F489737
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1084 | 482 | 1041 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300005543|Ga0070672_100393928|Ga0070672_1003939281 |
| Length | 240 |
| Sequence | MGDAGFTTYLVDDDPAVLRSITRLLKAGGYKTKSFSSPQKFLSSHDPSVPGCAIIDLVMSELDGLRLQEALARSGSQRPIIFLTGRGDVPTSVRAMKAGAVDFLTKPVKRDALFSAVVHAAELDAASRQKRQESKSIDERLATLTHREREVLEHVIAGRLNKQIAASLGTVEKTIKVHRSRIMEKMGVRTIADLVRLTEQIGLAPYGSGAQRSRDSQGLFLGIGPLSDRLFRLAGSRPSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 4 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 5 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 6 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 7 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 8 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 9 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 10 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 11 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 12 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 13 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 14 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 15 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 16 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 17 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 18 | 2904699407 | |||
| 19 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 20 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 21 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 22 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 23 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 24 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 25 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 26 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 27 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 28 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 29 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 30 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 31 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 32 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 33 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 34 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 35 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 36 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 37 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 38 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 39 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 40 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 41 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 42 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 43 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 44 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 45 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 46 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 47 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 50 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 94 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 101 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 109 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 111 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 112 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 113 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 120 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 121 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 122 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 125 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 126 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 128 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 129 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 130 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 131 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 132 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 136 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 137 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 138 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 139 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 141 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 142 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 143 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 144 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 145 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 146 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 147 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 148 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 149 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 150 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 152 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 165 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 168 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 169 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 179 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 184 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 185 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 186 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 257 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 264 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 268 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 270 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 271 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 272 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 273 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 274 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 275 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 276 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 277 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 278 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 279 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 280 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 281 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 282 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 283 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 284 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 285 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 286 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 288 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 294 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 297 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 298 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 300 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 301 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 302 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 305 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 307 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 310 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 311 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 312 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 314 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 315 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 316 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 319 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 320 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 321 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 322 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 323 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 324 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 325 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 326 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 407 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 408 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 409 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 410 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 411 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 412 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 415 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 418 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 419 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 420 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 421 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 422 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 423 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 424 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 443 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 444 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 445 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 460 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 462 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 464 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 467 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 468 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 469 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 470 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 471 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 472 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 473 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 474 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 475 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 476 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 477 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 478 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 479 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 480 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 481 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 482 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.12 |
| Metatranscriptomes | 0 |
| Isolates | 3.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.21 |
| Nodule | 2.95 |
| Rhizoplane | 5.44 |
| Rhizosphere | 86.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214628275 | 2209111006 | Bacteria | 5064 |
| 2 | ARcpr5oldR_c000250 | 3300000041 | Bacteria | 8579 |
| 3 | ARSoilYngRDRAFT_c00208 | 3300000042 | Bacteria | 9833 |
| 4 | ARcpr5yngRDRAFT_c000678 | 3300000043 | Plasmid | 4239 |
| 5 | ARSoilOldRDRAFT_c000174 | 3300000044 | Bacteria | 10743 |
| 6 | ARCol0oldRDRAFT_c01338 | 3300000045 | Bacteria | 1678 |
| 7 | ARCol0yngRDRAFT_1000170 | 3300000652 | Bacteria | 11077 |
| 8 | JGI24739J22299_10002749 | 3300001989 | Bacteria | 6767 |
| 9 | JGI24737J22298_10004199 | 3300001990 | Bacteria | 5035 |
| 10 | JGI24743J22301_10021848 | 3300001991 | Bacteria | 1224 |
| 11 | JGI24750J21931_1000010 | 3300002070 | Bacteria | 22844 |
| 12 | JGI24745J21846_1000735 | 3300002073 | Bacteria | 2976 |
| 13 | JGI24738J21930_10000125 | 3300002075 | Bacteria | 18550 |
| 14 | JGI24744J21845_10002950 | 3300002077 | Bacteria | 3481 |
| 15 | JGI24035J26624_1000050 | 3300002126 | Bacteria | 8914 |
| 16 | JGI24033J26618_1004385 | 3300002155 | Bacteria | 1523 |
| 17 | JGI24034J26672_10000156 | 3300002239 | Bacteria | 9646 |
| 18 | JGI24742J22300_10000121 | 3300002244 | Bacteria | 11239 |
| 19 | JGI24751J29686_10005039 | 3300002459 | Bacteria | 2692 |
| 20 | JGI25404J52841_10000042 | 3300003659 | Bacteria | 10423 |
| 21 | JGI25405J52794_10007928 | 3300003911 | Bacteria | 1971 |
| 22 | Ga0065717_1003254 | 3300005276 | Bacteria | 1330 |
| 23 | Ga0065704_10080809 | 3300005289 | Bacteria | 3876 |
| 24 | Ga0065715_10006737 | 3300005293 | Bacteria | 4358 |
| 25 | Ga0065715_10089962 | 3300005293 | Bacteria | 8002 |
| 26 | Ga0065715_10099237 | 3300005293 | Bacteria | 3437 |
| 27 | Ga0065707_10341838 | 3300005295 | Bacteria | 932 |
| 28 | Ga0070676_10002283 | 3300005328 | Bacteria | 9791 |
| 29 | Ga0070683_100000132 | 3300005329 | Bacteria | 48299 |
| 30 | Ga0070683_100126298 | 3300005329 | Bacteria | 2418 |
| 31 | Ga0070683_100390577 | 3300005329 | Bacteria | 1327 |
| 32 | Ga0070683_100674259 | 3300005329 | Bacteria | 990 |
| 33 | Ga0070683_100680301 | 3300005329 | Unclassified | 985 |
| 34 | Ga0070690_100003321 | 3300005330 | Bacteria | 8769 |
| 35 | Ga0070690_100012804 | 3300005330 | Bacteria | 4941 |
| 36 | Ga0070690_100083497 | 3300005330 | Bacteria | 2093 |
| 37 | Ga0070670_100009102 | 3300005331 | Bacteria | 8485 |
| 38 | Ga0070670_100033434 | 3300005331 | Bacteria | 4429 |
| 39 | Ga0070670_100589944 | 3300005331 | Bacteria | 994 |
| 40 | Ga0070670_100592767 | 3300005331 | Bacteria | 991 |
| 41 | Ga0070670_100701118 | 3300005331 | Bacteria | 910 |
| 42 | Ga0070677_10000355 | 3300005333 | Bacteria | 16034 |
| 43 | Ga0068869_100000063 | 3300005334 | Bacteria | 47742 |
| 44 | Ga0068869_100141404 | 3300005334 | Bacteria | 1858 |
| 45 | Ga0068869_100275665 | 3300005334 | Bacteria | 1351 |
| 46 | Ga0068869_101013595 | 3300005334 | Unclassified | 723 |
| 47 | Ga0070666_10014429 | 3300005335 | Bacteria | 5031 |
| 48 | Ga0070666_10034818 | 3300005335 | Unclassified | 3338 |
| 49 | Ga0070666_10193739 | 3300005335 | Unclassified | 1429 |
| 50 | Ga0070666_10522500 | 3300005335 | Bacteria | 862 |
| 51 | Ga0070680_100000702 | 3300005336 | Bacteria | 23234 |
| 52 | Ga0070680_100359636 | 3300005336 | Bacteria | 1238 |
| 53 | Ga0070682_100006330 | 3300005337 | Bacteria | 6645 |
| 54 | Ga0070682_100020616 | 3300005337 | Bacteria | 3882 |
| 55 | Ga0070682_100022247 | 3300005337 | Bacteria | 3753 |
| 56 | Ga0070682_100564773 | 3300005337 | Bacteria | 893 |
| 57 | Ga0068868_100000190 | 3300005338 | Bacteria | 40972 |
| 58 | Ga0068868_100090967 | 3300005338 | Bacteria | 2458 |
| 59 | Ga0070660_100000136 | 3300005339 | Bacteria | 46892 |
| 60 | Ga0070660_100028048 | 3300005339 | Bacteria | 4209 |
| 61 | Ga0070689_100011293 | 3300005340 | Bacteria | 6394 |
| 62 | Ga0070689_100101186 | 3300005340 | Bacteria | 2281 |
| 63 | Ga0070689_100142576 | 3300005340 | Bacteria | 1928 |
| 64 | Ga0070691_10004223 | 3300005341 | Bacteria | 6531 |
| 65 | Ga0070691_10149361 | 3300005341 | Bacteria | 1197 |
| 66 | Ga0070687_100000483 | 3300005343 | Bacteria | 13295 |
| 67 | Ga0070687_100003914 | 3300005343 | Bacteria | 5858 |
| 68 | Ga0070661_100009808 | 3300005344 | Bacteria | 6639 |
| 69 | Ga0070661_100048332 | 3300005344 | Bacteria | 3114 |
| 70 | Ga0070661_100257764 | 3300005344 | Bacteria | 1347 |
| 71 | Ga0070692_10000027 | 3300005345 | Bacteria | 27609 |
| 72 | Ga0070692_10035062 | 3300005345 | Bacteria | 2538 |
| 73 | Ga0070692_10225720 | 3300005345 | Bacteria | 1109 |
| 74 | Ga0070668_100004099 | 3300005347 | Bacteria | 10789 |
| 75 | Ga0070668_100109342 | 3300005347 | Bacteria | 2199 |
| 76 | Ga0070668_100142804 | 3300005347 | Bacteria | 1930 |
| 77 | Ga0070668_100153394 | 3300005347 | Bacteria | 1865 |
| 78 | Ga0070668_100159068 | 3300005347 | Bacteria | 1832 |
| 79 | Ga0070668_100161598 | 3300005347 | Bacteria | 1818 |
| 80 | Ga0070668_100321860 | 3300005347 | Bacteria | 1302 |
| 81 | Ga0070669_100001142 | 3300005353 | Bacteria | 19375 |
| 82 | Ga0070675_100005715 | 3300005354 | Bacteria | 9516 |
| 83 | Ga0070675_100129112 | 3300005354 | Bacteria | 2152 |
| 84 | Ga0070675_100390028 | 3300005354 | Bacteria | 1241 |
| 85 | Ga0070671_100001137 | 3300005355 | Bacteria | 19775 |
| 86 | Ga0070671_100144079 | 3300005355 | Bacteria | 2011 |
| 87 | Ga0070674_100004133 | 3300005356 | Bacteria | 8248 |
| 88 | Ga0070674_100057838 | 3300005356 | Bacteria | 2693 |
| 89 | Ga0070674_100059248 | 3300005356 | Bacteria | 2665 |
| 90 | Ga0070674_100509911 | 3300005356 | Bacteria | 1003 |
| 91 | Ga0070674_100868451 | 3300005356 | Unclassified | 784 |
| 92 | Ga0070674_100922225 | 3300005356 | Unclassified | 762 |
| 93 | Ga0070673_100013640 | 3300005364 | Bacteria | 5630 |
| 94 | Ga0070673_100290518 | 3300005364 | Unclassified | 1436 |
| 95 | Ga0070673_100513557 | 3300005364 | Unclassified | 1085 |
| 96 | Ga0070673_100859085 | 3300005364 | Bacteria | 840 |
| 97 | Ga0070688_100002215 | 3300005365 | Bacteria | 9810 |
| 98 | Ga0070688_100034652 | 3300005365 | Bacteria | 3060 |
| 99 | Ga0070688_100226420 | 3300005365 | Bacteria | 1320 |
| 100 | Ga0070659_100004635 | 3300005366 | Bacteria | 9823 |
| 101 | Ga0070659_100009448 | 3300005366 | Bacteria | 7163 |
| 102 | Ga0070659_100137422 | 3300005366 | Unclassified | 1988 |
| 103 | Ga0070667_100001898 | 3300005367 | Bacteria | 18535 |
| 104 | Ga0070667_100060787 | 3300005367 | Plasmid | 3198 |
| 105 | Ga0070667_100195769 | 3300005367 | Bacteria | 1792 |
| 106 | Ga0070703_10033415 | 3300005406 | Bacteria | 1566 |
| 107 | Ga0070709_10000219 | 3300005434 | Bacteria | 37061 |
| 108 | Ga0070709_10243272 | 3300005434 | Bacteria | 1293 |
| 109 | Ga0070714_100158116 | 3300005435 | Bacteria | 2048 |
| 110 | Ga0070714_100527447 | 3300005435 | Unclassified | 1128 |
| 111 | Ga0070713_100026963 | 3300005436 | Bacteria | 4518 |
| 112 | Ga0070713_100064932 | 3300005436 | Bacteria | 3064 |
| 113 | Ga0070713_100580298 | 3300005436 | Bacteria | 1064 |
| 114 | Ga0070710_10006625 | 3300005437 | Bacteria | 5570 |
| 115 | Ga0070701_10001666 | 3300005438 | Bacteria | 8319 |
| 116 | Ga0070711_100105550 | 3300005439 | Bacteria | 2058 |
| 117 | Ga0070711_100143624 | 3300005439 | Bacteria | 1792 |
| 118 | Ga0070705_100000406 | 3300005440 | Bacteria | 24745 |
| 119 | Ga0070705_100040084 | 3300005440 | Bacteria | 2661 |
| 120 | Ga0070700_100005060 | 3300005441 | Bacteria | 6951 |
| 121 | Ga0070700_100006171 | 3300005441 | Bacteria | 6384 |
| 122 | Ga0070694_100073517 | 3300005444 | Bacteria | 2361 |
| 123 | Ga0070694_100467911 | 3300005444 | Unclassified | 998 |
| 124 | Ga0070708_100002583 | 3300005445 | Bacteria | 14014 |
| 125 | Ga0070708_100314459 | 3300005445 | Bacteria | 1475 |
| 126 | Ga0070663_100004773 | 3300005455 | Bacteria | 7998 |
| 127 | Ga0070663_100025994 | 3300005455 | Bacteria | 3959 |
| 128 | Ga0070663_100106018 | 3300005455 | Bacteria | 2105 |
| 129 | Ga0070663_100224630 | 3300005455 | Bacteria | 1476 |
| 130 | Ga0070678_100000233 | 3300005456 | Bacteria | 25322 |
| 131 | Ga0070678_100056415 | 3300005456 | Unclassified | 2873 |
| 132 | Ga0070678_100234196 | 3300005456 | Bacteria | 1532 |
| 133 | Ga0070662_100008937 | 3300005457 | Bacteria | 6531 |
| 134 | Ga0070662_100227894 | 3300005457 | Bacteria | 1489 |
| 135 | Ga0070681_10009346 | 3300005458 | Bacteria | 9645 |
| 136 | Ga0070681_10021072 | 3300005458 | Bacteria | 6530 |
| 137 | Ga0070681_10047354 | 3300005458 | Unclassified | 4298 |
| 138 | Ga0068867_100000306 | 3300005459 | Bacteria | 32301 |
| 139 | Ga0070685_10001209 | 3300005466 | Bacteria | 13728 |
| 140 | Ga0070685_10027561 | 3300005466 | Bacteria | 3141 |
| 141 | Ga0070706_100020111 | 3300005467 | Bacteria | 6152 |
| 142 | Ga0070706_100328116 | 3300005467 | Bacteria | 1427 |
| 143 | Ga0070707_100001635 | 3300005468 | Bacteria | 21760 |
| 144 | Ga0070707_100505654 | 3300005468 | Bacteria | 1170 |
| 145 | Ga0070707_100778021 | 3300005468 | Bacteria | 921 |
| 146 | Ga0070679_100002290 | 3300005530 | Bacteria | 17305 |
| 147 | Ga0070679_100087826 | 3300005530 | Bacteria | 3097 |
| 148 | Ga0070679_100227809 | 3300005530 | Bacteria | 1823 |
| 149 | Ga0070684_100001097 | 3300005535 | Bacteria | 19398 |
| 150 | Ga0070697_100074989 | 3300005536 | Bacteria | 2780 |
| 151 | Ga0070697_100109874 | 3300005536 | Bacteria | 2296 |
| 152 | Ga0068853_100000364 | 3300005539 | Bacteria | 31160 |
| 153 | Ga0070672_100001950 | 3300005543 | Bacteria | 12938 |
| 154 | Ga0070672_100092150 | 3300005543 | Bacteria | 2446 |
| 155 | Ga0070672_100393928 | 3300005543 | Bacteria | 1186 |
| 156 | Ga0070686_100004938 | 3300005544 | Bacteria | 7355 |
| 157 | Ga0070686_100020979 | 3300005544 | Bacteria | 3876 |
| 158 | Ga0070686_100084339 | 3300005544 | Bacteria | 2111 |
| 159 | Ga0070695_100000208 | 3300005545 | Bacteria | 28669 |
| 160 | Ga0070695_100109485 | 3300005545 | Unclassified | 1872 |
| 161 | Ga0070695_100184509 | 3300005545 | Bacteria | 1480 |
| 162 | Ga0070696_100001498 | 3300005546 | Bacteria | 15325 |
| 163 | Ga0070696_100041297 | 3300005546 | Bacteria | 3187 |
| 164 | Ga0070693_100000244 | 3300005547 | Bacteria | 25523 |
| 165 | Ga0070693_100270705 | 3300005547 | Bacteria | 1134 |
| 166 | Ga0070665_100004691 | 3300005548 | Bacteria | 14269 |
| 167 | Ga0070665_100099806 | 3300005548 | Bacteria | 2907 |
| 168 | Ga0070704_100001662 | 3300005549 | Bacteria | 12053 |
| 169 | Ga0070704_100073935 | 3300005549 | Bacteria | 2484 |
| 170 | Ga0068855_100004695 | 3300005563 | Bacteria | 16698 |
| 171 | Ga0068855_100984237 | 3300005563 | Bacteria | 887 |
| 172 | Ga0070664_100014605 | 3300005564 | Bacteria | 6408 |
| 173 | Ga0070664_100021987 | 3300005564 | Bacteria | 5260 |
| 174 | Ga0068857_100004429 | 3300005577 | Bacteria | 11876 |
| 175 | Ga0068857_100602032 | 3300005577 | Bacteria | 1039 |
| 176 | Ga0068854_100000949 | 3300005578 | Bacteria | 17448 |
| 177 | Ga0068854_100299382 | 3300005578 | Unclassified | 1301 |
| 178 | Ga0068856_100000272 | 3300005614 | Bacteria | 56279 |
| 179 | Ga0068856_100066703 | 3300005614 | Bacteria | 3556 |
| 180 | Ga0070702_100000106 | 3300005615 | Bacteria | 24941 |
| 181 | Ga0070702_100167479 | 3300005615 | Bacteria | 1426 |
| 182 | Ga0070702_100331251 | 3300005615 | Bacteria | 1065 |
| 183 | Ga0068852_100001698 | 3300005616 | Bacteria | 15011 |
| 184 | Ga0068852_100084296 | 3300005616 | Bacteria | 2828 |
| 185 | Ga0068859_100009854 | 3300005617 | Bacteria | 9645 |
| 186 | Ga0068859_100161640 | 3300005617 | Bacteria | 2318 |
| 187 | Ga0068859_100666266 | 3300005617 | Bacteria | 1132 |
| 188 | Ga0068859_100784872 | 3300005617 | Bacteria | 1041 |
| 189 | Ga0068859_100793171 | 3300005617 | Bacteria | 1035 |
| 190 | Ga0068864_100000865 | 3300005618 | Bacteria | 25493 |
| 191 | Ga0068864_100416417 | 3300005618 | Bacteria | 1279 |
| 192 | Ga0068866_10000143 | 3300005718 | Bacteria | 32232 |
| 193 | Ga0068861_100001420 | 3300005719 | Bacteria | 15092 |
| 194 | Ga0068861_100059060 | 3300005719 | Bacteria | 2935 |
| 195 | Ga0068870_10000149 | 3300005840 | Bacteria | 24749 |
| 196 | Ga0068863_100000337 | 3300005841 | Bacteria | 47696 |
| 197 | Ga0068863_100257913 | 3300005841 | Bacteria | 1685 |
| 198 | Ga0068863_100286038 | 3300005841 | Bacteria | 1598 |
| 199 | Ga0068863_100532880 | 3300005841 | Bacteria | 1158 |
| 200 | Ga0068858_100004259 | 3300005842 | Bacteria | 14068 |
| 201 | Ga0068858_100167263 | 3300005842 | Bacteria | 2072 |
| 202 | Ga0068858_100668580 | 3300005842 | Bacteria | 1010 |
| 203 | Ga0068860_100014928 | 3300005843 | Bacteria | 7593 |
| 204 | Ga0068860_100019560 | 3300005843 | Bacteria | 6565 |
| 205 | Ga0068860_100068430 | 3300005843 | Bacteria | 3373 |
| 206 | Ga0068860_100181748 | 3300005843 | Bacteria | 2032 |
| 207 | Ga0068860_100699189 | 3300005843 | Bacteria | 1023 |
| 208 | Ga0068862_100003109 | 3300005844 | Bacteria | 14480 |
| 209 | Ga0068862_100022218 | 3300005844 | Bacteria | 5306 |
| 210 | Ga0068862_100120269 | 3300005844 | Bacteria | 2314 |
| 211 | Ga0068862_100330873 | 3300005844 | Bacteria | 1409 |
| 212 | Ga0068862_100566750 | 3300005844 | Unclassified | 1086 |
| 213 | Ga0068862_100992653 | 3300005844 | Bacteria | 830 |
| 214 | Ga0068862_101195093 | 3300005844 | Bacteria | 759 |
| 215 | Ga0081455_10000652 | 3300005937 | Bacteria | 45017 |
| 216 | Ga0081455_10002592 | 3300005937 | Bacteria | 21435 |
| 217 | Ga0081455_10015289 | 3300005937 | Bacteria | 7463 |
| 218 | Ga0081455_10037342 | 3300005937 | Bacteria | 4316 |
| 219 | Ga0081455_10059421 | 3300005937 | Bacteria | 3228 |
| 220 | Ga0081455_10063262 | 3300005937 | Bacteria | 3105 |
| 221 | Ga0081455_10182286 | 3300005937 | Bacteria | 1588 |
| 222 | Ga0081540_1000067 | 3300005983 | Bacteria | 115405 |
| 223 | Ga0081540_1000423 | 3300005983 | Bacteria | 41829 |
| 224 | Ga0081540_1002957 | 3300005983 | Bacteria | 13633 |
| 225 | Ga0081540_1018444 | 3300005983 | Bacteria | 4279 |
| 226 | Ga0081540_1109864 | 3300005983 | Bacteria | 1168 |
| 227 | Ga0070717_10348731 | 3300006028 | Bacteria | 1323 |
| 228 | Ga0070717_10493808 | 3300006028 | Unclassified | 1106 |
| 229 | Ga0075365_10032152 | 3300006038 | Bacteria | 3371 |
| 230 | Ga0075365_10032280 | 3300006038 | Bacteria | 3364 |
| 231 | Ga0075365_10156361 | 3300006038 | Bacteria | 1587 |
| 232 | Ga0075368_10107069 | 3300006042 | Bacteria | 1151 |
| 233 | Ga0075363_100076617 | 3300006048 | Unclassified | 1824 |
| 234 | Ga0075364_10035752 | 3300006051 | Bacteria | 3211 |
| 235 | Ga0075432_10003025 | 3300006058 | Bacteria | 5673 |
| 236 | Ga0075432_10103567 | 3300006058 | Bacteria | 1054 |
| 237 | Ga0070715_10022361 | 3300006163 | Bacteria | 2465 |
| 238 | Ga0070715_10187569 | 3300006163 | Unclassified | 1042 |
| 239 | Ga0070716_100000393 | 3300006173 | Bacteria | 17888 |
| 240 | Ga0070712_100088974 | 3300006175 | Bacteria | 2257 |
| 241 | Ga0070712_100109410 | 3300006175 | Bacteria | 2059 |
| 242 | Ga0070712_100113199 | 3300006175 | Bacteria | 2029 |
| 243 | Ga0070712_100382203 | 3300006175 | Bacteria | 1159 |
| 244 | Ga0075362_10015128 | 3300006177 | Bacteria | 3133 |
| 245 | Ga0075362_10024493 | 3300006177 | Bacteria | 2561 |
| 246 | Ga0075369_10024665 | 3300006186 | Bacteria | 2494 |
| 247 | Ga0075369_10027262 | 3300006186 | Bacteria | 2388 |
| 248 | Ga0075427_10000335 | 3300006194 | Bacteria | 5162 |
| 249 | Ga0075366_10017757 | 3300006195 | Bacteria | 4100 |
| 250 | Ga0075366_10043755 | 3300006195 | Bacteria | 2653 |
| 251 | Ga0075366_10275493 | 3300006195 | Bacteria | 1028 |
| 252 | Ga0097621_100000348 | 3300006237 | Bacteria | 31809 |
| 253 | Ga0097621_100043206 | 3300006237 | Bacteria | 3633 |
| 254 | Ga0097621_100051827 | 3300006237 | Bacteria | 3341 |
| 255 | Ga0097621_100113776 | 3300006237 | Bacteria | 2288 |
| 256 | Ga0075370_10064896 | 3300006353 | Bacteria | 2083 |
| 257 | Ga0068871_100003685 | 3300006358 | Bacteria | 10529 |
| 258 | Ga0068871_100032239 | 3300006358 | Bacteria | 4137 |
| 259 | Ga0068871_100753460 | 3300006358 | Bacteria | 895 |
| 260 | Ga0075428_100016252 | 3300006844 | Bacteria | 8226 |
| 261 | Ga0075428_100027553 | 3300006844 | Bacteria | 6287 |
| 262 | Ga0075428_100210215 | 3300006844 | Bacteria | 2102 |
| 263 | Ga0075428_100386688 | 3300006844 | Bacteria | 1500 |
| 264 | Ga0075428_100709193 | 3300006844 | Bacteria | 1072 |
| 265 | Ga0075430_100000011 | 3300006846 | Bacteria | 99671 |
| 266 | Ga0075430_100000012 | 3300006846 | Bacteria | 94359 |
| 267 | Ga0075430_100046226 | 3300006846 | Bacteria | 3677 |
| 268 | Ga0075430_100116198 | 3300006846 | Bacteria | 2230 |
| 269 | Ga0075430_100602571 | 3300006846 | Bacteria | 906 |
| 270 | Ga0075431_100000774 | 3300006847 | Bacteria | 27749 |
| 271 | Ga0075431_100023775 | 3300006847 | Bacteria | 6272 |
| 272 | Ga0075433_10000106 | 3300006852 | Bacteria | 41085 |
| 273 | Ga0075433_10003106 | 3300006852 | Bacteria | 12780 |
| 274 | Ga0075433_10014208 | 3300006852 | Bacteria | 6500 |
| 275 | Ga0075433_10228811 | 3300006852 | Bacteria | 1651 |
| 276 | Ga0075434_100000114 | 3300006871 | Bacteria | 46406 |
| 277 | Ga0075434_100000457 | 3300006871 | Bacteria | 30447 |
| 278 | Ga0075434_100006713 | 3300006871 | Bacteria | 10572 |
| 279 | Ga0075434_100019105 | 3300006871 | Bacteria | 6624 |
| 280 | Ga0075434_100056523 | 3300006871 | Bacteria | 3900 |
| 281 | Ga0075434_100246880 | 3300006871 | Unclassified | 1804 |
| 282 | Ga0075434_100249356 | 3300006871 | Bacteria | 1795 |
| 283 | Ga0075434_100252847 | 3300006871 | Bacteria | 1781 |
| 284 | Ga0075429_100003564 | 3300006880 | Bacteria | 13262 |
| 285 | Ga0075429_100019740 | 3300006880 | Bacteria | 5842 |
| 286 | Ga0068865_100000394 | 3300006881 | Bacteria | 24342 |
| 287 | Ga0068865_100481419 | 3300006881 | Bacteria | 1032 |
| 288 | Ga0075436_100005428 | 3300006914 | Bacteria | 8771 |
| 289 | Ga0075436_100353565 | 3300006914 | Bacteria | 1059 |
| 290 | Ga0075436_100698972 | 3300006914 | Unclassified | 751 |
| 291 | Ga0097620_100009854 | 3300006931 | Bacteria | 9645 |
| 292 | Ga0097620_100161638 | 3300006931 | Bacteria | 2318 |
| 293 | Ga0097620_100666363 | 3300006931 | Bacteria | 1132 |
| 294 | Ga0097620_100784889 | 3300006931 | Bacteria | 1041 |
| 295 | Ga0097620_100793166 | 3300006931 | Bacteria | 1035 |
| 296 | Ga0075435_100016140 | 3300007076 | Bacteria | 5627 |
| 297 | Ga0075435_100120223 | 3300007076 | Bacteria | 2191 |
| 298 | Ga0075435_100204567 | 3300007076 | Bacteria | 1673 |
| 299 | Ga0075435_100509383 | 3300007076 | Unclassified | 1041 |
| 300 | Ga0105240_10105641 | 3300009093 | Bacteria | 3418 |
| 301 | Ga0105240_10412227 | 3300009093 | Bacteria | 1519 |
| 302 | Ga0111539_10000299 | 3300009094 | Bacteria | 60010 |
| 303 | Ga0111539_10000581 | 3300009094 | Bacteria | 47068 |
| 304 | Ga0111539_10003962 | 3300009094 | Bacteria | 19452 |
| 305 | Ga0111539_10014752 | 3300009094 | Bacteria | 9746 |
| 306 | Ga0111539_10066402 | 3300009094 | Bacteria | 4261 |
| 307 | Ga0111539_10081875 | 3300009094 | Bacteria | 3797 |
| 308 | Ga0111539_10093515 | 3300009094 | Bacteria | 3532 |
| 309 | Ga0111539_10185951 | 3300009094 | Unclassified | 2426 |
| 310 | Ga0111539_10211650 | 3300009094 | Unclassified | 2259 |
| 311 | Ga0111539_10233060 | 3300009094 | Bacteria | 2144 |
| 312 | Ga0105245_10000663 | 3300009098 | Bacteria | 31171 |
| 313 | Ga0105245_10099641 | 3300009098 | Bacteria | 2687 |
| 314 | Ga0105245_10121065 | 3300009098 | Bacteria | 2445 |
| 315 | Ga0105245_10127180 | 3300009098 | Bacteria | 2387 |
| 316 | Ga0105245_10595304 | 3300009098 | Bacteria | 1132 |
| 317 | Ga0105247_10003720 | 3300009101 | Bacteria | 9896 |
| 318 | Ga0105247_10029580 | 3300009101 | Bacteria | 3320 |
| 319 | Ga0105247_10115761 | 3300009101 | Unclassified | 1731 |
| 320 | Ga0114129_10018146 | 3300009147 | Bacteria | 10020 |
| 321 | Ga0114129_10058804 | 3300009147 | Bacteria | 5376 |
| 322 | Ga0114129_10108623 | 3300009147 | Bacteria | 3830 |
| 323 | Ga0105243_10002452 | 3300009148 | Bacteria | 15493 |
| 324 | Ga0105243_10135684 | 3300009148 | Bacteria | 2093 |
| 325 | Ga0105243_10260788 | 3300009148 | Bacteria | 1551 |
| 326 | Ga0105243_10267920 | 3300009148 | Bacteria | 1532 |
| 327 | Ga0105241_10001566 | 3300009174 | Bacteria | 17502 |
| 328 | Ga0105241_10052636 | 3300009174 | Bacteria | 3109 |
| 329 | Ga0105241_10856042 | 3300009174 | Bacteria | 841 |
| 330 | Ga0105242_10001341 | 3300009176 | Bacteria | 19433 |
| 331 | Ga0105242_10052200 | 3300009176 | Bacteria | 3335 |
| 332 | Ga0105248_10030265 | 3300009177 | Bacteria | 6044 |
| 333 | Ga0105248_10078621 | 3300009177 | Bacteria | 3708 |
| 334 | Ga0105248_10448799 | 3300009177 | Unclassified | 1453 |
| 335 | Ga0105248_11138860 | 3300009177 | Bacteria | 882 |
| 336 | Ga0105237_10007002 | 3300009545 | Bacteria | 12424 |
| 337 | Ga0105237_10144737 | 3300009545 | Bacteria | 2371 |
| 338 | Ga0105237_10369646 | 3300009545 | Bacteria | 1439 |
| 339 | Ga0105238_10077336 | 3300009551 | Bacteria | 3319 |
| 340 | Ga0105238_10096781 | 3300009551 | Bacteria | 2937 |
| 341 | Ga0105238_10275498 | 3300009551 | Unclassified | 1663 |
| 342 | Ga0105238_10855533 | 3300009551 | Bacteria | 927 |
| 343 | Ga0105249_10074724 | 3300009553 | Bacteria | 3138 |
| 344 | Ga0105249_10110065 | 3300009553 | Bacteria | 2602 |
| 345 | Ga0105249_10172631 | 3300009553 | Bacteria | 2098 |
| 346 | Ga0105249_10454617 | 3300009553 | Bacteria | 1320 |
| 347 | Ga0105028_106036 | 3300009993 | Bacteria | 1262 |
| 348 | Ga0105239_10009001 | 3300010375 | Bacteria | 11298 |
| 349 | Ga0105239_10267779 | 3300010375 | Bacteria | 1921 |
| 350 | Ga0105239_11114931 | 3300010375 | Bacteria | 908 |
| 351 | Ga0105246_10000067 | 3300011119 | Bacteria | 42796 |
| 352 | Ga0105246_10123524 | 3300011119 | Bacteria | 1922 |
| 353 | Ga0105246_10266761 | 3300011119 | Bacteria | 1367 |
| 354 | Ga0157346_1001624 | 3300012480 | Bacteria | 1088 |
| 355 | Ga0157342_1000525 | 3300012507 | Bacteria | 2385 |
| 356 | Ga0157373_10047928 | 3300013100 | Bacteria | 3046 |
| 357 | Ga0157373_10122481 | 3300013100 | Unclassified | 1828 |
| 358 | Ga0157371_10006720 | 3300013102 | Bacteria | 9405 |
| 359 | Ga0157374_10003806 | 3300013296 | Bacteria | 12680 |
| 360 | Ga0157374_10277022 | 3300013296 | Bacteria | 1655 |
| 361 | Ga0157374_10662263 | 3300013296 | Unclassified | 1056 |
| 362 | Ga0157378_10061922 | 3300013297 | Unclassified | 3341 |
| 363 | Ga0157378_10067095 | 3300013297 | Bacteria | 3214 |
| 364 | Ga0163162_10001721 | 3300013306 | Bacteria | 20501 |
| 365 | Ga0163162_10103483 | 3300013306 | Bacteria | 2942 |
| 366 | Ga0163162_10343712 | 3300013306 | Bacteria | 1625 |
| 367 | Ga0163162_10607519 | 3300013306 | Unclassified | 1219 |
| 368 | Ga0163162_10759047 | 3300013306 | Bacteria | 1089 |
| 369 | Ga0157372_10010547 | 3300013307 | Bacteria | 9829 |
| 370 | Ga0157372_10176767 | 3300013307 | Bacteria | 2471 |
| 371 | Ga0157375_10002665 | 3300013308 | Bacteria | 15472 |
| 372 | Ga0157375_10057946 | 3300013308 | Unclassified | 3831 |
| 373 | Ga0157375_10318441 | 3300013308 | Bacteria | 1720 |
| 374 | Ga0157375_10324001 | 3300013308 | Unclassified | 1705 |
| 375 | Ga0157375_10531921 | 3300013308 | Bacteria | 1338 |
| 376 | Ga0157375_11743989 | 3300013308 | Bacteria | 738 |
| 377 | Ga0163163_10009638 | 3300014325 | Bacteria | 8638 |
| 378 | Ga0163163_10010130 | 3300014325 | Bacteria | 8456 |
| 379 | Ga0163163_10098867 | 3300014325 | Bacteria | 2939 |
| 380 | Ga0157380_10000049 | 3300014326 | Bacteria | 71296 |
| 381 | Ga0157380_10286160 | 3300014326 | Bacteria | 1511 |
| 382 | Ga0157380_10479340 | 3300014326 | Bacteria | 1203 |
| 383 | Ga0182008_10185081 | 3300014497 | Bacteria | 1055 |
| 384 | Ga0157377_10000053 | 3300014745 | Bacteria | 89091 |
| 385 | Ga0157379_10000306 | 3300014968 | Bacteria | 38858 |
| 386 | Ga0157379_10085760 | 3300014968 | Unclassified | 2823 |
| 387 | Ga0157379_10420972 | 3300014968 | Bacteria | 1230 |
| 388 | Ga0157376_10000099 | 3300014969 | Bacteria | 62912 |
| 389 | Ga0157376_10043248 | 3300014969 | Bacteria | 3696 |
| 390 | Ga0157376_10169805 | 3300014969 | Unclassified | 1985 |
| 391 | Ga0157376_10258346 | 3300014969 | Bacteria | 1630 |
| 392 | Ga0163161_10001833 | 3300017792 | Bacteria | 15530 |
| 393 | Ga0163161_10406553 | 3300017792 | Unclassified | 1092 |
| 394 | Ga0213874_10094993 | 3300021377 | Bacteria | 984 |
| 395 | Ga0213876_10047611 | 3300021384 | Unclassified | 2266 |
| 396 | Ga0213876_10072502 | 3300021384 | Bacteria | 1819 |
| 397 | Ga0213875_10001022 | 3300021388 | Bacteria | 19839 |
| 398 | Ga0207666_1000013 | 3300025271 | Bacteria | 42350 |
| 399 | Ga0207666_1000335 | 3300025271 | Bacteria | 6447 |
| 400 | Ga0207673_1000362 | 3300025290 | Plasmid | 4577 |
| 401 | Ga0209758_1049818 | 3300025297 | Bacteria | 1474 |
| 402 | Ga0207697_10000042 | 3300025315 | Bacteria | 48485 |
| 403 | Ga0207713_1167238 | 3300025735 | Bacteria | 696 |
| 404 | Ga0207653_10008834 | 3300025885 | Plasmid | 3141 |
| 405 | Ga0207682_10000089 | 3300025893 | Bacteria | 41721 |
| 406 | Ga0207692_10013104 | 3300025898 | Bacteria | 3587 |
| 407 | Ga0207642_10001638 | 3300025899 | Bacteria | 6898 |
| 408 | Ga0207710_10000812 | 3300025900 | Bacteria | 16914 |
| 409 | Ga0207710_10104458 | 3300025900 | Unclassified | 1340 |
| 410 | Ga0207688_10000460 | 3300025901 | Bacteria | 19414 |
| 411 | Ga0207688_10177139 | 3300025901 | Bacteria | 1270 |
| 412 | Ga0207680_10006724 | 3300025903 | Bacteria | 5579 |
| 413 | Ga0207647_10003720 | 3300025904 | Bacteria | 11405 |
| 414 | Ga0207647_10010565 | 3300025904 | Bacteria | 6514 |
| 415 | Ga0207685_10019368 | 3300025905 | Bacteria | 2242 |
| 416 | Ga0207685_10144159 | 3300025905 | Bacteria | 1071 |
| 417 | Ga0207699_10013829 | 3300025906 | Bacteria | 4143 |
| 418 | Ga0207645_10000162 | 3300025907 | Bacteria | 52720 |
| 419 | Ga0207645_10380165 | 3300025907 | Bacteria | 948 |
| 420 | Ga0207643_10000404 | 3300025908 | Bacteria | 28726 |
| 421 | Ga0207643_10082041 | 3300025908 | Bacteria | 1869 |
| 422 | Ga0207684_10010101 | 3300025910 | Bacteria | 8315 |
| 423 | Ga0207654_10001699 | 3300025911 | Bacteria | 11497 |
| 424 | Ga0207654_10342149 | 3300025911 | Unclassified | 1028 |
| 425 | Ga0207707_10011189 | 3300025912 | Bacteria | 7806 |
| 426 | Ga0207707_10050436 | 3300025912 | Bacteria | 3625 |
| 427 | Ga0207695_10183649 | 3300025913 | Bacteria | 2011 |
| 428 | Ga0207671_10163052 | 3300025914 | Unclassified | 1727 |
| 429 | Ga0207693_10047617 | 3300025915 | Bacteria | 3368 |
| 430 | Ga0207693_10058154 | 3300025915 | Bacteria | 3029 |
| 431 | Ga0207693_10075248 | 3300025915 | Bacteria | 2644 |
| 432 | Ga0207663_10119293 | 3300025916 | Bacteria | 1803 |
| 433 | Ga0207660_10000007 | 3300025917 | Bacteria | 102878 |
| 434 | Ga0207660_10017339 | 3300025917 | Bacteria | 4783 |
| 435 | Ga0207660_10333683 | 3300025917 | Unclassified | 1213 |
| 436 | Ga0207660_10438613 | 3300025917 | Bacteria | 1055 |
| 437 | Ga0207662_10000458 | 3300025918 | Bacteria | 18137 |
| 438 | Ga0207662_10264607 | 3300025918 | Bacteria | 1133 |
| 439 | Ga0207657_10010273 | 3300025919 | Bacteria | 9344 |
| 440 | Ga0207657_10019106 | 3300025919 | Bacteria | 6518 |
| 441 | Ga0207649_10000048 | 3300025920 | Bacteria | 110714 |
| 442 | Ga0207649_10000305 | 3300025920 | Bacteria | 37712 |
| 443 | Ga0207649_10032748 | 3300025920 | Bacteria | 3101 |
| 444 | Ga0207652_10002194 | 3300025921 | Bacteria | 16673 |
| 445 | Ga0207652_10403666 | 3300025921 | Bacteria | 1233 |
| 446 | Ga0207646_10783717 | 3300025922 | Bacteria | 850 |
| 447 | Ga0207681_10000116 | 3300025923 | Bacteria | 67094 |
| 448 | Ga0207681_10032505 | 3300025923 | Bacteria | 3417 |
| 449 | Ga0207681_10115806 | 3300025923 | Bacteria | 1957 |
| 450 | Ga0207694_10048904 | 3300025924 | Bacteria | 3273 |
| 451 | Ga0207694_10185136 | 3300025924 | Unclassified | 1690 |
| 452 | Ga0207650_10035382 | 3300025925 | Bacteria | 3626 |
| 453 | Ga0207650_10502015 | 3300025925 | Bacteria | 1014 |
| 454 | Ga0207650_10516723 | 3300025925 | Bacteria | 999 |
| 455 | Ga0207659_10000155 | 3300025926 | Bacteria | 40671 |
| 456 | Ga0207687_10000090 | 3300025927 | Bacteria | 66310 |
| 457 | Ga0207687_10058667 | 3300025927 | Bacteria | 2709 |
| 458 | Ga0207687_10185878 | 3300025927 | Bacteria | 1613 |
| 459 | Ga0207700_10016325 | 3300025928 | Bacteria | 4930 |
| 460 | Ga0207700_10067946 | 3300025928 | Bacteria | 2730 |
| 461 | Ga0207700_10793565 | 3300025928 | Bacteria | 847 |
| 462 | Ga0207664_10170356 | 3300025929 | Unclassified | 1863 |
| 463 | Ga0207644_10000251 | 3300025931 | Bacteria | 36497 |
| 464 | Ga0207644_10047828 | 3300025931 | Unclassified | 3055 |
| 465 | Ga0207644_10212125 | 3300025931 | Bacteria | 1531 |
| 466 | Ga0207690_10000320 | 3300025932 | Bacteria | 32219 |
| 467 | Ga0207690_10039510 | 3300025932 | Bacteria | 3079 |
| 468 | Ga0207690_10109796 | 3300025932 | Unclassified | 1985 |
| 469 | Ga0207706_10001307 | 3300025933 | Bacteria | 25000 |
| 470 | Ga0207706_10013231 | 3300025933 | Bacteria | 7505 |
| 471 | Ga0207706_10021126 | 3300025933 | Bacteria | 5848 |
| 472 | Ga0207706_10099363 | 3300025933 | Bacteria | 2560 |
| 473 | Ga0207686_10001488 | 3300025934 | Bacteria | 13216 |
| 474 | Ga0207686_10024689 | 3300025934 | Bacteria | 3486 |
| 475 | Ga0207686_10280720 | 3300025934 | Bacteria | 1229 |
| 476 | Ga0207686_10330780 | 3300025934 | Unclassified | 1141 |
| 477 | Ga0207709_10000081 | 3300025935 | Bacteria | 164427 |
| 478 | Ga0207709_10075917 | 3300025935 | Bacteria | 2150 |
| 479 | Ga0207670_10000096 | 3300025936 | Bacteria | 60650 |
| 480 | Ga0207670_10112791 | 3300025936 | Bacteria | 1962 |
| 481 | Ga0207669_10000136 | 3300025937 | Bacteria | 35030 |
| 482 | Ga0207669_10234658 | 3300025937 | Unclassified | 1356 |
| 483 | Ga0207669_10469904 | 3300025937 | Bacteria | 1000 |
| 484 | Ga0207704_10000215 | 3300025938 | Bacteria | 28899 |
| 485 | Ga0207665_10000555 | 3300025939 | Bacteria | 25158 |
| 486 | Ga0207665_10152493 | 3300025939 | Bacteria | 1656 |
| 487 | Ga0207691_10000829 | 3300025940 | Bacteria | 30864 |
| 488 | Ga0207691_10251467 | 3300025940 | Unclassified | 1526 |
| 489 | Ga0207711_10016986 | 3300025941 | Bacteria | 6045 |
| 490 | Ga0207711_10730816 | 3300025941 | Bacteria | 923 |
| 491 | Ga0207689_10000766 | 3300025942 | Bacteria | 30838 |
| 492 | Ga0207689_10141527 | 3300025942 | Bacteria | 1982 |
| 493 | Ga0207689_10179655 | 3300025942 | Bacteria | 1745 |
| 494 | Ga0207661_10000170 | 3300025944 | Bacteria | 41868 |
| 495 | Ga0207679_10000090 | 3300025945 | Bacteria | 79412 |
| 496 | Ga0207679_10293780 | 3300025945 | Unclassified | 1398 |
| 497 | Ga0207679_10518951 | 3300025945 | Bacteria | 1065 |
| 498 | Ga0207667_10002635 | 3300025949 | Bacteria | 22193 |
| 499 | Ga0207667_11145459 | 3300025949 | Bacteria | 759 |
| 500 | Ga0207651_10001086 | 3300025960 | Bacteria | 12065 |
| 501 | Ga0207651_10207194 | 3300025960 | Unclassified | 1576 |
| 502 | Ga0207651_10316088 | 3300025960 | Unclassified | 1304 |
| 503 | Ga0207712_10000495 | 3300025961 | Bacteria | 32538 |
| 504 | Ga0207712_10052703 | 3300025961 | Bacteria | 2851 |
| 505 | Ga0207712_10149273 | 3300025961 | Bacteria | 1804 |
| 506 | Ga0207712_10280458 | 3300025961 | Bacteria | 1360 |
| 507 | Ga0207668_10000133 | 3300025972 | Bacteria | 52202 |
| 508 | Ga0207668_10058457 | 3300025972 | Bacteria | 2695 |
| 509 | Ga0207668_10069173 | 3300025972 | Bacteria | 2513 |
| 510 | Ga0207668_10138270 | 3300025972 | Bacteria | 1869 |
| 511 | Ga0207668_10961466 | 3300025972 | Bacteria | 762 |
| 512 | Ga0207640_10000191 | 3300025981 | Bacteria | 43590 |
| 513 | Ga0207658_10006088 | 3300025986 | Bacteria | 8236 |
| 514 | Ga0207658_10074280 | 3300025986 | Unclassified | 2583 |
| 515 | Ga0207677_10002370 | 3300026023 | Bacteria | 9866 |
| 516 | Ga0207703_10000560 | 3300026035 | Bacteria | 38205 |
| 517 | Ga0207703_10382919 | 3300026035 | Bacteria | 1301 |
| 518 | Ga0207703_10528498 | 3300026035 | Bacteria | 1110 |
| 519 | Ga0207639_10004165 | 3300026041 | Bacteria | 9732 |
| 520 | Ga0207678_10000197 | 3300026067 | Bacteria | 52596 |
| 521 | Ga0207678_10012097 | 3300026067 | Bacteria | 7577 |
| 522 | Ga0207678_10053934 | 3300026067 | Unclassified | 3463 |
| 523 | Ga0207678_10055490 | 3300026067 | Bacteria | 3413 |
| 524 | Ga0207678_10065630 | 3300026067 | Bacteria | 3116 |
| 525 | Ga0207678_10222487 | 3300026067 | Bacteria | 1616 |
| 526 | Ga0207708_10000947 | 3300026075 | Bacteria | 21738 |
| 527 | Ga0207708_10010717 | 3300026075 | Bacteria | 6813 |
| 528 | Ga0207702_10001076 | 3300026078 | Bacteria | 27955 |
| 529 | Ga0207702_10085606 | 3300026078 | Bacteria | 2747 |
| 530 | Ga0207641_10003500 | 3300026088 | Bacteria | 13898 |
| 531 | Ga0207641_10091654 | 3300026088 | Bacteria | 2660 |
| 532 | Ga0207648_10001359 | 3300026089 | Bacteria | 27051 |
| 533 | Ga0207648_10272879 | 3300026089 | Bacteria | 1511 |
| 534 | Ga0207648_10675299 | 3300026089 | Bacteria | 956 |
| 535 | Ga0207676_10000993 | 3300026095 | Bacteria | 21871 |
| 536 | Ga0207676_10186429 | 3300026095 | Bacteria | 1821 |
| 537 | Ga0207676_11227056 | 3300026095 | Bacteria | 744 |
| 538 | Ga0207674_10001393 | 3300026116 | Bacteria | 31147 |
| 539 | Ga0207674_10367071 | 3300026116 | Bacteria | 1391 |
| 540 | Ga0207675_100003415 | 3300026118 | Bacteria | 15506 |
| 541 | Ga0207675_100113178 | 3300026118 | Bacteria | 2562 |
| 542 | Ga0207675_100310588 | 3300026118 | Bacteria | 1537 |
| 543 | Ga0207683_10000141 | 3300026121 | Bacteria | 59587 |
| 544 | Ga0207683_10031636 | 3300026121 | Unclassified | 4592 |
| 545 | Ga0207683_10389014 | 3300026121 | Bacteria | 1282 |
| 546 | Ga0207683_10534181 | 3300026121 | Bacteria | 1084 |
| 547 | Ga0207698_10015513 | 3300026142 | Bacteria | 5103 |
| 548 | Ga0207698_10158498 | 3300026142 | Bacteria | 1976 |
| 549 | Ga0209281_1000798 | 3300027111 | Bacteria | 29423 |
| 550 | Ga0210002_1002952 | 3300027617 | Bacteria | 2489 |
| 551 | Ga0209983_1009812 | 3300027665 | Bacteria | 1957 |
| 552 | Ga0209971_1004860 | 3300027682 | Bacteria | 3193 |
| 553 | Ga0209966_1023433 | 3300027695 | Bacteria | 1213 |
| 554 | Ga0209998_10001984 | 3300027717 | Bacteria | 4800 |
| 555 | Ga0209974_10000295 | 3300027876 | Bacteria | 16234 |
| 556 | Ga0209974_10009249 | 3300027876 | Bacteria | 3345 |
| 557 | Ga0209974_10084141 | 3300027876 | Bacteria | 1098 |
| 558 | Ga0209974_10084240 | 3300027876 | Bacteria | 1097 |
| 559 | Ga0207428_10000011 | 3300027907 | Bacteria | 354388 |
| 560 | Ga0207428_10000046 | 3300027907 | Bacteria | 191032 |
| 561 | Ga0207428_10000058 | 3300027907 | Bacteria | 158579 |
| 562 | Ga0207428_10013808 | 3300027907 | Bacteria | 7038 |
| 563 | Ga0207428_10019079 | 3300027907 | Bacteria | 5849 |
| 564 | Ga0207428_10026193 | 3300027907 | Bacteria | 4870 |
| 565 | Ga0207428_10382485 | 3300027907 | Bacteria | 1032 |
| 566 | Ga0268266_10004115 | 3300028379 | Bacteria | 14049 |
| 567 | Ga0268266_10099297 | 3300028379 | Bacteria | 2562 |
| 568 | Ga0268266_11239572 | 3300028379 | Unclassified | 721 |
| 569 | Ga0268265_10000405 | 3300028380 | Bacteria | 46127 |
| 570 | Ga0268265_10280447 | 3300028380 | Bacteria | 1491 |
| 571 | Ga0268265_10364213 | 3300028380 | Bacteria | 1324 |
| 572 | Ga0268265_10518859 | 3300028380 | Bacteria | 1126 |
| 573 | Ga0268265_10541348 | 3300028380 | Unclassified | 1104 |
| 574 | Ga0268265_10925299 | 3300028380 | Bacteria | 857 |
| 575 | Ga0268264_10000340 | 3300028381 | Bacteria | 71850 |
| 576 | Ga0268264_10064242 | 3300028381 | Bacteria | 3088 |
| 577 | Ga0268264_10069042 | 3300028381 | Bacteria | 2988 |
| 578 | Ga0268264_10106607 | 3300028381 | Bacteria | 2446 |
| 579 | Ga0268264_10135420 | 3300028381 | Bacteria | 2189 |
| 580 | Ga0307515_10307996 | 3300028794 | Bacteria | 1262 |
| 581 | Ga0265339_10019194 | 3300031249 | Bacteria | 4016 |
| 582 | Ga0307509_10141941 | 3300031507 | Bacteria | 2335 |
| 583 | Ga0307408_100192587 | 3300031548 | Bacteria | 1644 |
| 584 | Ga0265313_10207709 | 3300031595 | Bacteria | 812 |
| 585 | Ga0265314_10001316 | 3300031711 | Bacteria | 28132 |
| 586 | Ga0307413_10023977 | 3300031824 | Bacteria | 3317 |
| 587 | Ga0307406_10634203 | 3300031901 | Bacteria | 885 |
| 588 | Ga0307409_100559873 | 3300031995 | Bacteria | 1124 |
| 589 | Ga0307416_100233336 | 3300032002 | Bacteria | 1776 |
| 590 | Ga0307415_100143933 | 3300032126 | Bacteria | 1825 |
| 591 | Ga0307510_10028469 | 3300033180 | Bacteria | 6381 |
| 592 | Ga0373930_0010291 | 3300034816 | Bacteria | 1670 |
| 593 | Ga0373930_0013741 | 3300034816 | Bacteria | 1497 |
| 594 | Ga0373930_0016518 | 3300034816 | Bacteria | 1397 |
| 595 | Ga0373930_0018237 | 3300034816 | Bacteria | 1347 |
| 596 | Ga0373948_0000122 | 3300034817 | Bacteria | 8139 |
| 597 | Ga0373948_0011217 | 3300034817 | Bacteria | 1580 |
| 598 | Ga0373950_0016865 | 3300034818 | Bacteria | 1252 |
| 599 | Ga0373958_0000878 | 3300034819 | Bacteria | 3871 |
| 600 | Ga0373958_0001381 | 3300034819 | Bacteria | 3253 |
| 601 | Ga0373958_0002849 | 3300034819 | Bacteria | 2462 |
| 602 | Ga0373959_0026942 | 3300034820 | Bacteria | 1138 |
| 603 | Ga0373938_0000445 | 3300034957 | Bacteria | 6730 |
| 604 | Ga0373938_0001301 | 3300034957 | Plasmid | 4008 |
| 605 | Ga0373938_0030907 | 3300034957 | Bacteria | 1146 |
| 606 | Ga0373926_0003607 | 3300035083 | Bacteria | 5023 |
| 607 | Ga0373928_0000382 | 3300035084 | Bacteria | 8856 |
| 608 | Ga0373928_0000518 | 3300035084 | Bacteria | 7562 |
| 609 | Ga0373928_0047313 | 3300035084 | Bacteria | 1006 |
| 610 | Ga0373929_0001453 | 3300035085 | Bacteria | 4515 |
| 611 | Ga0373934_0008308 | 3300035086 | Bacteria | 3868 |
| 612 | Ga0373940_0003445 | 3300035088 | Bacteria | 3232 |
| 613 | Ga0373940_0016520 | 3300035088 | Bacteria | 1829 |
| 614 | Ga0373940_0019070 | 3300035088 | Bacteria | 1728 |
| 615 | Ga0373944_0008713 | 3300035089 | Bacteria | 2741 |
| 616 | Ga0373949_0000549 | 3300035090 | Bacteria | 12349 |
| 617 | Ga0373949_0001748 | 3300035090 | Bacteria | 5997 |
| 618 | Ga0373949_0004482 | 3300035090 | Bacteria | 3198 |
| 619 | Ga0373951_0000836 | 3300035091 | Bacteria | 8375 |
| 620 | Ga0373951_0001355 | 3300035091 | Bacteria | 6438 |
| 621 | Ga0373951_0012008 | 3300035091 | Bacteria | 1948 |
| 622 | Ga0373952_0001852 | 3300035092 | Bacteria | 3840 |
| 623 | Ga0373952_0025224 | 3300035092 | Bacteria | 1282 |
| 624 | Ga0373923_0013462 | 3300035111 | Bacteria | 3050 |
| 625 | Ga0373932_0003013 | 3300035112 | Bacteria | 4126 |
| 626 | Ga0373936_0161555 | 3300035113 | Unclassified | 976 |
| 627 | Ga0373936_0221720 | 3300035113 | Unclassified | 839 |
| 628 | Ga0373939_0000480 | 3300035114 | Bacteria | 10073 |
| 629 | Ga0373939_0001023 | 3300035114 | Bacteria | 6892 |
| 630 | Ga0373939_0005478 | 3300035114 | Bacteria | 3024 |
| 631 | Ga0373939_0012689 | 3300035114 | Bacteria | 2153 |
| 632 | Ga0373939_0018099 | 3300035114 | Bacteria | 1882 |
| 633 | Ga0373939_0065299 | 3300035114 | Bacteria | 1170 |
| 634 | Ga0373941_0001109 | 3300035115 | Bacteria | 5615 |
| 635 | Ga0373941_0005005 | 3300035115 | Bacteria | 3089 |
| 636 | Ga0373941_0034832 | 3300035115 | Bacteria | 1521 |
| 637 | Ga0373941_0041808 | 3300035115 | Bacteria | 1420 |
| 638 | Ga0373945_0005322 | 3300035116 | Unclassified | 4118 |
| 639 | Ga0373945_0012002 | 3300035116 | Bacteria | 2871 |
| 640 | Ga0373953_0017859 | 3300035117 | Unclassified | 2615 |
| 641 | Ga0373954_0010963 | 3300035118 | Bacteria | 4009 |
| 642 | Ga0373956_0004865 | 3300035119 | Bacteria | 5378 |
| 643 | Ga0373960_0000075 | 3300035121 | Bacteria | 14451 |
| 644 | Ga0373960_0000089 | 3300035121 | Bacteria | 13897 |
| 645 | Ga0373960_0014490 | 3300035121 | Bacteria | 1999 |
| 646 | Ga0373943_0009289 | 3300035170 | Bacteria | 4406 |
| 647 | Ga0373943_0057874 | 3300035170 | Unclassified | 1927 |
| 648 | Ga0373943_0090406 | 3300035170 | Bacteria | 1585 |
| 649 | Ga0373946_0012892 | 3300035171 | Unclassified | 3134 |
| 650 | Ga0373946_0016087 | 3300035171 | Bacteria | 2845 |
| 651 | Ga0373946_0037721 | 3300035171 | Unclassified | 1965 |
| 652 | Ga0373946_0053076 | 3300035171 | Bacteria | 1702 |
| 653 | Ga0373955_0001327 | 3300035172 | Bacteria | 10492 |
| 654 | Ga0373955_0406645 | 3300035172 | Bacteria | 827 |
| 655 | Ga0373942_0001936 | 3300035207 | Bacteria | 5183 |
| 656 | Ga0373942_0004729 | 3300035207 | Bacteria | 3158 |
| 657 | Ga0373961_0000902 | 3300035241 | Bacteria | 9951 |
| 658 | Ga0373961_0007325 | 3300035241 | Bacteria | 2667 |
| 659 | Ga0373961_0135741 | 3300035241 | Bacteria | 827 |
| 660 | Ga0373961_0210145 | 3300035241 | Unclassified | 690 |
| 661 | Ga0373962_0038458 | 3300035242 | Unclassified | 1339 |
| 662 | Ga0373924_0084664 | 3300035410 | Bacteria | 1352 |
| 663 | Ga0373931_0001924 | 3300035691 | Bacteria | 9092 |
| 664 | Ga0373931_0004146 | 3300035691 | Bacteria | 6581 |
| 665 | Ga0373931_0011110 | 3300035691 | Bacteria | 4342 |
| 666 | Ga0373931_0011894 | 3300035691 | Bacteria | 4209 |
| 667 | Ga0373931_0058402 | 3300035691 | Bacteria | 2072 |
| 668 | Ga0373931_0151259 | 3300035691 | Unclassified | 1353 |
| 669 | Ga0373935_0028883 | 3300035692 | Bacteria | 3429 |
| 670 | Ga0373927_0018418 | 3300035695 | Bacteria | 4590 |
| 671 | Ga0373927_0087402 | 3300035695 | Unclassified | 2023 |
| 672 | Ga0373927_0155320 | 3300035695 | Bacteria | 1498 |
| 673 | Ga0373933_0017691 | 3300035724 | Unclassified | 3998 |
| 674 | Ga0373947_0002148 | 3300035725 | Bacteria | 11979 |
| 675 | Ga0373947_0028164 | 3300035725 | Bacteria | 3291 |
| 676 | Ga0373947_0045145 | 3300035725 | Unclassified | 2636 |
| 677 | Ga0373937_0009181 | 3300036401 | Bacteria | 8582 |
| 678 | Ga0373937_0177070 | 3300036401 | Bacteria | 2002 |
| 679 | Ga0373937_0392084 | 3300036401 | Unclassified | 1317 |
| 680 | Ga0373925_0006522 | 3300037068 | Bacteria | 8579 |
| 681 | Ga0373925_0506638 | 3300037068 | Bacteria | 991 |
| 682 | Ga0373925_0863838 | 3300037068 | Bacteria | 746 |
| 683 | Ga0436364_0910105 | 3300037853 | Bacteria | 26232 |
| 684 | Ga0436365_1347068 | 3300039437 | Bacteria | 3830 |
| 685 | Ga0436365_1803148 | 3300039437 | Bacteria | 9277 |
| 686 | Ga0436360_0266827 | 3300039438 | Bacteria | 799 |
| 687 | Ga0436360_0519909 | 3300039438 | Bacteria | 957 |
| 688 | Ga0436360_1162768 | 3300039438 | Bacteria | 774 |
| 689 | Ga0436361_0920118 | 3300039447 | Bacteria | 957 |
| 690 | Ga0436363_0682568 | 3300039450 | Bacteria | 980 |
| 691 | Ga0439465_0176637 | 3300041413 | Bacteria | 771 |
| 692 | Ga0453684_0265518 | 3300044712 | Bacteria | 1964 |
| 693 | Ga0451576_0060211 | 3300045051 | Bacteria | 3961 |
| 694 | Ga0495617_079479 | 3300046452 | Bacteria | 1075 |
| 695 | Ga0495592_0086424 | 3300046454 | Unclassified | 2258 |
| 696 | Ga0495592_0297363 | 3300046454 | Unclassified | 1050 |
| 697 | Ga0495603_0001480 | 3300046455 | Bacteria | 13683 |
| 698 | Ga0495603_0026989 | 3300046455 | Bacteria | 3467 |
| 699 | Ga0495603_0027316 | 3300046455 | Bacteria | 3445 |
| 700 | Ga0495629_0000577 | 3300046459 | Bacteria | 29743 |
| 701 | Ga0495629_0011542 | 3300046459 | Bacteria | 6416 |
| 702 | Ga0495629_0014609 | 3300046459 | Bacteria | 5649 |
| 703 | Ga0495629_0099945 | 3300046459 | Bacteria | 2024 |
| 704 | Ga0495629_0113663 | 3300046459 | Bacteria | 1887 |
| 705 | Ga0495629_0442858 | 3300046459 | Bacteria | 880 |
| 706 | Ga0495638_0316536 | 3300046460 | Bacteria | 835 |
| 707 | Ga0495641_0020479 | 3300046461 | Bacteria | 3353 |
| 708 | Ga0495641_0125770 | 3300046461 | Unclassified | 1144 |
| 709 | Ga0495651_0016582 | 3300046462 | Bacteria | 5705 |
| 710 | Ga0495651_0021029 | 3300046462 | Bacteria | 5066 |
| 711 | Ga0495653_0018024 | 3300046463 | Bacteria | 5739 |
| 712 | Ga0495653_0032171 | 3300046463 | Unclassified | 4167 |
| 713 | Ga0495580_0085247 | 3300046472 | Unclassified | 2201 |
| 714 | Ga0495580_0136167 | 3300046472 | Bacteria | 1703 |
| 715 | Ga0495580_0155060 | 3300046472 | Bacteria | 1586 |
| 716 | Ga0495582_0001176 | 3300046473 | Bacteria | 14741 |
| 717 | Ga0495582_0023392 | 3300046473 | Bacteria | 3380 |
| 718 | Ga0495582_0039234 | 3300046473 | Bacteria | 2607 |
| 719 | Ga0495582_0203965 | 3300046473 | Bacteria | 1129 |
| 720 | Ga0495639_0002484 | 3300046475 | Bacteria | 8044 |
| 721 | Ga0495639_0009978 | 3300046475 | Bacteria | 4080 |
| 722 | Ga0495639_0111506 | 3300046475 | Unclassified | 1298 |
| 723 | Ga0495662_0004481 | 3300046476 | Bacteria | 7009 |
| 724 | Ga0495662_0015970 | 3300046476 | Unclassified | 3642 |
| 725 | Ga0495664_0009662 | 3300046477 | Bacteria | 5400 |
| 726 | Ga0495664_0025843 | 3300046477 | Unclassified | 3419 |
| 727 | Ga0495664_0027938 | 3300046477 | Bacteria | 3292 |
| 728 | Ga0495664_0138755 | 3300046477 | Bacteria | 1473 |
| 729 | Ga0495584_0117787 | 3300046491 | Bacteria | 1345 |
| 730 | Ga0495584_0129218 | 3300046491 | Bacteria | 1281 |
| 731 | Ga0495585_0020294 | 3300046492 | Unclassified | 3822 |
| 732 | Ga0495585_0073242 | 3300046492 | Bacteria | 1865 |
| 733 | Ga0495594_0005733 | 3300046499 | Bacteria | 6380 |
| 734 | Ga0495594_0008519 | 3300046499 | Bacteria | 5287 |
| 735 | Ga0495594_0073750 | 3300046499 | Bacteria | 1900 |
| 736 | Ga0495594_0083682 | 3300046499 | Unclassified | 1783 |
| 737 | Ga0495607_0030536 | 3300046501 | Unclassified | 3307 |
| 738 | Ga0495583_0020981 | 3300046506 | Bacteria | 3368 |
| 739 | Ga0495606_0007302 | 3300046507 | Bacteria | 9950 |
| 740 | Ga0495606_0017684 | 3300046507 | Bacteria | 5380 |
| 741 | Ga0495608_0000688 | 3300046511 | Bacteria | 23406 |
| 742 | Ga0495616_0211269 | 3300046513 | Bacteria | 849 |
| 743 | Ga0495618_0002700 | 3300046514 | Bacteria | 11310 |
| 744 | Ga0495618_0153605 | 3300046514 | Unclassified | 1470 |
| 745 | Ga0495620_0016304 | 3300046515 | Bacteria | 3731 |
| 746 | Ga0495620_0152568 | 3300046515 | Unclassified | 900 |
| 747 | Ga0495628_0023438 | 3300046516 | Bacteria | 5067 |
| 748 | Ga0495628_0053287 | 3300046516 | Unclassified | 3193 |
| 749 | Ga0495628_0081037 | 3300046516 | Bacteria | 2521 |
| 750 | Ga0495630_0014202 | 3300046517 | Bacteria | 5798 |
| 751 | Ga0495630_0077429 | 3300046517 | Bacteria | 2507 |
| 752 | Ga0495631_0121585 | 3300046518 | Unclassified | 1123 |
| 753 | Ga0495631_0152386 | 3300046518 | Bacteria | 992 |
| 754 | Ga0495632_0080940 | 3300046519 | Bacteria | 1549 |
| 755 | Ga0495644_0034138 | 3300046523 | Unclassified | 1920 |
| 756 | Ga0495663_0019753 | 3300046525 | Unclassified | 1931 |
| 757 | Ga0495666_0015245 | 3300046526 | Unclassified | 3828 |
| 758 | Ga0495666_0044191 | 3300046526 | Bacteria | 2151 |
| 759 | Ga0495666_0058094 | 3300046526 | Bacteria | 1851 |
| 760 | Ga0495652_0011434 | 3300046529 | Bacteria | 8029 |
| 761 | Ga0495652_0045348 | 3300046529 | Unclassified | 3780 |
| 762 | Ga0495652_0066312 | 3300046529 | Bacteria | 3030 |
| 763 | Ga0495652_0209603 | 3300046529 | Bacteria | 1472 |
| 764 | Ga0495654_0000195 | 3300046530 | Bacteria | 59404 |
| 765 | Ga0495665_0002695 | 3300046531 | Bacteria | 9573 |
| 766 | Ga0495665_0017690 | 3300046531 | Bacteria | 3832 |
| 767 | Ga0495665_0021884 | 3300046531 | Unclassified | 3438 |
| 768 | Ga0495640_0013114 | 3300046533 | Bacteria | 6308 |
| 769 | Ga0495640_0035222 | 3300046533 | Bacteria | 3543 |
| 770 | Ga0495640_0057166 | 3300046533 | Bacteria | 2663 |
| 771 | Ga0495640_0112913 | 3300046533 | Unclassified | 1773 |
| 772 | Ga0495640_0228658 | 3300046533 | Unclassified | 1171 |
| 773 | Ga0495587_0000534 | 3300046536 | Bacteria | 26299 |
| 774 | Ga0495587_0031195 | 3300046536 | Unclassified | 3229 |
| 775 | Ga0495587_0284282 | 3300046536 | Bacteria | 927 |
| 776 | Ga0495598_0003289 | 3300046537 | Bacteria | 3417 |
| 777 | Ga0495609_0017146 | 3300046538 | Unclassified | 3366 |
| 778 | Ga0495597_0071280 | 3300046542 | Bacteria | 1497 |
| 779 | Ga0495645_0001860 | 3300046543 | Bacteria | 14334 |
| 780 | Ga0495645_0021703 | 3300046543 | Bacteria | 4641 |
| 781 | Ga0495645_0043596 | 3300046543 | Bacteria | 3273 |
| 782 | Ga0495645_0155632 | 3300046543 | Unclassified | 1584 |
| 783 | Ga0495622_0043467 | 3300046557 | Bacteria | 2089 |
| 784 | Ga0495622_0060544 | 3300046557 | Bacteria | 1753 |
| 785 | Ga0495622_0139419 | 3300046557 | Unclassified | 1101 |
| 786 | Ga0495633_0058533 | 3300046558 | Unclassified | 1808 |
| 787 | Ga0495633_0223191 | 3300046558 | Bacteria | 862 |
| 788 | Ga0495667_0000771 | 3300046559 | Bacteria | 20558 |
| 789 | Ga0495667_0014884 | 3300046559 | Bacteria | 5256 |
| 790 | Ga0495656_0006096 | 3300046615 | Unclassified | 4206 |
| 791 | Ga0495656_0019409 | 3300046615 | Bacteria | 2624 |
| 792 | Ga0495668_0390015 | 3300046616 | Bacteria | 765 |
| 793 | Ga0495634_0011864 | 3300046642 | Bacteria | 6332 |
| 794 | Ga0495634_0047044 | 3300046642 | Bacteria | 2908 |
| 795 | Ga0495634_0120345 | 3300046642 | Unclassified | 1681 |
| 796 | Ga0495625_0001908 | 3300046660 | Bacteria | 23568 |
| 797 | Ga0495625_0268164 | 3300046660 | Bacteria | 1103 |
| 798 | Ga0495635_0003284 | 3300046663 | Bacteria | 11171 |
| 799 | Ga0495635_0018011 | 3300046663 | Bacteria | 4930 |
| 800 | Ga0495635_0034629 | 3300046663 | Bacteria | 3503 |
| 801 | Ga0495635_0072756 | 3300046663 | Bacteria | 2355 |
| 802 | Ga0495659_0017252 | 3300046664 | Unclassified | 2390 |
| 803 | Ga0495659_0025182 | 3300046664 | Bacteria | 2035 |
| 804 | Ga0495659_0099928 | 3300046664 | Bacteria | 1123 |
| 805 | Ga0495661_0269871 | 3300046665 | Bacteria | 861 |
| 806 | Ga0495588_0033487 | 3300046674 | Bacteria | 2595 |
| 807 | Ga0495588_0094496 | 3300046674 | Unclassified | 1567 |
| 808 | Ga0495588_0259057 | 3300046674 | Bacteria | 917 |
| 809 | Ga0495657_0001333 | 3300046675 | Bacteria | 21487 |
| 810 | Ga0495657_0284048 | 3300046675 | Unclassified | 990 |
| 811 | Ga0495599_0046612 | 3300046678 | Unclassified | 2718 |
| 812 | Ga0495599_0055821 | 3300046678 | Bacteria | 2472 |
| 813 | Ga0495599_0087262 | 3300046678 | Bacteria | 1948 |
| 814 | Ga0495599_0090822 | 3300046678 | Unclassified | 1905 |
| 815 | Ga0495623_0000354 | 3300046679 | Bacteria | 30302 |
| 816 | Ga0495646_0004095 | 3300046680 | Bacteria | 9146 |
| 817 | Ga0495646_0046680 | 3300046680 | Unclassified | 2639 |
| 818 | Ga0495646_0142667 | 3300046680 | Bacteria | 1338 |
| 819 | Ga0495647_0020517 | 3300046681 | Unclassified | 2372 |
| 820 | Ga0495647_0029475 | 3300046681 | Bacteria | 2029 |
| 821 | Ga0495647_0093073 | 3300046681 | Unclassified | 1238 |
| 822 | Ga0495658_0000944 | 3300046683 | Bacteria | 15496 |
| 823 | Ga0495658_0026428 | 3300046683 | Bacteria | 3111 |
| 824 | Ga0495658_0027655 | 3300046683 | Unclassified | 3054 |
| 825 | Ga0495658_0348119 | 3300046683 | Unclassified | 941 |
| 826 | Ga0495669_0083595 | 3300046684 | Bacteria | 1467 |
| 827 | Ga0495624_0002092 | 3300046690 | Bacteria | 15220 |
| 828 | Ga0495670_0034592 | 3300046691 | Unclassified | 2517 |
| 829 | Ga0495670_0069341 | 3300046691 | Bacteria | 1783 |
| 830 | Ga0495671_0216005 | 3300046692 | Unclassified | 929 |
| 831 | Ga0495649_0204497 | 3300046694 | Bacteria | 1025 |
| 832 | Ga0495589_0044030 | 3300046794 | Unclassified | 2221 |
| 833 | Ga0495600_0001299 | 3300046809 | Bacteria | 13803 |
| 834 | Ga0495600_0005531 | 3300046809 | Bacteria | 7623 |
| 835 | Ga0495660_0019580 | 3300046810 | Bacteria | 3885 |
| 836 | Ga0495581_0003049 | 3300047315 | Bacteria | 9597 |
| 837 | Ga0495581_0093984 | 3300047315 | Unclassified | 1740 |
| 838 | Ga0495581_0218689 | 3300047315 | Bacteria | 1114 |
| 839 | Ga0495581_0244815 | 3300047315 | Bacteria | 1048 |
| 840 | Ga0495604_0003048 | 3300047317 | Bacteria | 13390 |
| 841 | Ga0495604_0118199 | 3300047317 | Bacteria | 1922 |
| 842 | Ga0495604_0370935 | 3300047317 | Unclassified | 947 |
| 843 | Ga0495604_0506510 | 3300047317 | Bacteria | 782 |
| 844 | Ga0495636_0019523 | 3300047318 | Bacteria | 2725 |
| 845 | Ga0495674_0003671 | 3300047319 | Bacteria | 14931 |
| 846 | Ga0495674_0008886 | 3300047319 | Bacteria | 9554 |
| 847 | Ga0495674_0019619 | 3300047319 | Bacteria | 6273 |
| 848 | Ga0495674_0129891 | 3300047319 | Bacteria | 2123 |
| 849 | Ga0495676_0046504 | 3300047321 | Bacteria | 3521 |
| 850 | Ga0495676_0139063 | 3300047321 | Bacteria | 1742 |
| 851 | Ga0495680_0021289 | 3300047322 | Bacteria | 5431 |
| 852 | Ga0495680_0022905 | 3300047322 | Bacteria | 5201 |
| 853 | Ga0495680_0024262 | 3300047322 | Bacteria | 5032 |
| 854 | Ga0495680_0508285 | 3300047322 | Bacteria | 817 |
| 855 | Ga0495675_0000892 | 3300047444 | Bacteria | 18258 |
| 856 | Ga0495679_029342 | 3300047446 | Unclassified | 1795 |
| 857 | Ga0495673_0086286 | 3300047469 | Bacteria | 1290 |
| 858 | Ga0495684_0000517 | 3300047471 | Bacteria | 31334 |
| 859 | Ga0495684_0027435 | 3300047471 | Bacteria | 4372 |
| 860 | Ga0495684_0063404 | 3300047471 | Bacteria | 2810 |
| 861 | Ga0495684_0212214 | 3300047471 | Bacteria | 1423 |
| 862 | Ga0495684_0394881 | 3300047471 | Bacteria | 972 |
| 863 | Ga0495686_0229662 | 3300047472 | Bacteria | 1051 |
| 864 | Ga0495593_0002569 | 3300047673 | Bacteria | 10905 |
| 865 | Ga0495593_0005851 | 3300047673 | Bacteria | 7247 |
| 866 | Ga0495593_0040189 | 3300047673 | Bacteria | 2519 |
| 867 | Ga0495602_0004679 | 3300048088 | Bacteria | 14292 |
| 868 | Ga0495614_0023650 | 3300048089 | Bacteria | 2653 |
| 869 | Ga0495614_0047452 | 3300048089 | Unclassified | 1842 |
| 870 | Ga0496100_0000589 | 3300048903 | Bacteria | 17151 |
| 871 | Ga0496100_0036216 | 3300048903 | Bacteria | 3110 |
| 872 | Ga0496100_0077681 | 3300048903 | Unclassified | 2232 |
| 873 | Ga0496100_0484123 | 3300048903 | Bacteria | 952 |
| 874 | Ga0496101_0000782 | 3300048904 | Bacteria | 18836 |
| 875 | Ga0496101_0003150 | 3300048904 | Bacteria | 10204 |
| 876 | Ga0496101_0372589 | 3300048904 | Bacteria | 1123 |
| 877 | Ga0496101_0487180 | 3300048904 | Bacteria | 974 |
| 878 | Ga0496102_0004682 | 3300048905 | Bacteria | 11571 |
| 879 | Ga0496102_0013897 | 3300048905 | Bacteria | 6984 |
| 880 | Ga0496102_0092192 | 3300048905 | Bacteria | 2805 |
| 881 | Ga0496103_0054684 | 3300048906 | Bacteria | 2474 |
| 882 | Ga0496103_0079993 | 3300048906 | Unclassified | 2054 |
| 883 | Ga0496103_0153282 | 3300048906 | Bacteria | 1476 |
| 884 | Ga0496104_0031877 | 3300048907 | Bacteria | 4903 |
| 885 | Ga0496104_0033611 | 3300048907 | Bacteria | 4779 |
| 886 | Ga0496104_0092517 | 3300048907 | Bacteria | 2891 |
| 887 | Ga0496104_0337650 | 3300048907 | Bacteria | 1420 |
| 888 | Ga0496104_0452160 | 3300048907 | Bacteria | 1196 |
| 889 | Ga0496105_0161814 | 3300048908 | Bacteria | 1837 |
| 890 | Ga0496106_0028579 | 3300048909 | Bacteria | 4154 |
| 891 | Ga0496106_0049812 | 3300048909 | Bacteria | 3156 |
| 892 | Ga0496106_0157465 | 3300048909 | Bacteria | 1794 |
| 893 | Ga0496106_0284695 | 3300048909 | Bacteria | 1324 |
| 894 | Ga0496106_0670576 | 3300048909 | Bacteria | 828 |
| 895 | Ga0496107_0013677 | 3300048910 | Bacteria | 5674 |
| 896 | Ga0496107_0025804 | 3300048910 | Bacteria | 4163 |
| 897 | Ga0496107_0038274 | 3300048910 | Bacteria | 3442 |
| 898 | Ga0496107_0164033 | 3300048910 | Bacteria | 1647 |
| 899 | Ga0496107_0298937 | 3300048910 | Bacteria | 1198 |
| 900 | Ga0496107_0609139 | 3300048910 | Bacteria | 807 |
| 901 | Ga0496108_0006294 | 3300048911 | Bacteria | 9623 |
| 902 | Ga0496108_0008390 | 3300048911 | Bacteria | 8382 |
| 903 | Ga0496108_0106283 | 3300048911 | Bacteria | 2397 |
| 904 | Ga0496108_0261326 | 3300048911 | Unclassified | 1506 |
| 905 | Ga0496109_0000500 | 3300048912 | Bacteria | 33553 |
| 906 | Ga0496109_0001328 | 3300048912 | Bacteria | 20394 |
| 907 | Ga0496109_0016249 | 3300048912 | Bacteria | 6506 |
| 908 | Ga0496109_0164387 | 3300048912 | Unclassified | 2080 |
| 909 | Ga0496109_0184996 | 3300048912 | Bacteria | 1957 |
| 910 | Ga0496109_0473347 | 3300048912 | Bacteria | 1183 |
| 911 | Ga0496109_0486019 | 3300048912 | Bacteria | 1166 |
| 912 | Ga0496109_0634857 | 3300048912 | Unclassified | 1005 |
| 913 | Ga0496110_0044003 | 3300048913 | Bacteria | 3899 |
| 914 | Ga0496111_0073039 | 3300048914 | Bacteria | 2497 |
| 915 | Ga0496111_0202296 | 3300048914 | Bacteria | 1476 |
| 916 | Ga0496112_0019146 | 3300048915 | Bacteria | 6454 |
| 917 | Ga0496112_0451689 | 3300048915 | Unclassified | 1223 |
| 918 | Ga0496113_0005457 | 3300048916 | Bacteria | 7932 |
| 919 | Ga0496113_0059992 | 3300048916 | Bacteria | 2866 |
| 920 | Ga0496114_0000544 | 3300048917 | Bacteria | 27873 |
| 921 | Ga0496114_0016176 | 3300048917 | Bacteria | 6005 |
| 922 | Ga0496114_0036286 | 3300048917 | Bacteria | 4074 |
| 923 | Ga0496114_0548881 | 3300048917 | Unclassified | 1021 |
| 924 | Ga0496115_0033087 | 3300048918 | Bacteria | 4080 |
| 925 | Ga0496115_0100759 | 3300048918 | Bacteria | 2368 |
| 926 | Ga0496115_0108637 | 3300048918 | Bacteria | 2277 |
| 927 | Ga0496115_0141919 | 3300048918 | Bacteria | 1982 |
| 928 | Ga0496115_0154440 | 3300048918 | Bacteria | 1895 |
| 929 | Ga0496117_0290388 | 3300048920 | Bacteria | 871 |
| 930 | Ga0496119_0290424 | 3300048922 | Bacteria | 810 |
| 931 | Ga0496122_0271275 | 3300048925 | Bacteria | 934 |
| 932 | Ga0496126_0049295 | 3300048929 | Bacteria | 3845 |
| 933 | Ga0496126_0958899 | 3300048929 | Bacteria | 644 |
| 934 | Ga0495682_0050261 | 3300049460 | Bacteria | 1518 |
| 935 | Ga0501039_0097625 | 3300049575 | Bacteria | 2291 |
| 936 | Ga0501039_0636954 | 3300049575 | Bacteria | 835 |
| 937 | Ga0501040_0305620 | 3300049576 | Bacteria | 1137 |
| 938 | Ga0501040_0505473 | 3300049576 | Bacteria | 871 |
| 939 | Ga0501041_0588558 | 3300049577 | Unclassified | 710 |
| 940 | Ga0501042_0298408 | 3300049578 | Bacteria | 1164 |
| 941 | Ga0501042_0679358 | 3300049578 | Bacteria | 749 |
| 942 | Ga0501048_0533143 | 3300049582 | Bacteria | 842 |
| 943 | Ga0501071_0023370 | 3300049587 | Bacteria | 4317 |
| 944 | Ga0501072_0003196 | 3300049588 | Bacteria | 12308 |
| 945 | Ga0501072_0278698 | 3300049588 | Bacteria | 1330 |
| 946 | Ga0501072_0400244 | 3300049588 | Bacteria | 1089 |
| 947 | Ga0501073_0164659 | 3300049589 | Bacteria | 1536 |
| 948 | Ga0501073_0255391 | 3300049589 | Bacteria | 1210 |
| 949 | Ga0501074_0155465 | 3300049590 | Bacteria | 1634 |
| 950 | Ga0501075_0085939 | 3300049591 | Unclassified | 2383 |
| 951 | Ga0501075_0154148 | 3300049591 | Bacteria | 1752 |
| 952 | Ga0501076_0066540 | 3300049592 | Bacteria | 2876 |
| 953 | Ga0501076_0078791 | 3300049592 | Bacteria | 2644 |
| 954 | Ga0501076_0278271 | 3300049592 | Bacteria | 1371 |
| 955 | Ga0501077_0033846 | 3300049593 | Bacteria | 3253 |
| 956 | Ga0501077_0060461 | 3300049593 | Bacteria | 2404 |
| 957 | Ga0501077_0099594 | 3300049593 | Bacteria | 1842 |
| 958 | Ga0501077_0651554 | 3300049593 | Bacteria | 677 |
| 959 | Ga0501079_0187632 | 3300049741 | Bacteria | 1614 |
| 960 | Ga0501079_0251887 | 3300049741 | Bacteria | 1380 |
| 961 | Ga0501080_0121276 | 3300049742 | Bacteria | 2423 |
| 962 | Ga0501080_0342741 | 3300049742 | Bacteria | 1350 |
| 963 | Ga0501080_0354333 | 3300049742 | Bacteria | 1325 |
| 964 | Ga0501080_1096557 | 3300049742 | Bacteria | 687 |
| 965 | Ga0501081_0059079 | 3300049743 | Bacteria | 2654 |
| 966 | Ga0501081_0145530 | 3300049743 | Bacteria | 1700 |
| 967 | Ga0501081_0237851 | 3300049743 | Bacteria | 1327 |
| 968 | Ga0501083_0122077 | 3300049744 | Bacteria | 1709 |
| 969 | Ga0501044_0000315 | 3300049823 | Bacteria | 61159 |
| 970 | Ga0501044_0003273 | 3300049823 | Bacteria | 18232 |
| 971 | nmdc:mga0yw44_77285_c1 | 3300050492 | Bacteria | 2079 |
| 972 | nmdc:mga0k408_81378_c1 | 3300050493 | Bacteria | 1896 |
| 973 | nmdc:mga04h51_43807_c1 | 3300050495 | Bacteria | 1473 |
| 974 | nmdc:mga05p37_1224635_c1 | 3300050507 | Unclassified | 773 |
| 975 | nmdc:mga05p37_124_c1 | 3300050507 | Bacteria | 69907 |
| 976 | nmdc:mga05p37_35_c1 | 3300050507 | Bacteria | 110751 |
| 977 | nmdc:mga09592_12863_c1 | 3300050508 | Bacteria | 6823 |
| 978 | nmdc:mga09592_3352_c3 | 3300050508 | Bacteria | 7345 |
| 979 | nmdc:mga0qj67_1026_c1 | 3300050509 | Bacteria | 19313 |
| 980 | nmdc:mga0qj67_27397_c1 | 3300050509 | Bacteria | 4417 |
| 981 | nmdc:mga0qj67_326191_c1 | 3300050509 | Unclassified | 1242 |
| 982 | nmdc:mga0qj67_461_c1 | 3300050509 | Bacteria | 27816 |
| 983 | nmdc:mga0qj67_62190_c1 | 3300050509 | Bacteria | 2967 |
| 984 | nmdc:mga06r32_55452_c1 | 3300050510 | Bacteria | 3802 |
| 985 | nmdc:mga06r32_847_c1 | 3300050510 | Bacteria | 27075 |
| 986 | nmdc:mga08y16_12119_c1 | 3300050511 | Bacteria | 9060 |
| 987 | nmdc:mga08y16_202042_c1 | 3300050511 | Bacteria | 2059 |
| 988 | nmdc:mga08y16_22611_c1 | 3300050511 | Bacteria | 6639 |
| 989 | nmdc:mga08y16_23649_c1 | 3300050511 | Bacteria | 6488 |
| 990 | nmdc:mga08y16_2480_c1 | 3300050511 | Bacteria | 18957 |
| 991 | nmdc:mga08y16_278734_c1 | 3300050511 | Bacteria | 1725 |
| 992 | nmdc:mga08y16_403540_c1 | 3300050511 | Unclassified | 1399 |
| 993 | nmdc:mga0n895_11659_c1 | 3300050512 | Bacteria | 7852 |
| 994 | nmdc:mga0n895_41857_c1 | 3300050512 | Unclassified | 4455 |
| 995 | nmdc:mga0n895_6626_c1 | 3300050512 | Bacteria | 9863 |
| 996 | nmdc:mga0n895_73_c1 | 3300050512 | Bacteria | 57709 |
| 997 | nmdc:mga0n895_877_c1 | 3300050512 | Bacteria | 21660 |
| 998 | nmdc:mga0n895_955829_c1 | 3300050512 | Bacteria | 840 |
| 999 | nmdc:mga0rr50_11547_c1 | 3300050513 | Bacteria | 5660 |
| 1000 | nmdc:mga0rr50_145611_c1 | 3300050513 | Bacteria | 1910 |
| 1001 | nmdc:mga0rr50_25060_c1 | 3300050513 | Bacteria | 4142 |
| 1002 | nmdc:mga0rr50_27845_c1 | 3300050513 | Bacteria | 3964 |
| 1003 | nmdc:mga0rr50_42978_c1 | 3300050513 | Bacteria | 3303 |
| 1004 | nmdc:mga0rr50_75377_c1 | 3300050513 | Bacteria | 2586 |
| 1005 | nmdc:mga08x19_329911_c1 | 3300050514 | Bacteria | 1063 |
| 1006 | nmdc:mga08x19_47889_c1 | 3300050514 | Bacteria | 2737 |
| 1007 | nmdc:mga0a205_20696_c1 | 3300050515 | Bacteria | 6213 |
| 1008 | nmdc:mga0a205_276102_c1 | 3300050515 | Unclassified | 1557 |
| 1009 | nmdc:mga0a205_59_c1 | 3300050515 | Bacteria | 60447 |
| 1010 | nmdc:mga0a205_65728_c1 | 3300050515 | Bacteria | 3505 |
| 1011 | nmdc:mga0a205_817331_c1 | 3300050515 | Bacteria | 780 |
| 1012 | nmdc:mga0sz30_34393_c1 | 3300050516 | Bacteria | 2109 |
| 1013 | Ga0495601_0001707 | 3300053077 | Bacteria | 12125 |
| 1014 | Ga0495601_0040192 | 3300053077 | Bacteria | 2929 |
| 1015 | Ga0495601_0107171 | 3300053077 | Unclassified | 1807 |
| 1016 | Ga0495612_0004071 | 3300053078 | Bacteria | 6054 |
| 1017 | Ga0495612_0004728 | 3300053078 | Bacteria | 5637 |
| 1018 | Ga0495595_0000615 | 3300053084 | Bacteria | 13573 |
| 1019 | Ga0495619_0000687 | 3300053085 | Bacteria | 22137 |
| 1020 | Ga0495619_0013679 | 3300053085 | Bacteria | 5115 |
| 1021 | Ga0495619_0016558 | 3300053085 | Bacteria | 4667 |
| 1022 | Ga0495619_0031475 | 3300053085 | Bacteria | 3437 |
| 1023 | Ga0495619_0311662 | 3300053085 | Bacteria | 1090 |
| 1024 | Ga0500583_0326167 | 3300053092 | Bacteria | 748 |
| 1025 | Ga0500658_0038711 | 3300053134 | Bacteria | 1902 |
| 1026 | Ga0500573_0020975 | 3300053140 | Plasmid | 3742 |
| 1027 | Ga0500577_0017423 | 3300053142 | Unclassified | 2288 |
| 1028 | Ga0500589_149229 | 3300053147 | Bacteria | 954 |
| 1029 | Ga0501084_0016733 | 3300054114 | Bacteria | 6090 |
| 1030 | Ga0501084_0020383 | 3300054114 | Bacteria | 5529 |
| 1031 | Ga0501084_0109934 | 3300054114 | Bacteria | 2316 |
| 1032 | Ga0501084_0409923 | 3300054114 | Bacteria | 1145 |
| 1033 | Ga0501082_0366794 | 3300060353 | Bacteria | 1256 |
| 1034 | Ga0501082_0372683 | 3300060353 | Bacteria | 1245 |
| 1035 | Ga0501082_0392331 | 3300060353 | Unclassified | 1211 |
| 1036 | Ga0501082_0531911 | 3300060353 | Bacteria | 1028 |
| 1037 | Ga0530510_0021366 | 3300061734 | Bacteria | 4606 |
| 1038 | Ga0530510_0053789 | 3300061734 | Bacteria | 2909 |
| 1039 | Ga0530510_0072772 | 3300061734 | Bacteria | 2495 |
| 1040 | Ga0530510_0079496 | 3300061734 | Bacteria | 2385 |
| 1041 | Ga0530510_0471909 | 3300061734 | Unclassified | 950 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046664 | Ga0495659_0099928 | Ga0495659_0099928_550_1110 | 185 |
| 2 | 3300005467 | Ga0070706_100020111 | Ga0070706_1000201113 | 191 |
| 3 | 3300013296 | Ga0157374_10662263 | Ga0157374_106622631 | 191 |
| 4 | 3300025910 | Ga0207684_10010101 | Ga0207684_100101012 | 191 |
| 5 | 3300034819 | Ga0373958_0002849 | Ga0373958_0002849_736_1317 | 193 |
| 6 | 3300046459 | Ga0495629_0442858 | Ga0495629_0442858_114_698 | 193 |
| 7 | 3300035115 | Ga0373941_0034832 | Ga0373941_0034832_12_611 | 194 |
| 8 | 3300046472 | Ga0495580_0136167 | Ga0495580_0136167_901_1518 | 196 |
| 9 | 3300046499 | Ga0495594_0073750 | Ga0495594_0073750_1186_1803 | 196 |
| 10 | 3300048917 | Ga0496114_0548881 | Ga0496114_0548881_10_600 | 196 |
| 11 | iso_pu_bacteria | 2643221736 | 2644748158 | 197 |
| 12 | 3300026035 | Ga0207703_10528498 | Ga0207703_105284981 | 198 |
| 13 | 3300048909 | Ga0496106_0028579 | Ga0496106_0028579_3547_4143 | 198 |
| 14 | 3300048929 | Ga0496126_0958899 | Ga0496126_0958899_37_633 | 198 |
| 15 | 3300006844 | Ga0075428_100210215 | Ga0075428_1002102152 | 199 |
| 16 | 3300006846 | Ga0075430_100046226 | Ga0075430_1000462262 | 199 |
| 17 | 3300006847 | Ga0075431_100000774 | Ga0075431_10000077419 | 199 |
| 18 | 3300006880 | Ga0075429_100019740 | Ga0075429_1000197402 | 199 |
| 19 | 3300009094 | Ga0111539_10003962 | Ga0111539_1000396216 | 199 |
| 20 | 3300027907 | Ga0207428_10019079 | Ga0207428_100190792 | 199 |
| 21 | 3300031901 | Ga0307406_10634203 | Ga0307406_106342031 | 199 |
| 22 | 3300032002 | Ga0307416_100233336 | Ga0307416_1002333362 | 199 |
| 23 | 3300050507 | nmdc:mga05p37_124_c1 | nmdc:mga05p37_124_c1_13368_13967 | 199 |
| 24 | 3300050508 | nmdc:mga09592_3352_c3 | nmdc:mga09592_3352_c3_5967_6566 | 199 |
| 25 | 3300050509 | nmdc:mga0qj67_27397_c1 | nmdc:mga0qj67_27397_c1_1821_2420 | 199 |
| 26 | 3300050510 | nmdc:mga06r32_847_c1 | nmdc:mga06r32_847_c1_25587_26186 | 199 |
| 27 | 3300050511 | nmdc:mga08y16_23649_c1 | nmdc:mga08y16_23649_c1_4365_4964 | 199 |
| 28 | iso_pu_bacteria | 2513237137 | 2513863653 | 199 |
| 29 | iso_pu_bacteria | 2524023228 | 2524541481 | 199 |
| 30 | iso_pu_bacteria | 2738543024 | 2739309432 | 199 |
| 31 | iso_pu_bacteria | 2904699407 | 2904708126 | 199 |
| 32 | iso_pu_bacteria | 2935777560 | 2935780897 | 199 |
| 33 | iso_pu_bacteria | 2935785616 | 2935786030 | 199 |
| 34 | iso_pu_bacteria | 2935793552 | 2935797787 | 199 |
| 35 | iso_pu_bacteria | 2935819856 | 2935820720 | 199 |
| 36 | iso_pu_bacteria | 2935847175 | 2935849262 | 199 |
| 37 | iso_pu_bacteria | 8016522445 | 8016528428 | 199 |
| 38 | iso_pu_bacteria | 8016530956 | 8016533583 | 199 |
| 39 | iso_pu_bacteria | 8016539877 | 8016546810 | 199 |
| 40 | iso_pu_bacteria | 8016548790 | 8016555311 | 199 |
| 41 | iso_pu_bacteria | 8016557553 | 8016563670 | 199 |
| 42 | iso_pu_bacteria | 8016566248 | 8016571917 | 199 |
| 43 | iso_pu_bacteria | 8016575299 | 8016576125 | 199 |
| 44 | iso_pu_bacteria | 8016595262 | 8016601402 | 199 |
| 45 | iso_pu_bacteria | 8016603502 | 8016609031 | 199 |
| 46 | iso_pu_bacteria | 8016613128 | 8016615870 | 199 |
| 47 | iso_pu_bacteria | 8016622563 | 8016625360 | 199 |
| 48 | iso_pu_bacteria | 8019530166 | 8019533370 | 199 |
| 49 | iso_pu_bacteria | 8019538911 | 8019546296 | 199 |
| 50 | iso_pu_bacteria | 8019547302 | 8019552407 | 199 |
| 51 | 3300005356 | Ga0070674_100509911 | Ga0070674_1005099111 | 200 |
| 52 | 3300005548 | Ga0070665_100004691 | Ga0070665_10000469112 | 200 |
| 53 | 3300005617 | Ga0068859_100666266 | Ga0068859_1006662661 | 200 |
| 54 | 3300005842 | Ga0068858_100167263 | Ga0068858_1001672631 | 200 |
| 55 | 3300005844 | Ga0068862_100992653 | Ga0068862_1009926531 | 200 |
| 56 | 3300006163 | Ga0070715_10022361 | Ga0070715_100223613 | 200 |
| 57 | 3300006931 | Ga0097620_100666363 | Ga0097620_1006663631 | 200 |
| 58 | 3300009101 | Ga0105247_10029580 | Ga0105247_100295801 | 200 |
| 59 | 3300014326 | Ga0157380_10479340 | Ga0157380_104793402 | 200 |
| 60 | 3300025905 | Ga0207685_10144159 | Ga0207685_101441592 | 200 |
| 61 | 3300028379 | Ga0268266_10004115 | Ga0268266_1000411511 | 200 |
| 62 | 3300046515 | Ga0495620_0152568 | Ga0495620_0152568_50_655 | 200 |
| 63 | 3300047471 | Ga0495684_0212214 | Ga0495684_0212214_14_631 | 200 |
| 64 | 3300048912 | Ga0496109_0634857 | Ga0496109_0634857_363_983 | 200 |
| 65 | iso_pu_bacteria | 2643221634 | 2644196055 | 200 |
| 66 | iso_pu_bacteria | 8006964411 | 8006969422 | 200 |
| 67 | 3300005331 | Ga0070670_100701118 | Ga0070670_1007011181 | 201 |
| 68 | 3300005456 | Ga0070678_100234196 | Ga0070678_1002341962 | 201 |
| 69 | 3300005617 | Ga0068859_100793171 | Ga0068859_1007931712 | 201 |
| 70 | 3300006846 | Ga0075430_100602571 | Ga0075430_1006025711 | 201 |
| 71 | 3300006852 | Ga0075433_10003106 | Ga0075433_1000310612 | 201 |
| 72 | 3300006871 | Ga0075434_100019105 | Ga0075434_1000191052 | 201 |
| 73 | 3300006931 | Ga0097620_100793166 | Ga0097620_1007931662 | 201 |
| 74 | 3300007076 | Ga0075435_100016140 | Ga0075435_1000161402 | 201 |
| 75 | 3300009094 | Ga0111539_10081875 | Ga0111539_100818752 | 201 |
| 76 | 3300009993 | Ga0105028_106036 | Ga0105028_1060362 | 201 |
| 77 | 3300014968 | Ga0157379_10420972 | Ga0157379_104209722 | 201 |
| 78 | 3300025918 | Ga0207662_10264607 | Ga0207662_102646072 | 201 |
| 79 | 3300025972 | Ga0207668_10961466 | Ga0207668_109614661 | 201 |
| 80 | 3300026089 | Ga0207648_10675299 | Ga0207648_106752991 | 201 |
| 81 | 3300026121 | Ga0207683_10534181 | Ga0207683_105341812 | 201 |
| 82 | 3300027907 | Ga0207428_10026193 | Ga0207428_100261932 | 201 |
| 83 | 3300034819 | Ga0373958_0000878 | Ga0373958_0000878_1878_2483 | 201 |
| 84 | 3300034957 | Ga0373938_0030907 | Ga0373938_0030907_263_868 | 201 |
| 85 | 3300035088 | Ga0373940_0003445 | Ga0373940_0003445_1410_2015 | 201 |
| 86 | 3300035114 | Ga0373939_0005478 | Ga0373939_0005478_1956_2561 | 201 |
| 87 | 3300035114 | Ga0373939_0012689 | Ga0373939_0012689_1133_1738 | 201 |
| 88 | 3300035115 | Ga0373941_0041808 | Ga0373941_0041808_407_1012 | 201 |
| 89 | 3300035121 | Ga0373960_0014490 | Ga0373960_0014490_1150_1755 | 201 |
| 90 | 3300035242 | Ga0373962_0038458 | Ga0373962_0038458_538_1143 | 201 |
| 91 | 3300035691 | Ga0373931_0004146 | Ga0373931_0004146_2179_2784 | 201 |
| 92 | 3300049575 | Ga0501039_0097625 | Ga0501039_0097625_1197_1802 | 201 |
| 93 | 3300049576 | Ga0501040_0305620 | Ga0501040_0305620_513_1124 | 201 |
| 94 | 3300049587 | Ga0501071_0023370 | Ga0501071_0023370_3533_4138 | 201 |
| 95 | 3300049588 | Ga0501072_0003196 | Ga0501072_0003196_1854_2459 | 201 |
| 96 | 3300049590 | Ga0501074_0155465 | Ga0501074_0155465_20_625 | 201 |
| 97 | 3300049591 | Ga0501075_0085939 | Ga0501075_0085939_1321_1926 | 201 |
| 98 | 3300049592 | Ga0501076_0066540 | Ga0501076_0066540_1532_2137 | 201 |
| 99 | 3300049741 | Ga0501079_0187632 | Ga0501079_0187632_77_682 | 201 |
| 100 | 3300050511 | nmdc:mga08y16_403540_c1 | nmdc:mga08y16_403540_c1_572_1177 | 201 |
| 101 | 3300050512 | nmdc:mga0n895_6626_c1 | nmdc:mga0n895_6626_c1_6517_7122 | 201 |
| 102 | 3300050513 | nmdc:mga0rr50_11547_c1 | nmdc:mga0rr50_11547_c1_4059_4664 | 201 |
| 103 | 3300050515 | nmdc:mga0a205_65728_c1 | nmdc:mga0a205_65728_c1_120_725 | 201 |
| 104 | 3300054114 | Ga0501084_0016733 | Ga0501084_0016733_5160_5765 | 201 |
| 105 | 3300060353 | Ga0501082_0392331 | Ga0501082_0392331_153_758 | 201 |
| 106 | 3300061734 | Ga0530510_0053789 | Ga0530510_0053789_1896_2501 | 201 |
| 107 | 3300026095 | Ga0207676_11227056 | Ga0207676_112270561 | 202 |
| 108 | 3300046515 | Ga0495620_0016304 | Ga0495620_0016304_1863_2474 | 202 |
| 109 | 3300046558 | Ga0495633_0223191 | Ga0495633_0223191_80_691 | 202 |
| 110 | 3300046691 | Ga0495670_0069341 | Ga0495670_0069341_21_632 | 202 |
| 111 | 3300047472 | Ga0495686_0229662 | Ga0495686_0229662_142_753 | 202 |
| 112 | 3300049593 | Ga0501077_0651554 | Ga0501077_0651554_16_624 | 202 |
| 113 | 3300005937 | Ga0081455_10000652 | Ga0081455_1000065244 | 203 |
| 114 | 3300006353 | Ga0075370_10064896 | Ga0075370_100648962 | 203 |
| 115 | 3300021377 | Ga0213874_10094993 | Ga0213874_100949932 | 203 |
| 116 | 3300031595 | Ga0265313_10207709 | Ga0265313_102077091 | 203 |
| 117 | 3300035170 | Ga0373943_0090406 | Ga0373943_0090406_553_1164 | 203 |
| 118 | 3300035695 | Ga0373927_0155320 | Ga0373927_0155320_250_861 | 203 |
| 119 | 3300039438 | Ga0436360_0266827 | Ga0436360_0266827_83_694 | 203 |
| 120 | 3300039438 | Ga0436360_0519909 | Ga0436360_0519909_175_786 | 203 |
| 121 | 3300039438 | Ga0436360_1162768 | Ga0436360_1162768_135_761 | 203 |
| 122 | 3300039447 | Ga0436361_0920118 | Ga0436361_0920118_155_781 | 203 |
| 123 | 3300039450 | Ga0436363_0682568 | Ga0436363_0682568_68_682 | 203 |
| 124 | 3300046507 | Ga0495606_0007302 | Ga0495606_0007302_7657_8289 | 203 |
| 125 | 3300046507 | Ga0495606_0017684 | Ga0495606_0017684_3623_4240 | 203 |
| 126 | 3300046660 | Ga0495625_0001908 | Ga0495625_0001908_18414_19046 | 203 |
| 127 | 3300046810 | Ga0495660_0019580 | Ga0495660_0019580_2786_3418 | 203 |
| 128 | 3300047315 | Ga0495581_0218689 | Ga0495581_0218689_59_670 | 203 |
| 129 | 3300047321 | Ga0495676_0139063 | Ga0495676_0139063_660_1271 | 203 |
| 130 | 3300048920 | Ga0496117_0290388 | Ga0496117_0290388_33_647 | 203 |
| 131 | 3300053140 | Ga0500573_0020975 | Ga0500573_0020975_2017_2631 | 203 |
| 132 | 3300053142 | Ga0500577_0017423 | Ga0500577_0017423_1481_2095 | 203 |
| 133 | 3300060353 | Ga0501082_0531911 | Ga0501082_0531911_51_665 | 203 |
| 134 | iso_pu_bacteria | 2643221645 | 2644249340 | 203 |
| 135 | iso_pu_bacteria | 2738541300 | 2738845077 | 203 |
| 136 | iso_pu_bacteria | 2738543018 | 2739274656 | 203 |
| 137 | iso_pu_bacteria | 2738543030 | 2739343700 | 203 |
| 138 | 3300003659 | JGI25404J52841_10000042 | JGI25404J52841_100000426 | 204 |
| 139 | 3300005329 | Ga0070683_100390577 | Ga0070683_1003905772 | 204 |
| 140 | 3300005334 | Ga0068869_100141404 | Ga0068869_1001414042 | 204 |
| 141 | 3300005337 | Ga0070682_100564773 | Ga0070682_1005647732 | 204 |
| 142 | 3300005340 | Ga0070689_100101186 | Ga0070689_1001011864 | 204 |
| 143 | 3300005347 | Ga0070668_100109342 | Ga0070668_1001093423 | 204 |
| 144 | 3300005347 | Ga0070668_100159068 | Ga0070668_1001590682 | 204 |
| 145 | 3300005356 | Ga0070674_100059248 | Ga0070674_1000592482 | 204 |
| 146 | 3300005364 | Ga0070673_100513557 | Ga0070673_1005135571 | 204 |
| 147 | 3300005436 | Ga0070713_100580298 | Ga0070713_1005802982 | 204 |
| 148 | 3300005455 | Ga0070663_100224630 | Ga0070663_1002246302 | 204 |
| 149 | 3300005467 | Ga0070706_100328116 | Ga0070706_1003281162 | 204 |
| 150 | 3300005544 | Ga0070686_100084339 | Ga0070686_1000843392 | 204 |
| 151 | 3300005548 | Ga0070665_100099806 | Ga0070665_1000998063 | 204 |
| 152 | 3300005844 | Ga0068862_100120269 | Ga0068862_1001202692 | 204 |
| 153 | 3300005844 | Ga0068862_100330873 | Ga0068862_1003308731 | 204 |
| 154 | 3300005844 | Ga0068862_100566750 | Ga0068862_1005667502 | 204 |
| 155 | 3300005937 | Ga0081455_10037342 | Ga0081455_100373422 | 204 |
| 156 | 3300005983 | Ga0081540_1000067 | Ga0081540_100006720 | 204 |
| 157 | 3300005983 | Ga0081540_1000423 | Ga0081540_100042321 | 204 |
| 158 | 3300005983 | Ga0081540_1002957 | Ga0081540_100295713 | 204 |
| 159 | 3300005983 | Ga0081540_1018444 | Ga0081540_10184446 | 204 |
| 160 | 3300006028 | Ga0070717_10348731 | Ga0070717_103487312 | 204 |
| 161 | 3300006038 | Ga0075365_10032280 | Ga0075365_100322803 | 204 |
| 162 | 3300006048 | Ga0075363_100076617 | Ga0075363_1000766172 | 204 |
| 163 | 3300006051 | Ga0075364_10035752 | Ga0075364_100357522 | 204 |
| 164 | 3300006175 | Ga0070712_100113199 | Ga0070712_1001131992 | 204 |
| 165 | 3300006175 | Ga0070712_100382203 | Ga0070712_1003822031 | 204 |
| 166 | 3300006177 | Ga0075362_10015128 | Ga0075362_100151284 | 204 |
| 167 | 3300006177 | Ga0075362_10024493 | Ga0075362_100244932 | 204 |
| 168 | 3300006186 | Ga0075369_10024665 | Ga0075369_100246652 | 204 |
| 169 | 3300006186 | Ga0075369_10027262 | Ga0075369_100272621 | 204 |
| 170 | 3300006195 | Ga0075366_10017757 | Ga0075366_100177574 | 204 |
| 171 | 3300006195 | Ga0075366_10043755 | Ga0075366_100437552 | 204 |
| 172 | 3300006358 | Ga0068871_100753460 | Ga0068871_1007534602 | 204 |
| 173 | 3300006844 | Ga0075428_100027553 | Ga0075428_1000275532 | 204 |
| 174 | 3300006844 | Ga0075428_100386688 | Ga0075428_1003866881 | 204 |
| 175 | 3300006844 | Ga0075428_100709193 | Ga0075428_1007091932 | 204 |
| 176 | 3300006846 | Ga0075430_100000011 | Ga0075430_10000001141 | 204 |
| 177 | 3300009094 | Ga0111539_10066402 | Ga0111539_100664024 | 204 |
| 178 | 3300009094 | Ga0111539_10093515 | Ga0111539_100935152 | 204 |
| 179 | 3300009094 | Ga0111539_10233060 | Ga0111539_102330602 | 204 |
| 180 | 3300009147 | Ga0114129_10108623 | Ga0114129_101086233 | 204 |
| 181 | 3300009148 | Ga0105243_10267920 | Ga0105243_102679201 | 204 |
| 182 | 3300009174 | Ga0105241_10856042 | Ga0105241_108560422 | 204 |
| 183 | 3300009553 | Ga0105249_10110065 | Ga0105249_101100653 | 204 |
| 184 | 3300010375 | Ga0105239_10267779 | Ga0105239_102677792 | 204 |
| 185 | 3300011119 | Ga0105246_10123524 | Ga0105246_101235242 | 204 |
| 186 | 3300013306 | Ga0163162_10343712 | Ga0163162_103437122 | 204 |
| 187 | 3300013306 | Ga0163162_10759047 | Ga0163162_107590472 | 204 |
| 188 | 3300013308 | Ga0157375_10318441 | Ga0157375_103184412 | 204 |
| 189 | 3300013308 | Ga0157375_10324001 | Ga0157375_103240013 | 204 |
| 190 | 3300014969 | Ga0157376_10258346 | Ga0157376_102583462 | 204 |
| 191 | 3300025901 | Ga0207688_10177139 | Ga0207688_101771392 | 204 |
| 192 | 3300025907 | Ga0207645_10380165 | Ga0207645_103801652 | 204 |
| 193 | 3300025908 | Ga0207643_10082041 | Ga0207643_100820412 | 204 |
| 194 | 3300025923 | Ga0207681_10032505 | Ga0207681_100325052 | 204 |
| 195 | 3300025928 | Ga0207700_10793565 | Ga0207700_107935651 | 204 |
| 196 | 3300025933 | Ga0207706_10099363 | Ga0207706_100993632 | 204 |
| 197 | 3300025942 | Ga0207689_10179655 | Ga0207689_101796552 | 204 |
| 198 | 3300025960 | Ga0207651_10207194 | Ga0207651_102071942 | 204 |
| 199 | 3300025961 | Ga0207712_10149273 | Ga0207712_101492732 | 204 |
| 200 | 3300025972 | Ga0207668_10058457 | Ga0207668_100584573 | 204 |
| 201 | 3300025972 | Ga0207668_10138270 | Ga0207668_101382702 | 204 |
| 202 | 3300026067 | Ga0207678_10065630 | Ga0207678_100656302 | 204 |
| 203 | 3300026121 | Ga0207683_10389014 | Ga0207683_103890142 | 204 |
| 204 | 3300028379 | Ga0268266_10099297 | Ga0268266_100992972 | 204 |
| 205 | 3300028380 | Ga0268265_10541348 | Ga0268265_105413482 | 204 |
| 206 | 3300028794 | Ga0307515_10307996 | Ga0307515_103079962 | 204 |
| 207 | 3300031507 | Ga0307509_10141941 | Ga0307509_101419412 | 204 |
| 208 | 3300032126 | Ga0307415_100143933 | Ga0307415_1001439333 | 204 |
| 209 | 3300033180 | Ga0307510_10028469 | Ga0307510_100284694 | 204 |
| 210 | 3300037068 | Ga0373925_0863838 | Ga0373925_0863838_117_734 | 204 |
| 211 | 3300041413 | Ga0439465_0176637 | Ga0439465_0176637_103_720 | 204 |
| 212 | 3300046452 | Ga0495617_079479 | Ga0495617_079479_91_708 | 204 |
| 213 | 3300046455 | Ga0495603_0026989 | Ga0495603_0026989_2512_3129 | 204 |
| 214 | 3300046460 | Ga0495638_0316536 | Ga0495638_0316536_65_682 | 204 |
| 215 | 3300046492 | Ga0495585_0073242 | Ga0495585_0073242_597_1214 | 204 |
| 216 | 3300046506 | Ga0495583_0020981 | Ga0495583_0020981_132_749 | 204 |
| 217 | 3300046513 | Ga0495616_0211269 | Ga0495616_0211269_105_722 | 204 |
| 218 | 3300046518 | Ga0495631_0152386 | Ga0495631_0152386_158_775 | 204 |
| 219 | 3300046519 | Ga0495632_0080940 | Ga0495632_0080940_758_1375 | 204 |
| 220 | 3300046537 | Ga0495598_0003289 | Ga0495598_0003289_2533_3150 | 204 |
| 221 | 3300046542 | Ga0495597_0071280 | Ga0495597_0071280_201_818 | 204 |
| 222 | 3300046557 | Ga0495622_0043467 | Ga0495622_0043467_80_697 | 204 |
| 223 | 3300046615 | Ga0495656_0019409 | Ga0495656_0019409_802_1419 | 204 |
| 224 | 3300046660 | Ga0495625_0268164 | Ga0495625_0268164_138_755 | 204 |
| 225 | 3300046664 | Ga0495659_0025182 | Ga0495659_0025182_592_1209 | 204 |
| 226 | 3300046674 | Ga0495588_0259057 | Ga0495588_0259057_124_741 | 204 |
| 227 | 3300046684 | Ga0495669_0083595 | Ga0495669_0083595_500_1117 | 204 |
| 228 | 3300046694 | Ga0495649_0204497 | Ga0495649_0204497_91_708 | 204 |
| 229 | 3300048903 | Ga0496100_0484123 | Ga0496100_0484123_236_853 | 204 |
| 230 | 3300048907 | Ga0496104_0092517 | Ga0496104_0092517_595_1212 | 204 |
| 231 | 3300048910 | Ga0496107_0609139 | Ga0496107_0609139_138_755 | 204 |
| 232 | 3300048911 | Ga0496108_0106283 | Ga0496108_0106283_933_1550 | 204 |
| 233 | 3300048918 | Ga0496115_0100759 | Ga0496115_0100759_1125_1742 | 204 |
| 234 | 3300048925 | Ga0496122_0271275 | Ga0496122_0271275_274_891 | 204 |
| 235 | 3300048929 | Ga0496126_0049295 | Ga0496126_0049295_2946_3563 | 204 |
| 236 | 3300049460 | Ga0495682_0050261 | Ga0495682_0050261_699_1316 | 204 |
| 237 | 3300050493 | nmdc:mga0k408_81378_c1 | nmdc:mga0k408_81378_c1_823_1440 | 204 |
| 238 | 3300050509 | nmdc:mga0qj67_461_c1 | nmdc:mga0qj67_461_c1_9886_10500 | 204 |
| 239 | 3300050511 | nmdc:mga08y16_12119_c1 | nmdc:mga08y16_12119_c1_8261_8875 | 204 |
| 240 | 3300050516 | nmdc:mga0sz30_34393_c1 | nmdc:mga0sz30_34393_c1_149_766 | 204 |
| 241 | 3300053092 | Ga0500583_0326167 | Ga0500583_0326167_48_665 | 204 |
| 242 | 3300053134 | Ga0500658_0038711 | Ga0500658_0038711_1123_1740 | 204 |
| 243 | 3300053147 | Ga0500589_149229 | Ga0500589_149229_61_678 | 204 |
| 244 | iso_pu_bacteria | 2528768022 | 2528853294 | 204 |
| 245 | iso_pu_bacteria | 2824600985 | 2824604248 | 204 |
| 246 | iso_pu_bacteria | 2824609381 | 2824614279 | 204 |
| 247 | iso_pu_bacteria | 2824653114 | 2824658331 | 204 |
| 248 | iso_pu_bacteria | 2888419890 | 2888421568 | 204 |
| 249 | iso_pu_bacteria | 2929624759 | 2929630664 | 204 |
| 250 | iso_pu_bacteria | 2933577622 | 2933584986 | 204 |
| 251 | iso_pu_bacteria | 8055742211 | 8055748819 | 204 |
| 252 | 3300005338 | Ga0068868_100090967 | Ga0068868_1000909672 | 205 |
| 253 | 3300049575 | Ga0501039_0636954 | Ga0501039_0636954_60_743 | 205 |
| 254 | 3300049593 | Ga0501077_0099594 | Ga0501077_0099594_23_706 | 205 |
| 255 | 3300061734 | Ga0530510_0021366 | Ga0530510_0021366_70_753 | 205 |
| 256 | 3300005843 | Ga0068860_100068430 | Ga0068860_1000684302 | 206 |
| 257 | 3300005937 | Ga0081455_10059421 | Ga0081455_100594213 | 206 |
| 258 | 3300026118 | Ga0207675_100310588 | Ga0207675_1003105881 | 206 |
| 259 | 3300028380 | Ga0268265_10925299 | Ga0268265_109252991 | 206 |
| 260 | 3300028381 | Ga0268264_10064242 | Ga0268264_100642422 | 206 |
| 261 | 3300031548 | Ga0307408_100192587 | Ga0307408_1001925872 | 206 |
| 262 | 3300046543 | Ga0495645_0043596 | Ga0495645_0043596_2261_2887 | 206 |
| 263 | 3300046678 | Ga0495599_0087262 | Ga0495599_0087262_579_1205 | 206 |
| 264 | iso_pu_bacteria | 2515154107 | 2515611625 | 206 |
| 265 | iso_pu_bacteria | 2524023207 | 2524449279 | 206 |
| 266 | iso_pu_bacteria | 2921237296 | 2921237444 | 206 |
| 267 | iso_pu_bacteria | 2970047711 | 2970052458 | 206 |
| 268 | iso_pu_bacteria | 2970170962 | 2970171128 | 206 |
| 269 | 3300005329 | Ga0070683_100680301 | Ga0070683_1006803011 | 207 |
| 270 | 3300005334 | Ga0068869_101013595 | Ga0068869_1010135951 | 207 |
| 271 | 3300005335 | Ga0070666_10034818 | Ga0070666_100348182 | 207 |
| 272 | 3300005344 | Ga0070661_100048332 | Ga0070661_1000483322 | 207 |
| 273 | 3300005354 | Ga0070675_100129112 | Ga0070675_1001291122 | 207 |
| 274 | 3300005356 | Ga0070674_100922225 | Ga0070674_1009222251 | 207 |
| 275 | 3300005364 | Ga0070673_100290518 | Ga0070673_1002905182 | 207 |
| 276 | 3300005366 | Ga0070659_100137422 | Ga0070659_1001374222 | 207 |
| 277 | 3300005434 | Ga0070709_10243272 | Ga0070709_102432722 | 207 |
| 278 | 3300005435 | Ga0070714_100527447 | Ga0070714_1005274472 | 207 |
| 279 | 3300005436 | Ga0070713_100026963 | Ga0070713_1000269632 | 207 |
| 280 | 3300005456 | Ga0070678_100056415 | Ga0070678_1000564152 | 207 |
| 281 | 3300005536 | Ga0070697_100109874 | Ga0070697_1001098742 | 207 |
| 282 | 3300005545 | Ga0070695_100109485 | Ga0070695_1001094852 | 207 |
| 283 | 3300005547 | Ga0070693_100270705 | Ga0070693_1002707052 | 207 |
| 284 | 3300005578 | Ga0068854_100299382 | Ga0068854_1002993822 | 207 |
| 285 | 3300006028 | Ga0070717_10493808 | Ga0070717_104938082 | 207 |
| 286 | 3300006163 | Ga0070715_10187569 | Ga0070715_101875691 | 207 |
| 287 | 3300006175 | Ga0070712_100088974 | Ga0070712_1000889744 | 207 |
| 288 | 3300006237 | Ga0097621_100043206 | Ga0097621_1000432062 | 207 |
| 289 | 3300006358 | Ga0068871_100032239 | Ga0068871_1000322395 | 207 |
| 290 | 3300009098 | Ga0105245_10127180 | Ga0105245_101271804 | 207 |
| 291 | 3300009098 | Ga0105245_10595304 | Ga0105245_105953042 | 207 |
| 292 | 3300009176 | Ga0105242_10052200 | Ga0105242_100522004 | 207 |
| 293 | 3300009177 | Ga0105248_10448799 | Ga0105248_104487992 | 207 |
| 294 | 3300009545 | Ga0105237_10144737 | Ga0105237_101447374 | 207 |
| 295 | 3300009551 | Ga0105238_10275498 | Ga0105238_102754982 | 207 |
| 296 | 3300013100 | Ga0157373_10122481 | Ga0157373_101224812 | 207 |
| 297 | 3300013296 | Ga0157374_10277022 | Ga0157374_102770222 | 207 |
| 298 | 3300013306 | Ga0163162_10607519 | Ga0163162_106075191 | 207 |
| 299 | 3300014326 | Ga0157380_10286160 | Ga0157380_102861601 | 207 |
| 300 | 3300014969 | Ga0157376_10169805 | Ga0157376_101698052 | 207 |
| 301 | 3300025900 | Ga0207710_10104458 | Ga0207710_101044582 | 207 |
| 302 | 3300025914 | Ga0207671_10163052 | Ga0207671_101630522 | 207 |
| 303 | 3300025915 | Ga0207693_10058154 | Ga0207693_100581544 | 207 |
| 304 | 3300025924 | Ga0207694_10185136 | Ga0207694_101851362 | 207 |
| 305 | 3300025927 | Ga0207687_10058667 | Ga0207687_100586672 | 207 |
| 306 | 3300025928 | Ga0207700_10067946 | Ga0207700_100679463 | 207 |
| 307 | 3300025929 | Ga0207664_10170356 | Ga0207664_101703562 | 207 |
| 308 | 3300025931 | Ga0207644_10047828 | Ga0207644_100478282 | 207 |
| 309 | 3300025932 | Ga0207690_10109796 | Ga0207690_101097963 | 207 |
| 310 | 3300025933 | Ga0207706_10013231 | Ga0207706_100132316 | 207 |
| 311 | 3300025934 | Ga0207686_10024689 | Ga0207686_100246892 | 207 |
| 312 | 3300025937 | Ga0207669_10234658 | Ga0207669_102346582 | 207 |
| 313 | 3300025939 | Ga0207665_10152493 | Ga0207665_101524933 | 207 |
| 314 | 3300025945 | Ga0207679_10293780 | Ga0207679_102937801 | 207 |
| 315 | 3300025960 | Ga0207651_10316088 | Ga0207651_103160882 | 207 |
| 316 | 3300025986 | Ga0207658_10074280 | Ga0207658_100742802 | 207 |
| 317 | 3300026067 | Ga0207678_10222487 | Ga0207678_102224872 | 207 |
| 318 | 3300026121 | Ga0207683_10031636 | Ga0207683_100316363 | 207 |
| 319 | 3300028379 | Ga0268266_11239572 | Ga0268266_112395721 | 207 |
| 320 | 3300031824 | Ga0307413_10023977 | Ga0307413_100239773 | 207 |
| 321 | 3300031995 | Ga0307409_100559873 | Ga0307409_1005598731 | 207 |
| 322 | 3300035086 | Ga0373934_0008308 | Ga0373934_0008308_1719_2342 | 207 |
| 323 | 3300035111 | Ga0373923_0013462 | Ga0373923_0013462_393_1016 | 207 |
| 324 | 3300035117 | Ga0373953_0017859 | Ga0373953_0017859_711_1334 | 207 |
| 325 | 3300035118 | Ga0373954_0010963 | Ga0373954_0010963_2562_3185 | 207 |
| 326 | 3300035119 | Ga0373956_0004865 | Ga0373956_0004865_1339_1962 | 207 |
| 327 | 3300035172 | Ga0373955_0001327 | Ga0373955_0001327_9144_9767 | 207 |
| 328 | 3300035410 | Ga0373924_0084664 | Ga0373924_0084664_129_752 | 207 |
| 329 | 3300035724 | Ga0373933_0017691 | Ga0373933_0017691_2552_3175 | 207 |
| 330 | 3300036401 | Ga0373937_0009181 | Ga0373937_0009181_1192_1815 | 207 |
| 331 | 3300046454 | Ga0495592_0086424 | Ga0495592_0086424_696_1319 | 207 |
| 332 | 3300046462 | Ga0495651_0016582 | Ga0495651_0016582_1926_2549 | 207 |
| 333 | 3300046463 | Ga0495653_0018024 | Ga0495653_0018024_3150_3773 | 207 |
| 334 | 3300046477 | Ga0495664_0009662 | Ga0495664_0009662_3522_4145 | 207 |
| 335 | 3300046511 | Ga0495608_0000688 | Ga0495608_0000688_10284_10907 | 207 |
| 336 | 3300046514 | Ga0495618_0002700 | Ga0495618_0002700_3130_3753 | 207 |
| 337 | 3300046516 | Ga0495628_0023438 | Ga0495628_0023438_940_1563 | 207 |
| 338 | 3300046517 | Ga0495630_0077429 | Ga0495630_0077429_1416_2039 | 207 |
| 339 | 3300046529 | Ga0495652_0011434 | Ga0495652_0011434_3633_4256 | 207 |
| 340 | 3300046533 | Ga0495640_0035222 | Ga0495640_0035222_1350_1973 | 207 |
| 341 | 3300046536 | Ga0495587_0000534 | Ga0495587_0000534_13137_13760 | 207 |
| 342 | 3300046543 | Ga0495645_0001860 | Ga0495645_0001860_814_1437 | 207 |
| 343 | 3300046559 | Ga0495667_0000771 | Ga0495667_0000771_7060_7683 | 207 |
| 344 | 3300046642 | Ga0495634_0047044 | Ga0495634_0047044_1374_1997 | 207 |
| 345 | 3300046663 | Ga0495635_0003284 | Ga0495635_0003284_2502_3125 | 207 |
| 346 | 3300046675 | Ga0495657_0001333 | Ga0495657_0001333_7071_7694 | 207 |
| 347 | 3300046678 | Ga0495599_0090822 | Ga0495599_0090822_343_966 | 207 |
| 348 | 3300046679 | Ga0495623_0000354 | Ga0495623_0000354_13139_13762 | 207 |
| 349 | 3300046680 | Ga0495646_0004095 | Ga0495646_0004095_7828_8451 | 207 |
| 350 | 3300046683 | Ga0495658_0027655 | Ga0495658_0027655_745_1368 | 207 |
| 351 | 3300046809 | Ga0495600_0001299 | Ga0495600_0001299_297_920 | 207 |
| 352 | 3300047317 | Ga0495604_0003048 | Ga0495604_0003048_6750_7373 | 207 |
| 353 | 3300047318 | Ga0495636_0019523 | Ga0495636_0019523_1684_2310 | 207 |
| 354 | 3300047319 | Ga0495674_0003671 | Ga0495674_0003671_6768_7391 | 207 |
| 355 | 3300047322 | Ga0495680_0024262 | Ga0495680_0024262_2406_3029 | 207 |
| 356 | 3300047444 | Ga0495675_0000892 | Ga0495675_0000892_16696_17319 | 207 |
| 357 | 3300047471 | Ga0495684_0027435 | Ga0495684_0027435_2820_3443 | 207 |
| 358 | 3300047673 | Ga0495593_0040189 | Ga0495593_0040189_1815_2438 | 207 |
| 359 | 3300048088 | Ga0495602_0004679 | Ga0495602_0004679_1170_1793 | 207 |
| 360 | 3300048903 | Ga0496100_0077681 | Ga0496100_0077681_1308_1931 | 207 |
| 361 | 3300048904 | Ga0496101_0003150 | Ga0496101_0003150_8472_9095 | 207 |
| 362 | 3300048905 | Ga0496102_0013897 | Ga0496102_0013897_5748_6371 | 207 |
| 363 | 3300048906 | Ga0496103_0079993 | Ga0496103_0079993_1189_1812 | 207 |
| 364 | 3300048907 | Ga0496104_0033611 | Ga0496104_0033611_771_1394 | 207 |
| 365 | 3300048910 | Ga0496107_0013677 | Ga0496107_0013677_3644_4267 | 207 |
| 366 | 3300048911 | Ga0496108_0261326 | Ga0496108_0261326_13_636 | 207 |
| 367 | 3300048912 | Ga0496109_0164387 | Ga0496109_0164387_411_1034 | 207 |
| 368 | 3300048915 | Ga0496112_0451689 | Ga0496112_0451689_315_938 | 207 |
| 369 | 3300048917 | Ga0496114_0016176 | Ga0496114_0016176_1562_2185 | 207 |
| 370 | 3300048918 | Ga0496115_0154440 | Ga0496115_0154440_1120_1743 | 207 |
| 371 | 3300049742 | Ga0501080_0354333 | Ga0501080_0354333_268_912 | 207 |
| 372 | 3300049743 | Ga0501081_0145530 | Ga0501081_0145530_779_1423 | 207 |
| 373 | 3300049823 | Ga0501044_0000315 | Ga0501044_0000315_55144_55770 | 207 |
| 374 | 3300053077 | Ga0495601_0001707 | Ga0495601_0001707_4625_5248 | 207 |
| 375 | 3300053078 | Ga0495612_0004071 | Ga0495612_0004071_1496_2119 | 207 |
| 376 | 3300053084 | Ga0495595_0000615 | Ga0495595_0000615_739_1362 | 207 |
| 377 | 3300053085 | Ga0495619_0016558 | Ga0495619_0016558_1707_2330 | 207 |
| 378 | 3300005331 | Ga0070670_100592767 | Ga0070670_1005927672 | 208 |
| 379 | 3300005347 | Ga0070668_100161598 | Ga0070668_1001615982 | 208 |
| 380 | 3300005347 | Ga0070668_100321860 | Ga0070668_1003218601 | 208 |
| 381 | 3300005355 | Ga0070671_100144079 | Ga0070671_1001440792 | 208 |
| 382 | 3300005615 | Ga0070702_100167479 | Ga0070702_1001674792 | 208 |
| 383 | 3300005841 | Ga0068863_100257913 | Ga0068863_1002579132 | 208 |
| 384 | 3300005937 | Ga0081455_10015289 | Ga0081455_100152894 | 208 |
| 385 | 3300005983 | Ga0081540_1109864 | Ga0081540_11098642 | 208 |
| 386 | 3300006038 | Ga0075365_10032152 | Ga0075365_100321524 | 208 |
| 387 | 3300006038 | Ga0075365_10156361 | Ga0075365_101563611 | 208 |
| 388 | 3300006195 | Ga0075366_10275493 | Ga0075366_102754932 | 208 |
| 389 | 3300006237 | Ga0097621_100113776 | Ga0097621_1001137762 | 208 |
| 390 | 3300009093 | Ga0105240_10412227 | Ga0105240_104122271 | 208 |
| 391 | 3300009551 | Ga0105238_10096781 | Ga0105238_100967812 | 208 |
| 392 | 3300013308 | Ga0157375_10531921 | Ga0157375_105319212 | 208 |
| 393 | 3300021384 | Ga0213876_10047611 | Ga0213876_100476112 | 208 |
| 394 | 3300021388 | Ga0213875_10001022 | Ga0213875_1000102210 | 208 |
| 395 | 3300025297 | Ga0209758_1049818 | Ga0209758_10498181 | 208 |
| 396 | 3300025915 | Ga0207693_10075248 | Ga0207693_100752482 | 208 |
| 397 | 3300025925 | Ga0207650_10502015 | Ga0207650_105020151 | 208 |
| 398 | 3300025940 | Ga0207691_10251467 | Ga0207691_102514671 | 208 |
| 399 | 3300026088 | Ga0207641_10091654 | Ga0207641_100916542 | 208 |
| 400 | 3300028380 | Ga0268265_10280447 | Ga0268265_102804472 | 208 |
| 401 | 3300034816 | Ga0373930_0010291 | Ga0373930_0010291_300_926 | 208 |
| 402 | 3300035113 | Ga0373936_0221720 | Ga0373936_0221720_40_666 | 208 |
| 403 | 3300035114 | Ga0373939_0018099 | Ga0373939_0018099_163_789 | 208 |
| 404 | 3300035171 | Ga0373946_0016087 | Ga0373946_0016087_1912_2538 | 208 |
| 405 | 3300035241 | Ga0373961_0135741 | Ga0373961_0135741_13_639 | 208 |
| 406 | 3300035691 | Ga0373931_0058402 | Ga0373931_0058402_768_1394 | 208 |
| 407 | 3300035695 | Ga0373927_0018418 | Ga0373927_0018418_1936_2562 | 208 |
| 408 | 3300035725 | Ga0373947_0028164 | Ga0373947_0028164_866_1492 | 208 |
| 409 | 3300036401 | Ga0373937_0177070 | Ga0373937_0177070_1347_1973 | 208 |
| 410 | 3300037068 | Ga0373925_0506638 | Ga0373925_0506638_117_743 | 208 |
| 411 | 3300037853 | Ga0436364_0910105 | Ga0436364_0910105_11534_12163 | 208 |
| 412 | 3300039437 | Ga0436365_1803148 | Ga0436365_1803148_1608_2237 | 208 |
| 413 | 3300046455 | Ga0495603_0001480 | Ga0495603_0001480_8424_9050 | 208 |
| 414 | 3300046459 | Ga0495629_0011542 | Ga0495629_0011542_4634_5260 | 208 |
| 415 | 3300046461 | Ga0495641_0020479 | Ga0495641_0020479_1637_2263 | 208 |
| 416 | 3300046473 | Ga0495582_0001176 | Ga0495582_0001176_5940_6566 | 208 |
| 417 | 3300046475 | Ga0495639_0002484 | Ga0495639_0002484_3821_4447 | 208 |
| 418 | 3300046476 | Ga0495662_0004481 | Ga0495662_0004481_4635_5261 | 208 |
| 419 | 3300046477 | Ga0495664_0138755 | Ga0495664_0138755_118_744 | 208 |
| 420 | 3300046499 | Ga0495594_0008519 | Ga0495594_0008519_1109_1735 | 208 |
| 421 | 3300046516 | Ga0495628_0081037 | Ga0495628_0081037_920_1546 | 208 |
| 422 | 3300046517 | Ga0495630_0014202 | Ga0495630_0014202_4711_5337 | 208 |
| 423 | 3300046526 | Ga0495666_0044191 | Ga0495666_0044191_471_1097 | 208 |
| 424 | 3300046531 | Ga0495665_0002695 | Ga0495665_0002695_3007_3633 | 208 |
| 425 | 3300046533 | Ga0495640_0013114 | Ga0495640_0013114_1492_2118 | 208 |
| 426 | 3300046557 | Ga0495622_0060544 | Ga0495622_0060544_46_672 | 208 |
| 427 | 3300046559 | Ga0495667_0014884 | Ga0495667_0014884_3558_4184 | 208 |
| 428 | 3300046616 | Ga0495668_0390015 | Ga0495668_0390015_56_682 | 208 |
| 429 | 3300046642 | Ga0495634_0011864 | Ga0495634_0011864_2033_2659 | 208 |
| 430 | 3300046675 | Ga0495657_0284048 | Ga0495657_0284048_160_786 | 208 |
| 431 | 3300046678 | Ga0495599_0055821 | Ga0495599_0055821_594_1220 | 208 |
| 432 | 3300046681 | Ga0495647_0029475 | Ga0495647_0029475_296_922 | 208 |
| 433 | 3300046683 | Ga0495658_0026428 | Ga0495658_0026428_2298_2924 | 208 |
| 434 | 3300046690 | Ga0495624_0002092 | Ga0495624_0002092_12453_13079 | 208 |
| 435 | 3300047315 | Ga0495581_0003049 | Ga0495581_0003049_4616_5242 | 208 |
| 436 | 3300047317 | Ga0495604_0370935 | Ga0495604_0370935_67_693 | 208 |
| 437 | 3300047319 | Ga0495674_0019619 | Ga0495674_0019619_4587_5213 | 208 |
| 438 | 3300047322 | Ga0495680_0508285 | Ga0495680_0508285_20_646 | 208 |
| 439 | 3300047469 | Ga0495673_0086286 | Ga0495673_0086286_470_1096 | 208 |
| 440 | 3300047471 | Ga0495684_0063404 | Ga0495684_0063404_1569_2195 | 208 |
| 441 | 3300047673 | Ga0495593_0002569 | Ga0495593_0002569_4352_4978 | 208 |
| 442 | 3300048089 | Ga0495614_0023650 | Ga0495614_0023650_235_861 | 208 |
| 443 | 3300048904 | Ga0496101_0487180 | Ga0496101_0487180_69_695 | 208 |
| 444 | 3300048909 | Ga0496106_0670576 | Ga0496106_0670576_54_680 | 208 |
| 445 | 3300048918 | Ga0496115_0141919 | Ga0496115_0141919_279_935 | 208 |
| 446 | 3300049577 | Ga0501041_0588558 | Ga0501041_0588558_53_682 | 208 |
| 447 | 3300050492 | nmdc:mga0yw44_77285_c1 | nmdc:mga0yw44_77285_c1_948_1574 | 208 |
| 448 | 3300050507 | nmdc:mga05p37_1224635_c1 | nmdc:mga05p37_1224635_c1_129_755 | 208 |
| 449 | 3300061734 | Ga0530510_0471909 | Ga0530510_0471909_205_834 | 208 |
| 450 | 3300005439 | Ga0070711_100105550 | Ga0070711_1001055503 | 209 |
| 451 | 3300005468 | Ga0070707_100001635 | Ga0070707_1000016359 | 209 |
| 452 | 3300005468 | Ga0070707_100778021 | Ga0070707_1007780212 | 209 |
| 453 | 3300006846 | Ga0075430_100116198 | Ga0075430_1001161983 | 209 |
| 454 | 3300006852 | Ga0075433_10228811 | Ga0075433_102288112 | 209 |
| 455 | 3300006871 | Ga0075434_100056523 | Ga0075434_1000565234 | 209 |
| 456 | 3300006871 | Ga0075434_100252847 | Ga0075434_1002528472 | 209 |
| 457 | 3300007076 | Ga0075435_100120223 | Ga0075435_1001202233 | 209 |
| 458 | 3300007076 | Ga0075435_100204567 | Ga0075435_1002045672 | 209 |
| 459 | 3300014969 | Ga0157376_10043248 | Ga0157376_100432483 | 209 |
| 460 | 3300025916 | Ga0207663_10119293 | Ga0207663_101192932 | 209 |
| 461 | 3300025922 | Ga0207646_10783717 | Ga0207646_107837171 | 209 |
| 462 | 3300031249 | Ga0265339_10019194 | Ga0265339_100191943 | 209 |
| 463 | 3300031711 | Ga0265314_10001316 | Ga0265314_100013163 | 209 |
| 464 | 3300046459 | Ga0495629_0113663 | Ga0495629_0113663_214_843 | 209 |
| 465 | 3300046529 | Ga0495652_0209603 | Ga0495652_0209603_458_1087 | 209 |
| 466 | 3300046533 | Ga0495640_0057166 | Ga0495640_0057166_781_1410 | 209 |
| 467 | 3300046680 | Ga0495646_0142667 | Ga0495646_0142667_343_972 | 209 |
| 468 | 3300047319 | Ga0495674_0129891 | Ga0495674_0129891_1100_1729 | 209 |
| 469 | 3300047471 | Ga0495684_0394881 | Ga0495684_0394881_54_683 | 209 |
| 470 | 3300048903 | Ga0496100_0036216 | Ga0496100_0036216_1680_2309 | 209 |
| 471 | 3300048907 | Ga0496104_0452160 | Ga0496104_0452160_557_1186 | 209 |
| 472 | 3300048910 | Ga0496107_0298937 | Ga0496107_0298937_222_851 | 209 |
| 473 | 3300048912 | Ga0496109_0473347 | Ga0496109_0473347_327_956 | 209 |
| 474 | 3300048917 | Ga0496114_0036286 | Ga0496114_0036286_719_1348 | 209 |
| 475 | 3300049578 | Ga0501042_0298408 | Ga0501042_0298408_88_723 | 209 |
| 476 | 3300049578 | Ga0501042_0679358 | Ga0501042_0679358_45_692 | 209 |
| 477 | 3300049582 | Ga0501048_0533143 | Ga0501048_0533143_170_805 | 209 |
| 478 | 3300049588 | Ga0501072_0278698 | Ga0501072_0278698_462_1097 | 209 |
| 479 | 3300049592 | Ga0501076_0278271 | Ga0501076_0278271_661_1296 | 209 |
| 480 | 3300049741 | Ga0501079_0251887 | Ga0501079_0251887_551_1186 | 209 |
| 481 | 3300049743 | Ga0501081_0059079 | Ga0501081_0059079_880_1515 | 209 |
| 482 | 3300050509 | nmdc:mga0qj67_326191_c1 | nmdc:mga0qj67_326191_c1_552_1199 | 209 |
| 483 | 3300050509 | nmdc:mga0qj67_62190_c1 | nmdc:mga0qj67_62190_c1_308_937 | 209 |
| 484 | 3300050513 | nmdc:mga0rr50_145611_c1 | nmdc:mga0rr50_145611_c1_633_1262 | 209 |
| 485 | 3300050513 | nmdc:mga0rr50_27845_c1 | nmdc:mga0rr50_27845_c1_2310_2939 | 209 |
| 486 | 3300050515 | nmdc:mga0a205_276102_c1 | nmdc:mga0a205_276102_c1_59_688 | 209 |
| 487 | 3300053077 | Ga0495601_0040192 | Ga0495601_0040192_1106_1735 | 209 |
| 488 | 3300053085 | Ga0495619_0031475 | Ga0495619_0031475_1710_2339 | 209 |
| 489 | 3300053085 | Ga0495619_0311662 | Ga0495619_0311662_229_858 | 209 |
| 490 | 3300054114 | Ga0501084_0020383 | Ga0501084_0020383_3370_4017 | 209 |
| 491 | 3300054114 | Ga0501084_0109934 | Ga0501084_0109934_145_780 | 209 |
| 492 | 3300060353 | Ga0501082_0366794 | Ga0501082_0366794_192_827 | 209 |
| 493 | 3300061734 | Ga0530510_0072772 | Ga0530510_0072772_1397_2032 | 209 |
| 494 | 2209111006 | 2214628275 | 2213659747 | 210 |
| 495 | 3300000041 | ARcpr5oldR_c000250 | ARcpr5oldR_0002504 | 210 |
| 496 | 3300000042 | ARSoilYngRDRAFT_c00208 | ARSoilYngRDRAFT_002084 | 210 |
| 497 | 3300000043 | ARcpr5yngRDRAFT_c000678 | ARcpr5yngRDRAFT_0006784 | 210 |
| 498 | 3300000044 | ARSoilOldRDRAFT_c000174 | ARSoilOldRDRAFT_0001749 | 210 |
| 499 | 3300000045 | ARCol0oldRDRAFT_c01338 | ARCol0oldRDRAFT_013382 | 210 |
| 500 | 3300000652 | ARCol0yngRDRAFT_1000170 | ARCol0yngRDRAFT_10001709 | 210 |
| 501 | 3300001989 | JGI24739J22299_10002749 | JGI24739J22299_100027495 | 210 |
| 502 | 3300001990 | JGI24737J22298_10004199 | JGI24737J22298_100041992 | 210 |
| 503 | 3300001991 | JGI24743J22301_10021848 | JGI24743J22301_100218482 | 210 |
| 504 | 3300002070 | JGI24750J21931_1000010 | JGI24750J21931_100001023 | 210 |
| 505 | 3300002073 | JGI24745J21846_1000735 | JGI24745J21846_10007352 | 210 |
| 506 | 3300002075 | JGI24738J21930_10000125 | JGI24738J21930_1000012511 | 210 |
| 507 | 3300002077 | JGI24744J21845_10002950 | JGI24744J21845_100029503 | 210 |
| 508 | 3300002126 | JGI24035J26624_1000050 | JGI24035J26624_10000502 | 210 |
| 509 | 3300002155 | JGI24033J26618_1004385 | JGI24033J26618_10043852 | 210 |
| 510 | 3300002239 | JGI24034J26672_10000156 | JGI24034J26672_1000015611 | 210 |
| 511 | 3300002244 | JGI24742J22300_10000121 | JGI24742J22300_100001214 | 210 |
| 512 | 3300002459 | JGI24751J29686_10005039 | JGI24751J29686_100050392 | 210 |
| 513 | 3300003911 | JGI25405J52794_10007928 | JGI25405J52794_100079282 | 210 |
| 514 | 3300005276 | Ga0065717_1003254 | Ga0065717_10032542 | 210 |
| 515 | 3300005289 | Ga0065704_10080809 | Ga0065704_100808092 | 210 |
| 516 | 3300005293 | Ga0065715_10006737 | Ga0065715_100067371 | 210 |
| 517 | 3300005293 | Ga0065715_10089962 | Ga0065715_100899624 | 210 |
| 518 | 3300005293 | Ga0065715_10099237 | Ga0065715_100992374 | 210 |
| 519 | 3300005295 | Ga0065707_10341838 | Ga0065707_103418381 | 210 |
| 520 | 3300005328 | Ga0070676_10002283 | Ga0070676_100022835 | 210 |
| 521 | 3300005329 | Ga0070683_100000132 | Ga0070683_10000013240 | 210 |
| 522 | 3300005329 | Ga0070683_100126298 | Ga0070683_1001262982 | 210 |
| 523 | 3300005329 | Ga0070683_100674259 | Ga0070683_1006742591 | 210 |
| 524 | 3300005330 | Ga0070690_100003321 | Ga0070690_1000033215 | 210 |
| 525 | 3300005330 | Ga0070690_100012804 | Ga0070690_1000128043 | 210 |
| 526 | 3300005330 | Ga0070690_100083497 | Ga0070690_1000834971 | 210 |
| 527 | 3300005331 | Ga0070670_100009102 | Ga0070670_1000091025 | 210 |
| 528 | 3300005331 | Ga0070670_100033434 | Ga0070670_1000334347 | 210 |
| 529 | 3300005331 | Ga0070670_100589944 | Ga0070670_1005899442 | 210 |
| 530 | 3300005333 | Ga0070677_10000355 | Ga0070677_1000035512 | 210 |
| 531 | 3300005334 | Ga0068869_100000063 | Ga0068869_10000006340 | 210 |
| 532 | 3300005334 | Ga0068869_100275665 | Ga0068869_1002756651 | 210 |
| 533 | 3300005335 | Ga0070666_10014429 | Ga0070666_100144292 | 210 |
| 534 | 3300005335 | Ga0070666_10193739 | Ga0070666_101937392 | 210 |
| 535 | 3300005335 | Ga0070666_10522500 | Ga0070666_105225001 | 210 |
| 536 | 3300005336 | Ga0070680_100000702 | Ga0070680_10000070210 | 210 |
| 537 | 3300005336 | Ga0070680_100359636 | Ga0070680_1003596362 | 210 |
| 538 | 3300005337 | Ga0070682_100006330 | Ga0070682_1000063302 | 210 |
| 539 | 3300005337 | Ga0070682_100020616 | Ga0070682_1000206162 | 210 |
| 540 | 3300005337 | Ga0070682_100022247 | Ga0070682_1000222474 | 210 |
| 541 | 3300005338 | Ga0068868_100000190 | Ga0068868_1000001903 | 210 |
| 542 | 3300005339 | Ga0070660_100000136 | Ga0070660_1000001365 | 210 |
| 543 | 3300005339 | Ga0070660_100028048 | Ga0070660_1000280482 | 210 |
| 544 | 3300005340 | Ga0070689_100011293 | Ga0070689_1000112932 | 210 |
| 545 | 3300005340 | Ga0070689_100142576 | Ga0070689_1001425761 | 210 |
| 546 | 3300005341 | Ga0070691_10004223 | Ga0070691_100042235 | 210 |
| 547 | 3300005341 | Ga0070691_10149361 | Ga0070691_101493612 | 210 |
| 548 | 3300005343 | Ga0070687_100000483 | Ga0070687_10000048310 | 210 |
| 549 | 3300005343 | Ga0070687_100003914 | Ga0070687_1000039144 | 210 |
| 550 | 3300005344 | Ga0070661_100009808 | Ga0070661_1000098085 | 210 |
| 551 | 3300005344 | Ga0070661_100257764 | Ga0070661_1002577642 | 210 |
| 552 | 3300005345 | Ga0070692_10000027 | Ga0070692_100000275 | 210 |
| 553 | 3300005345 | Ga0070692_10035062 | Ga0070692_100350623 | 210 |
| 554 | 3300005345 | Ga0070692_10225720 | Ga0070692_102257202 | 210 |
| 555 | 3300005347 | Ga0070668_100004099 | Ga0070668_10000409912 | 210 |
| 556 | 3300005347 | Ga0070668_100142804 | Ga0070668_1001428042 | 210 |
| 557 | 3300005347 | Ga0070668_100153394 | Ga0070668_1001533942 | 210 |
| 558 | 3300005353 | Ga0070669_100001142 | Ga0070669_10000114212 | 210 |
| 559 | 3300005354 | Ga0070675_100005715 | Ga0070675_1000057152 | 210 |
| 560 | 3300005354 | Ga0070675_100390028 | Ga0070675_1003900282 | 210 |
| 561 | 3300005355 | Ga0070671_100001137 | Ga0070671_1000011378 | 210 |
| 562 | 3300005356 | Ga0070674_100004133 | Ga0070674_1000041335 | 210 |
| 563 | 3300005356 | Ga0070674_100057838 | Ga0070674_1000578382 | 210 |
| 564 | 3300005356 | Ga0070674_100868451 | Ga0070674_1008684511 | 210 |
| 565 | 3300005364 | Ga0070673_100013640 | Ga0070673_1000136402 | 210 |
| 566 | 3300005364 | Ga0070673_100859085 | Ga0070673_1008590851 | 210 |
| 567 | 3300005365 | Ga0070688_100002215 | Ga0070688_1000022155 | 210 |
| 568 | 3300005365 | Ga0070688_100034652 | Ga0070688_1000346522 | 210 |
| 569 | 3300005365 | Ga0070688_100226420 | Ga0070688_1002264202 | 210 |
| 570 | 3300005366 | Ga0070659_100004635 | Ga0070659_1000046352 | 210 |
| 571 | 3300005366 | Ga0070659_100009448 | Ga0070659_1000094484 | 210 |
| 572 | 3300005367 | Ga0070667_100001898 | Ga0070667_10000189816 | 210 |
| 573 | 3300005367 | Ga0070667_100060787 | Ga0070667_1000607871 | 210 |
| 574 | 3300005367 | Ga0070667_100195769 | Ga0070667_1001957692 | 210 |
| 575 | 3300005406 | Ga0070703_10033415 | Ga0070703_100334152 | 210 |
| 576 | 3300005434 | Ga0070709_10000219 | Ga0070709_1000021935 | 210 |
| 577 | 3300005435 | Ga0070714_100158116 | Ga0070714_1001581162 | 210 |
| 578 | 3300005436 | Ga0070713_100064932 | Ga0070713_1000649322 | 210 |
| 579 | 3300005437 | Ga0070710_10006625 | Ga0070710_100066259 | 210 |
| 580 | 3300005438 | Ga0070701_10001666 | Ga0070701_100016664 | 210 |
| 581 | 3300005439 | Ga0070711_100143624 | Ga0070711_1001436242 | 210 |
| 582 | 3300005440 | Ga0070705_100000406 | Ga0070705_1000004066 | 210 |
| 583 | 3300005440 | Ga0070705_100040084 | Ga0070705_1000400843 | 210 |
| 584 | 3300005441 | Ga0070700_100005060 | Ga0070700_1000050604 | 210 |
| 585 | 3300005441 | Ga0070700_100006171 | Ga0070700_1000061712 | 210 |
| 586 | 3300005444 | Ga0070694_100073517 | Ga0070694_1000735172 | 210 |
| 587 | 3300005444 | Ga0070694_100467911 | Ga0070694_1004679111 | 210 |
| 588 | 3300005445 | Ga0070708_100002583 | Ga0070708_1000025836 | 210 |
| 589 | 3300005445 | Ga0070708_100314459 | Ga0070708_1003144592 | 210 |
| 590 | 3300005455 | Ga0070663_100004773 | Ga0070663_1000047735 | 210 |
| 591 | 3300005455 | Ga0070663_100025994 | Ga0070663_1000259944 | 210 |
| 592 | 3300005455 | Ga0070663_100106018 | Ga0070663_1001060182 | 210 |
| 593 | 3300005456 | Ga0070678_100000233 | Ga0070678_10000023328 | 210 |
| 594 | 3300005457 | Ga0070662_100008937 | Ga0070662_1000089375 | 210 |
| 595 | 3300005457 | Ga0070662_100227894 | Ga0070662_1002278942 | 210 |
| 596 | 3300005458 | Ga0070681_10009346 | Ga0070681_100093465 | 210 |
| 597 | 3300005458 | Ga0070681_10021072 | Ga0070681_100210728 | 210 |
| 598 | 3300005458 | Ga0070681_10047354 | Ga0070681_100473544 | 210 |
| 599 | 3300005459 | Ga0068867_100000306 | Ga0068867_10000030615 | 210 |
| 600 | 3300005466 | Ga0070685_10001209 | Ga0070685_100012099 | 210 |
| 601 | 3300005466 | Ga0070685_10027561 | Ga0070685_100275612 | 210 |
| 602 | 3300005468 | Ga0070707_100505654 | Ga0070707_1005056542 | 210 |
| 603 | 3300005530 | Ga0070679_100002290 | Ga0070679_1000022902 | 210 |
| 604 | 3300005530 | Ga0070679_100087826 | Ga0070679_1000878262 | 210 |
| 605 | 3300005530 | Ga0070679_100227809 | Ga0070679_1002278093 | 210 |
| 606 | 3300005535 | Ga0070684_100001097 | Ga0070684_1000010972 | 210 |
| 607 | 3300005536 | Ga0070697_100074989 | Ga0070697_1000749892 | 210 |
| 608 | 3300005539 | Ga0068853_100000364 | Ga0068853_10000036412 | 210 |
| 609 | 3300005543 | Ga0070672_100001950 | Ga0070672_1000019505 | 210 |
| 610 | 3300005543 | Ga0070672_100092150 | Ga0070672_1000921502 | 210 |
| 611 | 3300005543 | Ga0070672_100393928 | Ga0070672_1003939281 | 210 |
| 612 | 3300005544 | Ga0070686_100004938 | Ga0070686_1000049385 | 210 |
| 613 | 3300005544 | Ga0070686_100020979 | Ga0070686_1000209794 | 210 |
| 614 | 3300005545 | Ga0070695_100000208 | Ga0070695_10000020828 | 210 |
| 615 | 3300005545 | Ga0070695_100184509 | Ga0070695_1001845092 | 210 |
| 616 | 3300005546 | Ga0070696_100001498 | Ga0070696_1000014982 | 210 |
| 617 | 3300005546 | Ga0070696_100041297 | Ga0070696_1000412972 | 210 |
| 618 | 3300005547 | Ga0070693_100000244 | Ga0070693_10000024428 | 210 |
| 619 | 3300005549 | Ga0070704_100001662 | Ga0070704_10000166213 | 210 |
| 620 | 3300005549 | Ga0070704_100073935 | Ga0070704_1000739352 | 210 |
| 621 | 3300005563 | Ga0068855_100004695 | Ga0068855_1000046955 | 210 |
| 622 | 3300005563 | Ga0068855_100984237 | Ga0068855_1009842372 | 210 |
| 623 | 3300005564 | Ga0070664_100014605 | Ga0070664_1000146056 | 210 |
| 624 | 3300005564 | Ga0070664_100021987 | Ga0070664_1000219871 | 210 |
| 625 | 3300005577 | Ga0068857_100004429 | Ga0068857_1000044295 | 210 |
| 626 | 3300005577 | Ga0068857_100602032 | Ga0068857_1006020322 | 210 |
| 627 | 3300005578 | Ga0068854_100000949 | Ga0068854_1000009495 | 210 |
| 628 | 3300005614 | Ga0068856_100000272 | Ga0068856_10000027212 | 210 |
| 629 | 3300005614 | Ga0068856_100066703 | Ga0068856_1000667033 | 210 |
| 630 | 3300005615 | Ga0070702_100000106 | Ga0070702_1000001065 | 210 |
| 631 | 3300005615 | Ga0070702_100331251 | Ga0070702_1003312512 | 210 |
| 632 | 3300005616 | Ga0068852_100001698 | Ga0068852_10000169812 | 210 |
| 633 | 3300005616 | Ga0068852_100084296 | Ga0068852_1000842963 | 210 |
| 634 | 3300005617 | Ga0068859_100009854 | Ga0068859_1000098545 | 210 |
| 635 | 3300005617 | Ga0068859_100161640 | Ga0068859_1001616403 | 210 |
| 636 | 3300005617 | Ga0068859_100784872 | Ga0068859_1007848721 | 210 |
| 637 | 3300005618 | Ga0068864_100000865 | Ga0068864_10000086528 | 210 |
| 638 | 3300005618 | Ga0068864_100416417 | Ga0068864_1004164171 | 210 |
| 639 | 3300005718 | Ga0068866_10000143 | Ga0068866_1000014330 | 210 |
| 640 | 3300005719 | Ga0068861_100001420 | Ga0068861_10000142012 | 210 |
| 641 | 3300005719 | Ga0068861_100059060 | Ga0068861_1000590602 | 210 |
| 642 | 3300005840 | Ga0068870_10000149 | Ga0068870_1000014916 | 210 |
| 643 | 3300005841 | Ga0068863_100000337 | Ga0068863_10000033741 | 210 |
| 644 | 3300005841 | Ga0068863_100286038 | Ga0068863_1002860381 | 210 |
| 645 | 3300005841 | Ga0068863_100532880 | Ga0068863_1005328801 | 210 |
| 646 | 3300005842 | Ga0068858_100004259 | Ga0068858_10000425915 | 210 |
| 647 | 3300005842 | Ga0068858_100668580 | Ga0068858_1006685801 | 210 |
| 648 | 3300005843 | Ga0068860_100014928 | Ga0068860_1000149283 | 210 |
| 649 | 3300005843 | Ga0068860_100019560 | Ga0068860_1000195602 | 210 |
| 650 | 3300005843 | Ga0068860_100181748 | Ga0068860_1001817482 | 210 |
| 651 | 3300005843 | Ga0068860_100699189 | Ga0068860_1006991891 | 210 |
| 652 | 3300005844 | Ga0068862_100003109 | Ga0068862_1000031095 | 210 |
| 653 | 3300005844 | Ga0068862_100022218 | Ga0068862_1000222183 | 210 |
| 654 | 3300005844 | Ga0068862_101195093 | Ga0068862_1011950931 | 210 |
| 655 | 3300005937 | Ga0081455_10002592 | Ga0081455_100025928 | 210 |
| 656 | 3300005937 | Ga0081455_10063262 | Ga0081455_100632622 | 210 |
| 657 | 3300005937 | Ga0081455_10182286 | Ga0081455_101822862 | 210 |
| 658 | 3300006042 | Ga0075368_10107069 | Ga0075368_101070692 | 210 |
| 659 | 3300006058 | Ga0075432_10003025 | Ga0075432_100030252 | 210 |
| 660 | 3300006058 | Ga0075432_10103567 | Ga0075432_101035671 | 210 |
| 661 | 3300006173 | Ga0070716_100000393 | Ga0070716_10000039320 | 210 |
| 662 | 3300006175 | Ga0070712_100109410 | Ga0070712_1001094102 | 210 |
| 663 | 3300006194 | Ga0075427_10000335 | Ga0075427_100003351 | 210 |
| 664 | 3300006237 | Ga0097621_100000348 | Ga0097621_10000034812 | 210 |
| 665 | 3300006237 | Ga0097621_100051827 | Ga0097621_1000518274 | 210 |
| 666 | 3300006358 | Ga0068871_100003685 | Ga0068871_1000036859 | 210 |
| 667 | 3300006844 | Ga0075428_100016252 | Ga0075428_1000162525 | 210 |
| 668 | 3300006846 | Ga0075430_100000012 | Ga0075430_10000001253 | 210 |
| 669 | 3300006847 | Ga0075431_100023775 | Ga0075431_1000237755 | 210 |
| 670 | 3300006852 | Ga0075433_10000106 | Ga0075433_1000010616 | 210 |
| 671 | 3300006852 | Ga0075433_10014208 | Ga0075433_100142082 | 210 |
| 672 | 3300006871 | Ga0075434_100000114 | Ga0075434_1000001144 | 210 |
| 673 | 3300006871 | Ga0075434_100000457 | Ga0075434_10000045711 | 210 |
| 674 | 3300006871 | Ga0075434_100006713 | Ga0075434_1000067135 | 210 |
| 675 | 3300006871 | Ga0075434_100246880 | Ga0075434_1002468802 | 210 |
| 676 | 3300006871 | Ga0075434_100249356 | Ga0075434_1002493562 | 210 |
| 677 | 3300006880 | Ga0075429_100003564 | Ga0075429_10000356411 | 210 |
| 678 | 3300006881 | Ga0068865_100000394 | Ga0068865_10000039422 | 210 |
| 679 | 3300006881 | Ga0068865_100481419 | Ga0068865_1004814192 | 210 |
| 680 | 3300006914 | Ga0075436_100005428 | Ga0075436_1000054283 | 210 |
| 681 | 3300006914 | Ga0075436_100353565 | Ga0075436_1003535651 | 210 |
| 682 | 3300006914 | Ga0075436_100698972 | Ga0075436_1006989721 | 210 |
| 683 | 3300006931 | Ga0097620_100009854 | Ga0097620_1000098545 | 210 |
| 684 | 3300006931 | Ga0097620_100161638 | Ga0097620_1001616383 | 210 |
| 685 | 3300006931 | Ga0097620_100784889 | Ga0097620_1007848891 | 210 |
| 686 | 3300007076 | Ga0075435_100509383 | Ga0075435_1005093832 | 210 |
| 687 | 3300009093 | Ga0105240_10105641 | Ga0105240_101056412 | 210 |
| 688 | 3300009094 | Ga0111539_10000299 | Ga0111539_1000029923 | 210 |
| 689 | 3300009094 | Ga0111539_10000581 | Ga0111539_1000058140 | 210 |
| 690 | 3300009094 | Ga0111539_10014752 | Ga0111539_100147525 | 210 |
| 691 | 3300009094 | Ga0111539_10185951 | Ga0111539_101859512 | 210 |
| 692 | 3300009094 | Ga0111539_10211650 | Ga0111539_102116504 | 210 |
| 693 | 3300009098 | Ga0105245_10000663 | Ga0105245_1000066314 | 210 |
| 694 | 3300009098 | Ga0105245_10099641 | Ga0105245_100996413 | 210 |
| 695 | 3300009098 | Ga0105245_10121065 | Ga0105245_101210652 | 210 |
| 696 | 3300009101 | Ga0105247_10003720 | Ga0105247_100037205 | 210 |
| 697 | 3300009101 | Ga0105247_10115761 | Ga0105247_101157612 | 210 |
| 698 | 3300009147 | Ga0114129_10018146 | Ga0114129_100181466 | 210 |
| 699 | 3300009147 | Ga0114129_10058804 | Ga0114129_100588042 | 210 |
| 700 | 3300009148 | Ga0105243_10002452 | Ga0105243_1000245213 | 210 |
| 701 | 3300009148 | Ga0105243_10135684 | Ga0105243_101356842 | 210 |
| 702 | 3300009148 | Ga0105243_10260788 | Ga0105243_102607882 | 210 |
| 703 | 3300009174 | Ga0105241_10001566 | Ga0105241_1000156616 | 210 |
| 704 | 3300009174 | Ga0105241_10052636 | Ga0105241_100526363 | 210 |
| 705 | 3300009176 | Ga0105242_10001341 | Ga0105242_1000134113 | 210 |
| 706 | 3300009177 | Ga0105248_10030265 | Ga0105248_100302652 | 210 |
| 707 | 3300009177 | Ga0105248_10078621 | Ga0105248_100786214 | 210 |
| 708 | 3300009177 | Ga0105248_11138860 | Ga0105248_111388601 | 210 |
| 709 | 3300009545 | Ga0105237_10007002 | Ga0105237_1000700213 | 210 |
| 710 | 3300009545 | Ga0105237_10369646 | Ga0105237_103696462 | 210 |
| 711 | 3300009551 | Ga0105238_10077336 | Ga0105238_100773362 | 210 |
| 712 | 3300009551 | Ga0105238_10855533 | Ga0105238_108555331 | 210 |
| 713 | 3300009553 | Ga0105249_10074724 | Ga0105249_100747244 | 210 |
| 714 | 3300009553 | Ga0105249_10172631 | Ga0105249_101726312 | 210 |
| 715 | 3300009553 | Ga0105249_10454617 | Ga0105249_104546172 | 210 |
| 716 | 3300010375 | Ga0105239_10009001 | Ga0105239_1000900112 | 210 |
| 717 | 3300010375 | Ga0105239_11114931 | Ga0105239_111149312 | 210 |
| 718 | 3300011119 | Ga0105246_10000067 | Ga0105246_100000675 | 210 |
| 719 | 3300011119 | Ga0105246_10266761 | Ga0105246_102667612 | 210 |
| 720 | 3300012480 | Ga0157346_1001624 | Ga0157346_10016242 | 210 |
| 721 | 3300012507 | Ga0157342_1000525 | Ga0157342_10005252 | 210 |
| 722 | 3300013100 | Ga0157373_10047928 | Ga0157373_100479283 | 210 |
| 723 | 3300013102 | Ga0157371_10006720 | Ga0157371_100067203 | 210 |
| 724 | 3300013296 | Ga0157374_10003806 | Ga0157374_100038068 | 210 |
| 725 | 3300013297 | Ga0157378_10061922 | Ga0157378_100619221 | 210 |
| 726 | 3300013297 | Ga0157378_10067095 | Ga0157378_100670952 | 210 |
| 727 | 3300013306 | Ga0163162_10001721 | Ga0163162_1000172112 | 210 |
| 728 | 3300013306 | Ga0163162_10103483 | Ga0163162_101034833 | 210 |
| 729 | 3300013307 | Ga0157372_10010547 | Ga0157372_100105474 | 210 |
| 730 | 3300013307 | Ga0157372_10176767 | Ga0157372_101767672 | 210 |
| 731 | 3300013308 | Ga0157375_10002665 | Ga0157375_1000266513 | 210 |
| 732 | 3300013308 | Ga0157375_10057946 | Ga0157375_100579464 | 210 |
| 733 | 3300013308 | Ga0157375_11743989 | Ga0157375_117439891 | 210 |
| 734 | 3300014325 | Ga0163163_10009638 | Ga0163163_100096385 | 210 |
| 735 | 3300014325 | Ga0163163_10010130 | Ga0163163_100101307 | 210 |
| 736 | 3300014325 | Ga0163163_10098867 | Ga0163163_100988672 | 210 |
| 737 | 3300014326 | Ga0157380_10000049 | Ga0157380_1000004966 | 210 |
| 738 | 3300014497 | Ga0182008_10185081 | Ga0182008_101850811 | 210 |
| 739 | 3300014745 | Ga0157377_10000053 | Ga0157377_1000005328 | 210 |
| 740 | 3300014968 | Ga0157379_10000306 | Ga0157379_100003066 | 210 |
| 741 | 3300014968 | Ga0157379_10085760 | Ga0157379_100857603 | 210 |
| 742 | 3300014969 | Ga0157376_10000099 | Ga0157376_1000009912 | 210 |
| 743 | 3300017792 | Ga0163161_10001833 | Ga0163161_1000183313 | 210 |
| 744 | 3300017792 | Ga0163161_10406553 | Ga0163161_104065532 | 210 |
| 745 | 3300021384 | Ga0213876_10072502 | Ga0213876_100725022 | 210 |
| 746 | 3300025271 | Ga0207666_1000013 | Ga0207666_100001327 | 210 |
| 747 | 3300025271 | Ga0207666_1000335 | Ga0207666_10003356 | 210 |
| 748 | 3300025290 | Ga0207673_1000362 | Ga0207673_10003625 | 210 |
| 749 | 3300025315 | Ga0207697_10000042 | Ga0207697_1000004213 | 210 |
| 750 | 3300025735 | Ga0207713_1167238 | Ga0207713_11672381 | 210 |
| 751 | 3300025885 | Ga0207653_10008834 | Ga0207653_100088341 | 210 |
| 752 | 3300025893 | Ga0207682_10000089 | Ga0207682_1000008934 | 210 |
| 753 | 3300025898 | Ga0207692_10013104 | Ga0207692_100131042 | 210 |
| 754 | 3300025899 | Ga0207642_10001638 | Ga0207642_100016383 | 210 |
| 755 | 3300025900 | Ga0207710_10000812 | Ga0207710_100008125 | 210 |
| 756 | 3300025901 | Ga0207688_10000460 | Ga0207688_100004605 | 210 |
| 757 | 3300025903 | Ga0207680_10006724 | Ga0207680_100067244 | 210 |
| 758 | 3300025904 | Ga0207647_10003720 | Ga0207647_1000372014 | 210 |
| 759 | 3300025904 | Ga0207647_10010565 | Ga0207647_100105652 | 210 |
| 760 | 3300025905 | Ga0207685_10019368 | Ga0207685_100193684 | 210 |
| 761 | 3300025906 | Ga0207699_10013829 | Ga0207699_100138293 | 210 |
| 762 | 3300025907 | Ga0207645_10000162 | Ga0207645_100001625 | 210 |
| 763 | 3300025908 | Ga0207643_10000404 | Ga0207643_1000040424 | 210 |
| 764 | 3300025911 | Ga0207654_10001699 | Ga0207654_1000169914 | 210 |
| 765 | 3300025911 | Ga0207654_10342149 | Ga0207654_103421491 | 210 |
| 766 | 3300025912 | Ga0207707_10011189 | Ga0207707_100111899 | 210 |
| 767 | 3300025912 | Ga0207707_10050436 | Ga0207707_100504363 | 210 |
| 768 | 3300025913 | Ga0207695_10183649 | Ga0207695_101836492 | 210 |
| 769 | 3300025915 | Ga0207693_10047617 | Ga0207693_100476172 | 210 |
| 770 | 3300025917 | Ga0207660_10000007 | Ga0207660_1000000762 | 210 |
| 771 | 3300025917 | Ga0207660_10017339 | Ga0207660_100173391 | 210 |
| 772 | 3300025917 | Ga0207660_10333683 | Ga0207660_103336832 | 210 |
| 773 | 3300025917 | Ga0207660_10438613 | Ga0207660_104386131 | 210 |
| 774 | 3300025918 | Ga0207662_10000458 | Ga0207662_100004589 | 210 |
| 775 | 3300025919 | Ga0207657_10010273 | Ga0207657_100102735 | 210 |
| 776 | 3300025919 | Ga0207657_10019106 | Ga0207657_100191065 | 210 |
| 777 | 3300025920 | Ga0207649_10000048 | Ga0207649_1000004823 | 210 |
| 778 | 3300025920 | Ga0207649_10000305 | Ga0207649_1000030528 | 210 |
| 779 | 3300025920 | Ga0207649_10032748 | Ga0207649_100327484 | 210 |
| 780 | 3300025921 | Ga0207652_10002194 | Ga0207652_1000219418 | 210 |
| 781 | 3300025921 | Ga0207652_10403666 | Ga0207652_104036662 | 210 |
| 782 | 3300025923 | Ga0207681_10000116 | Ga0207681_1000011639 | 210 |
| 783 | 3300025923 | Ga0207681_10115806 | Ga0207681_101158062 | 210 |
| 784 | 3300025924 | Ga0207694_10048904 | Ga0207694_100489043 | 210 |
| 785 | 3300025925 | Ga0207650_10035382 | Ga0207650_100353822 | 210 |
| 786 | 3300025925 | Ga0207650_10516723 | Ga0207650_105167232 | 210 |
| 787 | 3300025926 | Ga0207659_10000155 | Ga0207659_100001552 | 210 |
| 788 | 3300025927 | Ga0207687_10000090 | Ga0207687_1000009014 | 210 |
| 789 | 3300025927 | Ga0207687_10185878 | Ga0207687_101858782 | 210 |
| 790 | 3300025928 | Ga0207700_10016325 | Ga0207700_100163253 | 210 |
| 791 | 3300025931 | Ga0207644_10000251 | Ga0207644_100002515 | 210 |
| 792 | 3300025931 | Ga0207644_10212125 | Ga0207644_102121252 | 210 |
| 793 | 3300025932 | Ga0207690_10000320 | Ga0207690_100003203 | 210 |
| 794 | 3300025932 | Ga0207690_10039510 | Ga0207690_100395101 | 210 |
| 795 | 3300025933 | Ga0207706_10001307 | Ga0207706_100013075 | 210 |
| 796 | 3300025933 | Ga0207706_10021126 | Ga0207706_100211264 | 210 |
| 797 | 3300025934 | Ga0207686_10001488 | Ga0207686_100014885 | 210 |
| 798 | 3300025934 | Ga0207686_10280720 | Ga0207686_102807202 | 210 |
| 799 | 3300025934 | Ga0207686_10330780 | Ga0207686_103307801 | 210 |
| 800 | 3300025935 | Ga0207709_10000081 | Ga0207709_10000081150 | 210 |
| 801 | 3300025935 | Ga0207709_10075917 | Ga0207709_100759172 | 210 |
| 802 | 3300025936 | Ga0207670_10000096 | Ga0207670_1000009639 | 210 |
| 803 | 3300025936 | Ga0207670_10112791 | Ga0207670_101127912 | 210 |
| 804 | 3300025937 | Ga0207669_10000136 | Ga0207669_1000013635 | 210 |
| 805 | 3300025937 | Ga0207669_10469904 | Ga0207669_104699042 | 210 |
| 806 | 3300025938 | Ga0207704_10000215 | Ga0207704_1000021528 | 210 |
| 807 | 3300025939 | Ga0207665_10000555 | Ga0207665_1000055525 | 210 |
| 808 | 3300025940 | Ga0207691_10000829 | Ga0207691_1000082913 | 210 |
| 809 | 3300025941 | Ga0207711_10016986 | Ga0207711_100169862 | 210 |
| 810 | 3300025941 | Ga0207711_10730816 | Ga0207711_107308161 | 210 |
| 811 | 3300025942 | Ga0207689_10000766 | Ga0207689_1000076613 | 210 |
| 812 | 3300025942 | Ga0207689_10141527 | Ga0207689_101415272 | 210 |
| 813 | 3300025944 | Ga0207661_10000170 | Ga0207661_100001707 | 210 |
| 814 | 3300025945 | Ga0207679_10000090 | Ga0207679_1000009013 | 210 |
| 815 | 3300025945 | Ga0207679_10518951 | Ga0207679_105189512 | 210 |
| 816 | 3300025949 | Ga0207667_10002635 | Ga0207667_100026353 | 210 |
| 817 | 3300025949 | Ga0207667_11145459 | Ga0207667_111454591 | 210 |
| 818 | 3300025960 | Ga0207651_10001086 | Ga0207651_1000108613 | 210 |
| 819 | 3300025961 | Ga0207712_10000495 | Ga0207712_1000049529 | 210 |
| 820 | 3300025961 | Ga0207712_10052703 | Ga0207712_100527031 | 210 |
| 821 | 3300025961 | Ga0207712_10280458 | Ga0207712_102804581 | 210 |
| 822 | 3300025972 | Ga0207668_10000133 | Ga0207668_100001334 | 210 |
| 823 | 3300025972 | Ga0207668_10069173 | Ga0207668_100691732 | 210 |
| 824 | 3300025981 | Ga0207640_10000191 | Ga0207640_100001918 | 210 |
| 825 | 3300025986 | Ga0207658_10006088 | Ga0207658_100060882 | 210 |
| 826 | 3300026023 | Ga0207677_10002370 | Ga0207677_100023704 | 210 |
| 827 | 3300026035 | Ga0207703_10000560 | Ga0207703_100005606 | 210 |
| 828 | 3300026035 | Ga0207703_10382919 | Ga0207703_103829192 | 210 |
| 829 | 3300026041 | Ga0207639_10004165 | Ga0207639_100041659 | 210 |
| 830 | 3300026067 | Ga0207678_10000197 | Ga0207678_100001975 | 210 |
| 831 | 3300026067 | Ga0207678_10012097 | Ga0207678_100120978 | 210 |
| 832 | 3300026067 | Ga0207678_10053934 | Ga0207678_100539342 | 210 |
| 833 | 3300026067 | Ga0207678_10055490 | Ga0207678_100554903 | 210 |
| 834 | 3300026075 | Ga0207708_10000947 | Ga0207708_1000094722 | 210 |
| 835 | 3300026075 | Ga0207708_10010717 | Ga0207708_100107178 | 210 |
| 836 | 3300026078 | Ga0207702_10001076 | Ga0207702_1000107626 | 210 |
| 837 | 3300026078 | Ga0207702_10085606 | Ga0207702_100856062 | 210 |
| 838 | 3300026088 | Ga0207641_10003500 | Ga0207641_100035009 | 210 |
| 839 | 3300026089 | Ga0207648_10001359 | Ga0207648_100013595 | 210 |
| 840 | 3300026089 | Ga0207648_10272879 | Ga0207648_102728793 | 210 |
| 841 | 3300026095 | Ga0207676_10000993 | Ga0207676_1000099322 | 210 |
| 842 | 3300026095 | Ga0207676_10186429 | Ga0207676_101864292 | 210 |
| 843 | 3300026116 | Ga0207674_10001393 | Ga0207674_1000139314 | 210 |
| 844 | 3300026116 | Ga0207674_10367071 | Ga0207674_103670712 | 210 |
| 845 | 3300026118 | Ga0207675_100003415 | Ga0207675_1000034155 | 210 |
| 846 | 3300026118 | Ga0207675_100113178 | Ga0207675_1001131783 | 210 |
| 847 | 3300026121 | Ga0207683_10000141 | Ga0207683_1000014155 | 210 |
| 848 | 3300026142 | Ga0207698_10015513 | Ga0207698_100155132 | 210 |
| 849 | 3300026142 | Ga0207698_10158498 | Ga0207698_101584982 | 210 |
| 850 | 3300027111 | Ga0209281_1000798 | Ga0209281_100079818 | 210 |
| 851 | 3300027617 | Ga0210002_1002952 | Ga0210002_10029523 | 210 |
| 852 | 3300027665 | Ga0209983_1009812 | Ga0209983_10098122 | 210 |
| 853 | 3300027682 | Ga0209971_1004860 | Ga0209971_10048602 | 210 |
| 854 | 3300027695 | Ga0209966_1023433 | Ga0209966_10234332 | 210 |
| 855 | 3300027717 | Ga0209998_10001984 | Ga0209998_100019842 | 210 |
| 856 | 3300027876 | Ga0209974_10000295 | Ga0209974_1000029513 | 210 |
| 857 | 3300027876 | Ga0209974_10009249 | Ga0209974_100092493 | 210 |
| 858 | 3300027876 | Ga0209974_10084141 | Ga0209974_100841412 | 210 |
| 859 | 3300027876 | Ga0209974_10084240 | Ga0209974_100842402 | 210 |
| 860 | 3300027907 | Ga0207428_10000011 | Ga0207428_1000001116 | 210 |
| 861 | 3300027907 | Ga0207428_10000046 | Ga0207428_10000046167 | 210 |
| 862 | 3300027907 | Ga0207428_10000058 | Ga0207428_10000058114 | 210 |
| 863 | 3300027907 | Ga0207428_10013808 | Ga0207428_100138084 | 210 |
| 864 | 3300027907 | Ga0207428_10382485 | Ga0207428_103824851 | 210 |
| 865 | 3300028380 | Ga0268265_10000405 | Ga0268265_1000040512 | 210 |
| 866 | 3300028380 | Ga0268265_10364213 | Ga0268265_103642132 | 210 |
| 867 | 3300028380 | Ga0268265_10518859 | Ga0268265_105188592 | 210 |
| 868 | 3300028381 | Ga0268264_10000340 | Ga0268264_1000034033 | 210 |
| 869 | 3300028381 | Ga0268264_10069042 | Ga0268264_100690422 | 210 |
| 870 | 3300028381 | Ga0268264_10106607 | Ga0268264_101066073 | 210 |
| 871 | 3300028381 | Ga0268264_10135420 | Ga0268264_101354202 | 210 |
| 872 | 3300034816 | Ga0373930_0013741 | Ga0373930_0013741_231_863 | 210 |
| 873 | 3300034816 | Ga0373930_0016518 | Ga0373930_0016518_329_961 | 210 |
| 874 | 3300034816 | Ga0373930_0018237 | Ga0373930_0018237_234_881 | 210 |
| 875 | 3300034817 | Ga0373948_0000122 | Ga0373948_0000122_1503_2135 | 210 |
| 876 | 3300034817 | Ga0373948_0011217 | Ga0373948_0011217_133_780 | 210 |
| 877 | 3300034818 | Ga0373950_0016865 | Ga0373950_0016865_543_1175 | 210 |
| 878 | 3300034819 | Ga0373958_0001381 | Ga0373958_0001381_2407_3039 | 210 |
| 879 | 3300034820 | Ga0373959_0026942 | Ga0373959_0026942_224_856 | 210 |
| 880 | 3300034957 | Ga0373938_0000445 | Ga0373938_0000445_639_1271 | 210 |
| 881 | 3300034957 | Ga0373938_0001301 | Ga0373938_0001301_2622_3254 | 210 |
| 882 | 3300035083 | Ga0373926_0003607 | Ga0373926_0003607_2263_2898 | 210 |
| 883 | 3300035084 | Ga0373928_0000382 | Ga0373928_0000382_5829_6461 | 210 |
| 884 | 3300035084 | Ga0373928_0000518 | Ga0373928_0000518_4061_4693 | 210 |
| 885 | 3300035084 | Ga0373928_0047313 | Ga0373928_0047313_48_695 | 210 |
| 886 | 3300035085 | Ga0373929_0001453 | Ga0373929_0001453_3691_4323 | 210 |
| 887 | 3300035088 | Ga0373940_0016520 | Ga0373940_0016520_311_958 | 210 |
| 888 | 3300035088 | Ga0373940_0019070 | Ga0373940_0019070_826_1458 | 210 |
| 889 | 3300035089 | Ga0373944_0008713 | Ga0373944_0008713_721_1368 | 210 |
| 890 | 3300035090 | Ga0373949_0000549 | Ga0373949_0000549_2278_2910 | 210 |
| 891 | 3300035090 | Ga0373949_0001748 | Ga0373949_0001748_2856_3488 | 210 |
| 892 | 3300035090 | Ga0373949_0004482 | Ga0373949_0004482_725_1372 | 210 |
| 893 | 3300035091 | Ga0373951_0000836 | Ga0373951_0000836_7084_7716 | 210 |
| 894 | 3300035091 | Ga0373951_0001355 | Ga0373951_0001355_761_1393 | 210 |
| 895 | 3300035091 | Ga0373951_0012008 | Ga0373951_0012008_390_1037 | 210 |
| 896 | 3300035092 | Ga0373952_0001852 | Ga0373952_0001852_2395_3027 | 210 |
| 897 | 3300035092 | Ga0373952_0025224 | Ga0373952_0025224_453_1085 | 210 |
| 898 | 3300035112 | Ga0373932_0003013 | Ga0373932_0003013_1500_2147 | 210 |
| 899 | 3300035113 | Ga0373936_0161555 | Ga0373936_0161555_240_875 | 210 |
| 900 | 3300035114 | Ga0373939_0000480 | Ga0373939_0000480_7017_7649 | 210 |
| 901 | 3300035114 | Ga0373939_0001023 | Ga0373939_0001023_825_1457 | 210 |
| 902 | 3300035114 | Ga0373939_0065299 | Ga0373939_0065299_125_772 | 210 |
| 903 | 3300035115 | Ga0373941_0001109 | Ga0373941_0001109_3540_4172 | 210 |
| 904 | 3300035115 | Ga0373941_0005005 | Ga0373941_0005005_660_1292 | 210 |
| 905 | 3300035116 | Ga0373945_0005322 | Ga0373945_0005322_1559_2212 | 210 |
| 906 | 3300035116 | Ga0373945_0012002 | Ga0373945_0012002_1082_1717 | 210 |
| 907 | 3300035121 | Ga0373960_0000075 | Ga0373960_0000075_11405_12037 | 210 |
| 908 | 3300035121 | Ga0373960_0000089 | Ga0373960_0000089_9328_9960 | 210 |
| 909 | 3300035170 | Ga0373943_0009289 | Ga0373943_0009289_1361_2008 | 210 |
| 910 | 3300035170 | Ga0373943_0057874 | Ga0373943_0057874_960_1613 | 210 |
| 911 | 3300035171 | Ga0373946_0012892 | Ga0373946_0012892_2369_3004 | 210 |
| 912 | 3300035171 | Ga0373946_0037721 | Ga0373946_0037721_520_1173 | 210 |
| 913 | 3300035171 | Ga0373946_0053076 | Ga0373946_0053076_931_1578 | 210 |
| 914 | 3300035172 | Ga0373955_0406645 | Ga0373955_0406645_179_811 | 210 |
| 915 | 3300035207 | Ga0373942_0001936 | Ga0373942_0001936_3901_4533 | 210 |
| 916 | 3300035207 | Ga0373942_0004729 | Ga0373942_0004729_2268_2900 | 210 |
| 917 | 3300035241 | Ga0373961_0000902 | Ga0373961_0000902_2005_2637 | 210 |
| 918 | 3300035241 | Ga0373961_0007325 | Ga0373961_0007325_622_1269 | 210 |
| 919 | 3300035241 | Ga0373961_0210145 | Ga0373961_0210145_14_646 | 210 |
| 920 | 3300035691 | Ga0373931_0001924 | Ga0373931_0001924_846_1478 | 210 |
| 921 | 3300035691 | Ga0373931_0011110 | Ga0373931_0011110_1587_2234 | 210 |
| 922 | 3300035691 | Ga0373931_0011894 | Ga0373931_0011894_3162_3794 | 210 |
| 923 | 3300035691 | Ga0373931_0151259 | Ga0373931_0151259_621_1253 | 210 |
| 924 | 3300035692 | Ga0373935_0028883 | Ga0373935_0028883_1673_2320 | 210 |
| 925 | 3300035695 | Ga0373927_0087402 | Ga0373927_0087402_17_649 | 210 |
| 926 | 3300035725 | Ga0373947_0002148 | Ga0373947_0002148_4789_5436 | 210 |
| 927 | 3300035725 | Ga0373947_0045145 | Ga0373947_0045145_1380_2033 | 210 |
| 928 | 3300036401 | Ga0373937_0392084 | Ga0373937_0392084_367_1020 | 210 |
| 929 | 3300037068 | Ga0373925_0006522 | Ga0373925_0006522_4611_5258 | 210 |
| 930 | 3300039437 | Ga0436365_1347068 | Ga0436365_1347068_1652_2293 | 210 |
| 931 | 3300044712 | Ga0453684_0265518 | Ga0453684_0265518_861_1493 | 210 |
| 932 | 3300045051 | Ga0451576_0060211 | Ga0451576_0060211_557_1189 | 210 |
| 933 | 3300046454 | Ga0495592_0297363 | Ga0495592_0297363_263_916 | 210 |
| 934 | 3300046455 | Ga0495603_0027316 | Ga0495603_0027316_2585_3232 | 210 |
| 935 | 3300046459 | Ga0495629_0000577 | Ga0495629_0000577_17354_18001 | 210 |
| 936 | 3300046459 | Ga0495629_0014609 | Ga0495629_0014609_2274_2927 | 210 |
| 937 | 3300046459 | Ga0495629_0099945 | Ga0495629_0099945_50_685 | 210 |
| 938 | 3300046461 | Ga0495641_0125770 | Ga0495641_0125770_131_766 | 210 |
| 939 | 3300046462 | Ga0495651_0021029 | Ga0495651_0021029_4127_4780 | 210 |
| 940 | 3300046463 | Ga0495653_0032171 | Ga0495653_0032171_1798_2451 | 210 |
| 941 | 3300046472 | Ga0495580_0085247 | Ga0495580_0085247_1275_1910 | 210 |
| 942 | 3300046472 | Ga0495580_0155060 | Ga0495580_0155060_170_817 | 210 |
| 943 | 3300046473 | Ga0495582_0023392 | Ga0495582_0023392_1135_1770 | 210 |
| 944 | 3300046473 | Ga0495582_0039234 | Ga0495582_0039234_1463_2110 | 210 |
| 945 | 3300046473 | Ga0495582_0203965 | Ga0495582_0203965_478_1110 | 210 |
| 946 | 3300046475 | Ga0495639_0009978 | Ga0495639_0009978_1567_2202 | 210 |
| 947 | 3300046475 | Ga0495639_0111506 | Ga0495639_0111506_518_1171 | 210 |
| 948 | 3300046476 | Ga0495662_0015970 | Ga0495662_0015970_622_1275 | 210 |
| 949 | 3300046477 | Ga0495664_0025843 | Ga0495664_0025843_203_856 | 210 |
| 950 | 3300046477 | Ga0495664_0027938 | Ga0495664_0027938_2555_3190 | 210 |
| 951 | 3300046491 | Ga0495584_0117787 | Ga0495584_0117787_52_684 | 210 |
| 952 | 3300046491 | Ga0495584_0129218 | Ga0495584_0129218_120_773 | 210 |
| 953 | 3300046492 | Ga0495585_0020294 | Ga0495585_0020294_478_1131 | 210 |
| 954 | 3300046499 | Ga0495594_0005733 | Ga0495594_0005733_2656_3303 | 210 |
| 955 | 3300046499 | Ga0495594_0083682 | Ga0495594_0083682_496_1149 | 210 |
| 956 | 3300046501 | Ga0495607_0030536 | Ga0495607_0030536_2641_3294 | 210 |
| 957 | 3300046514 | Ga0495618_0153605 | Ga0495618_0153605_452_1087 | 210 |
| 958 | 3300046516 | Ga0495628_0053287 | Ga0495628_0053287_1265_1918 | 210 |
| 959 | 3300046518 | Ga0495631_0121585 | Ga0495631_0121585_287_940 | 210 |
| 960 | 3300046523 | Ga0495644_0034138 | Ga0495644_0034138_987_1640 | 210 |
| 961 | 3300046525 | Ga0495663_0019753 | Ga0495663_0019753_421_1074 | 210 |
| 962 | 3300046526 | Ga0495666_0015245 | Ga0495666_0015245_2542_3195 | 210 |
| 963 | 3300046526 | Ga0495666_0058094 | Ga0495666_0058094_1052_1687 | 210 |
| 964 | 3300046529 | Ga0495652_0045348 | Ga0495652_0045348_2494_3147 | 210 |
| 965 | 3300046529 | Ga0495652_0066312 | Ga0495652_0066312_973_1608 | 210 |
| 966 | 3300046530 | Ga0495654_0000195 | Ga0495654_0000195_26967_27671 | 210 |
| 967 | 3300046531 | Ga0495665_0017690 | Ga0495665_0017690_1904_2539 | 210 |
| 968 | 3300046531 | Ga0495665_0021884 | Ga0495665_0021884_2647_3300 | 210 |
| 969 | 3300046533 | Ga0495640_0112913 | Ga0495640_0112913_719_1372 | 210 |
| 970 | 3300046533 | Ga0495640_0228658 | Ga0495640_0228658_406_1041 | 210 |
| 971 | 3300046536 | Ga0495587_0031195 | Ga0495587_0031195_645_1298 | 210 |
| 972 | 3300046536 | Ga0495587_0284282 | Ga0495587_0284282_183_830 | 210 |
| 973 | 3300046538 | Ga0495609_0017146 | Ga0495609_0017146_471_1124 | 210 |
| 974 | 3300046543 | Ga0495645_0021703 | Ga0495645_0021703_3067_3702 | 210 |
| 975 | 3300046543 | Ga0495645_0155632 | Ga0495645_0155632_303_956 | 210 |
| 976 | 3300046557 | Ga0495622_0139419 | Ga0495622_0139419_338_973 | 210 |
| 977 | 3300046558 | Ga0495633_0058533 | Ga0495633_0058533_14_667 | 210 |
| 978 | 3300046615 | Ga0495656_0006096 | Ga0495656_0006096_1747_2400 | 210 |
| 979 | 3300046642 | Ga0495634_0120345 | Ga0495634_0120345_427_1080 | 210 |
| 980 | 3300046663 | Ga0495635_0018011 | Ga0495635_0018011_120_773 | 210 |
| 981 | 3300046663 | Ga0495635_0034629 | Ga0495635_0034629_1878_2513 | 210 |
| 982 | 3300046663 | Ga0495635_0072756 | Ga0495635_0072756_652_1299 | 210 |
| 983 | 3300046664 | Ga0495659_0017252 | Ga0495659_0017252_614_1267 | 210 |
| 984 | 3300046665 | Ga0495661_0269871 | Ga0495661_0269871_86_739 | 210 |
| 985 | 3300046674 | Ga0495588_0033487 | Ga0495588_0033487_654_1301 | 210 |
| 986 | 3300046674 | Ga0495588_0094496 | Ga0495588_0094496_602_1255 | 210 |
| 987 | 3300046678 | Ga0495599_0046612 | Ga0495599_0046612_145_798 | 210 |
| 988 | 3300046680 | Ga0495646_0046680 | Ga0495646_0046680_1840_2493 | 210 |
| 989 | 3300046681 | Ga0495647_0020517 | Ga0495647_0020517_1587_2240 | 210 |
| 990 | 3300046681 | Ga0495647_0093073 | Ga0495647_0093073_259_894 | 210 |
| 991 | 3300046683 | Ga0495658_0000944 | Ga0495658_0000944_5084_5731 | 210 |
| 992 | 3300046683 | Ga0495658_0348119 | Ga0495658_0348119_159_812 | 210 |
| 993 | 3300046691 | Ga0495670_0034592 | Ga0495670_0034592_580_1233 | 210 |
| 994 | 3300046692 | Ga0495671_0216005 | Ga0495671_0216005_60_713 | 210 |
| 995 | 3300046794 | Ga0495589_0044030 | Ga0495589_0044030_176_829 | 210 |
| 996 | 3300046809 | Ga0495600_0005531 | Ga0495600_0005531_5081_5734 | 210 |
| 997 | 3300047315 | Ga0495581_0093984 | Ga0495581_0093984_375_1010 | 210 |
| 998 | 3300047315 | Ga0495581_0244815 | Ga0495581_0244815_20_652 | 210 |
| 999 | 3300047317 | Ga0495604_0118199 | Ga0495604_0118199_1016_1663 | 210 |
| 1000 | 3300047317 | Ga0495604_0506510 | Ga0495604_0506510_134_766 | 210 |
| 1001 | 3300047319 | Ga0495674_0008886 | Ga0495674_0008886_2773_3408 | 210 |
| 1002 | 3300047321 | Ga0495676_0046504 | Ga0495676_0046504_399_1046 | 210 |
| 1003 | 3300047322 | Ga0495680_0021289 | Ga0495680_0021289_1192_1839 | 210 |
| 1004 | 3300047322 | Ga0495680_0022905 | Ga0495680_0022905_1997_2650 | 210 |
| 1005 | 3300047446 | Ga0495679_029342 | Ga0495679_029342_191_844 | 210 |
| 1006 | 3300047471 | Ga0495684_0000517 | Ga0495684_0000517_2372_3025 | 210 |
| 1007 | 3300047673 | Ga0495593_0005851 | Ga0495593_0005851_4584_5231 | 210 |
| 1008 | 3300048089 | Ga0495614_0047452 | Ga0495614_0047452_297_932 | 210 |
| 1009 | 3300048903 | Ga0496100_0000589 | Ga0496100_0000589_7136_7768 | 210 |
| 1010 | 3300048904 | Ga0496101_0000782 | Ga0496101_0000782_8833_9465 | 210 |
| 1011 | 3300048904 | Ga0496101_0372589 | Ga0496101_0372589_121_753 | 210 |
| 1012 | 3300048905 | Ga0496102_0004682 | Ga0496102_0004682_3958_4590 | 210 |
| 1013 | 3300048905 | Ga0496102_0092192 | Ga0496102_0092192_1434_2066 | 210 |
| 1014 | 3300048906 | Ga0496103_0054684 | Ga0496103_0054684_1063_1695 | 210 |
| 1015 | 3300048906 | Ga0496103_0153282 | Ga0496103_0153282_310_957 | 210 |
| 1016 | 3300048907 | Ga0496104_0031877 | Ga0496104_0031877_1814_2461 | 210 |
| 1017 | 3300048907 | Ga0496104_0337650 | Ga0496104_0337650_189_836 | 210 |
| 1018 | 3300048908 | Ga0496105_0161814 | Ga0496105_0161814_421_1068 | 210 |
| 1019 | 3300048909 | Ga0496106_0049812 | Ga0496106_0049812_203_835 | 210 |
| 1020 | 3300048909 | Ga0496106_0157465 | Ga0496106_0157465_908_1540 | 210 |
| 1021 | 3300048909 | Ga0496106_0284695 | Ga0496106_0284695_464_1099 | 210 |
| 1022 | 3300048910 | Ga0496107_0025804 | Ga0496107_0025804_1814_2461 | 210 |
| 1023 | 3300048910 | Ga0496107_0038274 | Ga0496107_0038274_1044_1676 | 210 |
| 1024 | 3300048910 | Ga0496107_0164033 | Ga0496107_0164033_610_1257 | 210 |
| 1025 | 3300048911 | Ga0496108_0006294 | Ga0496108_0006294_4468_5100 | 210 |
| 1026 | 3300048911 | Ga0496108_0008390 | Ga0496108_0008390_3962_4594 | 210 |
| 1027 | 3300048912 | Ga0496109_0000500 | Ga0496109_0000500_3492_4124 | 210 |
| 1028 | 3300048912 | Ga0496109_0001328 | Ga0496109_0001328_17850_18482 | 210 |
| 1029 | 3300048912 | Ga0496109_0016249 | Ga0496109_0016249_770_1417 | 210 |
| 1030 | 3300048912 | Ga0496109_0184996 | Ga0496109_0184996_773_1420 | 210 |
| 1031 | 3300048912 | Ga0496109_0486019 | Ga0496109_0486019_106_738 | 210 |
| 1032 | 3300048913 | Ga0496110_0044003 | Ga0496110_0044003_2633_3265 | 210 |
| 1033 | 3300048914 | Ga0496111_0073039 | Ga0496111_0073039_1133_1780 | 210 |
| 1034 | 3300048914 | Ga0496111_0202296 | Ga0496111_0202296_796_1428 | 210 |
| 1035 | 3300048915 | Ga0496112_0019146 | Ga0496112_0019146_4938_5570 | 210 |
| 1036 | 3300048916 | Ga0496113_0005457 | Ga0496113_0005457_4080_4712 | 210 |
| 1037 | 3300048916 | Ga0496113_0059992 | Ga0496113_0059992_406_1053 | 210 |
| 1038 | 3300048917 | Ga0496114_0000544 | Ga0496114_0000544_2326_2958 | 210 |
| 1039 | 3300048918 | Ga0496115_0033087 | Ga0496115_0033087_872_1504 | 210 |
| 1040 | 3300048918 | Ga0496115_0108637 | Ga0496115_0108637_1101_1736 | 210 |
| 1041 | 3300048922 | Ga0496119_0290424 | Ga0496119_0290424_81_728 | 210 |
| 1042 | 3300049576 | Ga0501040_0505473 | Ga0501040_0505473_195_827 | 210 |
| 1043 | 3300049588 | Ga0501072_0400244 | Ga0501072_0400244_330_968 | 210 |
| 1044 | 3300049589 | Ga0501073_0164659 | Ga0501073_0164659_292_930 | 210 |
| 1045 | 3300049589 | Ga0501073_0255391 | Ga0501073_0255391_81_713 | 210 |
| 1046 | 3300049591 | Ga0501075_0154148 | Ga0501075_0154148_853_1485 | 210 |
| 1047 | 3300049592 | Ga0501076_0078791 | Ga0501076_0078791_448_1080 | 210 |
| 1048 | 3300049593 | Ga0501077_0033846 | Ga0501077_0033846_1479_2111 | 210 |
| 1049 | 3300049593 | Ga0501077_0060461 | Ga0501077_0060461_832_1470 | 210 |
| 1050 | 3300049742 | Ga0501080_0121276 | Ga0501080_0121276_1136_1807 | 210 |
| 1051 | 3300049742 | Ga0501080_0342741 | Ga0501080_0342741_344_982 | 210 |
| 1052 | 3300049742 | Ga0501080_1096557 | Ga0501080_1096557_22_654 | 210 |
| 1053 | 3300049743 | Ga0501081_0237851 | Ga0501081_0237851_176_814 | 210 |
| 1054 | 3300049744 | Ga0501083_0122077 | Ga0501083_0122077_430_1068 | 210 |
| 1055 | 3300049823 | Ga0501044_0003273 | Ga0501044_0003273_16424_17095 | 210 |
| 1056 | 3300050495 | nmdc:mga04h51_43807_c1 | nmdc:mga04h51_43807_c1_520_1152 | 210 |
| 1057 | 3300050507 | nmdc:mga05p37_35_c1 | nmdc:mga05p37_35_c1_4229_4864 | 210 |
| 1058 | 3300050508 | nmdc:mga09592_12863_c1 | nmdc:mga09592_12863_c1_4611_5246 | 210 |
| 1059 | 3300050509 | nmdc:mga0qj67_1026_c1 | nmdc:mga0qj67_1026_c1_18069_18704 | 210 |
| 1060 | 3300050510 | nmdc:mga06r32_55452_c1 | nmdc:mga06r32_55452_c1_390_1025 | 210 |
| 1061 | 3300050511 | nmdc:mga08y16_202042_c1 | nmdc:mga08y16_202042_c1_1022_1669 | 210 |
| 1062 | 3300050511 | nmdc:mga08y16_22611_c1 | nmdc:mga08y16_22611_c1_1384_2019 | 210 |
| 1063 | 3300050511 | nmdc:mga08y16_2480_c1 | nmdc:mga08y16_2480_c1_828_1460 | 210 |
| 1064 | 3300050511 | nmdc:mga08y16_278734_c1 | nmdc:mga08y16_278734_c1_826_1458 | 210 |
| 1065 | 3300050512 | nmdc:mga0n895_11659_c1 | nmdc:mga0n895_11659_c1_5164_5799 | 210 |
| 1066 | 3300050512 | nmdc:mga0n895_41857_c1 | nmdc:mga0n895_41857_c1_335_982 | 210 |
| 1067 | 3300050512 | nmdc:mga0n895_73_c1 | nmdc:mga0n895_73_c1_39692_40327 | 210 |
| 1068 | 3300050512 | nmdc:mga0n895_877_c1 | nmdc:mga0n895_877_c1_7335_7967 | 210 |
| 1069 | 3300050512 | nmdc:mga0n895_955829_c1 | nmdc:mga0n895_955829_c1_104_748 | 210 |
| 1070 | 3300050513 | nmdc:mga0rr50_25060_c1 | nmdc:mga0rr50_25060_c1_2503_3138 | 210 |
| 1071 | 3300050513 | nmdc:mga0rr50_42978_c1 | nmdc:mga0rr50_42978_c1_2638_3270 | 210 |
| 1072 | 3300050513 | nmdc:mga0rr50_75377_c1 | nmdc:mga0rr50_75377_c1_409_1056 | 210 |
| 1073 | 3300050514 | nmdc:mga08x19_329911_c1 | nmdc:mga08x19_329911_c1_130_762 | 210 |
| 1074 | 3300050514 | nmdc:mga08x19_47889_c1 | nmdc:mga08x19_47889_c1_1227_1859 | 210 |
| 1075 | 3300050515 | nmdc:mga0a205_20696_c1 | nmdc:mga0a205_20696_c1_3556_4188 | 210 |
| 1076 | 3300050515 | nmdc:mga0a205_59_c1 | nmdc:mga0a205_59_c1_39673_40308 | 210 |
| 1077 | 3300050515 | nmdc:mga0a205_817331_c1 | nmdc:mga0a205_817331_c1_102_737 | 210 |
| 1078 | 3300053077 | Ga0495601_0107171 | Ga0495601_0107171_635_1288 | 210 |
| 1079 | 3300053078 | Ga0495612_0004728 | Ga0495612_0004728_3096_3749 | 210 |
| 1080 | 3300053085 | Ga0495619_0000687 | Ga0495619_0000687_20194_20841 | 210 |
| 1081 | 3300053085 | Ga0495619_0013679 | Ga0495619_0013679_3828_4481 | 210 |
| 1082 | 3300054114 | Ga0501084_0409923 | Ga0501084_0409923_296_928 | 210 |
| 1083 | 3300060353 | Ga0501082_0372683 | Ga0501082_0372683_308_946 | 210 |
| 1084 | 3300061734 | Ga0530510_0079496 | Ga0530510_0079496_707_1345 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dck-assembly1.cif.gz_A | structure of unphosphorylated fixj-n complexed with mn2+ | 0.9434 | 5 | 122 |
| 4wul-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9425 | 144 | 204 |
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.9406 | 140 | 203 |
| 4wul-assembly1.cif.gz_B | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9355 | 144 | 204 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9354 | 142 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9916 | 143 | 200 | 1.10.10.10 |
| 1zn2A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9881 | 143 | 200 | 1.10.10.10 |
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9589 | 143 | 200 | 1.10.10.10 |
| 1zn2A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9557 | 143 | 200 | 1.10.10.10 |
| 1a04B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9556 | 142 | 203 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A8W472-F1-model_v4 | deleted | 0.9798 | 3 | 202 |
|
| AF-A0A370KTC8-F1-model_v4 | DNA-binding response regulator | 0.9793 | 5 | 202 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A327YBQ8-F1-model_v4 | deleted | 0.9788 | 5 | 202 |
|
| AF-H8GG97-F1-model_v4 | Response regulator | 0.9784 | 5 | 203 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A1L6L826-F1-model_v4 | deleted | 0.9773 | 5 | 202 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar