F489737

General Info

Members Datasets Scaffolds Average Seq Length
1084 482 1041 209

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100393928|Ga0070672_1003939281
Length 240
Sequence MGDAGFTTYLVDDDPAVLRSITRLLKAGGYKTKSFSSPQKFLSSHDPSVPGCAIIDLVMSELDGLRLQEALARSGSQRPIIFLTGRGDVPTSVRAMKAGAVDFLTKPVKRDALFSAVVHAAELDAASRQKRQESKSIDERLATLTHREREVLEHVIAGRLNKQIAASLGTVEKTIKVHRSRIMEKMGVRTIADLVRLTEQIGLAPYGSGAQRSRDSQGLFLGIGPLSDRLFRLAGSRPSL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
4 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2643221736 Bosea sp. Root483D1 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738543018 Massilia sp. GV045 Isolate Unclassified
12 2738543024 Aminobacter sp. AP02 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
15 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
16 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
17 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
18 2904699407
19 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
20 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
21 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
22 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
23 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
24 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
25 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
26 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
27 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
28 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
29 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
30 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
31 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
32 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
33 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
34 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
37 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
38 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
39 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
40 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
41 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
42 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
43 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
44 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
45 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
46 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
47 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
79 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
80 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
81 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
82 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
83 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
84 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
85 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
86 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
87 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
88 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
96 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
120 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
121 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
125 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
127 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
128 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
129 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
132 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
136 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
137 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
143 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
144 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
145 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
146 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
147 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
148 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
149 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
150 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
151 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
155 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
156 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
164 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
168 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
169 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
175 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
176 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
177 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
178 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
179 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
180 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
183 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
184 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
185 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
186 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
188 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
189 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
257 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
264 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
268 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
269 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
270 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
271 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
272 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
273 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
274 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
275 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
279 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
280 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
281 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
282 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
283 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
284 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
285 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
286 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
287 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
288 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
289 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
290 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
291 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
292 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
293 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
294 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
296 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
297 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
298 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
299 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
300 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
301 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
302 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
303 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
304 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
305 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
306 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
307 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
308 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
309 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
310 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
311 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
312 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
314 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
315 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
316 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
319 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
320 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
321 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
322 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
323 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
324 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
331 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
332 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
333 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
334 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
335 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
338 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
339 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
340 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
341 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
344 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
345 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
348 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
354 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
355 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
358 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
359 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
360 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
361 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
364 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
365 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
366 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
367 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
368 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
369 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
370 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
371 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
372 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
373 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
374 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
375 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
376 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
377 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
378 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
379 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
380 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
384 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
385 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
386 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
387 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
390 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
398 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
399 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
400 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
401 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
402 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
403 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
404 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
407 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
408 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
409 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
410 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
411 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
418 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
419 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
420 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
421 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
422 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
425 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
431 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
432 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
433 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
434 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
435 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
436 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
437 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
438 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
439 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
440 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
441 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
442 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
443 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
444 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
445 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
446 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
447 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
448 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
449 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
450 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
451 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
452 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
453 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
454 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
455 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
456 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
457 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
458 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
459 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
460 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
461 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
462 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
463 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
464 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
465 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
466 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
467 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
468 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
469 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
470 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
471 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
472 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
473 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
474 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
475 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
476 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
477 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
478 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
479 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
480 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
481 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
482 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 0
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 2.95
Rhizoplane 5.44
Rhizosphere 86.81
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214628275 2209111006 Bacteria 5064
2 ARcpr5oldR_c000250 3300000041 Bacteria 8579
3 ARSoilYngRDRAFT_c00208 3300000042 Bacteria 9833
4 ARcpr5yngRDRAFT_c000678 3300000043 Plasmid 4239
5 ARSoilOldRDRAFT_c000174 3300000044 Bacteria 10743
6 ARCol0oldRDRAFT_c01338 3300000045 Bacteria 1678
7 ARCol0yngRDRAFT_1000170 3300000652 Bacteria 11077
8 JGI24739J22299_10002749 3300001989 Bacteria 6767
9 JGI24737J22298_10004199 3300001990 Bacteria 5035
10 JGI24743J22301_10021848 3300001991 Bacteria 1224
11 JGI24750J21931_1000010 3300002070 Bacteria 22844
12 JGI24745J21846_1000735 3300002073 Bacteria 2976
13 JGI24738J21930_10000125 3300002075 Bacteria 18550
14 JGI24744J21845_10002950 3300002077 Bacteria 3481
15 JGI24035J26624_1000050 3300002126 Bacteria 8914
16 JGI24033J26618_1004385 3300002155 Bacteria 1523
17 JGI24034J26672_10000156 3300002239 Bacteria 9646
18 JGI24742J22300_10000121 3300002244 Bacteria 11239
19 JGI24751J29686_10005039 3300002459 Bacteria 2692
20 JGI25404J52841_10000042 3300003659 Bacteria 10423
21 JGI25405J52794_10007928 3300003911 Bacteria 1971
22 Ga0065717_1003254 3300005276 Bacteria 1330
23 Ga0065704_10080809 3300005289 Bacteria 3876
24 Ga0065715_10006737 3300005293 Bacteria 4358
25 Ga0065715_10089962 3300005293 Bacteria 8002
26 Ga0065715_10099237 3300005293 Bacteria 3437
27 Ga0065707_10341838 3300005295 Bacteria 932
28 Ga0070676_10002283 3300005328 Bacteria 9791
29 Ga0070683_100000132 3300005329 Bacteria 48299
30 Ga0070683_100126298 3300005329 Bacteria 2418
31 Ga0070683_100390577 3300005329 Bacteria 1327
32 Ga0070683_100674259 3300005329 Bacteria 990
33 Ga0070683_100680301 3300005329 Unclassified 985
34 Ga0070690_100003321 3300005330 Bacteria 8769
35 Ga0070690_100012804 3300005330 Bacteria 4941
36 Ga0070690_100083497 3300005330 Bacteria 2093
37 Ga0070670_100009102 3300005331 Bacteria 8485
38 Ga0070670_100033434 3300005331 Bacteria 4429
39 Ga0070670_100589944 3300005331 Bacteria 994
40 Ga0070670_100592767 3300005331 Bacteria 991
41 Ga0070670_100701118 3300005331 Bacteria 910
42 Ga0070677_10000355 3300005333 Bacteria 16034
43 Ga0068869_100000063 3300005334 Bacteria 47742
44 Ga0068869_100141404 3300005334 Bacteria 1858
45 Ga0068869_100275665 3300005334 Bacteria 1351
46 Ga0068869_101013595 3300005334 Unclassified 723
47 Ga0070666_10014429 3300005335 Bacteria 5031
48 Ga0070666_10034818 3300005335 Unclassified 3338
49 Ga0070666_10193739 3300005335 Unclassified 1429
50 Ga0070666_10522500 3300005335 Bacteria 862
51 Ga0070680_100000702 3300005336 Bacteria 23234
52 Ga0070680_100359636 3300005336 Bacteria 1238
53 Ga0070682_100006330 3300005337 Bacteria 6645
54 Ga0070682_100020616 3300005337 Bacteria 3882
55 Ga0070682_100022247 3300005337 Bacteria 3753
56 Ga0070682_100564773 3300005337 Bacteria 893
57 Ga0068868_100000190 3300005338 Bacteria 40972
58 Ga0068868_100090967 3300005338 Bacteria 2458
59 Ga0070660_100000136 3300005339 Bacteria 46892
60 Ga0070660_100028048 3300005339 Bacteria 4209
61 Ga0070689_100011293 3300005340 Bacteria 6394
62 Ga0070689_100101186 3300005340 Bacteria 2281
63 Ga0070689_100142576 3300005340 Bacteria 1928
64 Ga0070691_10004223 3300005341 Bacteria 6531
65 Ga0070691_10149361 3300005341 Bacteria 1197
66 Ga0070687_100000483 3300005343 Bacteria 13295
67 Ga0070687_100003914 3300005343 Bacteria 5858
68 Ga0070661_100009808 3300005344 Bacteria 6639
69 Ga0070661_100048332 3300005344 Bacteria 3114
70 Ga0070661_100257764 3300005344 Bacteria 1347
71 Ga0070692_10000027 3300005345 Bacteria 27609
72 Ga0070692_10035062 3300005345 Bacteria 2538
73 Ga0070692_10225720 3300005345 Bacteria 1109
74 Ga0070668_100004099 3300005347 Bacteria 10789
75 Ga0070668_100109342 3300005347 Bacteria 2199
76 Ga0070668_100142804 3300005347 Bacteria 1930
77 Ga0070668_100153394 3300005347 Bacteria 1865
78 Ga0070668_100159068 3300005347 Bacteria 1832
79 Ga0070668_100161598 3300005347 Bacteria 1818
80 Ga0070668_100321860 3300005347 Bacteria 1302
81 Ga0070669_100001142 3300005353 Bacteria 19375
82 Ga0070675_100005715 3300005354 Bacteria 9516
83 Ga0070675_100129112 3300005354 Bacteria 2152
84 Ga0070675_100390028 3300005354 Bacteria 1241
85 Ga0070671_100001137 3300005355 Bacteria 19775
86 Ga0070671_100144079 3300005355 Bacteria 2011
87 Ga0070674_100004133 3300005356 Bacteria 8248
88 Ga0070674_100057838 3300005356 Bacteria 2693
89 Ga0070674_100059248 3300005356 Bacteria 2665
90 Ga0070674_100509911 3300005356 Bacteria 1003
91 Ga0070674_100868451 3300005356 Unclassified 784
92 Ga0070674_100922225 3300005356 Unclassified 762
93 Ga0070673_100013640 3300005364 Bacteria 5630
94 Ga0070673_100290518 3300005364 Unclassified 1436
95 Ga0070673_100513557 3300005364 Unclassified 1085
96 Ga0070673_100859085 3300005364 Bacteria 840
97 Ga0070688_100002215 3300005365 Bacteria 9810
98 Ga0070688_100034652 3300005365 Bacteria 3060
99 Ga0070688_100226420 3300005365 Bacteria 1320
100 Ga0070659_100004635 3300005366 Bacteria 9823
101 Ga0070659_100009448 3300005366 Bacteria 7163
102 Ga0070659_100137422 3300005366 Unclassified 1988
103 Ga0070667_100001898 3300005367 Bacteria 18535
104 Ga0070667_100060787 3300005367 Plasmid 3198
105 Ga0070667_100195769 3300005367 Bacteria 1792
106 Ga0070703_10033415 3300005406 Bacteria 1566
107 Ga0070709_10000219 3300005434 Bacteria 37061
108 Ga0070709_10243272 3300005434 Bacteria 1293
109 Ga0070714_100158116 3300005435 Bacteria 2048
110 Ga0070714_100527447 3300005435 Unclassified 1128
111 Ga0070713_100026963 3300005436 Bacteria 4518
112 Ga0070713_100064932 3300005436 Bacteria 3064
113 Ga0070713_100580298 3300005436 Bacteria 1064
114 Ga0070710_10006625 3300005437 Bacteria 5570
115 Ga0070701_10001666 3300005438 Bacteria 8319
116 Ga0070711_100105550 3300005439 Bacteria 2058
117 Ga0070711_100143624 3300005439 Bacteria 1792
118 Ga0070705_100000406 3300005440 Bacteria 24745
119 Ga0070705_100040084 3300005440 Bacteria 2661
120 Ga0070700_100005060 3300005441 Bacteria 6951
121 Ga0070700_100006171 3300005441 Bacteria 6384
122 Ga0070694_100073517 3300005444 Bacteria 2361
123 Ga0070694_100467911 3300005444 Unclassified 998
124 Ga0070708_100002583 3300005445 Bacteria 14014
125 Ga0070708_100314459 3300005445 Bacteria 1475
126 Ga0070663_100004773 3300005455 Bacteria 7998
127 Ga0070663_100025994 3300005455 Bacteria 3959
128 Ga0070663_100106018 3300005455 Bacteria 2105
129 Ga0070663_100224630 3300005455 Bacteria 1476
130 Ga0070678_100000233 3300005456 Bacteria 25322
131 Ga0070678_100056415 3300005456 Unclassified 2873
132 Ga0070678_100234196 3300005456 Bacteria 1532
133 Ga0070662_100008937 3300005457 Bacteria 6531
134 Ga0070662_100227894 3300005457 Bacteria 1489
135 Ga0070681_10009346 3300005458 Bacteria 9645
136 Ga0070681_10021072 3300005458 Bacteria 6530
137 Ga0070681_10047354 3300005458 Unclassified 4298
138 Ga0068867_100000306 3300005459 Bacteria 32301
139 Ga0070685_10001209 3300005466 Bacteria 13728
140 Ga0070685_10027561 3300005466 Bacteria 3141
141 Ga0070706_100020111 3300005467 Bacteria 6152
142 Ga0070706_100328116 3300005467 Bacteria 1427
143 Ga0070707_100001635 3300005468 Bacteria 21760
144 Ga0070707_100505654 3300005468 Bacteria 1170
145 Ga0070707_100778021 3300005468 Bacteria 921
146 Ga0070679_100002290 3300005530 Bacteria 17305
147 Ga0070679_100087826 3300005530 Bacteria 3097
148 Ga0070679_100227809 3300005530 Bacteria 1823
149 Ga0070684_100001097 3300005535 Bacteria 19398
150 Ga0070697_100074989 3300005536 Bacteria 2780
151 Ga0070697_100109874 3300005536 Bacteria 2296
152 Ga0068853_100000364 3300005539 Bacteria 31160
153 Ga0070672_100001950 3300005543 Bacteria 12938
154 Ga0070672_100092150 3300005543 Bacteria 2446
155 Ga0070672_100393928 3300005543 Bacteria 1186
156 Ga0070686_100004938 3300005544 Bacteria 7355
157 Ga0070686_100020979 3300005544 Bacteria 3876
158 Ga0070686_100084339 3300005544 Bacteria 2111
159 Ga0070695_100000208 3300005545 Bacteria 28669
160 Ga0070695_100109485 3300005545 Unclassified 1872
161 Ga0070695_100184509 3300005545 Bacteria 1480
162 Ga0070696_100001498 3300005546 Bacteria 15325
163 Ga0070696_100041297 3300005546 Bacteria 3187
164 Ga0070693_100000244 3300005547 Bacteria 25523
165 Ga0070693_100270705 3300005547 Bacteria 1134
166 Ga0070665_100004691 3300005548 Bacteria 14269
167 Ga0070665_100099806 3300005548 Bacteria 2907
168 Ga0070704_100001662 3300005549 Bacteria 12053
169 Ga0070704_100073935 3300005549 Bacteria 2484
170 Ga0068855_100004695 3300005563 Bacteria 16698
171 Ga0068855_100984237 3300005563 Bacteria 887
172 Ga0070664_100014605 3300005564 Bacteria 6408
173 Ga0070664_100021987 3300005564 Bacteria 5260
174 Ga0068857_100004429 3300005577 Bacteria 11876
175 Ga0068857_100602032 3300005577 Bacteria 1039
176 Ga0068854_100000949 3300005578 Bacteria 17448
177 Ga0068854_100299382 3300005578 Unclassified 1301
178 Ga0068856_100000272 3300005614 Bacteria 56279
179 Ga0068856_100066703 3300005614 Bacteria 3556
180 Ga0070702_100000106 3300005615 Bacteria 24941
181 Ga0070702_100167479 3300005615 Bacteria 1426
182 Ga0070702_100331251 3300005615 Bacteria 1065
183 Ga0068852_100001698 3300005616 Bacteria 15011
184 Ga0068852_100084296 3300005616 Bacteria 2828
185 Ga0068859_100009854 3300005617 Bacteria 9645
186 Ga0068859_100161640 3300005617 Bacteria 2318
187 Ga0068859_100666266 3300005617 Bacteria 1132
188 Ga0068859_100784872 3300005617 Bacteria 1041
189 Ga0068859_100793171 3300005617 Bacteria 1035
190 Ga0068864_100000865 3300005618 Bacteria 25493
191 Ga0068864_100416417 3300005618 Bacteria 1279
192 Ga0068866_10000143 3300005718 Bacteria 32232
193 Ga0068861_100001420 3300005719 Bacteria 15092
194 Ga0068861_100059060 3300005719 Bacteria 2935
195 Ga0068870_10000149 3300005840 Bacteria 24749
196 Ga0068863_100000337 3300005841 Bacteria 47696
197 Ga0068863_100257913 3300005841 Bacteria 1685
198 Ga0068863_100286038 3300005841 Bacteria 1598
199 Ga0068863_100532880 3300005841 Bacteria 1158
200 Ga0068858_100004259 3300005842 Bacteria 14068
201 Ga0068858_100167263 3300005842 Bacteria 2072
202 Ga0068858_100668580 3300005842 Bacteria 1010
203 Ga0068860_100014928 3300005843 Bacteria 7593
204 Ga0068860_100019560 3300005843 Bacteria 6565
205 Ga0068860_100068430 3300005843 Bacteria 3373
206 Ga0068860_100181748 3300005843 Bacteria 2032
207 Ga0068860_100699189 3300005843 Bacteria 1023
208 Ga0068862_100003109 3300005844 Bacteria 14480
209 Ga0068862_100022218 3300005844 Bacteria 5306
210 Ga0068862_100120269 3300005844 Bacteria 2314
211 Ga0068862_100330873 3300005844 Bacteria 1409
212 Ga0068862_100566750 3300005844 Unclassified 1086
213 Ga0068862_100992653 3300005844 Bacteria 830
214 Ga0068862_101195093 3300005844 Bacteria 759
215 Ga0081455_10000652 3300005937 Bacteria 45017
216 Ga0081455_10002592 3300005937 Bacteria 21435
217 Ga0081455_10015289 3300005937 Bacteria 7463
218 Ga0081455_10037342 3300005937 Bacteria 4316
219 Ga0081455_10059421 3300005937 Bacteria 3228
220 Ga0081455_10063262 3300005937 Bacteria 3105
221 Ga0081455_10182286 3300005937 Bacteria 1588
222 Ga0081540_1000067 3300005983 Bacteria 115405
223 Ga0081540_1000423 3300005983 Bacteria 41829
224 Ga0081540_1002957 3300005983 Bacteria 13633
225 Ga0081540_1018444 3300005983 Bacteria 4279
226 Ga0081540_1109864 3300005983 Bacteria 1168
227 Ga0070717_10348731 3300006028 Bacteria 1323
228 Ga0070717_10493808 3300006028 Unclassified 1106
229 Ga0075365_10032152 3300006038 Bacteria 3371
230 Ga0075365_10032280 3300006038 Bacteria 3364
231 Ga0075365_10156361 3300006038 Bacteria 1587
232 Ga0075368_10107069 3300006042 Bacteria 1151
233 Ga0075363_100076617 3300006048 Unclassified 1824
234 Ga0075364_10035752 3300006051 Bacteria 3211
235 Ga0075432_10003025 3300006058 Bacteria 5673
236 Ga0075432_10103567 3300006058 Bacteria 1054
237 Ga0070715_10022361 3300006163 Bacteria 2465
238 Ga0070715_10187569 3300006163 Unclassified 1042
239 Ga0070716_100000393 3300006173 Bacteria 17888
240 Ga0070712_100088974 3300006175 Bacteria 2257
241 Ga0070712_100109410 3300006175 Bacteria 2059
242 Ga0070712_100113199 3300006175 Bacteria 2029
243 Ga0070712_100382203 3300006175 Bacteria 1159
244 Ga0075362_10015128 3300006177 Bacteria 3133
245 Ga0075362_10024493 3300006177 Bacteria 2561
246 Ga0075369_10024665 3300006186 Bacteria 2494
247 Ga0075369_10027262 3300006186 Bacteria 2388
248 Ga0075427_10000335 3300006194 Bacteria 5162
249 Ga0075366_10017757 3300006195 Bacteria 4100
250 Ga0075366_10043755 3300006195 Bacteria 2653
251 Ga0075366_10275493 3300006195 Bacteria 1028
252 Ga0097621_100000348 3300006237 Bacteria 31809
253 Ga0097621_100043206 3300006237 Bacteria 3633
254 Ga0097621_100051827 3300006237 Bacteria 3341
255 Ga0097621_100113776 3300006237 Bacteria 2288
256 Ga0075370_10064896 3300006353 Bacteria 2083
257 Ga0068871_100003685 3300006358 Bacteria 10529
258 Ga0068871_100032239 3300006358 Bacteria 4137
259 Ga0068871_100753460 3300006358 Bacteria 895
260 Ga0075428_100016252 3300006844 Bacteria 8226
261 Ga0075428_100027553 3300006844 Bacteria 6287
262 Ga0075428_100210215 3300006844 Bacteria 2102
263 Ga0075428_100386688 3300006844 Bacteria 1500
264 Ga0075428_100709193 3300006844 Bacteria 1072
265 Ga0075430_100000011 3300006846 Bacteria 99671
266 Ga0075430_100000012 3300006846 Bacteria 94359
267 Ga0075430_100046226 3300006846 Bacteria 3677
268 Ga0075430_100116198 3300006846 Bacteria 2230
269 Ga0075430_100602571 3300006846 Bacteria 906
270 Ga0075431_100000774 3300006847 Bacteria 27749
271 Ga0075431_100023775 3300006847 Bacteria 6272
272 Ga0075433_10000106 3300006852 Bacteria 41085
273 Ga0075433_10003106 3300006852 Bacteria 12780
274 Ga0075433_10014208 3300006852 Bacteria 6500
275 Ga0075433_10228811 3300006852 Bacteria 1651
276 Ga0075434_100000114 3300006871 Bacteria 46406
277 Ga0075434_100000457 3300006871 Bacteria 30447
278 Ga0075434_100006713 3300006871 Bacteria 10572
279 Ga0075434_100019105 3300006871 Bacteria 6624
280 Ga0075434_100056523 3300006871 Bacteria 3900
281 Ga0075434_100246880 3300006871 Unclassified 1804
282 Ga0075434_100249356 3300006871 Bacteria 1795
283 Ga0075434_100252847 3300006871 Bacteria 1781
284 Ga0075429_100003564 3300006880 Bacteria 13262
285 Ga0075429_100019740 3300006880 Bacteria 5842
286 Ga0068865_100000394 3300006881 Bacteria 24342
287 Ga0068865_100481419 3300006881 Bacteria 1032
288 Ga0075436_100005428 3300006914 Bacteria 8771
289 Ga0075436_100353565 3300006914 Bacteria 1059
290 Ga0075436_100698972 3300006914 Unclassified 751
291 Ga0097620_100009854 3300006931 Bacteria 9645
292 Ga0097620_100161638 3300006931 Bacteria 2318
293 Ga0097620_100666363 3300006931 Bacteria 1132
294 Ga0097620_100784889 3300006931 Bacteria 1041
295 Ga0097620_100793166 3300006931 Bacteria 1035
296 Ga0075435_100016140 3300007076 Bacteria 5627
297 Ga0075435_100120223 3300007076 Bacteria 2191
298 Ga0075435_100204567 3300007076 Bacteria 1673
299 Ga0075435_100509383 3300007076 Unclassified 1041
300 Ga0105240_10105641 3300009093 Bacteria 3418
301 Ga0105240_10412227 3300009093 Bacteria 1519
302 Ga0111539_10000299 3300009094 Bacteria 60010
303 Ga0111539_10000581 3300009094 Bacteria 47068
304 Ga0111539_10003962 3300009094 Bacteria 19452
305 Ga0111539_10014752 3300009094 Bacteria 9746
306 Ga0111539_10066402 3300009094 Bacteria 4261
307 Ga0111539_10081875 3300009094 Bacteria 3797
308 Ga0111539_10093515 3300009094 Bacteria 3532
309 Ga0111539_10185951 3300009094 Unclassified 2426
310 Ga0111539_10211650 3300009094 Unclassified 2259
311 Ga0111539_10233060 3300009094 Bacteria 2144
312 Ga0105245_10000663 3300009098 Bacteria 31171
313 Ga0105245_10099641 3300009098 Bacteria 2687
314 Ga0105245_10121065 3300009098 Bacteria 2445
315 Ga0105245_10127180 3300009098 Bacteria 2387
316 Ga0105245_10595304 3300009098 Bacteria 1132
317 Ga0105247_10003720 3300009101 Bacteria 9896
318 Ga0105247_10029580 3300009101 Bacteria 3320
319 Ga0105247_10115761 3300009101 Unclassified 1731
320 Ga0114129_10018146 3300009147 Bacteria 10020
321 Ga0114129_10058804 3300009147 Bacteria 5376
322 Ga0114129_10108623 3300009147 Bacteria 3830
323 Ga0105243_10002452 3300009148 Bacteria 15493
324 Ga0105243_10135684 3300009148 Bacteria 2093
325 Ga0105243_10260788 3300009148 Bacteria 1551
326 Ga0105243_10267920 3300009148 Bacteria 1532
327 Ga0105241_10001566 3300009174 Bacteria 17502
328 Ga0105241_10052636 3300009174 Bacteria 3109
329 Ga0105241_10856042 3300009174 Bacteria 841
330 Ga0105242_10001341 3300009176 Bacteria 19433
331 Ga0105242_10052200 3300009176 Bacteria 3335
332 Ga0105248_10030265 3300009177 Bacteria 6044
333 Ga0105248_10078621 3300009177 Bacteria 3708
334 Ga0105248_10448799 3300009177 Unclassified 1453
335 Ga0105248_11138860 3300009177 Bacteria 882
336 Ga0105237_10007002 3300009545 Bacteria 12424
337 Ga0105237_10144737 3300009545 Bacteria 2371
338 Ga0105237_10369646 3300009545 Bacteria 1439
339 Ga0105238_10077336 3300009551 Bacteria 3319
340 Ga0105238_10096781 3300009551 Bacteria 2937
341 Ga0105238_10275498 3300009551 Unclassified 1663
342 Ga0105238_10855533 3300009551 Bacteria 927
343 Ga0105249_10074724 3300009553 Bacteria 3138
344 Ga0105249_10110065 3300009553 Bacteria 2602
345 Ga0105249_10172631 3300009553 Bacteria 2098
346 Ga0105249_10454617 3300009553 Bacteria 1320
347 Ga0105028_106036 3300009993 Bacteria 1262
348 Ga0105239_10009001 3300010375 Bacteria 11298
349 Ga0105239_10267779 3300010375 Bacteria 1921
350 Ga0105239_11114931 3300010375 Bacteria 908
351 Ga0105246_10000067 3300011119 Bacteria 42796
352 Ga0105246_10123524 3300011119 Bacteria 1922
353 Ga0105246_10266761 3300011119 Bacteria 1367
354 Ga0157346_1001624 3300012480 Bacteria 1088
355 Ga0157342_1000525 3300012507 Bacteria 2385
356 Ga0157373_10047928 3300013100 Bacteria 3046
357 Ga0157373_10122481 3300013100 Unclassified 1828
358 Ga0157371_10006720 3300013102 Bacteria 9405
359 Ga0157374_10003806 3300013296 Bacteria 12680
360 Ga0157374_10277022 3300013296 Bacteria 1655
361 Ga0157374_10662263 3300013296 Unclassified 1056
362 Ga0157378_10061922 3300013297 Unclassified 3341
363 Ga0157378_10067095 3300013297 Bacteria 3214
364 Ga0163162_10001721 3300013306 Bacteria 20501
365 Ga0163162_10103483 3300013306 Bacteria 2942
366 Ga0163162_10343712 3300013306 Bacteria 1625
367 Ga0163162_10607519 3300013306 Unclassified 1219
368 Ga0163162_10759047 3300013306 Bacteria 1089
369 Ga0157372_10010547 3300013307 Bacteria 9829
370 Ga0157372_10176767 3300013307 Bacteria 2471
371 Ga0157375_10002665 3300013308 Bacteria 15472
372 Ga0157375_10057946 3300013308 Unclassified 3831
373 Ga0157375_10318441 3300013308 Bacteria 1720
374 Ga0157375_10324001 3300013308 Unclassified 1705
375 Ga0157375_10531921 3300013308 Bacteria 1338
376 Ga0157375_11743989 3300013308 Bacteria 738
377 Ga0163163_10009638 3300014325 Bacteria 8638
378 Ga0163163_10010130 3300014325 Bacteria 8456
379 Ga0163163_10098867 3300014325 Bacteria 2939
380 Ga0157380_10000049 3300014326 Bacteria 71296
381 Ga0157380_10286160 3300014326 Bacteria 1511
382 Ga0157380_10479340 3300014326 Bacteria 1203
383 Ga0182008_10185081 3300014497 Bacteria 1055
384 Ga0157377_10000053 3300014745 Bacteria 89091
385 Ga0157379_10000306 3300014968 Bacteria 38858
386 Ga0157379_10085760 3300014968 Unclassified 2823
387 Ga0157379_10420972 3300014968 Bacteria 1230
388 Ga0157376_10000099 3300014969 Bacteria 62912
389 Ga0157376_10043248 3300014969 Bacteria 3696
390 Ga0157376_10169805 3300014969 Unclassified 1985
391 Ga0157376_10258346 3300014969 Bacteria 1630
392 Ga0163161_10001833 3300017792 Bacteria 15530
393 Ga0163161_10406553 3300017792 Unclassified 1092
394 Ga0213874_10094993 3300021377 Bacteria 984
395 Ga0213876_10047611 3300021384 Unclassified 2266
396 Ga0213876_10072502 3300021384 Bacteria 1819
397 Ga0213875_10001022 3300021388 Bacteria 19839
398 Ga0207666_1000013 3300025271 Bacteria 42350
399 Ga0207666_1000335 3300025271 Bacteria 6447
400 Ga0207673_1000362 3300025290 Plasmid 4577
401 Ga0209758_1049818 3300025297 Bacteria 1474
402 Ga0207697_10000042 3300025315 Bacteria 48485
403 Ga0207713_1167238 3300025735 Bacteria 696
404 Ga0207653_10008834 3300025885 Plasmid 3141
405 Ga0207682_10000089 3300025893 Bacteria 41721
406 Ga0207692_10013104 3300025898 Bacteria 3587
407 Ga0207642_10001638 3300025899 Bacteria 6898
408 Ga0207710_10000812 3300025900 Bacteria 16914
409 Ga0207710_10104458 3300025900 Unclassified 1340
410 Ga0207688_10000460 3300025901 Bacteria 19414
411 Ga0207688_10177139 3300025901 Bacteria 1270
412 Ga0207680_10006724 3300025903 Bacteria 5579
413 Ga0207647_10003720 3300025904 Bacteria 11405
414 Ga0207647_10010565 3300025904 Bacteria 6514
415 Ga0207685_10019368 3300025905 Bacteria 2242
416 Ga0207685_10144159 3300025905 Bacteria 1071
417 Ga0207699_10013829 3300025906 Bacteria 4143
418 Ga0207645_10000162 3300025907 Bacteria 52720
419 Ga0207645_10380165 3300025907 Bacteria 948
420 Ga0207643_10000404 3300025908 Bacteria 28726
421 Ga0207643_10082041 3300025908 Bacteria 1869
422 Ga0207684_10010101 3300025910 Bacteria 8315
423 Ga0207654_10001699 3300025911 Bacteria 11497
424 Ga0207654_10342149 3300025911 Unclassified 1028
425 Ga0207707_10011189 3300025912 Bacteria 7806
426 Ga0207707_10050436 3300025912 Bacteria 3625
427 Ga0207695_10183649 3300025913 Bacteria 2011
428 Ga0207671_10163052 3300025914 Unclassified 1727
429 Ga0207693_10047617 3300025915 Bacteria 3368
430 Ga0207693_10058154 3300025915 Bacteria 3029
431 Ga0207693_10075248 3300025915 Bacteria 2644
432 Ga0207663_10119293 3300025916 Bacteria 1803
433 Ga0207660_10000007 3300025917 Bacteria 102878
434 Ga0207660_10017339 3300025917 Bacteria 4783
435 Ga0207660_10333683 3300025917 Unclassified 1213
436 Ga0207660_10438613 3300025917 Bacteria 1055
437 Ga0207662_10000458 3300025918 Bacteria 18137
438 Ga0207662_10264607 3300025918 Bacteria 1133
439 Ga0207657_10010273 3300025919 Bacteria 9344
440 Ga0207657_10019106 3300025919 Bacteria 6518
441 Ga0207649_10000048 3300025920 Bacteria 110714
442 Ga0207649_10000305 3300025920 Bacteria 37712
443 Ga0207649_10032748 3300025920 Bacteria 3101
444 Ga0207652_10002194 3300025921 Bacteria 16673
445 Ga0207652_10403666 3300025921 Bacteria 1233
446 Ga0207646_10783717 3300025922 Bacteria 850
447 Ga0207681_10000116 3300025923 Bacteria 67094
448 Ga0207681_10032505 3300025923 Bacteria 3417
449 Ga0207681_10115806 3300025923 Bacteria 1957
450 Ga0207694_10048904 3300025924 Bacteria 3273
451 Ga0207694_10185136 3300025924 Unclassified 1690
452 Ga0207650_10035382 3300025925 Bacteria 3626
453 Ga0207650_10502015 3300025925 Bacteria 1014
454 Ga0207650_10516723 3300025925 Bacteria 999
455 Ga0207659_10000155 3300025926 Bacteria 40671
456 Ga0207687_10000090 3300025927 Bacteria 66310
457 Ga0207687_10058667 3300025927 Bacteria 2709
458 Ga0207687_10185878 3300025927 Bacteria 1613
459 Ga0207700_10016325 3300025928 Bacteria 4930
460 Ga0207700_10067946 3300025928 Bacteria 2730
461 Ga0207700_10793565 3300025928 Bacteria 847
462 Ga0207664_10170356 3300025929 Unclassified 1863
463 Ga0207644_10000251 3300025931 Bacteria 36497
464 Ga0207644_10047828 3300025931 Unclassified 3055
465 Ga0207644_10212125 3300025931 Bacteria 1531
466 Ga0207690_10000320 3300025932 Bacteria 32219
467 Ga0207690_10039510 3300025932 Bacteria 3079
468 Ga0207690_10109796 3300025932 Unclassified 1985
469 Ga0207706_10001307 3300025933 Bacteria 25000
470 Ga0207706_10013231 3300025933 Bacteria 7505
471 Ga0207706_10021126 3300025933 Bacteria 5848
472 Ga0207706_10099363 3300025933 Bacteria 2560
473 Ga0207686_10001488 3300025934 Bacteria 13216
474 Ga0207686_10024689 3300025934 Bacteria 3486
475 Ga0207686_10280720 3300025934 Bacteria 1229
476 Ga0207686_10330780 3300025934 Unclassified 1141
477 Ga0207709_10000081 3300025935 Bacteria 164427
478 Ga0207709_10075917 3300025935 Bacteria 2150
479 Ga0207670_10000096 3300025936 Bacteria 60650
480 Ga0207670_10112791 3300025936 Bacteria 1962
481 Ga0207669_10000136 3300025937 Bacteria 35030
482 Ga0207669_10234658 3300025937 Unclassified 1356
483 Ga0207669_10469904 3300025937 Bacteria 1000
484 Ga0207704_10000215 3300025938 Bacteria 28899
485 Ga0207665_10000555 3300025939 Bacteria 25158
486 Ga0207665_10152493 3300025939 Bacteria 1656
487 Ga0207691_10000829 3300025940 Bacteria 30864
488 Ga0207691_10251467 3300025940 Unclassified 1526
489 Ga0207711_10016986 3300025941 Bacteria 6045
490 Ga0207711_10730816 3300025941 Bacteria 923
491 Ga0207689_10000766 3300025942 Bacteria 30838
492 Ga0207689_10141527 3300025942 Bacteria 1982
493 Ga0207689_10179655 3300025942 Bacteria 1745
494 Ga0207661_10000170 3300025944 Bacteria 41868
495 Ga0207679_10000090 3300025945 Bacteria 79412
496 Ga0207679_10293780 3300025945 Unclassified 1398
497 Ga0207679_10518951 3300025945 Bacteria 1065
498 Ga0207667_10002635 3300025949 Bacteria 22193
499 Ga0207667_11145459 3300025949 Bacteria 759
500 Ga0207651_10001086 3300025960 Bacteria 12065
501 Ga0207651_10207194 3300025960 Unclassified 1576
502 Ga0207651_10316088 3300025960 Unclassified 1304
503 Ga0207712_10000495 3300025961 Bacteria 32538
504 Ga0207712_10052703 3300025961 Bacteria 2851
505 Ga0207712_10149273 3300025961 Bacteria 1804
506 Ga0207712_10280458 3300025961 Bacteria 1360
507 Ga0207668_10000133 3300025972 Bacteria 52202
508 Ga0207668_10058457 3300025972 Bacteria 2695
509 Ga0207668_10069173 3300025972 Bacteria 2513
510 Ga0207668_10138270 3300025972 Bacteria 1869
511 Ga0207668_10961466 3300025972 Bacteria 762
512 Ga0207640_10000191 3300025981 Bacteria 43590
513 Ga0207658_10006088 3300025986 Bacteria 8236
514 Ga0207658_10074280 3300025986 Unclassified 2583
515 Ga0207677_10002370 3300026023 Bacteria 9866
516 Ga0207703_10000560 3300026035 Bacteria 38205
517 Ga0207703_10382919 3300026035 Bacteria 1301
518 Ga0207703_10528498 3300026035 Bacteria 1110
519 Ga0207639_10004165 3300026041 Bacteria 9732
520 Ga0207678_10000197 3300026067 Bacteria 52596
521 Ga0207678_10012097 3300026067 Bacteria 7577
522 Ga0207678_10053934 3300026067 Unclassified 3463
523 Ga0207678_10055490 3300026067 Bacteria 3413
524 Ga0207678_10065630 3300026067 Bacteria 3116
525 Ga0207678_10222487 3300026067 Bacteria 1616
526 Ga0207708_10000947 3300026075 Bacteria 21738
527 Ga0207708_10010717 3300026075 Bacteria 6813
528 Ga0207702_10001076 3300026078 Bacteria 27955
529 Ga0207702_10085606 3300026078 Bacteria 2747
530 Ga0207641_10003500 3300026088 Bacteria 13898
531 Ga0207641_10091654 3300026088 Bacteria 2660
532 Ga0207648_10001359 3300026089 Bacteria 27051
533 Ga0207648_10272879 3300026089 Bacteria 1511
534 Ga0207648_10675299 3300026089 Bacteria 956
535 Ga0207676_10000993 3300026095 Bacteria 21871
536 Ga0207676_10186429 3300026095 Bacteria 1821
537 Ga0207676_11227056 3300026095 Bacteria 744
538 Ga0207674_10001393 3300026116 Bacteria 31147
539 Ga0207674_10367071 3300026116 Bacteria 1391
540 Ga0207675_100003415 3300026118 Bacteria 15506
541 Ga0207675_100113178 3300026118 Bacteria 2562
542 Ga0207675_100310588 3300026118 Bacteria 1537
543 Ga0207683_10000141 3300026121 Bacteria 59587
544 Ga0207683_10031636 3300026121 Unclassified 4592
545 Ga0207683_10389014 3300026121 Bacteria 1282
546 Ga0207683_10534181 3300026121 Bacteria 1084
547 Ga0207698_10015513 3300026142 Bacteria 5103
548 Ga0207698_10158498 3300026142 Bacteria 1976
549 Ga0209281_1000798 3300027111 Bacteria 29423
550 Ga0210002_1002952 3300027617 Bacteria 2489
551 Ga0209983_1009812 3300027665 Bacteria 1957
552 Ga0209971_1004860 3300027682 Bacteria 3193
553 Ga0209966_1023433 3300027695 Bacteria 1213
554 Ga0209998_10001984 3300027717 Bacteria 4800
555 Ga0209974_10000295 3300027876 Bacteria 16234
556 Ga0209974_10009249 3300027876 Bacteria 3345
557 Ga0209974_10084141 3300027876 Bacteria 1098
558 Ga0209974_10084240 3300027876 Bacteria 1097
559 Ga0207428_10000011 3300027907 Bacteria 354388
560 Ga0207428_10000046 3300027907 Bacteria 191032
561 Ga0207428_10000058 3300027907 Bacteria 158579
562 Ga0207428_10013808 3300027907 Bacteria 7038
563 Ga0207428_10019079 3300027907 Bacteria 5849
564 Ga0207428_10026193 3300027907 Bacteria 4870
565 Ga0207428_10382485 3300027907 Bacteria 1032
566 Ga0268266_10004115 3300028379 Bacteria 14049
567 Ga0268266_10099297 3300028379 Bacteria 2562
568 Ga0268266_11239572 3300028379 Unclassified 721
569 Ga0268265_10000405 3300028380 Bacteria 46127
570 Ga0268265_10280447 3300028380 Bacteria 1491
571 Ga0268265_10364213 3300028380 Bacteria 1324
572 Ga0268265_10518859 3300028380 Bacteria 1126
573 Ga0268265_10541348 3300028380 Unclassified 1104
574 Ga0268265_10925299 3300028380 Bacteria 857
575 Ga0268264_10000340 3300028381 Bacteria 71850
576 Ga0268264_10064242 3300028381 Bacteria 3088
577 Ga0268264_10069042 3300028381 Bacteria 2988
578 Ga0268264_10106607 3300028381 Bacteria 2446
579 Ga0268264_10135420 3300028381 Bacteria 2189
580 Ga0307515_10307996 3300028794 Bacteria 1262
581 Ga0265339_10019194 3300031249 Bacteria 4016
582 Ga0307509_10141941 3300031507 Bacteria 2335
583 Ga0307408_100192587 3300031548 Bacteria 1644
584 Ga0265313_10207709 3300031595 Bacteria 812
585 Ga0265314_10001316 3300031711 Bacteria 28132
586 Ga0307413_10023977 3300031824 Bacteria 3317
587 Ga0307406_10634203 3300031901 Bacteria 885
588 Ga0307409_100559873 3300031995 Bacteria 1124
589 Ga0307416_100233336 3300032002 Bacteria 1776
590 Ga0307415_100143933 3300032126 Bacteria 1825
591 Ga0307510_10028469 3300033180 Bacteria 6381
592 Ga0373930_0010291 3300034816 Bacteria 1670
593 Ga0373930_0013741 3300034816 Bacteria 1497
594 Ga0373930_0016518 3300034816 Bacteria 1397
595 Ga0373930_0018237 3300034816 Bacteria 1347
596 Ga0373948_0000122 3300034817 Bacteria 8139
597 Ga0373948_0011217 3300034817 Bacteria 1580
598 Ga0373950_0016865 3300034818 Bacteria 1252
599 Ga0373958_0000878 3300034819 Bacteria 3871
600 Ga0373958_0001381 3300034819 Bacteria 3253
601 Ga0373958_0002849 3300034819 Bacteria 2462
602 Ga0373959_0026942 3300034820 Bacteria 1138
603 Ga0373938_0000445 3300034957 Bacteria 6730
604 Ga0373938_0001301 3300034957 Plasmid 4008
605 Ga0373938_0030907 3300034957 Bacteria 1146
606 Ga0373926_0003607 3300035083 Bacteria 5023
607 Ga0373928_0000382 3300035084 Bacteria 8856
608 Ga0373928_0000518 3300035084 Bacteria 7562
609 Ga0373928_0047313 3300035084 Bacteria 1006
610 Ga0373929_0001453 3300035085 Bacteria 4515
611 Ga0373934_0008308 3300035086 Bacteria 3868
612 Ga0373940_0003445 3300035088 Bacteria 3232
613 Ga0373940_0016520 3300035088 Bacteria 1829
614 Ga0373940_0019070 3300035088 Bacteria 1728
615 Ga0373944_0008713 3300035089 Bacteria 2741
616 Ga0373949_0000549 3300035090 Bacteria 12349
617 Ga0373949_0001748 3300035090 Bacteria 5997
618 Ga0373949_0004482 3300035090 Bacteria 3198
619 Ga0373951_0000836 3300035091 Bacteria 8375
620 Ga0373951_0001355 3300035091 Bacteria 6438
621 Ga0373951_0012008 3300035091 Bacteria 1948
622 Ga0373952_0001852 3300035092 Bacteria 3840
623 Ga0373952_0025224 3300035092 Bacteria 1282
624 Ga0373923_0013462 3300035111 Bacteria 3050
625 Ga0373932_0003013 3300035112 Bacteria 4126
626 Ga0373936_0161555 3300035113 Unclassified 976
627 Ga0373936_0221720 3300035113 Unclassified 839
628 Ga0373939_0000480 3300035114 Bacteria 10073
629 Ga0373939_0001023 3300035114 Bacteria 6892
630 Ga0373939_0005478 3300035114 Bacteria 3024
631 Ga0373939_0012689 3300035114 Bacteria 2153
632 Ga0373939_0018099 3300035114 Bacteria 1882
633 Ga0373939_0065299 3300035114 Bacteria 1170
634 Ga0373941_0001109 3300035115 Bacteria 5615
635 Ga0373941_0005005 3300035115 Bacteria 3089
636 Ga0373941_0034832 3300035115 Bacteria 1521
637 Ga0373941_0041808 3300035115 Bacteria 1420
638 Ga0373945_0005322 3300035116 Unclassified 4118
639 Ga0373945_0012002 3300035116 Bacteria 2871
640 Ga0373953_0017859 3300035117 Unclassified 2615
641 Ga0373954_0010963 3300035118 Bacteria 4009
642 Ga0373956_0004865 3300035119 Bacteria 5378
643 Ga0373960_0000075 3300035121 Bacteria 14451
644 Ga0373960_0000089 3300035121 Bacteria 13897
645 Ga0373960_0014490 3300035121 Bacteria 1999
646 Ga0373943_0009289 3300035170 Bacteria 4406
647 Ga0373943_0057874 3300035170 Unclassified 1927
648 Ga0373943_0090406 3300035170 Bacteria 1585
649 Ga0373946_0012892 3300035171 Unclassified 3134
650 Ga0373946_0016087 3300035171 Bacteria 2845
651 Ga0373946_0037721 3300035171 Unclassified 1965
652 Ga0373946_0053076 3300035171 Bacteria 1702
653 Ga0373955_0001327 3300035172 Bacteria 10492
654 Ga0373955_0406645 3300035172 Bacteria 827
655 Ga0373942_0001936 3300035207 Bacteria 5183
656 Ga0373942_0004729 3300035207 Bacteria 3158
657 Ga0373961_0000902 3300035241 Bacteria 9951
658 Ga0373961_0007325 3300035241 Bacteria 2667
659 Ga0373961_0135741 3300035241 Bacteria 827
660 Ga0373961_0210145 3300035241 Unclassified 690
661 Ga0373962_0038458 3300035242 Unclassified 1339
662 Ga0373924_0084664 3300035410 Bacteria 1352
663 Ga0373931_0001924 3300035691 Bacteria 9092
664 Ga0373931_0004146 3300035691 Bacteria 6581
665 Ga0373931_0011110 3300035691 Bacteria 4342
666 Ga0373931_0011894 3300035691 Bacteria 4209
667 Ga0373931_0058402 3300035691 Bacteria 2072
668 Ga0373931_0151259 3300035691 Unclassified 1353
669 Ga0373935_0028883 3300035692 Bacteria 3429
670 Ga0373927_0018418 3300035695 Bacteria 4590
671 Ga0373927_0087402 3300035695 Unclassified 2023
672 Ga0373927_0155320 3300035695 Bacteria 1498
673 Ga0373933_0017691 3300035724 Unclassified 3998
674 Ga0373947_0002148 3300035725 Bacteria 11979
675 Ga0373947_0028164 3300035725 Bacteria 3291
676 Ga0373947_0045145 3300035725 Unclassified 2636
677 Ga0373937_0009181 3300036401 Bacteria 8582
678 Ga0373937_0177070 3300036401 Bacteria 2002
679 Ga0373937_0392084 3300036401 Unclassified 1317
680 Ga0373925_0006522 3300037068 Bacteria 8579
681 Ga0373925_0506638 3300037068 Bacteria 991
682 Ga0373925_0863838 3300037068 Bacteria 746
683 Ga0436364_0910105 3300037853 Bacteria 26232
684 Ga0436365_1347068 3300039437 Bacteria 3830
685 Ga0436365_1803148 3300039437 Bacteria 9277
686 Ga0436360_0266827 3300039438 Bacteria 799
687 Ga0436360_0519909 3300039438 Bacteria 957
688 Ga0436360_1162768 3300039438 Bacteria 774
689 Ga0436361_0920118 3300039447 Bacteria 957
690 Ga0436363_0682568 3300039450 Bacteria 980
691 Ga0439465_0176637 3300041413 Bacteria 771
692 Ga0453684_0265518 3300044712 Bacteria 1964
693 Ga0451576_0060211 3300045051 Bacteria 3961
694 Ga0495617_079479 3300046452 Bacteria 1075
695 Ga0495592_0086424 3300046454 Unclassified 2258
696 Ga0495592_0297363 3300046454 Unclassified 1050
697 Ga0495603_0001480 3300046455 Bacteria 13683
698 Ga0495603_0026989 3300046455 Bacteria 3467
699 Ga0495603_0027316 3300046455 Bacteria 3445
700 Ga0495629_0000577 3300046459 Bacteria 29743
701 Ga0495629_0011542 3300046459 Bacteria 6416
702 Ga0495629_0014609 3300046459 Bacteria 5649
703 Ga0495629_0099945 3300046459 Bacteria 2024
704 Ga0495629_0113663 3300046459 Bacteria 1887
705 Ga0495629_0442858 3300046459 Bacteria 880
706 Ga0495638_0316536 3300046460 Bacteria 835
707 Ga0495641_0020479 3300046461 Bacteria 3353
708 Ga0495641_0125770 3300046461 Unclassified 1144
709 Ga0495651_0016582 3300046462 Bacteria 5705
710 Ga0495651_0021029 3300046462 Bacteria 5066
711 Ga0495653_0018024 3300046463 Bacteria 5739
712 Ga0495653_0032171 3300046463 Unclassified 4167
713 Ga0495580_0085247 3300046472 Unclassified 2201
714 Ga0495580_0136167 3300046472 Bacteria 1703
715 Ga0495580_0155060 3300046472 Bacteria 1586
716 Ga0495582_0001176 3300046473 Bacteria 14741
717 Ga0495582_0023392 3300046473 Bacteria 3380
718 Ga0495582_0039234 3300046473 Bacteria 2607
719 Ga0495582_0203965 3300046473 Bacteria 1129
720 Ga0495639_0002484 3300046475 Bacteria 8044
721 Ga0495639_0009978 3300046475 Bacteria 4080
722 Ga0495639_0111506 3300046475 Unclassified 1298
723 Ga0495662_0004481 3300046476 Bacteria 7009
724 Ga0495662_0015970 3300046476 Unclassified 3642
725 Ga0495664_0009662 3300046477 Bacteria 5400
726 Ga0495664_0025843 3300046477 Unclassified 3419
727 Ga0495664_0027938 3300046477 Bacteria 3292
728 Ga0495664_0138755 3300046477 Bacteria 1473
729 Ga0495584_0117787 3300046491 Bacteria 1345
730 Ga0495584_0129218 3300046491 Bacteria 1281
731 Ga0495585_0020294 3300046492 Unclassified 3822
732 Ga0495585_0073242 3300046492 Bacteria 1865
733 Ga0495594_0005733 3300046499 Bacteria 6380
734 Ga0495594_0008519 3300046499 Bacteria 5287
735 Ga0495594_0073750 3300046499 Bacteria 1900
736 Ga0495594_0083682 3300046499 Unclassified 1783
737 Ga0495607_0030536 3300046501 Unclassified 3307
738 Ga0495583_0020981 3300046506 Bacteria 3368
739 Ga0495606_0007302 3300046507 Bacteria 9950
740 Ga0495606_0017684 3300046507 Bacteria 5380
741 Ga0495608_0000688 3300046511 Bacteria 23406
742 Ga0495616_0211269 3300046513 Bacteria 849
743 Ga0495618_0002700 3300046514 Bacteria 11310
744 Ga0495618_0153605 3300046514 Unclassified 1470
745 Ga0495620_0016304 3300046515 Bacteria 3731
746 Ga0495620_0152568 3300046515 Unclassified 900
747 Ga0495628_0023438 3300046516 Bacteria 5067
748 Ga0495628_0053287 3300046516 Unclassified 3193
749 Ga0495628_0081037 3300046516 Bacteria 2521
750 Ga0495630_0014202 3300046517 Bacteria 5798
751 Ga0495630_0077429 3300046517 Bacteria 2507
752 Ga0495631_0121585 3300046518 Unclassified 1123
753 Ga0495631_0152386 3300046518 Bacteria 992
754 Ga0495632_0080940 3300046519 Bacteria 1549
755 Ga0495644_0034138 3300046523 Unclassified 1920
756 Ga0495663_0019753 3300046525 Unclassified 1931
757 Ga0495666_0015245 3300046526 Unclassified 3828
758 Ga0495666_0044191 3300046526 Bacteria 2151
759 Ga0495666_0058094 3300046526 Bacteria 1851
760 Ga0495652_0011434 3300046529 Bacteria 8029
761 Ga0495652_0045348 3300046529 Unclassified 3780
762 Ga0495652_0066312 3300046529 Bacteria 3030
763 Ga0495652_0209603 3300046529 Bacteria 1472
764 Ga0495654_0000195 3300046530 Bacteria 59404
765 Ga0495665_0002695 3300046531 Bacteria 9573
766 Ga0495665_0017690 3300046531 Bacteria 3832
767 Ga0495665_0021884 3300046531 Unclassified 3438
768 Ga0495640_0013114 3300046533 Bacteria 6308
769 Ga0495640_0035222 3300046533 Bacteria 3543
770 Ga0495640_0057166 3300046533 Bacteria 2663
771 Ga0495640_0112913 3300046533 Unclassified 1773
772 Ga0495640_0228658 3300046533 Unclassified 1171
773 Ga0495587_0000534 3300046536 Bacteria 26299
774 Ga0495587_0031195 3300046536 Unclassified 3229
775 Ga0495587_0284282 3300046536 Bacteria 927
776 Ga0495598_0003289 3300046537 Bacteria 3417
777 Ga0495609_0017146 3300046538 Unclassified 3366
778 Ga0495597_0071280 3300046542 Bacteria 1497
779 Ga0495645_0001860 3300046543 Bacteria 14334
780 Ga0495645_0021703 3300046543 Bacteria 4641
781 Ga0495645_0043596 3300046543 Bacteria 3273
782 Ga0495645_0155632 3300046543 Unclassified 1584
783 Ga0495622_0043467 3300046557 Bacteria 2089
784 Ga0495622_0060544 3300046557 Bacteria 1753
785 Ga0495622_0139419 3300046557 Unclassified 1101
786 Ga0495633_0058533 3300046558 Unclassified 1808
787 Ga0495633_0223191 3300046558 Bacteria 862
788 Ga0495667_0000771 3300046559 Bacteria 20558
789 Ga0495667_0014884 3300046559 Bacteria 5256
790 Ga0495656_0006096 3300046615 Unclassified 4206
791 Ga0495656_0019409 3300046615 Bacteria 2624
792 Ga0495668_0390015 3300046616 Bacteria 765
793 Ga0495634_0011864 3300046642 Bacteria 6332
794 Ga0495634_0047044 3300046642 Bacteria 2908
795 Ga0495634_0120345 3300046642 Unclassified 1681
796 Ga0495625_0001908 3300046660 Bacteria 23568
797 Ga0495625_0268164 3300046660 Bacteria 1103
798 Ga0495635_0003284 3300046663 Bacteria 11171
799 Ga0495635_0018011 3300046663 Bacteria 4930
800 Ga0495635_0034629 3300046663 Bacteria 3503
801 Ga0495635_0072756 3300046663 Bacteria 2355
802 Ga0495659_0017252 3300046664 Unclassified 2390
803 Ga0495659_0025182 3300046664 Bacteria 2035
804 Ga0495659_0099928 3300046664 Bacteria 1123
805 Ga0495661_0269871 3300046665 Bacteria 861
806 Ga0495588_0033487 3300046674 Bacteria 2595
807 Ga0495588_0094496 3300046674 Unclassified 1567
808 Ga0495588_0259057 3300046674 Bacteria 917
809 Ga0495657_0001333 3300046675 Bacteria 21487
810 Ga0495657_0284048 3300046675 Unclassified 990
811 Ga0495599_0046612 3300046678 Unclassified 2718
812 Ga0495599_0055821 3300046678 Bacteria 2472
813 Ga0495599_0087262 3300046678 Bacteria 1948
814 Ga0495599_0090822 3300046678 Unclassified 1905
815 Ga0495623_0000354 3300046679 Bacteria 30302
816 Ga0495646_0004095 3300046680 Bacteria 9146
817 Ga0495646_0046680 3300046680 Unclassified 2639
818 Ga0495646_0142667 3300046680 Bacteria 1338
819 Ga0495647_0020517 3300046681 Unclassified 2372
820 Ga0495647_0029475 3300046681 Bacteria 2029
821 Ga0495647_0093073 3300046681 Unclassified 1238
822 Ga0495658_0000944 3300046683 Bacteria 15496
823 Ga0495658_0026428 3300046683 Bacteria 3111
824 Ga0495658_0027655 3300046683 Unclassified 3054
825 Ga0495658_0348119 3300046683 Unclassified 941
826 Ga0495669_0083595 3300046684 Bacteria 1467
827 Ga0495624_0002092 3300046690 Bacteria 15220
828 Ga0495670_0034592 3300046691 Unclassified 2517
829 Ga0495670_0069341 3300046691 Bacteria 1783
830 Ga0495671_0216005 3300046692 Unclassified 929
831 Ga0495649_0204497 3300046694 Bacteria 1025
832 Ga0495589_0044030 3300046794 Unclassified 2221
833 Ga0495600_0001299 3300046809 Bacteria 13803
834 Ga0495600_0005531 3300046809 Bacteria 7623
835 Ga0495660_0019580 3300046810 Bacteria 3885
836 Ga0495581_0003049 3300047315 Bacteria 9597
837 Ga0495581_0093984 3300047315 Unclassified 1740
838 Ga0495581_0218689 3300047315 Bacteria 1114
839 Ga0495581_0244815 3300047315 Bacteria 1048
840 Ga0495604_0003048 3300047317 Bacteria 13390
841 Ga0495604_0118199 3300047317 Bacteria 1922
842 Ga0495604_0370935 3300047317 Unclassified 947
843 Ga0495604_0506510 3300047317 Bacteria 782
844 Ga0495636_0019523 3300047318 Bacteria 2725
845 Ga0495674_0003671 3300047319 Bacteria 14931
846 Ga0495674_0008886 3300047319 Bacteria 9554
847 Ga0495674_0019619 3300047319 Bacteria 6273
848 Ga0495674_0129891 3300047319 Bacteria 2123
849 Ga0495676_0046504 3300047321 Bacteria 3521
850 Ga0495676_0139063 3300047321 Bacteria 1742
851 Ga0495680_0021289 3300047322 Bacteria 5431
852 Ga0495680_0022905 3300047322 Bacteria 5201
853 Ga0495680_0024262 3300047322 Bacteria 5032
854 Ga0495680_0508285 3300047322 Bacteria 817
855 Ga0495675_0000892 3300047444 Bacteria 18258
856 Ga0495679_029342 3300047446 Unclassified 1795
857 Ga0495673_0086286 3300047469 Bacteria 1290
858 Ga0495684_0000517 3300047471 Bacteria 31334
859 Ga0495684_0027435 3300047471 Bacteria 4372
860 Ga0495684_0063404 3300047471 Bacteria 2810
861 Ga0495684_0212214 3300047471 Bacteria 1423
862 Ga0495684_0394881 3300047471 Bacteria 972
863 Ga0495686_0229662 3300047472 Bacteria 1051
864 Ga0495593_0002569 3300047673 Bacteria 10905
865 Ga0495593_0005851 3300047673 Bacteria 7247
866 Ga0495593_0040189 3300047673 Bacteria 2519
867 Ga0495602_0004679 3300048088 Bacteria 14292
868 Ga0495614_0023650 3300048089 Bacteria 2653
869 Ga0495614_0047452 3300048089 Unclassified 1842
870 Ga0496100_0000589 3300048903 Bacteria 17151
871 Ga0496100_0036216 3300048903 Bacteria 3110
872 Ga0496100_0077681 3300048903 Unclassified 2232
873 Ga0496100_0484123 3300048903 Bacteria 952
874 Ga0496101_0000782 3300048904 Bacteria 18836
875 Ga0496101_0003150 3300048904 Bacteria 10204
876 Ga0496101_0372589 3300048904 Bacteria 1123
877 Ga0496101_0487180 3300048904 Bacteria 974
878 Ga0496102_0004682 3300048905 Bacteria 11571
879 Ga0496102_0013897 3300048905 Bacteria 6984
880 Ga0496102_0092192 3300048905 Bacteria 2805
881 Ga0496103_0054684 3300048906 Bacteria 2474
882 Ga0496103_0079993 3300048906 Unclassified 2054
883 Ga0496103_0153282 3300048906 Bacteria 1476
884 Ga0496104_0031877 3300048907 Bacteria 4903
885 Ga0496104_0033611 3300048907 Bacteria 4779
886 Ga0496104_0092517 3300048907 Bacteria 2891
887 Ga0496104_0337650 3300048907 Bacteria 1420
888 Ga0496104_0452160 3300048907 Bacteria 1196
889 Ga0496105_0161814 3300048908 Bacteria 1837
890 Ga0496106_0028579 3300048909 Bacteria 4154
891 Ga0496106_0049812 3300048909 Bacteria 3156
892 Ga0496106_0157465 3300048909 Bacteria 1794
893 Ga0496106_0284695 3300048909 Bacteria 1324
894 Ga0496106_0670576 3300048909 Bacteria 828
895 Ga0496107_0013677 3300048910 Bacteria 5674
896 Ga0496107_0025804 3300048910 Bacteria 4163
897 Ga0496107_0038274 3300048910 Bacteria 3442
898 Ga0496107_0164033 3300048910 Bacteria 1647
899 Ga0496107_0298937 3300048910 Bacteria 1198
900 Ga0496107_0609139 3300048910 Bacteria 807
901 Ga0496108_0006294 3300048911 Bacteria 9623
902 Ga0496108_0008390 3300048911 Bacteria 8382
903 Ga0496108_0106283 3300048911 Bacteria 2397
904 Ga0496108_0261326 3300048911 Unclassified 1506
905 Ga0496109_0000500 3300048912 Bacteria 33553
906 Ga0496109_0001328 3300048912 Bacteria 20394
907 Ga0496109_0016249 3300048912 Bacteria 6506
908 Ga0496109_0164387 3300048912 Unclassified 2080
909 Ga0496109_0184996 3300048912 Bacteria 1957
910 Ga0496109_0473347 3300048912 Bacteria 1183
911 Ga0496109_0486019 3300048912 Bacteria 1166
912 Ga0496109_0634857 3300048912 Unclassified 1005
913 Ga0496110_0044003 3300048913 Bacteria 3899
914 Ga0496111_0073039 3300048914 Bacteria 2497
915 Ga0496111_0202296 3300048914 Bacteria 1476
916 Ga0496112_0019146 3300048915 Bacteria 6454
917 Ga0496112_0451689 3300048915 Unclassified 1223
918 Ga0496113_0005457 3300048916 Bacteria 7932
919 Ga0496113_0059992 3300048916 Bacteria 2866
920 Ga0496114_0000544 3300048917 Bacteria 27873
921 Ga0496114_0016176 3300048917 Bacteria 6005
922 Ga0496114_0036286 3300048917 Bacteria 4074
923 Ga0496114_0548881 3300048917 Unclassified 1021
924 Ga0496115_0033087 3300048918 Bacteria 4080
925 Ga0496115_0100759 3300048918 Bacteria 2368
926 Ga0496115_0108637 3300048918 Bacteria 2277
927 Ga0496115_0141919 3300048918 Bacteria 1982
928 Ga0496115_0154440 3300048918 Bacteria 1895
929 Ga0496117_0290388 3300048920 Bacteria 871
930 Ga0496119_0290424 3300048922 Bacteria 810
931 Ga0496122_0271275 3300048925 Bacteria 934
932 Ga0496126_0049295 3300048929 Bacteria 3845
933 Ga0496126_0958899 3300048929 Bacteria 644
934 Ga0495682_0050261 3300049460 Bacteria 1518
935 Ga0501039_0097625 3300049575 Bacteria 2291
936 Ga0501039_0636954 3300049575 Bacteria 835
937 Ga0501040_0305620 3300049576 Bacteria 1137
938 Ga0501040_0505473 3300049576 Bacteria 871
939 Ga0501041_0588558 3300049577 Unclassified 710
940 Ga0501042_0298408 3300049578 Bacteria 1164
941 Ga0501042_0679358 3300049578 Bacteria 749
942 Ga0501048_0533143 3300049582 Bacteria 842
943 Ga0501071_0023370 3300049587 Bacteria 4317
944 Ga0501072_0003196 3300049588 Bacteria 12308
945 Ga0501072_0278698 3300049588 Bacteria 1330
946 Ga0501072_0400244 3300049588 Bacteria 1089
947 Ga0501073_0164659 3300049589 Bacteria 1536
948 Ga0501073_0255391 3300049589 Bacteria 1210
949 Ga0501074_0155465 3300049590 Bacteria 1634
950 Ga0501075_0085939 3300049591 Unclassified 2383
951 Ga0501075_0154148 3300049591 Bacteria 1752
952 Ga0501076_0066540 3300049592 Bacteria 2876
953 Ga0501076_0078791 3300049592 Bacteria 2644
954 Ga0501076_0278271 3300049592 Bacteria 1371
955 Ga0501077_0033846 3300049593 Bacteria 3253
956 Ga0501077_0060461 3300049593 Bacteria 2404
957 Ga0501077_0099594 3300049593 Bacteria 1842
958 Ga0501077_0651554 3300049593 Bacteria 677
959 Ga0501079_0187632 3300049741 Bacteria 1614
960 Ga0501079_0251887 3300049741 Bacteria 1380
961 Ga0501080_0121276 3300049742 Bacteria 2423
962 Ga0501080_0342741 3300049742 Bacteria 1350
963 Ga0501080_0354333 3300049742 Bacteria 1325
964 Ga0501080_1096557 3300049742 Bacteria 687
965 Ga0501081_0059079 3300049743 Bacteria 2654
966 Ga0501081_0145530 3300049743 Bacteria 1700
967 Ga0501081_0237851 3300049743 Bacteria 1327
968 Ga0501083_0122077 3300049744 Bacteria 1709
969 Ga0501044_0000315 3300049823 Bacteria 61159
970 Ga0501044_0003273 3300049823 Bacteria 18232
971 nmdc:mga0yw44_77285_c1 3300050492 Bacteria 2079
972 nmdc:mga0k408_81378_c1 3300050493 Bacteria 1896
973 nmdc:mga04h51_43807_c1 3300050495 Bacteria 1473
974 nmdc:mga05p37_1224635_c1 3300050507 Unclassified 773
975 nmdc:mga05p37_124_c1 3300050507 Bacteria 69907
976 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
977 nmdc:mga09592_12863_c1 3300050508 Bacteria 6823
978 nmdc:mga09592_3352_c3 3300050508 Bacteria 7345
979 nmdc:mga0qj67_1026_c1 3300050509 Bacteria 19313
980 nmdc:mga0qj67_27397_c1 3300050509 Bacteria 4417
981 nmdc:mga0qj67_326191_c1 3300050509 Unclassified 1242
982 nmdc:mga0qj67_461_c1 3300050509 Bacteria 27816
983 nmdc:mga0qj67_62190_c1 3300050509 Bacteria 2967
984 nmdc:mga06r32_55452_c1 3300050510 Bacteria 3802
985 nmdc:mga06r32_847_c1 3300050510 Bacteria 27075
986 nmdc:mga08y16_12119_c1 3300050511 Bacteria 9060
987 nmdc:mga08y16_202042_c1 3300050511 Bacteria 2059
988 nmdc:mga08y16_22611_c1 3300050511 Bacteria 6639
989 nmdc:mga08y16_23649_c1 3300050511 Bacteria 6488
990 nmdc:mga08y16_2480_c1 3300050511 Bacteria 18957
991 nmdc:mga08y16_278734_c1 3300050511 Bacteria 1725
992 nmdc:mga08y16_403540_c1 3300050511 Unclassified 1399
993 nmdc:mga0n895_11659_c1 3300050512 Bacteria 7852
994 nmdc:mga0n895_41857_c1 3300050512 Unclassified 4455
995 nmdc:mga0n895_6626_c1 3300050512 Bacteria 9863
996 nmdc:mga0n895_73_c1 3300050512 Bacteria 57709
997 nmdc:mga0n895_877_c1 3300050512 Bacteria 21660
998 nmdc:mga0n895_955829_c1 3300050512 Bacteria 840
999 nmdc:mga0rr50_11547_c1 3300050513 Bacteria 5660
1000 nmdc:mga0rr50_145611_c1 3300050513 Bacteria 1910
1001 nmdc:mga0rr50_25060_c1 3300050513 Bacteria 4142
1002 nmdc:mga0rr50_27845_c1 3300050513 Bacteria 3964
1003 nmdc:mga0rr50_42978_c1 3300050513 Bacteria 3303
1004 nmdc:mga0rr50_75377_c1 3300050513 Bacteria 2586
1005 nmdc:mga08x19_329911_c1 3300050514 Bacteria 1063
1006 nmdc:mga08x19_47889_c1 3300050514 Bacteria 2737
1007 nmdc:mga0a205_20696_c1 3300050515 Bacteria 6213
1008 nmdc:mga0a205_276102_c1 3300050515 Unclassified 1557
1009 nmdc:mga0a205_59_c1 3300050515 Bacteria 60447
1010 nmdc:mga0a205_65728_c1 3300050515 Bacteria 3505
1011 nmdc:mga0a205_817331_c1 3300050515 Bacteria 780
1012 nmdc:mga0sz30_34393_c1 3300050516 Bacteria 2109
1013 Ga0495601_0001707 3300053077 Bacteria 12125
1014 Ga0495601_0040192 3300053077 Bacteria 2929
1015 Ga0495601_0107171 3300053077 Unclassified 1807
1016 Ga0495612_0004071 3300053078 Bacteria 6054
1017 Ga0495612_0004728 3300053078 Bacteria 5637
1018 Ga0495595_0000615 3300053084 Bacteria 13573
1019 Ga0495619_0000687 3300053085 Bacteria 22137
1020 Ga0495619_0013679 3300053085 Bacteria 5115
1021 Ga0495619_0016558 3300053085 Bacteria 4667
1022 Ga0495619_0031475 3300053085 Bacteria 3437
1023 Ga0495619_0311662 3300053085 Bacteria 1090
1024 Ga0500583_0326167 3300053092 Bacteria 748
1025 Ga0500658_0038711 3300053134 Bacteria 1902
1026 Ga0500573_0020975 3300053140 Plasmid 3742
1027 Ga0500577_0017423 3300053142 Unclassified 2288
1028 Ga0500589_149229 3300053147 Bacteria 954
1029 Ga0501084_0016733 3300054114 Bacteria 6090
1030 Ga0501084_0020383 3300054114 Bacteria 5529
1031 Ga0501084_0109934 3300054114 Bacteria 2316
1032 Ga0501084_0409923 3300054114 Bacteria 1145
1033 Ga0501082_0366794 3300060353 Bacteria 1256
1034 Ga0501082_0372683 3300060353 Bacteria 1245
1035 Ga0501082_0392331 3300060353 Unclassified 1211
1036 Ga0501082_0531911 3300060353 Bacteria 1028
1037 Ga0530510_0021366 3300061734 Bacteria 4606
1038 Ga0530510_0053789 3300061734 Bacteria 2909
1039 Ga0530510_0072772 3300061734 Bacteria 2495
1040 Ga0530510_0079496 3300061734 Bacteria 2385
1041 Ga0530510_0471909 3300061734 Unclassified 950

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046664 Ga0495659_0099928 Ga0495659_0099928_550_1110 185
2 3300005467 Ga0070706_100020111 Ga0070706_1000201113 191
3 3300013296 Ga0157374_10662263 Ga0157374_106622631 191
4 3300025910 Ga0207684_10010101 Ga0207684_100101012 191
5 3300034819 Ga0373958_0002849 Ga0373958_0002849_736_1317 193
6 3300046459 Ga0495629_0442858 Ga0495629_0442858_114_698 193
7 3300035115 Ga0373941_0034832 Ga0373941_0034832_12_611 194
8 3300046472 Ga0495580_0136167 Ga0495580_0136167_901_1518 196
9 3300046499 Ga0495594_0073750 Ga0495594_0073750_1186_1803 196
10 3300048917 Ga0496114_0548881 Ga0496114_0548881_10_600 196
11 iso_pu_bacteria 2643221736 2644748158 197
12 3300026035 Ga0207703_10528498 Ga0207703_105284981 198
13 3300048909 Ga0496106_0028579 Ga0496106_0028579_3547_4143 198
14 3300048929 Ga0496126_0958899 Ga0496126_0958899_37_633 198
15 3300006844 Ga0075428_100210215 Ga0075428_1002102152 199
16 3300006846 Ga0075430_100046226 Ga0075430_1000462262 199
17 3300006847 Ga0075431_100000774 Ga0075431_10000077419 199
18 3300006880 Ga0075429_100019740 Ga0075429_1000197402 199
19 3300009094 Ga0111539_10003962 Ga0111539_1000396216 199
20 3300027907 Ga0207428_10019079 Ga0207428_100190792 199
21 3300031901 Ga0307406_10634203 Ga0307406_106342031 199
22 3300032002 Ga0307416_100233336 Ga0307416_1002333362 199
23 3300050507 nmdc:mga05p37_124_c1 nmdc:mga05p37_124_c1_13368_13967 199
24 3300050508 nmdc:mga09592_3352_c3 nmdc:mga09592_3352_c3_5967_6566 199
25 3300050509 nmdc:mga0qj67_27397_c1 nmdc:mga0qj67_27397_c1_1821_2420 199
26 3300050510 nmdc:mga06r32_847_c1 nmdc:mga06r32_847_c1_25587_26186 199
27 3300050511 nmdc:mga08y16_23649_c1 nmdc:mga08y16_23649_c1_4365_4964 199
28 iso_pu_bacteria 2513237137 2513863653 199
29 iso_pu_bacteria 2524023228 2524541481 199
30 iso_pu_bacteria 2738543024 2739309432 199
31 iso_pu_bacteria 2904699407 2904708126 199
32 iso_pu_bacteria 2935777560 2935780897 199
33 iso_pu_bacteria 2935785616 2935786030 199
34 iso_pu_bacteria 2935793552 2935797787 199
35 iso_pu_bacteria 2935819856 2935820720 199
36 iso_pu_bacteria 2935847175 2935849262 199
37 iso_pu_bacteria 8016522445 8016528428 199
38 iso_pu_bacteria 8016530956 8016533583 199
39 iso_pu_bacteria 8016539877 8016546810 199
40 iso_pu_bacteria 8016548790 8016555311 199
41 iso_pu_bacteria 8016557553 8016563670 199
42 iso_pu_bacteria 8016566248 8016571917 199
43 iso_pu_bacteria 8016575299 8016576125 199
44 iso_pu_bacteria 8016595262 8016601402 199
45 iso_pu_bacteria 8016603502 8016609031 199
46 iso_pu_bacteria 8016613128 8016615870 199
47 iso_pu_bacteria 8016622563 8016625360 199
48 iso_pu_bacteria 8019530166 8019533370 199
49 iso_pu_bacteria 8019538911 8019546296 199
50 iso_pu_bacteria 8019547302 8019552407 199
51 3300005356 Ga0070674_100509911 Ga0070674_1005099111 200
52 3300005548 Ga0070665_100004691 Ga0070665_10000469112 200
53 3300005617 Ga0068859_100666266 Ga0068859_1006662661 200
54 3300005842 Ga0068858_100167263 Ga0068858_1001672631 200
55 3300005844 Ga0068862_100992653 Ga0068862_1009926531 200
56 3300006163 Ga0070715_10022361 Ga0070715_100223613 200
57 3300006931 Ga0097620_100666363 Ga0097620_1006663631 200
58 3300009101 Ga0105247_10029580 Ga0105247_100295801 200
59 3300014326 Ga0157380_10479340 Ga0157380_104793402 200
60 3300025905 Ga0207685_10144159 Ga0207685_101441592 200
61 3300028379 Ga0268266_10004115 Ga0268266_1000411511 200
62 3300046515 Ga0495620_0152568 Ga0495620_0152568_50_655 200
63 3300047471 Ga0495684_0212214 Ga0495684_0212214_14_631 200
64 3300048912 Ga0496109_0634857 Ga0496109_0634857_363_983 200
65 iso_pu_bacteria 2643221634 2644196055 200
66 iso_pu_bacteria 8006964411 8006969422 200
67 3300005331 Ga0070670_100701118 Ga0070670_1007011181 201
68 3300005456 Ga0070678_100234196 Ga0070678_1002341962 201
69 3300005617 Ga0068859_100793171 Ga0068859_1007931712 201
70 3300006846 Ga0075430_100602571 Ga0075430_1006025711 201
71 3300006852 Ga0075433_10003106 Ga0075433_1000310612 201
72 3300006871 Ga0075434_100019105 Ga0075434_1000191052 201
73 3300006931 Ga0097620_100793166 Ga0097620_1007931662 201
74 3300007076 Ga0075435_100016140 Ga0075435_1000161402 201
75 3300009094 Ga0111539_10081875 Ga0111539_100818752 201
76 3300009993 Ga0105028_106036 Ga0105028_1060362 201
77 3300014968 Ga0157379_10420972 Ga0157379_104209722 201
78 3300025918 Ga0207662_10264607 Ga0207662_102646072 201
79 3300025972 Ga0207668_10961466 Ga0207668_109614661 201
80 3300026089 Ga0207648_10675299 Ga0207648_106752991 201
81 3300026121 Ga0207683_10534181 Ga0207683_105341812 201
82 3300027907 Ga0207428_10026193 Ga0207428_100261932 201
83 3300034819 Ga0373958_0000878 Ga0373958_0000878_1878_2483 201
84 3300034957 Ga0373938_0030907 Ga0373938_0030907_263_868 201
85 3300035088 Ga0373940_0003445 Ga0373940_0003445_1410_2015 201
86 3300035114 Ga0373939_0005478 Ga0373939_0005478_1956_2561 201
87 3300035114 Ga0373939_0012689 Ga0373939_0012689_1133_1738 201
88 3300035115 Ga0373941_0041808 Ga0373941_0041808_407_1012 201
89 3300035121 Ga0373960_0014490 Ga0373960_0014490_1150_1755 201
90 3300035242 Ga0373962_0038458 Ga0373962_0038458_538_1143 201
91 3300035691 Ga0373931_0004146 Ga0373931_0004146_2179_2784 201
92 3300049575 Ga0501039_0097625 Ga0501039_0097625_1197_1802 201
93 3300049576 Ga0501040_0305620 Ga0501040_0305620_513_1124 201
94 3300049587 Ga0501071_0023370 Ga0501071_0023370_3533_4138 201
95 3300049588 Ga0501072_0003196 Ga0501072_0003196_1854_2459 201
96 3300049590 Ga0501074_0155465 Ga0501074_0155465_20_625 201
97 3300049591 Ga0501075_0085939 Ga0501075_0085939_1321_1926 201
98 3300049592 Ga0501076_0066540 Ga0501076_0066540_1532_2137 201
99 3300049741 Ga0501079_0187632 Ga0501079_0187632_77_682 201
100 3300050511 nmdc:mga08y16_403540_c1 nmdc:mga08y16_403540_c1_572_1177 201
101 3300050512 nmdc:mga0n895_6626_c1 nmdc:mga0n895_6626_c1_6517_7122 201
102 3300050513 nmdc:mga0rr50_11547_c1 nmdc:mga0rr50_11547_c1_4059_4664 201
103 3300050515 nmdc:mga0a205_65728_c1 nmdc:mga0a205_65728_c1_120_725 201
104 3300054114 Ga0501084_0016733 Ga0501084_0016733_5160_5765 201
105 3300060353 Ga0501082_0392331 Ga0501082_0392331_153_758 201
106 3300061734 Ga0530510_0053789 Ga0530510_0053789_1896_2501 201
107 3300026095 Ga0207676_11227056 Ga0207676_112270561 202
108 3300046515 Ga0495620_0016304 Ga0495620_0016304_1863_2474 202
109 3300046558 Ga0495633_0223191 Ga0495633_0223191_80_691 202
110 3300046691 Ga0495670_0069341 Ga0495670_0069341_21_632 202
111 3300047472 Ga0495686_0229662 Ga0495686_0229662_142_753 202
112 3300049593 Ga0501077_0651554 Ga0501077_0651554_16_624 202
113 3300005937 Ga0081455_10000652 Ga0081455_1000065244 203
114 3300006353 Ga0075370_10064896 Ga0075370_100648962 203
115 3300021377 Ga0213874_10094993 Ga0213874_100949932 203
116 3300031595 Ga0265313_10207709 Ga0265313_102077091 203
117 3300035170 Ga0373943_0090406 Ga0373943_0090406_553_1164 203
118 3300035695 Ga0373927_0155320 Ga0373927_0155320_250_861 203
119 3300039438 Ga0436360_0266827 Ga0436360_0266827_83_694 203
120 3300039438 Ga0436360_0519909 Ga0436360_0519909_175_786 203
121 3300039438 Ga0436360_1162768 Ga0436360_1162768_135_761 203
122 3300039447 Ga0436361_0920118 Ga0436361_0920118_155_781 203
123 3300039450 Ga0436363_0682568 Ga0436363_0682568_68_682 203
124 3300046507 Ga0495606_0007302 Ga0495606_0007302_7657_8289 203
125 3300046507 Ga0495606_0017684 Ga0495606_0017684_3623_4240 203
126 3300046660 Ga0495625_0001908 Ga0495625_0001908_18414_19046 203
127 3300046810 Ga0495660_0019580 Ga0495660_0019580_2786_3418 203
128 3300047315 Ga0495581_0218689 Ga0495581_0218689_59_670 203
129 3300047321 Ga0495676_0139063 Ga0495676_0139063_660_1271 203
130 3300048920 Ga0496117_0290388 Ga0496117_0290388_33_647 203
131 3300053140 Ga0500573_0020975 Ga0500573_0020975_2017_2631 203
132 3300053142 Ga0500577_0017423 Ga0500577_0017423_1481_2095 203
133 3300060353 Ga0501082_0531911 Ga0501082_0531911_51_665 203
134 iso_pu_bacteria 2643221645 2644249340 203
135 iso_pu_bacteria 2738541300 2738845077 203
136 iso_pu_bacteria 2738543018 2739274656 203
137 iso_pu_bacteria 2738543030 2739343700 203
138 3300003659 JGI25404J52841_10000042 JGI25404J52841_100000426 204
139 3300005329 Ga0070683_100390577 Ga0070683_1003905772 204
140 3300005334 Ga0068869_100141404 Ga0068869_1001414042 204
141 3300005337 Ga0070682_100564773 Ga0070682_1005647732 204
142 3300005340 Ga0070689_100101186 Ga0070689_1001011864 204
143 3300005347 Ga0070668_100109342 Ga0070668_1001093423 204
144 3300005347 Ga0070668_100159068 Ga0070668_1001590682 204
145 3300005356 Ga0070674_100059248 Ga0070674_1000592482 204
146 3300005364 Ga0070673_100513557 Ga0070673_1005135571 204
147 3300005436 Ga0070713_100580298 Ga0070713_1005802982 204
148 3300005455 Ga0070663_100224630 Ga0070663_1002246302 204
149 3300005467 Ga0070706_100328116 Ga0070706_1003281162 204
150 3300005544 Ga0070686_100084339 Ga0070686_1000843392 204
151 3300005548 Ga0070665_100099806 Ga0070665_1000998063 204
152 3300005844 Ga0068862_100120269 Ga0068862_1001202692 204
153 3300005844 Ga0068862_100330873 Ga0068862_1003308731 204
154 3300005844 Ga0068862_100566750 Ga0068862_1005667502 204
155 3300005937 Ga0081455_10037342 Ga0081455_100373422 204
156 3300005983 Ga0081540_1000067 Ga0081540_100006720 204
157 3300005983 Ga0081540_1000423 Ga0081540_100042321 204
158 3300005983 Ga0081540_1002957 Ga0081540_100295713 204
159 3300005983 Ga0081540_1018444 Ga0081540_10184446 204
160 3300006028 Ga0070717_10348731 Ga0070717_103487312 204
161 3300006038 Ga0075365_10032280 Ga0075365_100322803 204
162 3300006048 Ga0075363_100076617 Ga0075363_1000766172 204
163 3300006051 Ga0075364_10035752 Ga0075364_100357522 204
164 3300006175 Ga0070712_100113199 Ga0070712_1001131992 204
165 3300006175 Ga0070712_100382203 Ga0070712_1003822031 204
166 3300006177 Ga0075362_10015128 Ga0075362_100151284 204
167 3300006177 Ga0075362_10024493 Ga0075362_100244932 204
168 3300006186 Ga0075369_10024665 Ga0075369_100246652 204
169 3300006186 Ga0075369_10027262 Ga0075369_100272621 204
170 3300006195 Ga0075366_10017757 Ga0075366_100177574 204
171 3300006195 Ga0075366_10043755 Ga0075366_100437552 204
172 3300006358 Ga0068871_100753460 Ga0068871_1007534602 204
173 3300006844 Ga0075428_100027553 Ga0075428_1000275532 204
174 3300006844 Ga0075428_100386688 Ga0075428_1003866881 204
175 3300006844 Ga0075428_100709193 Ga0075428_1007091932 204
176 3300006846 Ga0075430_100000011 Ga0075430_10000001141 204
177 3300009094 Ga0111539_10066402 Ga0111539_100664024 204
178 3300009094 Ga0111539_10093515 Ga0111539_100935152 204
179 3300009094 Ga0111539_10233060 Ga0111539_102330602 204
180 3300009147 Ga0114129_10108623 Ga0114129_101086233 204
181 3300009148 Ga0105243_10267920 Ga0105243_102679201 204
182 3300009174 Ga0105241_10856042 Ga0105241_108560422 204
183 3300009553 Ga0105249_10110065 Ga0105249_101100653 204
184 3300010375 Ga0105239_10267779 Ga0105239_102677792 204
185 3300011119 Ga0105246_10123524 Ga0105246_101235242 204
186 3300013306 Ga0163162_10343712 Ga0163162_103437122 204
187 3300013306 Ga0163162_10759047 Ga0163162_107590472 204
188 3300013308 Ga0157375_10318441 Ga0157375_103184412 204
189 3300013308 Ga0157375_10324001 Ga0157375_103240013 204
190 3300014969 Ga0157376_10258346 Ga0157376_102583462 204
191 3300025901 Ga0207688_10177139 Ga0207688_101771392 204
192 3300025907 Ga0207645_10380165 Ga0207645_103801652 204
193 3300025908 Ga0207643_10082041 Ga0207643_100820412 204
194 3300025923 Ga0207681_10032505 Ga0207681_100325052 204
195 3300025928 Ga0207700_10793565 Ga0207700_107935651 204
196 3300025933 Ga0207706_10099363 Ga0207706_100993632 204
197 3300025942 Ga0207689_10179655 Ga0207689_101796552 204
198 3300025960 Ga0207651_10207194 Ga0207651_102071942 204
199 3300025961 Ga0207712_10149273 Ga0207712_101492732 204
200 3300025972 Ga0207668_10058457 Ga0207668_100584573 204
201 3300025972 Ga0207668_10138270 Ga0207668_101382702 204
202 3300026067 Ga0207678_10065630 Ga0207678_100656302 204
203 3300026121 Ga0207683_10389014 Ga0207683_103890142 204
204 3300028379 Ga0268266_10099297 Ga0268266_100992972 204
205 3300028380 Ga0268265_10541348 Ga0268265_105413482 204
206 3300028794 Ga0307515_10307996 Ga0307515_103079962 204
207 3300031507 Ga0307509_10141941 Ga0307509_101419412 204
208 3300032126 Ga0307415_100143933 Ga0307415_1001439333 204
209 3300033180 Ga0307510_10028469 Ga0307510_100284694 204
210 3300037068 Ga0373925_0863838 Ga0373925_0863838_117_734 204
211 3300041413 Ga0439465_0176637 Ga0439465_0176637_103_720 204
212 3300046452 Ga0495617_079479 Ga0495617_079479_91_708 204
213 3300046455 Ga0495603_0026989 Ga0495603_0026989_2512_3129 204
214 3300046460 Ga0495638_0316536 Ga0495638_0316536_65_682 204
215 3300046492 Ga0495585_0073242 Ga0495585_0073242_597_1214 204
216 3300046506 Ga0495583_0020981 Ga0495583_0020981_132_749 204
217 3300046513 Ga0495616_0211269 Ga0495616_0211269_105_722 204
218 3300046518 Ga0495631_0152386 Ga0495631_0152386_158_775 204
219 3300046519 Ga0495632_0080940 Ga0495632_0080940_758_1375 204
220 3300046537 Ga0495598_0003289 Ga0495598_0003289_2533_3150 204
221 3300046542 Ga0495597_0071280 Ga0495597_0071280_201_818 204
222 3300046557 Ga0495622_0043467 Ga0495622_0043467_80_697 204
223 3300046615 Ga0495656_0019409 Ga0495656_0019409_802_1419 204
224 3300046660 Ga0495625_0268164 Ga0495625_0268164_138_755 204
225 3300046664 Ga0495659_0025182 Ga0495659_0025182_592_1209 204
226 3300046674 Ga0495588_0259057 Ga0495588_0259057_124_741 204
227 3300046684 Ga0495669_0083595 Ga0495669_0083595_500_1117 204
228 3300046694 Ga0495649_0204497 Ga0495649_0204497_91_708 204
229 3300048903 Ga0496100_0484123 Ga0496100_0484123_236_853 204
230 3300048907 Ga0496104_0092517 Ga0496104_0092517_595_1212 204
231 3300048910 Ga0496107_0609139 Ga0496107_0609139_138_755 204
232 3300048911 Ga0496108_0106283 Ga0496108_0106283_933_1550 204
233 3300048918 Ga0496115_0100759 Ga0496115_0100759_1125_1742 204
234 3300048925 Ga0496122_0271275 Ga0496122_0271275_274_891 204
235 3300048929 Ga0496126_0049295 Ga0496126_0049295_2946_3563 204
236 3300049460 Ga0495682_0050261 Ga0495682_0050261_699_1316 204
237 3300050493 nmdc:mga0k408_81378_c1 nmdc:mga0k408_81378_c1_823_1440 204
238 3300050509 nmdc:mga0qj67_461_c1 nmdc:mga0qj67_461_c1_9886_10500 204
239 3300050511 nmdc:mga08y16_12119_c1 nmdc:mga08y16_12119_c1_8261_8875 204
240 3300050516 nmdc:mga0sz30_34393_c1 nmdc:mga0sz30_34393_c1_149_766 204
241 3300053092 Ga0500583_0326167 Ga0500583_0326167_48_665 204
242 3300053134 Ga0500658_0038711 Ga0500658_0038711_1123_1740 204
243 3300053147 Ga0500589_149229 Ga0500589_149229_61_678 204
244 iso_pu_bacteria 2528768022 2528853294 204
245 iso_pu_bacteria 2824600985 2824604248 204
246 iso_pu_bacteria 2824609381 2824614279 204
247 iso_pu_bacteria 2824653114 2824658331 204
248 iso_pu_bacteria 2888419890 2888421568 204
249 iso_pu_bacteria 2929624759 2929630664 204
250 iso_pu_bacteria 2933577622 2933584986 204
251 iso_pu_bacteria 8055742211 8055748819 204
252 3300005338 Ga0068868_100090967 Ga0068868_1000909672 205
253 3300049575 Ga0501039_0636954 Ga0501039_0636954_60_743 205
254 3300049593 Ga0501077_0099594 Ga0501077_0099594_23_706 205
255 3300061734 Ga0530510_0021366 Ga0530510_0021366_70_753 205
256 3300005843 Ga0068860_100068430 Ga0068860_1000684302 206
257 3300005937 Ga0081455_10059421 Ga0081455_100594213 206
258 3300026118 Ga0207675_100310588 Ga0207675_1003105881 206
259 3300028380 Ga0268265_10925299 Ga0268265_109252991 206
260 3300028381 Ga0268264_10064242 Ga0268264_100642422 206
261 3300031548 Ga0307408_100192587 Ga0307408_1001925872 206
262 3300046543 Ga0495645_0043596 Ga0495645_0043596_2261_2887 206
263 3300046678 Ga0495599_0087262 Ga0495599_0087262_579_1205 206
264 iso_pu_bacteria 2515154107 2515611625 206
265 iso_pu_bacteria 2524023207 2524449279 206
266 iso_pu_bacteria 2921237296 2921237444 206
267 iso_pu_bacteria 2970047711 2970052458 206
268 iso_pu_bacteria 2970170962 2970171128 206
269 3300005329 Ga0070683_100680301 Ga0070683_1006803011 207
270 3300005334 Ga0068869_101013595 Ga0068869_1010135951 207
271 3300005335 Ga0070666_10034818 Ga0070666_100348182 207
272 3300005344 Ga0070661_100048332 Ga0070661_1000483322 207
273 3300005354 Ga0070675_100129112 Ga0070675_1001291122 207
274 3300005356 Ga0070674_100922225 Ga0070674_1009222251 207
275 3300005364 Ga0070673_100290518 Ga0070673_1002905182 207
276 3300005366 Ga0070659_100137422 Ga0070659_1001374222 207
277 3300005434 Ga0070709_10243272 Ga0070709_102432722 207
278 3300005435 Ga0070714_100527447 Ga0070714_1005274472 207
279 3300005436 Ga0070713_100026963 Ga0070713_1000269632 207
280 3300005456 Ga0070678_100056415 Ga0070678_1000564152 207
281 3300005536 Ga0070697_100109874 Ga0070697_1001098742 207
282 3300005545 Ga0070695_100109485 Ga0070695_1001094852 207
283 3300005547 Ga0070693_100270705 Ga0070693_1002707052 207
284 3300005578 Ga0068854_100299382 Ga0068854_1002993822 207
285 3300006028 Ga0070717_10493808 Ga0070717_104938082 207
286 3300006163 Ga0070715_10187569 Ga0070715_101875691 207
287 3300006175 Ga0070712_100088974 Ga0070712_1000889744 207
288 3300006237 Ga0097621_100043206 Ga0097621_1000432062 207
289 3300006358 Ga0068871_100032239 Ga0068871_1000322395 207
290 3300009098 Ga0105245_10127180 Ga0105245_101271804 207
291 3300009098 Ga0105245_10595304 Ga0105245_105953042 207
292 3300009176 Ga0105242_10052200 Ga0105242_100522004 207
293 3300009177 Ga0105248_10448799 Ga0105248_104487992 207
294 3300009545 Ga0105237_10144737 Ga0105237_101447374 207
295 3300009551 Ga0105238_10275498 Ga0105238_102754982 207
296 3300013100 Ga0157373_10122481 Ga0157373_101224812 207
297 3300013296 Ga0157374_10277022 Ga0157374_102770222 207
298 3300013306 Ga0163162_10607519 Ga0163162_106075191 207
299 3300014326 Ga0157380_10286160 Ga0157380_102861601 207
300 3300014969 Ga0157376_10169805 Ga0157376_101698052 207
301 3300025900 Ga0207710_10104458 Ga0207710_101044582 207
302 3300025914 Ga0207671_10163052 Ga0207671_101630522 207
303 3300025915 Ga0207693_10058154 Ga0207693_100581544 207
304 3300025924 Ga0207694_10185136 Ga0207694_101851362 207
305 3300025927 Ga0207687_10058667 Ga0207687_100586672 207
306 3300025928 Ga0207700_10067946 Ga0207700_100679463 207
307 3300025929 Ga0207664_10170356 Ga0207664_101703562 207
308 3300025931 Ga0207644_10047828 Ga0207644_100478282 207
309 3300025932 Ga0207690_10109796 Ga0207690_101097963 207
310 3300025933 Ga0207706_10013231 Ga0207706_100132316 207
311 3300025934 Ga0207686_10024689 Ga0207686_100246892 207
312 3300025937 Ga0207669_10234658 Ga0207669_102346582 207
313 3300025939 Ga0207665_10152493 Ga0207665_101524933 207
314 3300025945 Ga0207679_10293780 Ga0207679_102937801 207
315 3300025960 Ga0207651_10316088 Ga0207651_103160882 207
316 3300025986 Ga0207658_10074280 Ga0207658_100742802 207
317 3300026067 Ga0207678_10222487 Ga0207678_102224872 207
318 3300026121 Ga0207683_10031636 Ga0207683_100316363 207
319 3300028379 Ga0268266_11239572 Ga0268266_112395721 207
320 3300031824 Ga0307413_10023977 Ga0307413_100239773 207
321 3300031995 Ga0307409_100559873 Ga0307409_1005598731 207
322 3300035086 Ga0373934_0008308 Ga0373934_0008308_1719_2342 207
323 3300035111 Ga0373923_0013462 Ga0373923_0013462_393_1016 207
324 3300035117 Ga0373953_0017859 Ga0373953_0017859_711_1334 207
325 3300035118 Ga0373954_0010963 Ga0373954_0010963_2562_3185 207
326 3300035119 Ga0373956_0004865 Ga0373956_0004865_1339_1962 207
327 3300035172 Ga0373955_0001327 Ga0373955_0001327_9144_9767 207
328 3300035410 Ga0373924_0084664 Ga0373924_0084664_129_752 207
329 3300035724 Ga0373933_0017691 Ga0373933_0017691_2552_3175 207
330 3300036401 Ga0373937_0009181 Ga0373937_0009181_1192_1815 207
331 3300046454 Ga0495592_0086424 Ga0495592_0086424_696_1319 207
332 3300046462 Ga0495651_0016582 Ga0495651_0016582_1926_2549 207
333 3300046463 Ga0495653_0018024 Ga0495653_0018024_3150_3773 207
334 3300046477 Ga0495664_0009662 Ga0495664_0009662_3522_4145 207
335 3300046511 Ga0495608_0000688 Ga0495608_0000688_10284_10907 207
336 3300046514 Ga0495618_0002700 Ga0495618_0002700_3130_3753 207
337 3300046516 Ga0495628_0023438 Ga0495628_0023438_940_1563 207
338 3300046517 Ga0495630_0077429 Ga0495630_0077429_1416_2039 207
339 3300046529 Ga0495652_0011434 Ga0495652_0011434_3633_4256 207
340 3300046533 Ga0495640_0035222 Ga0495640_0035222_1350_1973 207
341 3300046536 Ga0495587_0000534 Ga0495587_0000534_13137_13760 207
342 3300046543 Ga0495645_0001860 Ga0495645_0001860_814_1437 207
343 3300046559 Ga0495667_0000771 Ga0495667_0000771_7060_7683 207
344 3300046642 Ga0495634_0047044 Ga0495634_0047044_1374_1997 207
345 3300046663 Ga0495635_0003284 Ga0495635_0003284_2502_3125 207
346 3300046675 Ga0495657_0001333 Ga0495657_0001333_7071_7694 207
347 3300046678 Ga0495599_0090822 Ga0495599_0090822_343_966 207
348 3300046679 Ga0495623_0000354 Ga0495623_0000354_13139_13762 207
349 3300046680 Ga0495646_0004095 Ga0495646_0004095_7828_8451 207
350 3300046683 Ga0495658_0027655 Ga0495658_0027655_745_1368 207
351 3300046809 Ga0495600_0001299 Ga0495600_0001299_297_920 207
352 3300047317 Ga0495604_0003048 Ga0495604_0003048_6750_7373 207
353 3300047318 Ga0495636_0019523 Ga0495636_0019523_1684_2310 207
354 3300047319 Ga0495674_0003671 Ga0495674_0003671_6768_7391 207
355 3300047322 Ga0495680_0024262 Ga0495680_0024262_2406_3029 207
356 3300047444 Ga0495675_0000892 Ga0495675_0000892_16696_17319 207
357 3300047471 Ga0495684_0027435 Ga0495684_0027435_2820_3443 207
358 3300047673 Ga0495593_0040189 Ga0495593_0040189_1815_2438 207
359 3300048088 Ga0495602_0004679 Ga0495602_0004679_1170_1793 207
360 3300048903 Ga0496100_0077681 Ga0496100_0077681_1308_1931 207
361 3300048904 Ga0496101_0003150 Ga0496101_0003150_8472_9095 207
362 3300048905 Ga0496102_0013897 Ga0496102_0013897_5748_6371 207
363 3300048906 Ga0496103_0079993 Ga0496103_0079993_1189_1812 207
364 3300048907 Ga0496104_0033611 Ga0496104_0033611_771_1394 207
365 3300048910 Ga0496107_0013677 Ga0496107_0013677_3644_4267 207
366 3300048911 Ga0496108_0261326 Ga0496108_0261326_13_636 207
367 3300048912 Ga0496109_0164387 Ga0496109_0164387_411_1034 207
368 3300048915 Ga0496112_0451689 Ga0496112_0451689_315_938 207
369 3300048917 Ga0496114_0016176 Ga0496114_0016176_1562_2185 207
370 3300048918 Ga0496115_0154440 Ga0496115_0154440_1120_1743 207
371 3300049742 Ga0501080_0354333 Ga0501080_0354333_268_912 207
372 3300049743 Ga0501081_0145530 Ga0501081_0145530_779_1423 207
373 3300049823 Ga0501044_0000315 Ga0501044_0000315_55144_55770 207
374 3300053077 Ga0495601_0001707 Ga0495601_0001707_4625_5248 207
375 3300053078 Ga0495612_0004071 Ga0495612_0004071_1496_2119 207
376 3300053084 Ga0495595_0000615 Ga0495595_0000615_739_1362 207
377 3300053085 Ga0495619_0016558 Ga0495619_0016558_1707_2330 207
378 3300005331 Ga0070670_100592767 Ga0070670_1005927672 208
379 3300005347 Ga0070668_100161598 Ga0070668_1001615982 208
380 3300005347 Ga0070668_100321860 Ga0070668_1003218601 208
381 3300005355 Ga0070671_100144079 Ga0070671_1001440792 208
382 3300005615 Ga0070702_100167479 Ga0070702_1001674792 208
383 3300005841 Ga0068863_100257913 Ga0068863_1002579132 208
384 3300005937 Ga0081455_10015289 Ga0081455_100152894 208
385 3300005983 Ga0081540_1109864 Ga0081540_11098642 208
386 3300006038 Ga0075365_10032152 Ga0075365_100321524 208
387 3300006038 Ga0075365_10156361 Ga0075365_101563611 208
388 3300006195 Ga0075366_10275493 Ga0075366_102754932 208
389 3300006237 Ga0097621_100113776 Ga0097621_1001137762 208
390 3300009093 Ga0105240_10412227 Ga0105240_104122271 208
391 3300009551 Ga0105238_10096781 Ga0105238_100967812 208
392 3300013308 Ga0157375_10531921 Ga0157375_105319212 208
393 3300021384 Ga0213876_10047611 Ga0213876_100476112 208
394 3300021388 Ga0213875_10001022 Ga0213875_1000102210 208
395 3300025297 Ga0209758_1049818 Ga0209758_10498181 208
396 3300025915 Ga0207693_10075248 Ga0207693_100752482 208
397 3300025925 Ga0207650_10502015 Ga0207650_105020151 208
398 3300025940 Ga0207691_10251467 Ga0207691_102514671 208
399 3300026088 Ga0207641_10091654 Ga0207641_100916542 208
400 3300028380 Ga0268265_10280447 Ga0268265_102804472 208
401 3300034816 Ga0373930_0010291 Ga0373930_0010291_300_926 208
402 3300035113 Ga0373936_0221720 Ga0373936_0221720_40_666 208
403 3300035114 Ga0373939_0018099 Ga0373939_0018099_163_789 208
404 3300035171 Ga0373946_0016087 Ga0373946_0016087_1912_2538 208
405 3300035241 Ga0373961_0135741 Ga0373961_0135741_13_639 208
406 3300035691 Ga0373931_0058402 Ga0373931_0058402_768_1394 208
407 3300035695 Ga0373927_0018418 Ga0373927_0018418_1936_2562 208
408 3300035725 Ga0373947_0028164 Ga0373947_0028164_866_1492 208
409 3300036401 Ga0373937_0177070 Ga0373937_0177070_1347_1973 208
410 3300037068 Ga0373925_0506638 Ga0373925_0506638_117_743 208
411 3300037853 Ga0436364_0910105 Ga0436364_0910105_11534_12163 208
412 3300039437 Ga0436365_1803148 Ga0436365_1803148_1608_2237 208
413 3300046455 Ga0495603_0001480 Ga0495603_0001480_8424_9050 208
414 3300046459 Ga0495629_0011542 Ga0495629_0011542_4634_5260 208
415 3300046461 Ga0495641_0020479 Ga0495641_0020479_1637_2263 208
416 3300046473 Ga0495582_0001176 Ga0495582_0001176_5940_6566 208
417 3300046475 Ga0495639_0002484 Ga0495639_0002484_3821_4447 208
418 3300046476 Ga0495662_0004481 Ga0495662_0004481_4635_5261 208
419 3300046477 Ga0495664_0138755 Ga0495664_0138755_118_744 208
420 3300046499 Ga0495594_0008519 Ga0495594_0008519_1109_1735 208
421 3300046516 Ga0495628_0081037 Ga0495628_0081037_920_1546 208
422 3300046517 Ga0495630_0014202 Ga0495630_0014202_4711_5337 208
423 3300046526 Ga0495666_0044191 Ga0495666_0044191_471_1097 208
424 3300046531 Ga0495665_0002695 Ga0495665_0002695_3007_3633 208
425 3300046533 Ga0495640_0013114 Ga0495640_0013114_1492_2118 208
426 3300046557 Ga0495622_0060544 Ga0495622_0060544_46_672 208
427 3300046559 Ga0495667_0014884 Ga0495667_0014884_3558_4184 208
428 3300046616 Ga0495668_0390015 Ga0495668_0390015_56_682 208
429 3300046642 Ga0495634_0011864 Ga0495634_0011864_2033_2659 208
430 3300046675 Ga0495657_0284048 Ga0495657_0284048_160_786 208
431 3300046678 Ga0495599_0055821 Ga0495599_0055821_594_1220 208
432 3300046681 Ga0495647_0029475 Ga0495647_0029475_296_922 208
433 3300046683 Ga0495658_0026428 Ga0495658_0026428_2298_2924 208
434 3300046690 Ga0495624_0002092 Ga0495624_0002092_12453_13079 208
435 3300047315 Ga0495581_0003049 Ga0495581_0003049_4616_5242 208
436 3300047317 Ga0495604_0370935 Ga0495604_0370935_67_693 208
437 3300047319 Ga0495674_0019619 Ga0495674_0019619_4587_5213 208
438 3300047322 Ga0495680_0508285 Ga0495680_0508285_20_646 208
439 3300047469 Ga0495673_0086286 Ga0495673_0086286_470_1096 208
440 3300047471 Ga0495684_0063404 Ga0495684_0063404_1569_2195 208
441 3300047673 Ga0495593_0002569 Ga0495593_0002569_4352_4978 208
442 3300048089 Ga0495614_0023650 Ga0495614_0023650_235_861 208
443 3300048904 Ga0496101_0487180 Ga0496101_0487180_69_695 208
444 3300048909 Ga0496106_0670576 Ga0496106_0670576_54_680 208
445 3300048918 Ga0496115_0141919 Ga0496115_0141919_279_935 208
446 3300049577 Ga0501041_0588558 Ga0501041_0588558_53_682 208
447 3300050492 nmdc:mga0yw44_77285_c1 nmdc:mga0yw44_77285_c1_948_1574 208
448 3300050507 nmdc:mga05p37_1224635_c1 nmdc:mga05p37_1224635_c1_129_755 208
449 3300061734 Ga0530510_0471909 Ga0530510_0471909_205_834 208
450 3300005439 Ga0070711_100105550 Ga0070711_1001055503 209
451 3300005468 Ga0070707_100001635 Ga0070707_1000016359 209
452 3300005468 Ga0070707_100778021 Ga0070707_1007780212 209
453 3300006846 Ga0075430_100116198 Ga0075430_1001161983 209
454 3300006852 Ga0075433_10228811 Ga0075433_102288112 209
455 3300006871 Ga0075434_100056523 Ga0075434_1000565234 209
456 3300006871 Ga0075434_100252847 Ga0075434_1002528472 209
457 3300007076 Ga0075435_100120223 Ga0075435_1001202233 209
458 3300007076 Ga0075435_100204567 Ga0075435_1002045672 209
459 3300014969 Ga0157376_10043248 Ga0157376_100432483 209
460 3300025916 Ga0207663_10119293 Ga0207663_101192932 209
461 3300025922 Ga0207646_10783717 Ga0207646_107837171 209
462 3300031249 Ga0265339_10019194 Ga0265339_100191943 209
463 3300031711 Ga0265314_10001316 Ga0265314_100013163 209
464 3300046459 Ga0495629_0113663 Ga0495629_0113663_214_843 209
465 3300046529 Ga0495652_0209603 Ga0495652_0209603_458_1087 209
466 3300046533 Ga0495640_0057166 Ga0495640_0057166_781_1410 209
467 3300046680 Ga0495646_0142667 Ga0495646_0142667_343_972 209
468 3300047319 Ga0495674_0129891 Ga0495674_0129891_1100_1729 209
469 3300047471 Ga0495684_0394881 Ga0495684_0394881_54_683 209
470 3300048903 Ga0496100_0036216 Ga0496100_0036216_1680_2309 209
471 3300048907 Ga0496104_0452160 Ga0496104_0452160_557_1186 209
472 3300048910 Ga0496107_0298937 Ga0496107_0298937_222_851 209
473 3300048912 Ga0496109_0473347 Ga0496109_0473347_327_956 209
474 3300048917 Ga0496114_0036286 Ga0496114_0036286_719_1348 209
475 3300049578 Ga0501042_0298408 Ga0501042_0298408_88_723 209
476 3300049578 Ga0501042_0679358 Ga0501042_0679358_45_692 209
477 3300049582 Ga0501048_0533143 Ga0501048_0533143_170_805 209
478 3300049588 Ga0501072_0278698 Ga0501072_0278698_462_1097 209
479 3300049592 Ga0501076_0278271 Ga0501076_0278271_661_1296 209
480 3300049741 Ga0501079_0251887 Ga0501079_0251887_551_1186 209
481 3300049743 Ga0501081_0059079 Ga0501081_0059079_880_1515 209
482 3300050509 nmdc:mga0qj67_326191_c1 nmdc:mga0qj67_326191_c1_552_1199 209
483 3300050509 nmdc:mga0qj67_62190_c1 nmdc:mga0qj67_62190_c1_308_937 209
484 3300050513 nmdc:mga0rr50_145611_c1 nmdc:mga0rr50_145611_c1_633_1262 209
485 3300050513 nmdc:mga0rr50_27845_c1 nmdc:mga0rr50_27845_c1_2310_2939 209
486 3300050515 nmdc:mga0a205_276102_c1 nmdc:mga0a205_276102_c1_59_688 209
487 3300053077 Ga0495601_0040192 Ga0495601_0040192_1106_1735 209
488 3300053085 Ga0495619_0031475 Ga0495619_0031475_1710_2339 209
489 3300053085 Ga0495619_0311662 Ga0495619_0311662_229_858 209
490 3300054114 Ga0501084_0020383 Ga0501084_0020383_3370_4017 209
491 3300054114 Ga0501084_0109934 Ga0501084_0109934_145_780 209
492 3300060353 Ga0501082_0366794 Ga0501082_0366794_192_827 209
493 3300061734 Ga0530510_0072772 Ga0530510_0072772_1397_2032 209
494 2209111006 2214628275 2213659747 210
495 3300000041 ARcpr5oldR_c000250 ARcpr5oldR_0002504 210
496 3300000042 ARSoilYngRDRAFT_c00208 ARSoilYngRDRAFT_002084 210
497 3300000043 ARcpr5yngRDRAFT_c000678 ARcpr5yngRDRAFT_0006784 210
498 3300000044 ARSoilOldRDRAFT_c000174 ARSoilOldRDRAFT_0001749 210
499 3300000045 ARCol0oldRDRAFT_c01338 ARCol0oldRDRAFT_013382 210
500 3300000652 ARCol0yngRDRAFT_1000170 ARCol0yngRDRAFT_10001709 210
501 3300001989 JGI24739J22299_10002749 JGI24739J22299_100027495 210
502 3300001990 JGI24737J22298_10004199 JGI24737J22298_100041992 210
503 3300001991 JGI24743J22301_10021848 JGI24743J22301_100218482 210
504 3300002070 JGI24750J21931_1000010 JGI24750J21931_100001023 210
505 3300002073 JGI24745J21846_1000735 JGI24745J21846_10007352 210
506 3300002075 JGI24738J21930_10000125 JGI24738J21930_1000012511 210
507 3300002077 JGI24744J21845_10002950 JGI24744J21845_100029503 210
508 3300002126 JGI24035J26624_1000050 JGI24035J26624_10000502 210
509 3300002155 JGI24033J26618_1004385 JGI24033J26618_10043852 210
510 3300002239 JGI24034J26672_10000156 JGI24034J26672_1000015611 210
511 3300002244 JGI24742J22300_10000121 JGI24742J22300_100001214 210
512 3300002459 JGI24751J29686_10005039 JGI24751J29686_100050392 210
513 3300003911 JGI25405J52794_10007928 JGI25405J52794_100079282 210
514 3300005276 Ga0065717_1003254 Ga0065717_10032542 210
515 3300005289 Ga0065704_10080809 Ga0065704_100808092 210
516 3300005293 Ga0065715_10006737 Ga0065715_100067371 210
517 3300005293 Ga0065715_10089962 Ga0065715_100899624 210
518 3300005293 Ga0065715_10099237 Ga0065715_100992374 210
519 3300005295 Ga0065707_10341838 Ga0065707_103418381 210
520 3300005328 Ga0070676_10002283 Ga0070676_100022835 210
521 3300005329 Ga0070683_100000132 Ga0070683_10000013240 210
522 3300005329 Ga0070683_100126298 Ga0070683_1001262982 210
523 3300005329 Ga0070683_100674259 Ga0070683_1006742591 210
524 3300005330 Ga0070690_100003321 Ga0070690_1000033215 210
525 3300005330 Ga0070690_100012804 Ga0070690_1000128043 210
526 3300005330 Ga0070690_100083497 Ga0070690_1000834971 210
527 3300005331 Ga0070670_100009102 Ga0070670_1000091025 210
528 3300005331 Ga0070670_100033434 Ga0070670_1000334347 210
529 3300005331 Ga0070670_100589944 Ga0070670_1005899442 210
530 3300005333 Ga0070677_10000355 Ga0070677_1000035512 210
531 3300005334 Ga0068869_100000063 Ga0068869_10000006340 210
532 3300005334 Ga0068869_100275665 Ga0068869_1002756651 210
533 3300005335 Ga0070666_10014429 Ga0070666_100144292 210
534 3300005335 Ga0070666_10193739 Ga0070666_101937392 210
535 3300005335 Ga0070666_10522500 Ga0070666_105225001 210
536 3300005336 Ga0070680_100000702 Ga0070680_10000070210 210
537 3300005336 Ga0070680_100359636 Ga0070680_1003596362 210
538 3300005337 Ga0070682_100006330 Ga0070682_1000063302 210
539 3300005337 Ga0070682_100020616 Ga0070682_1000206162 210
540 3300005337 Ga0070682_100022247 Ga0070682_1000222474 210
541 3300005338 Ga0068868_100000190 Ga0068868_1000001903 210
542 3300005339 Ga0070660_100000136 Ga0070660_1000001365 210
543 3300005339 Ga0070660_100028048 Ga0070660_1000280482 210
544 3300005340 Ga0070689_100011293 Ga0070689_1000112932 210
545 3300005340 Ga0070689_100142576 Ga0070689_1001425761 210
546 3300005341 Ga0070691_10004223 Ga0070691_100042235 210
547 3300005341 Ga0070691_10149361 Ga0070691_101493612 210
548 3300005343 Ga0070687_100000483 Ga0070687_10000048310 210
549 3300005343 Ga0070687_100003914 Ga0070687_1000039144 210
550 3300005344 Ga0070661_100009808 Ga0070661_1000098085 210
551 3300005344 Ga0070661_100257764 Ga0070661_1002577642 210
552 3300005345 Ga0070692_10000027 Ga0070692_100000275 210
553 3300005345 Ga0070692_10035062 Ga0070692_100350623 210
554 3300005345 Ga0070692_10225720 Ga0070692_102257202 210
555 3300005347 Ga0070668_100004099 Ga0070668_10000409912 210
556 3300005347 Ga0070668_100142804 Ga0070668_1001428042 210
557 3300005347 Ga0070668_100153394 Ga0070668_1001533942 210
558 3300005353 Ga0070669_100001142 Ga0070669_10000114212 210
559 3300005354 Ga0070675_100005715 Ga0070675_1000057152 210
560 3300005354 Ga0070675_100390028 Ga0070675_1003900282 210
561 3300005355 Ga0070671_100001137 Ga0070671_1000011378 210
562 3300005356 Ga0070674_100004133 Ga0070674_1000041335 210
563 3300005356 Ga0070674_100057838 Ga0070674_1000578382 210
564 3300005356 Ga0070674_100868451 Ga0070674_1008684511 210
565 3300005364 Ga0070673_100013640 Ga0070673_1000136402 210
566 3300005364 Ga0070673_100859085 Ga0070673_1008590851 210
567 3300005365 Ga0070688_100002215 Ga0070688_1000022155 210
568 3300005365 Ga0070688_100034652 Ga0070688_1000346522 210
569 3300005365 Ga0070688_100226420 Ga0070688_1002264202 210
570 3300005366 Ga0070659_100004635 Ga0070659_1000046352 210
571 3300005366 Ga0070659_100009448 Ga0070659_1000094484 210
572 3300005367 Ga0070667_100001898 Ga0070667_10000189816 210
573 3300005367 Ga0070667_100060787 Ga0070667_1000607871 210
574 3300005367 Ga0070667_100195769 Ga0070667_1001957692 210
575 3300005406 Ga0070703_10033415 Ga0070703_100334152 210
576 3300005434 Ga0070709_10000219 Ga0070709_1000021935 210
577 3300005435 Ga0070714_100158116 Ga0070714_1001581162 210
578 3300005436 Ga0070713_100064932 Ga0070713_1000649322 210
579 3300005437 Ga0070710_10006625 Ga0070710_100066259 210
580 3300005438 Ga0070701_10001666 Ga0070701_100016664 210
581 3300005439 Ga0070711_100143624 Ga0070711_1001436242 210
582 3300005440 Ga0070705_100000406 Ga0070705_1000004066 210
583 3300005440 Ga0070705_100040084 Ga0070705_1000400843 210
584 3300005441 Ga0070700_100005060 Ga0070700_1000050604 210
585 3300005441 Ga0070700_100006171 Ga0070700_1000061712 210
586 3300005444 Ga0070694_100073517 Ga0070694_1000735172 210
587 3300005444 Ga0070694_100467911 Ga0070694_1004679111 210
588 3300005445 Ga0070708_100002583 Ga0070708_1000025836 210
589 3300005445 Ga0070708_100314459 Ga0070708_1003144592 210
590 3300005455 Ga0070663_100004773 Ga0070663_1000047735 210
591 3300005455 Ga0070663_100025994 Ga0070663_1000259944 210
592 3300005455 Ga0070663_100106018 Ga0070663_1001060182 210
593 3300005456 Ga0070678_100000233 Ga0070678_10000023328 210
594 3300005457 Ga0070662_100008937 Ga0070662_1000089375 210
595 3300005457 Ga0070662_100227894 Ga0070662_1002278942 210
596 3300005458 Ga0070681_10009346 Ga0070681_100093465 210
597 3300005458 Ga0070681_10021072 Ga0070681_100210728 210
598 3300005458 Ga0070681_10047354 Ga0070681_100473544 210
599 3300005459 Ga0068867_100000306 Ga0068867_10000030615 210
600 3300005466 Ga0070685_10001209 Ga0070685_100012099 210
601 3300005466 Ga0070685_10027561 Ga0070685_100275612 210
602 3300005468 Ga0070707_100505654 Ga0070707_1005056542 210
603 3300005530 Ga0070679_100002290 Ga0070679_1000022902 210
604 3300005530 Ga0070679_100087826 Ga0070679_1000878262 210
605 3300005530 Ga0070679_100227809 Ga0070679_1002278093 210
606 3300005535 Ga0070684_100001097 Ga0070684_1000010972 210
607 3300005536 Ga0070697_100074989 Ga0070697_1000749892 210
608 3300005539 Ga0068853_100000364 Ga0068853_10000036412 210
609 3300005543 Ga0070672_100001950 Ga0070672_1000019505 210
610 3300005543 Ga0070672_100092150 Ga0070672_1000921502 210
611 3300005543 Ga0070672_100393928 Ga0070672_1003939281 210
612 3300005544 Ga0070686_100004938 Ga0070686_1000049385 210
613 3300005544 Ga0070686_100020979 Ga0070686_1000209794 210
614 3300005545 Ga0070695_100000208 Ga0070695_10000020828 210
615 3300005545 Ga0070695_100184509 Ga0070695_1001845092 210
616 3300005546 Ga0070696_100001498 Ga0070696_1000014982 210
617 3300005546 Ga0070696_100041297 Ga0070696_1000412972 210
618 3300005547 Ga0070693_100000244 Ga0070693_10000024428 210
619 3300005549 Ga0070704_100001662 Ga0070704_10000166213 210
620 3300005549 Ga0070704_100073935 Ga0070704_1000739352 210
621 3300005563 Ga0068855_100004695 Ga0068855_1000046955 210
622 3300005563 Ga0068855_100984237 Ga0068855_1009842372 210
623 3300005564 Ga0070664_100014605 Ga0070664_1000146056 210
624 3300005564 Ga0070664_100021987 Ga0070664_1000219871 210
625 3300005577 Ga0068857_100004429 Ga0068857_1000044295 210
626 3300005577 Ga0068857_100602032 Ga0068857_1006020322 210
627 3300005578 Ga0068854_100000949 Ga0068854_1000009495 210
628 3300005614 Ga0068856_100000272 Ga0068856_10000027212 210
629 3300005614 Ga0068856_100066703 Ga0068856_1000667033 210
630 3300005615 Ga0070702_100000106 Ga0070702_1000001065 210
631 3300005615 Ga0070702_100331251 Ga0070702_1003312512 210
632 3300005616 Ga0068852_100001698 Ga0068852_10000169812 210
633 3300005616 Ga0068852_100084296 Ga0068852_1000842963 210
634 3300005617 Ga0068859_100009854 Ga0068859_1000098545 210
635 3300005617 Ga0068859_100161640 Ga0068859_1001616403 210
636 3300005617 Ga0068859_100784872 Ga0068859_1007848721 210
637 3300005618 Ga0068864_100000865 Ga0068864_10000086528 210
638 3300005618 Ga0068864_100416417 Ga0068864_1004164171 210
639 3300005718 Ga0068866_10000143 Ga0068866_1000014330 210
640 3300005719 Ga0068861_100001420 Ga0068861_10000142012 210
641 3300005719 Ga0068861_100059060 Ga0068861_1000590602 210
642 3300005840 Ga0068870_10000149 Ga0068870_1000014916 210
643 3300005841 Ga0068863_100000337 Ga0068863_10000033741 210
644 3300005841 Ga0068863_100286038 Ga0068863_1002860381 210
645 3300005841 Ga0068863_100532880 Ga0068863_1005328801 210
646 3300005842 Ga0068858_100004259 Ga0068858_10000425915 210
647 3300005842 Ga0068858_100668580 Ga0068858_1006685801 210
648 3300005843 Ga0068860_100014928 Ga0068860_1000149283 210
649 3300005843 Ga0068860_100019560 Ga0068860_1000195602 210
650 3300005843 Ga0068860_100181748 Ga0068860_1001817482 210
651 3300005843 Ga0068860_100699189 Ga0068860_1006991891 210
652 3300005844 Ga0068862_100003109 Ga0068862_1000031095 210
653 3300005844 Ga0068862_100022218 Ga0068862_1000222183 210
654 3300005844 Ga0068862_101195093 Ga0068862_1011950931 210
655 3300005937 Ga0081455_10002592 Ga0081455_100025928 210
656 3300005937 Ga0081455_10063262 Ga0081455_100632622 210
657 3300005937 Ga0081455_10182286 Ga0081455_101822862 210
658 3300006042 Ga0075368_10107069 Ga0075368_101070692 210
659 3300006058 Ga0075432_10003025 Ga0075432_100030252 210
660 3300006058 Ga0075432_10103567 Ga0075432_101035671 210
661 3300006173 Ga0070716_100000393 Ga0070716_10000039320 210
662 3300006175 Ga0070712_100109410 Ga0070712_1001094102 210
663 3300006194 Ga0075427_10000335 Ga0075427_100003351 210
664 3300006237 Ga0097621_100000348 Ga0097621_10000034812 210
665 3300006237 Ga0097621_100051827 Ga0097621_1000518274 210
666 3300006358 Ga0068871_100003685 Ga0068871_1000036859 210
667 3300006844 Ga0075428_100016252 Ga0075428_1000162525 210
668 3300006846 Ga0075430_100000012 Ga0075430_10000001253 210
669 3300006847 Ga0075431_100023775 Ga0075431_1000237755 210
670 3300006852 Ga0075433_10000106 Ga0075433_1000010616 210
671 3300006852 Ga0075433_10014208 Ga0075433_100142082 210
672 3300006871 Ga0075434_100000114 Ga0075434_1000001144 210
673 3300006871 Ga0075434_100000457 Ga0075434_10000045711 210
674 3300006871 Ga0075434_100006713 Ga0075434_1000067135 210
675 3300006871 Ga0075434_100246880 Ga0075434_1002468802 210
676 3300006871 Ga0075434_100249356 Ga0075434_1002493562 210
677 3300006880 Ga0075429_100003564 Ga0075429_10000356411 210
678 3300006881 Ga0068865_100000394 Ga0068865_10000039422 210
679 3300006881 Ga0068865_100481419 Ga0068865_1004814192 210
680 3300006914 Ga0075436_100005428 Ga0075436_1000054283 210
681 3300006914 Ga0075436_100353565 Ga0075436_1003535651 210
682 3300006914 Ga0075436_100698972 Ga0075436_1006989721 210
683 3300006931 Ga0097620_100009854 Ga0097620_1000098545 210
684 3300006931 Ga0097620_100161638 Ga0097620_1001616383 210
685 3300006931 Ga0097620_100784889 Ga0097620_1007848891 210
686 3300007076 Ga0075435_100509383 Ga0075435_1005093832 210
687 3300009093 Ga0105240_10105641 Ga0105240_101056412 210
688 3300009094 Ga0111539_10000299 Ga0111539_1000029923 210
689 3300009094 Ga0111539_10000581 Ga0111539_1000058140 210
690 3300009094 Ga0111539_10014752 Ga0111539_100147525 210
691 3300009094 Ga0111539_10185951 Ga0111539_101859512 210
692 3300009094 Ga0111539_10211650 Ga0111539_102116504 210
693 3300009098 Ga0105245_10000663 Ga0105245_1000066314 210
694 3300009098 Ga0105245_10099641 Ga0105245_100996413 210
695 3300009098 Ga0105245_10121065 Ga0105245_101210652 210
696 3300009101 Ga0105247_10003720 Ga0105247_100037205 210
697 3300009101 Ga0105247_10115761 Ga0105247_101157612 210
698 3300009147 Ga0114129_10018146 Ga0114129_100181466 210
699 3300009147 Ga0114129_10058804 Ga0114129_100588042 210
700 3300009148 Ga0105243_10002452 Ga0105243_1000245213 210
701 3300009148 Ga0105243_10135684 Ga0105243_101356842 210
702 3300009148 Ga0105243_10260788 Ga0105243_102607882 210
703 3300009174 Ga0105241_10001566 Ga0105241_1000156616 210
704 3300009174 Ga0105241_10052636 Ga0105241_100526363 210
705 3300009176 Ga0105242_10001341 Ga0105242_1000134113 210
706 3300009177 Ga0105248_10030265 Ga0105248_100302652 210
707 3300009177 Ga0105248_10078621 Ga0105248_100786214 210
708 3300009177 Ga0105248_11138860 Ga0105248_111388601 210
709 3300009545 Ga0105237_10007002 Ga0105237_1000700213 210
710 3300009545 Ga0105237_10369646 Ga0105237_103696462 210
711 3300009551 Ga0105238_10077336 Ga0105238_100773362 210
712 3300009551 Ga0105238_10855533 Ga0105238_108555331 210
713 3300009553 Ga0105249_10074724 Ga0105249_100747244 210
714 3300009553 Ga0105249_10172631 Ga0105249_101726312 210
715 3300009553 Ga0105249_10454617 Ga0105249_104546172 210
716 3300010375 Ga0105239_10009001 Ga0105239_1000900112 210
717 3300010375 Ga0105239_11114931 Ga0105239_111149312 210
718 3300011119 Ga0105246_10000067 Ga0105246_100000675 210
719 3300011119 Ga0105246_10266761 Ga0105246_102667612 210
720 3300012480 Ga0157346_1001624 Ga0157346_10016242 210
721 3300012507 Ga0157342_1000525 Ga0157342_10005252 210
722 3300013100 Ga0157373_10047928 Ga0157373_100479283 210
723 3300013102 Ga0157371_10006720 Ga0157371_100067203 210
724 3300013296 Ga0157374_10003806 Ga0157374_100038068 210
725 3300013297 Ga0157378_10061922 Ga0157378_100619221 210
726 3300013297 Ga0157378_10067095 Ga0157378_100670952 210
727 3300013306 Ga0163162_10001721 Ga0163162_1000172112 210
728 3300013306 Ga0163162_10103483 Ga0163162_101034833 210
729 3300013307 Ga0157372_10010547 Ga0157372_100105474 210
730 3300013307 Ga0157372_10176767 Ga0157372_101767672 210
731 3300013308 Ga0157375_10002665 Ga0157375_1000266513 210
732 3300013308 Ga0157375_10057946 Ga0157375_100579464 210
733 3300013308 Ga0157375_11743989 Ga0157375_117439891 210
734 3300014325 Ga0163163_10009638 Ga0163163_100096385 210
735 3300014325 Ga0163163_10010130 Ga0163163_100101307 210
736 3300014325 Ga0163163_10098867 Ga0163163_100988672 210
737 3300014326 Ga0157380_10000049 Ga0157380_1000004966 210
738 3300014497 Ga0182008_10185081 Ga0182008_101850811 210
739 3300014745 Ga0157377_10000053 Ga0157377_1000005328 210
740 3300014968 Ga0157379_10000306 Ga0157379_100003066 210
741 3300014968 Ga0157379_10085760 Ga0157379_100857603 210
742 3300014969 Ga0157376_10000099 Ga0157376_1000009912 210
743 3300017792 Ga0163161_10001833 Ga0163161_1000183313 210
744 3300017792 Ga0163161_10406553 Ga0163161_104065532 210
745 3300021384 Ga0213876_10072502 Ga0213876_100725022 210
746 3300025271 Ga0207666_1000013 Ga0207666_100001327 210
747 3300025271 Ga0207666_1000335 Ga0207666_10003356 210
748 3300025290 Ga0207673_1000362 Ga0207673_10003625 210
749 3300025315 Ga0207697_10000042 Ga0207697_1000004213 210
750 3300025735 Ga0207713_1167238 Ga0207713_11672381 210
751 3300025885 Ga0207653_10008834 Ga0207653_100088341 210
752 3300025893 Ga0207682_10000089 Ga0207682_1000008934 210
753 3300025898 Ga0207692_10013104 Ga0207692_100131042 210
754 3300025899 Ga0207642_10001638 Ga0207642_100016383 210
755 3300025900 Ga0207710_10000812 Ga0207710_100008125 210
756 3300025901 Ga0207688_10000460 Ga0207688_100004605 210
757 3300025903 Ga0207680_10006724 Ga0207680_100067244 210
758 3300025904 Ga0207647_10003720 Ga0207647_1000372014 210
759 3300025904 Ga0207647_10010565 Ga0207647_100105652 210
760 3300025905 Ga0207685_10019368 Ga0207685_100193684 210
761 3300025906 Ga0207699_10013829 Ga0207699_100138293 210
762 3300025907 Ga0207645_10000162 Ga0207645_100001625 210
763 3300025908 Ga0207643_10000404 Ga0207643_1000040424 210
764 3300025911 Ga0207654_10001699 Ga0207654_1000169914 210
765 3300025911 Ga0207654_10342149 Ga0207654_103421491 210
766 3300025912 Ga0207707_10011189 Ga0207707_100111899 210
767 3300025912 Ga0207707_10050436 Ga0207707_100504363 210
768 3300025913 Ga0207695_10183649 Ga0207695_101836492 210
769 3300025915 Ga0207693_10047617 Ga0207693_100476172 210
770 3300025917 Ga0207660_10000007 Ga0207660_1000000762 210
771 3300025917 Ga0207660_10017339 Ga0207660_100173391 210
772 3300025917 Ga0207660_10333683 Ga0207660_103336832 210
773 3300025917 Ga0207660_10438613 Ga0207660_104386131 210
774 3300025918 Ga0207662_10000458 Ga0207662_100004589 210
775 3300025919 Ga0207657_10010273 Ga0207657_100102735 210
776 3300025919 Ga0207657_10019106 Ga0207657_100191065 210
777 3300025920 Ga0207649_10000048 Ga0207649_1000004823 210
778 3300025920 Ga0207649_10000305 Ga0207649_1000030528 210
779 3300025920 Ga0207649_10032748 Ga0207649_100327484 210
780 3300025921 Ga0207652_10002194 Ga0207652_1000219418 210
781 3300025921 Ga0207652_10403666 Ga0207652_104036662 210
782 3300025923 Ga0207681_10000116 Ga0207681_1000011639 210
783 3300025923 Ga0207681_10115806 Ga0207681_101158062 210
784 3300025924 Ga0207694_10048904 Ga0207694_100489043 210
785 3300025925 Ga0207650_10035382 Ga0207650_100353822 210
786 3300025925 Ga0207650_10516723 Ga0207650_105167232 210
787 3300025926 Ga0207659_10000155 Ga0207659_100001552 210
788 3300025927 Ga0207687_10000090 Ga0207687_1000009014 210
789 3300025927 Ga0207687_10185878 Ga0207687_101858782 210
790 3300025928 Ga0207700_10016325 Ga0207700_100163253 210
791 3300025931 Ga0207644_10000251 Ga0207644_100002515 210
792 3300025931 Ga0207644_10212125 Ga0207644_102121252 210
793 3300025932 Ga0207690_10000320 Ga0207690_100003203 210
794 3300025932 Ga0207690_10039510 Ga0207690_100395101 210
795 3300025933 Ga0207706_10001307 Ga0207706_100013075 210
796 3300025933 Ga0207706_10021126 Ga0207706_100211264 210
797 3300025934 Ga0207686_10001488 Ga0207686_100014885 210
798 3300025934 Ga0207686_10280720 Ga0207686_102807202 210
799 3300025934 Ga0207686_10330780 Ga0207686_103307801 210
800 3300025935 Ga0207709_10000081 Ga0207709_10000081150 210
801 3300025935 Ga0207709_10075917 Ga0207709_100759172 210
802 3300025936 Ga0207670_10000096 Ga0207670_1000009639 210
803 3300025936 Ga0207670_10112791 Ga0207670_101127912 210
804 3300025937 Ga0207669_10000136 Ga0207669_1000013635 210
805 3300025937 Ga0207669_10469904 Ga0207669_104699042 210
806 3300025938 Ga0207704_10000215 Ga0207704_1000021528 210
807 3300025939 Ga0207665_10000555 Ga0207665_1000055525 210
808 3300025940 Ga0207691_10000829 Ga0207691_1000082913 210
809 3300025941 Ga0207711_10016986 Ga0207711_100169862 210
810 3300025941 Ga0207711_10730816 Ga0207711_107308161 210
811 3300025942 Ga0207689_10000766 Ga0207689_1000076613 210
812 3300025942 Ga0207689_10141527 Ga0207689_101415272 210
813 3300025944 Ga0207661_10000170 Ga0207661_100001707 210
814 3300025945 Ga0207679_10000090 Ga0207679_1000009013 210
815 3300025945 Ga0207679_10518951 Ga0207679_105189512 210
816 3300025949 Ga0207667_10002635 Ga0207667_100026353 210
817 3300025949 Ga0207667_11145459 Ga0207667_111454591 210
818 3300025960 Ga0207651_10001086 Ga0207651_1000108613 210
819 3300025961 Ga0207712_10000495 Ga0207712_1000049529 210
820 3300025961 Ga0207712_10052703 Ga0207712_100527031 210
821 3300025961 Ga0207712_10280458 Ga0207712_102804581 210
822 3300025972 Ga0207668_10000133 Ga0207668_100001334 210
823 3300025972 Ga0207668_10069173 Ga0207668_100691732 210
824 3300025981 Ga0207640_10000191 Ga0207640_100001918 210
825 3300025986 Ga0207658_10006088 Ga0207658_100060882 210
826 3300026023 Ga0207677_10002370 Ga0207677_100023704 210
827 3300026035 Ga0207703_10000560 Ga0207703_100005606 210
828 3300026035 Ga0207703_10382919 Ga0207703_103829192 210
829 3300026041 Ga0207639_10004165 Ga0207639_100041659 210
830 3300026067 Ga0207678_10000197 Ga0207678_100001975 210
831 3300026067 Ga0207678_10012097 Ga0207678_100120978 210
832 3300026067 Ga0207678_10053934 Ga0207678_100539342 210
833 3300026067 Ga0207678_10055490 Ga0207678_100554903 210
834 3300026075 Ga0207708_10000947 Ga0207708_1000094722 210
835 3300026075 Ga0207708_10010717 Ga0207708_100107178 210
836 3300026078 Ga0207702_10001076 Ga0207702_1000107626 210
837 3300026078 Ga0207702_10085606 Ga0207702_100856062 210
838 3300026088 Ga0207641_10003500 Ga0207641_100035009 210
839 3300026089 Ga0207648_10001359 Ga0207648_100013595 210
840 3300026089 Ga0207648_10272879 Ga0207648_102728793 210
841 3300026095 Ga0207676_10000993 Ga0207676_1000099322 210
842 3300026095 Ga0207676_10186429 Ga0207676_101864292 210
843 3300026116 Ga0207674_10001393 Ga0207674_1000139314 210
844 3300026116 Ga0207674_10367071 Ga0207674_103670712 210
845 3300026118 Ga0207675_100003415 Ga0207675_1000034155 210
846 3300026118 Ga0207675_100113178 Ga0207675_1001131783 210
847 3300026121 Ga0207683_10000141 Ga0207683_1000014155 210
848 3300026142 Ga0207698_10015513 Ga0207698_100155132 210
849 3300026142 Ga0207698_10158498 Ga0207698_101584982 210
850 3300027111 Ga0209281_1000798 Ga0209281_100079818 210
851 3300027617 Ga0210002_1002952 Ga0210002_10029523 210
852 3300027665 Ga0209983_1009812 Ga0209983_10098122 210
853 3300027682 Ga0209971_1004860 Ga0209971_10048602 210
854 3300027695 Ga0209966_1023433 Ga0209966_10234332 210
855 3300027717 Ga0209998_10001984 Ga0209998_100019842 210
856 3300027876 Ga0209974_10000295 Ga0209974_1000029513 210
857 3300027876 Ga0209974_10009249 Ga0209974_100092493 210
858 3300027876 Ga0209974_10084141 Ga0209974_100841412 210
859 3300027876 Ga0209974_10084240 Ga0209974_100842402 210
860 3300027907 Ga0207428_10000011 Ga0207428_1000001116 210
861 3300027907 Ga0207428_10000046 Ga0207428_10000046167 210
862 3300027907 Ga0207428_10000058 Ga0207428_10000058114 210
863 3300027907 Ga0207428_10013808 Ga0207428_100138084 210
864 3300027907 Ga0207428_10382485 Ga0207428_103824851 210
865 3300028380 Ga0268265_10000405 Ga0268265_1000040512 210
866 3300028380 Ga0268265_10364213 Ga0268265_103642132 210
867 3300028380 Ga0268265_10518859 Ga0268265_105188592 210
868 3300028381 Ga0268264_10000340 Ga0268264_1000034033 210
869 3300028381 Ga0268264_10069042 Ga0268264_100690422 210
870 3300028381 Ga0268264_10106607 Ga0268264_101066073 210
871 3300028381 Ga0268264_10135420 Ga0268264_101354202 210
872 3300034816 Ga0373930_0013741 Ga0373930_0013741_231_863 210
873 3300034816 Ga0373930_0016518 Ga0373930_0016518_329_961 210
874 3300034816 Ga0373930_0018237 Ga0373930_0018237_234_881 210
875 3300034817 Ga0373948_0000122 Ga0373948_0000122_1503_2135 210
876 3300034817 Ga0373948_0011217 Ga0373948_0011217_133_780 210
877 3300034818 Ga0373950_0016865 Ga0373950_0016865_543_1175 210
878 3300034819 Ga0373958_0001381 Ga0373958_0001381_2407_3039 210
879 3300034820 Ga0373959_0026942 Ga0373959_0026942_224_856 210
880 3300034957 Ga0373938_0000445 Ga0373938_0000445_639_1271 210
881 3300034957 Ga0373938_0001301 Ga0373938_0001301_2622_3254 210
882 3300035083 Ga0373926_0003607 Ga0373926_0003607_2263_2898 210
883 3300035084 Ga0373928_0000382 Ga0373928_0000382_5829_6461 210
884 3300035084 Ga0373928_0000518 Ga0373928_0000518_4061_4693 210
885 3300035084 Ga0373928_0047313 Ga0373928_0047313_48_695 210
886 3300035085 Ga0373929_0001453 Ga0373929_0001453_3691_4323 210
887 3300035088 Ga0373940_0016520 Ga0373940_0016520_311_958 210
888 3300035088 Ga0373940_0019070 Ga0373940_0019070_826_1458 210
889 3300035089 Ga0373944_0008713 Ga0373944_0008713_721_1368 210
890 3300035090 Ga0373949_0000549 Ga0373949_0000549_2278_2910 210
891 3300035090 Ga0373949_0001748 Ga0373949_0001748_2856_3488 210
892 3300035090 Ga0373949_0004482 Ga0373949_0004482_725_1372 210
893 3300035091 Ga0373951_0000836 Ga0373951_0000836_7084_7716 210
894 3300035091 Ga0373951_0001355 Ga0373951_0001355_761_1393 210
895 3300035091 Ga0373951_0012008 Ga0373951_0012008_390_1037 210
896 3300035092 Ga0373952_0001852 Ga0373952_0001852_2395_3027 210
897 3300035092 Ga0373952_0025224 Ga0373952_0025224_453_1085 210
898 3300035112 Ga0373932_0003013 Ga0373932_0003013_1500_2147 210
899 3300035113 Ga0373936_0161555 Ga0373936_0161555_240_875 210
900 3300035114 Ga0373939_0000480 Ga0373939_0000480_7017_7649 210
901 3300035114 Ga0373939_0001023 Ga0373939_0001023_825_1457 210
902 3300035114 Ga0373939_0065299 Ga0373939_0065299_125_772 210
903 3300035115 Ga0373941_0001109 Ga0373941_0001109_3540_4172 210
904 3300035115 Ga0373941_0005005 Ga0373941_0005005_660_1292 210
905 3300035116 Ga0373945_0005322 Ga0373945_0005322_1559_2212 210
906 3300035116 Ga0373945_0012002 Ga0373945_0012002_1082_1717 210
907 3300035121 Ga0373960_0000075 Ga0373960_0000075_11405_12037 210
908 3300035121 Ga0373960_0000089 Ga0373960_0000089_9328_9960 210
909 3300035170 Ga0373943_0009289 Ga0373943_0009289_1361_2008 210
910 3300035170 Ga0373943_0057874 Ga0373943_0057874_960_1613 210
911 3300035171 Ga0373946_0012892 Ga0373946_0012892_2369_3004 210
912 3300035171 Ga0373946_0037721 Ga0373946_0037721_520_1173 210
913 3300035171 Ga0373946_0053076 Ga0373946_0053076_931_1578 210
914 3300035172 Ga0373955_0406645 Ga0373955_0406645_179_811 210
915 3300035207 Ga0373942_0001936 Ga0373942_0001936_3901_4533 210
916 3300035207 Ga0373942_0004729 Ga0373942_0004729_2268_2900 210
917 3300035241 Ga0373961_0000902 Ga0373961_0000902_2005_2637 210
918 3300035241 Ga0373961_0007325 Ga0373961_0007325_622_1269 210
919 3300035241 Ga0373961_0210145 Ga0373961_0210145_14_646 210
920 3300035691 Ga0373931_0001924 Ga0373931_0001924_846_1478 210
921 3300035691 Ga0373931_0011110 Ga0373931_0011110_1587_2234 210
922 3300035691 Ga0373931_0011894 Ga0373931_0011894_3162_3794 210
923 3300035691 Ga0373931_0151259 Ga0373931_0151259_621_1253 210
924 3300035692 Ga0373935_0028883 Ga0373935_0028883_1673_2320 210
925 3300035695 Ga0373927_0087402 Ga0373927_0087402_17_649 210
926 3300035725 Ga0373947_0002148 Ga0373947_0002148_4789_5436 210
927 3300035725 Ga0373947_0045145 Ga0373947_0045145_1380_2033 210
928 3300036401 Ga0373937_0392084 Ga0373937_0392084_367_1020 210
929 3300037068 Ga0373925_0006522 Ga0373925_0006522_4611_5258 210
930 3300039437 Ga0436365_1347068 Ga0436365_1347068_1652_2293 210
931 3300044712 Ga0453684_0265518 Ga0453684_0265518_861_1493 210
932 3300045051 Ga0451576_0060211 Ga0451576_0060211_557_1189 210
933 3300046454 Ga0495592_0297363 Ga0495592_0297363_263_916 210
934 3300046455 Ga0495603_0027316 Ga0495603_0027316_2585_3232 210
935 3300046459 Ga0495629_0000577 Ga0495629_0000577_17354_18001 210
936 3300046459 Ga0495629_0014609 Ga0495629_0014609_2274_2927 210
937 3300046459 Ga0495629_0099945 Ga0495629_0099945_50_685 210
938 3300046461 Ga0495641_0125770 Ga0495641_0125770_131_766 210
939 3300046462 Ga0495651_0021029 Ga0495651_0021029_4127_4780 210
940 3300046463 Ga0495653_0032171 Ga0495653_0032171_1798_2451 210
941 3300046472 Ga0495580_0085247 Ga0495580_0085247_1275_1910 210
942 3300046472 Ga0495580_0155060 Ga0495580_0155060_170_817 210
943 3300046473 Ga0495582_0023392 Ga0495582_0023392_1135_1770 210
944 3300046473 Ga0495582_0039234 Ga0495582_0039234_1463_2110 210
945 3300046473 Ga0495582_0203965 Ga0495582_0203965_478_1110 210
946 3300046475 Ga0495639_0009978 Ga0495639_0009978_1567_2202 210
947 3300046475 Ga0495639_0111506 Ga0495639_0111506_518_1171 210
948 3300046476 Ga0495662_0015970 Ga0495662_0015970_622_1275 210
949 3300046477 Ga0495664_0025843 Ga0495664_0025843_203_856 210
950 3300046477 Ga0495664_0027938 Ga0495664_0027938_2555_3190 210
951 3300046491 Ga0495584_0117787 Ga0495584_0117787_52_684 210
952 3300046491 Ga0495584_0129218 Ga0495584_0129218_120_773 210
953 3300046492 Ga0495585_0020294 Ga0495585_0020294_478_1131 210
954 3300046499 Ga0495594_0005733 Ga0495594_0005733_2656_3303 210
955 3300046499 Ga0495594_0083682 Ga0495594_0083682_496_1149 210
956 3300046501 Ga0495607_0030536 Ga0495607_0030536_2641_3294 210
957 3300046514 Ga0495618_0153605 Ga0495618_0153605_452_1087 210
958 3300046516 Ga0495628_0053287 Ga0495628_0053287_1265_1918 210
959 3300046518 Ga0495631_0121585 Ga0495631_0121585_287_940 210
960 3300046523 Ga0495644_0034138 Ga0495644_0034138_987_1640 210
961 3300046525 Ga0495663_0019753 Ga0495663_0019753_421_1074 210
962 3300046526 Ga0495666_0015245 Ga0495666_0015245_2542_3195 210
963 3300046526 Ga0495666_0058094 Ga0495666_0058094_1052_1687 210
964 3300046529 Ga0495652_0045348 Ga0495652_0045348_2494_3147 210
965 3300046529 Ga0495652_0066312 Ga0495652_0066312_973_1608 210
966 3300046530 Ga0495654_0000195 Ga0495654_0000195_26967_27671 210
967 3300046531 Ga0495665_0017690 Ga0495665_0017690_1904_2539 210
968 3300046531 Ga0495665_0021884 Ga0495665_0021884_2647_3300 210
969 3300046533 Ga0495640_0112913 Ga0495640_0112913_719_1372 210
970 3300046533 Ga0495640_0228658 Ga0495640_0228658_406_1041 210
971 3300046536 Ga0495587_0031195 Ga0495587_0031195_645_1298 210
972 3300046536 Ga0495587_0284282 Ga0495587_0284282_183_830 210
973 3300046538 Ga0495609_0017146 Ga0495609_0017146_471_1124 210
974 3300046543 Ga0495645_0021703 Ga0495645_0021703_3067_3702 210
975 3300046543 Ga0495645_0155632 Ga0495645_0155632_303_956 210
976 3300046557 Ga0495622_0139419 Ga0495622_0139419_338_973 210
977 3300046558 Ga0495633_0058533 Ga0495633_0058533_14_667 210
978 3300046615 Ga0495656_0006096 Ga0495656_0006096_1747_2400 210
979 3300046642 Ga0495634_0120345 Ga0495634_0120345_427_1080 210
980 3300046663 Ga0495635_0018011 Ga0495635_0018011_120_773 210
981 3300046663 Ga0495635_0034629 Ga0495635_0034629_1878_2513 210
982 3300046663 Ga0495635_0072756 Ga0495635_0072756_652_1299 210
983 3300046664 Ga0495659_0017252 Ga0495659_0017252_614_1267 210
984 3300046665 Ga0495661_0269871 Ga0495661_0269871_86_739 210
985 3300046674 Ga0495588_0033487 Ga0495588_0033487_654_1301 210
986 3300046674 Ga0495588_0094496 Ga0495588_0094496_602_1255 210
987 3300046678 Ga0495599_0046612 Ga0495599_0046612_145_798 210
988 3300046680 Ga0495646_0046680 Ga0495646_0046680_1840_2493 210
989 3300046681 Ga0495647_0020517 Ga0495647_0020517_1587_2240 210
990 3300046681 Ga0495647_0093073 Ga0495647_0093073_259_894 210
991 3300046683 Ga0495658_0000944 Ga0495658_0000944_5084_5731 210
992 3300046683 Ga0495658_0348119 Ga0495658_0348119_159_812 210
993 3300046691 Ga0495670_0034592 Ga0495670_0034592_580_1233 210
994 3300046692 Ga0495671_0216005 Ga0495671_0216005_60_713 210
995 3300046794 Ga0495589_0044030 Ga0495589_0044030_176_829 210
996 3300046809 Ga0495600_0005531 Ga0495600_0005531_5081_5734 210
997 3300047315 Ga0495581_0093984 Ga0495581_0093984_375_1010 210
998 3300047315 Ga0495581_0244815 Ga0495581_0244815_20_652 210
999 3300047317 Ga0495604_0118199 Ga0495604_0118199_1016_1663 210
1000 3300047317 Ga0495604_0506510 Ga0495604_0506510_134_766 210
1001 3300047319 Ga0495674_0008886 Ga0495674_0008886_2773_3408 210
1002 3300047321 Ga0495676_0046504 Ga0495676_0046504_399_1046 210
1003 3300047322 Ga0495680_0021289 Ga0495680_0021289_1192_1839 210
1004 3300047322 Ga0495680_0022905 Ga0495680_0022905_1997_2650 210
1005 3300047446 Ga0495679_029342 Ga0495679_029342_191_844 210
1006 3300047471 Ga0495684_0000517 Ga0495684_0000517_2372_3025 210
1007 3300047673 Ga0495593_0005851 Ga0495593_0005851_4584_5231 210
1008 3300048089 Ga0495614_0047452 Ga0495614_0047452_297_932 210
1009 3300048903 Ga0496100_0000589 Ga0496100_0000589_7136_7768 210
1010 3300048904 Ga0496101_0000782 Ga0496101_0000782_8833_9465 210
1011 3300048904 Ga0496101_0372589 Ga0496101_0372589_121_753 210
1012 3300048905 Ga0496102_0004682 Ga0496102_0004682_3958_4590 210
1013 3300048905 Ga0496102_0092192 Ga0496102_0092192_1434_2066 210
1014 3300048906 Ga0496103_0054684 Ga0496103_0054684_1063_1695 210
1015 3300048906 Ga0496103_0153282 Ga0496103_0153282_310_957 210
1016 3300048907 Ga0496104_0031877 Ga0496104_0031877_1814_2461 210
1017 3300048907 Ga0496104_0337650 Ga0496104_0337650_189_836 210
1018 3300048908 Ga0496105_0161814 Ga0496105_0161814_421_1068 210
1019 3300048909 Ga0496106_0049812 Ga0496106_0049812_203_835 210
1020 3300048909 Ga0496106_0157465 Ga0496106_0157465_908_1540 210
1021 3300048909 Ga0496106_0284695 Ga0496106_0284695_464_1099 210
1022 3300048910 Ga0496107_0025804 Ga0496107_0025804_1814_2461 210
1023 3300048910 Ga0496107_0038274 Ga0496107_0038274_1044_1676 210
1024 3300048910 Ga0496107_0164033 Ga0496107_0164033_610_1257 210
1025 3300048911 Ga0496108_0006294 Ga0496108_0006294_4468_5100 210
1026 3300048911 Ga0496108_0008390 Ga0496108_0008390_3962_4594 210
1027 3300048912 Ga0496109_0000500 Ga0496109_0000500_3492_4124 210
1028 3300048912 Ga0496109_0001328 Ga0496109_0001328_17850_18482 210
1029 3300048912 Ga0496109_0016249 Ga0496109_0016249_770_1417 210
1030 3300048912 Ga0496109_0184996 Ga0496109_0184996_773_1420 210
1031 3300048912 Ga0496109_0486019 Ga0496109_0486019_106_738 210
1032 3300048913 Ga0496110_0044003 Ga0496110_0044003_2633_3265 210
1033 3300048914 Ga0496111_0073039 Ga0496111_0073039_1133_1780 210
1034 3300048914 Ga0496111_0202296 Ga0496111_0202296_796_1428 210
1035 3300048915 Ga0496112_0019146 Ga0496112_0019146_4938_5570 210
1036 3300048916 Ga0496113_0005457 Ga0496113_0005457_4080_4712 210
1037 3300048916 Ga0496113_0059992 Ga0496113_0059992_406_1053 210
1038 3300048917 Ga0496114_0000544 Ga0496114_0000544_2326_2958 210
1039 3300048918 Ga0496115_0033087 Ga0496115_0033087_872_1504 210
1040 3300048918 Ga0496115_0108637 Ga0496115_0108637_1101_1736 210
1041 3300048922 Ga0496119_0290424 Ga0496119_0290424_81_728 210
1042 3300049576 Ga0501040_0505473 Ga0501040_0505473_195_827 210
1043 3300049588 Ga0501072_0400244 Ga0501072_0400244_330_968 210
1044 3300049589 Ga0501073_0164659 Ga0501073_0164659_292_930 210
1045 3300049589 Ga0501073_0255391 Ga0501073_0255391_81_713 210
1046 3300049591 Ga0501075_0154148 Ga0501075_0154148_853_1485 210
1047 3300049592 Ga0501076_0078791 Ga0501076_0078791_448_1080 210
1048 3300049593 Ga0501077_0033846 Ga0501077_0033846_1479_2111 210
1049 3300049593 Ga0501077_0060461 Ga0501077_0060461_832_1470 210
1050 3300049742 Ga0501080_0121276 Ga0501080_0121276_1136_1807 210
1051 3300049742 Ga0501080_0342741 Ga0501080_0342741_344_982 210
1052 3300049742 Ga0501080_1096557 Ga0501080_1096557_22_654 210
1053 3300049743 Ga0501081_0237851 Ga0501081_0237851_176_814 210
1054 3300049744 Ga0501083_0122077 Ga0501083_0122077_430_1068 210
1055 3300049823 Ga0501044_0003273 Ga0501044_0003273_16424_17095 210
1056 3300050495 nmdc:mga04h51_43807_c1 nmdc:mga04h51_43807_c1_520_1152 210
1057 3300050507 nmdc:mga05p37_35_c1 nmdc:mga05p37_35_c1_4229_4864 210
1058 3300050508 nmdc:mga09592_12863_c1 nmdc:mga09592_12863_c1_4611_5246 210
1059 3300050509 nmdc:mga0qj67_1026_c1 nmdc:mga0qj67_1026_c1_18069_18704 210
1060 3300050510 nmdc:mga06r32_55452_c1 nmdc:mga06r32_55452_c1_390_1025 210
1061 3300050511 nmdc:mga08y16_202042_c1 nmdc:mga08y16_202042_c1_1022_1669 210
1062 3300050511 nmdc:mga08y16_22611_c1 nmdc:mga08y16_22611_c1_1384_2019 210
1063 3300050511 nmdc:mga08y16_2480_c1 nmdc:mga08y16_2480_c1_828_1460 210
1064 3300050511 nmdc:mga08y16_278734_c1 nmdc:mga08y16_278734_c1_826_1458 210
1065 3300050512 nmdc:mga0n895_11659_c1 nmdc:mga0n895_11659_c1_5164_5799 210
1066 3300050512 nmdc:mga0n895_41857_c1 nmdc:mga0n895_41857_c1_335_982 210
1067 3300050512 nmdc:mga0n895_73_c1 nmdc:mga0n895_73_c1_39692_40327 210
1068 3300050512 nmdc:mga0n895_877_c1 nmdc:mga0n895_877_c1_7335_7967 210
1069 3300050512 nmdc:mga0n895_955829_c1 nmdc:mga0n895_955829_c1_104_748 210
1070 3300050513 nmdc:mga0rr50_25060_c1 nmdc:mga0rr50_25060_c1_2503_3138 210
1071 3300050513 nmdc:mga0rr50_42978_c1 nmdc:mga0rr50_42978_c1_2638_3270 210
1072 3300050513 nmdc:mga0rr50_75377_c1 nmdc:mga0rr50_75377_c1_409_1056 210
1073 3300050514 nmdc:mga08x19_329911_c1 nmdc:mga08x19_329911_c1_130_762 210
1074 3300050514 nmdc:mga08x19_47889_c1 nmdc:mga08x19_47889_c1_1227_1859 210
1075 3300050515 nmdc:mga0a205_20696_c1 nmdc:mga0a205_20696_c1_3556_4188 210
1076 3300050515 nmdc:mga0a205_59_c1 nmdc:mga0a205_59_c1_39673_40308 210
1077 3300050515 nmdc:mga0a205_817331_c1 nmdc:mga0a205_817331_c1_102_737 210
1078 3300053077 Ga0495601_0107171 Ga0495601_0107171_635_1288 210
1079 3300053078 Ga0495612_0004728 Ga0495612_0004728_3096_3749 210
1080 3300053085 Ga0495619_0000687 Ga0495619_0000687_20194_20841 210
1081 3300053085 Ga0495619_0013679 Ga0495619_0013679_3828_4481 210
1082 3300054114 Ga0501084_0409923 Ga0501084_0409923_296_928 210
1083 3300060353 Ga0501082_0372683 Ga0501082_0372683_308_946 210
1084 3300061734 Ga0530510_0079496 Ga0530510_0079496_707_1345 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

9

118

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

142

198

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dck-assembly1.cif.gz_A structure of unphosphorylated fixj-n complexed with mn2+ 0.9434 5 122
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9425 144 204
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9406 140 203
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9355 144 204
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9354 142 204
ID Description Score Start End Superfamily
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9916 143 200 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9881 143 200 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9589 143 200 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9557 143 200 1.10.10.10
1a04B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9556 142 203 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6A8W472-F1-model_v4 deleted 0.9798 3 202
AF-A0A370KTC8-F1-model_v4 DNA-binding response regulator 0.9793 5 202 GO:0000160
GO:0003677
GO:0006355
AF-A0A327YBQ8-F1-model_v4 deleted 0.9788 5 202
AF-H8GG97-F1-model_v4 Response regulator 0.9784 5 203 GO:0000160
GO:0003677
GO:0006355
AF-A0A1L6L826-F1-model_v4 deleted 0.9773 5 202

Feature Viewer

pLDDT pTM Quality
91.44 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map