| 2124 | 3005598129 | |||
| 2125 | 3005713807 | |||
| 2126 | 3005721316 | |||
| 2127 | 8006942139 | |||
| 2128 | 8006964447 | |||
| 2129 | 8006981875 | |||
| 2130 | 8006986947 | |||
| 2131 | 8006992259 | |||
| 2132 | 8006996164 | |||
| 2133 | 8016514621 | |||
| 2134 | 8016530725 | |||
| 2135 | 8016540292 | |||
| 2136 | 8016552939 | |||
| 2137 | 8016561316 | |||
| 2138 | 8016574360 | |||
| 2139 | 8016578457 | |||
| 2140 | 8016584772 | |||
| 2141 | 8016591312 | |||
| 2142 | 8016599174 | |||
| 2143 | 8016611873 | |||
| 2144 | 8016621933 | |||
| 2145 | 8016627917 | |||
| 2146 | 8016632242 | |||
| 2147 | 8017061810 | |||
| 2148 | 8019535738 | |||
| 2149 | 8019543743 | |||
| 2150 | 8019555028 | |||
| 2151 | 8019557870 | |||
| 2152 | 8019567419 | |||
| 2153 | 8019581339 | |||
| 2154 | 8019602270 | |||
| 2155 | 8019616292 | |||
| 2156 | 8019626896 | |||
| 2157 | 8019635622 | |||
| 2158 | 8019644063 | |||
| 2159 | 8019657052 | |||
| 2160 | 8019663419 | |||
| 2161 | 8019673034 | |||
| 2162 | 8019683109 | |||
| 2163 | 8019688800 | |||
| 2164 | 8055747495 | |||
| 2165 | 8056680545 | |||
| 2166 | 8056683886 | |||
| 2167 | 8056694236 | |||
| 2168 | 8056972431 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s9c-assembly4.cif.gz_H | crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2 | 0.9273 | 12 | 288 |
| 1s9c-assembly6.cif.gz_K | crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2 | 0.9223 | 12 | 288 |
| 1s9c-assembly1.cif.gz_B | crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2 | 0.917 | 10 | 288 |
| 1s9c-assembly4.cif.gz_H | crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2 | 0.9168 | 12 | 288 |
| 3oml-assembly1.cif.gz_A | structure of full-length peroxisomal multifunctional enzyme type 2 from drosophila melanogaster | 0.9167 | 14 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s9cL02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9542 | 164 | 288 | 3.10.129.10 |
| 1pn2D02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9511 | 166 | 287 | 3.10.129.10 |
| af_Q54XZ0_160_288_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9472 | 165 | 288 | 3.10.129.10 |
| 3khpB02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9456 | 165 | 287 | 3.10.129.10 |
| 3kh8B02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9453 | 164 | 288 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0L8EMW4-F1-model_v4 | deleted | 0.9681 | 166 | 288 |
|
| AF-A0A4Q4CUA7-F1-model_v4 | MaoC family dehydratase | 0.9653 | 170 | 288 |
GO:0003857
GO:0004300 GO:0006635 GO:0044594 |
| AF-A0A7C3IS89-F1-model_v4 | MaoC family dehydratase | 0.9626 | 166 | 288 |
GO:0003857
GO:0004300 GO:0006635 GO:0044594 |
| AF-A0A1D2U063-F1-model_v4 | Dehydratase | 0.9607 | 77 | 288 |
GO:0003857
GO:0004300 GO:0006635 GO:0044594 |
| AF-A0A6N8URN1-F1-model_v4 | deleted | 0.9587 | 121 | 288 |
|