F489749
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1084 | 432 | 2168 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300046499|Ga0495594_0039360|Ga0495594_0039360_1199_2221 |
| Length | 340 |
| Sequence | VLRWDNLHAGPIGGHAASPKQRERLMADTTHTWTRALSDTSAPTVRKSGLHRFMRQRSTIAFLMCLPLIVIICGLIIYPAIYSIHLSMLNKAQTRFIGLSNFTFLISRDTFWMVVWQSTIFALSAVFFKALIGLVTAHLVNNLPVKGQRKWRGMLLVPWVIPLALSTLGWWWLFDPTNSAFNYTLQSLGFDRVAWLSDPYWARFTVILVNVWYGAPFFLIMYLAALKSVPEQLYEAAAIDGATAWQKFIHITLPMMRNIIAITVLFSLIVTFANFDIVQIMTAGGPRNMTHMFATYAFLLGIRSGDLPLGAATSLFMFPILAVAAVFILRGVRKRGREIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 19 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 20 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 21 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 22 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 23 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 156 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 254 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 269 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 285 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 286 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 287 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 288 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 289 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 290 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 291 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 292 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 293 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 294 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 295 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 296 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 297 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 298 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 302 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 303 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 304 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 361 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 362 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 363 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 364 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 365 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 366 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 369 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 370 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 371 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 372 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 373 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 374 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 375 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 407 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 423 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 428 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 429 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 430 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 431 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 432 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0.55 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 5.63 |
| Rhizosphere | 92.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495594_0039360 | 3300046499 | Bacteria | 2585 |
| 2 | 2214745210 | 2209111006 | Bacteria | 15141 |
| 3 | ARcpr5oldR_c000695 | 3300000041 | Bacteria | 3910 |
| 4 | ARSoilYngRDRAFT_c00009 | 3300000042 | Bacteria | 30468 |
| 5 | ARcpr5yngRDRAFT_c000006 | 3300000043 | Bacteria | 44193 |
| 6 | ARSoilOldRDRAFT_c000102 | 3300000044 | Bacteria | 16000 |
| 7 | ARCol0oldRDRAFT_c00372 | 3300000045 | Bacteria | 4333 |
| 8 | ARCol0yngRDRAFT_1000031 | 3300000652 | Bacteria | 25026 |
| 9 | JGI24746J21847_1001151 | 3300001977 | Bacteria | 4176 |
| 10 | JGI24747J21853_1000092 | 3300001978 | Bacteria | 3941 |
| 11 | JGI24739J22299_10001142 | 3300001989 | Bacteria | 9904 |
| 12 | JGI24737J22298_10017959 | 3300001990 | Bacteria | 2274 |
| 13 | JGI24737J22298_10037862 | 3300001990 | Bacteria | 1486 |
| 14 | JGI24735J21928_10069260 | 3300002067 | Bacteria | 1011 |
| 15 | JGI24750J21931_1000491 | 3300002070 | Bacteria | 6207 |
| 16 | JGI24745J21846_1001148 | 3300002073 | Bacteria | 2527 |
| 17 | JGI24738J21930_10005466 | 3300002075 | Bacteria | 3043 |
| 18 | JGI24744J21845_10000700 | 3300002077 | Bacteria | 6195 |
| 19 | JGI24035J26624_1001205 | 3300002126 | Bacteria | 2448 |
| 20 | JGI24033J26618_1006830 | 3300002155 | Bacteria | 1288 |
| 21 | JGI24742J22300_10003140 | 3300002244 | Bacteria | 2672 |
| 22 | JGI24751J29686_10006826 | 3300002459 | Bacteria | 2328 |
| 23 | JGI25405J52794_10017981 | 3300003911 | Bacteria | 1409 |
| 24 | Ga0058862_10003908 | 3300004803 | Bacteria | 2604 |
| 25 | Ga0065716_1001696 | 3300005277 | Bacteria | 4102 |
| 26 | Ga0065712_10091161 | 3300005290 | Bacteria | 2388 |
| 27 | Ga0065712_10173397 | 3300005290 | Bacteria | 1231 |
| 28 | Ga0065715_10003882 | 3300005293 | Bacteria | 5114 |
| 29 | Ga0065707_10019357 | 3300005295 | Bacteria | 1526 |
| 30 | Ga0065707_10089297 | 3300005295 | Bacteria | 4410 |
| 31 | Ga0070658_10010506 | 3300005327 | Bacteria | 7420 |
| 32 | Ga0070658_10328280 | 3300005327 | Bacteria | 1307 |
| 33 | Ga0070676_10002898 | 3300005328 | Bacteria | 8857 |
| 34 | Ga0070676_10031581 | 3300005328 | Bacteria | 3028 |
| 35 | Ga0070676_10209316 | 3300005328 | Bacteria | 1282 |
| 36 | Ga0070683_100001166 | 3300005329 | Bacteria | 19905 |
| 37 | Ga0070683_100009942 | 3300005329 | Bacteria | 8157 |
| 38 | Ga0070683_100186558 | 3300005329 | Bacteria | 1969 |
| 39 | Ga0070690_100001038 | 3300005330 | Bacteria | 14220 |
| 40 | Ga0070690_100149465 | 3300005330 | Bacteria | 1592 |
| 41 | Ga0070670_100003635 | 3300005331 | Bacteria | 12843 |
| 42 | Ga0070670_100038180 | 3300005331 | Bacteria | 4129 |
| 43 | Ga0070670_100085731 | 3300005331 | Bacteria | 2706 |
| 44 | Ga0070677_10000126 | 3300005333 | Bacteria | 25482 |
| 45 | Ga0068869_100009659 | 3300005334 | Bacteria | 6264 |
| 46 | Ga0068869_100082414 | 3300005334 | Bacteria | 2404 |
| 47 | Ga0070666_10103670 | 3300005335 | Bacteria | 1963 |
| 48 | Ga0070666_10220254 | 3300005335 | Bacteria | 1338 |
| 49 | Ga0070680_100006676 | 3300005336 | Bacteria | 8784 |
| 50 | Ga0070680_100013378 | 3300005336 | Bacteria | 6389 |
| 51 | Ga0070680_100027427 | 3300005336 | Bacteria | 4560 |
| 52 | Ga0070682_100003724 | 3300005337 | Bacteria | 8473 |
| 53 | Ga0068868_100003027 | 3300005338 | Bacteria | 11693 |
| 54 | Ga0068868_100190218 | 3300005338 | Bacteria | 1707 |
| 55 | Ga0070660_100019513 | 3300005339 | Bacteria | 4970 |
| 56 | Ga0070660_100064566 | 3300005339 | Bacteria | 2848 |
| 57 | Ga0070660_100202467 | 3300005339 | Bacteria | 1610 |
| 58 | Ga0070660_100268543 | 3300005339 | Bacteria | 1394 |
| 59 | Ga0070689_100004527 | 3300005340 | Bacteria | 9413 |
| 60 | Ga0070689_100084015 | 3300005340 | Bacteria | 2502 |
| 61 | Ga0070689_100113844 | 3300005340 | Bacteria | 2154 |
| 62 | Ga0070691_10000994 | 3300005341 | Bacteria | 11602 |
| 63 | Ga0070691_10009230 | 3300005341 | Bacteria | 4508 |
| 64 | Ga0070687_100000085 | 3300005343 | Bacteria | 30647 |
| 65 | Ga0070687_100129834 | 3300005343 | Bacteria | 1453 |
| 66 | Ga0070687_100180981 | 3300005343 | Bacteria | 1262 |
| 67 | Ga0070661_100000307 | 3300005344 | Bacteria | 39479 |
| 68 | Ga0070661_100095552 | 3300005344 | Bacteria | 2204 |
| 69 | Ga0070661_100218325 | 3300005344 | Bacteria | 1462 |
| 70 | Ga0070692_10002518 | 3300005345 | Bacteria | 7129 |
| 71 | Ga0070692_10081215 | 3300005345 | Bacteria | 1746 |
| 72 | Ga0070668_100001248 | 3300005347 | Bacteria | 18134 |
| 73 | Ga0070668_100268383 | 3300005347 | Bacteria | 1421 |
| 74 | Ga0070669_100005868 | 3300005353 | Bacteria | 8857 |
| 75 | Ga0070675_100044851 | 3300005354 | Bacteria | 3616 |
| 76 | Ga0070675_100401123 | 3300005354 | Bacteria | 1223 |
| 77 | Ga0070671_100000104 | 3300005355 | Bacteria | 53922 |
| 78 | Ga0070671_100004422 | 3300005355 | Bacteria | 11117 |
| 79 | Ga0070671_100041645 | 3300005355 | Bacteria | 3817 |
| 80 | Ga0070671_100060686 | 3300005355 | Bacteria | 3149 |
| 81 | Ga0070671_100087407 | 3300005355 | Bacteria | 2609 |
| 82 | Ga0070671_100453080 | 3300005355 | Bacteria | 1101 |
| 83 | Ga0070674_100003469 | 3300005356 | Bacteria | 8857 |
| 84 | Ga0070674_100329133 | 3300005356 | Bacteria | 1227 |
| 85 | Ga0070673_100000152 | 3300005364 | Bacteria | 33183 |
| 86 | Ga0070673_100148341 | 3300005364 | Bacteria | 1984 |
| 87 | Ga0070688_100000558 | 3300005365 | Bacteria | 18862 |
| 88 | Ga0070688_100004316 | 3300005365 | Bacteria | 7393 |
| 89 | Ga0070659_100010268 | 3300005366 | Bacteria | 6888 |
| 90 | Ga0070659_100116631 | 3300005366 | Bacteria | 2159 |
| 91 | Ga0070659_100187852 | 3300005366 | Bacteria | 1698 |
| 92 | Ga0070659_100356791 | 3300005366 | Bacteria | 1227 |
| 93 | Ga0070659_100499375 | 3300005366 | Bacteria | 1037 |
| 94 | Ga0070667_100005640 | 3300005367 | Bacteria | 10453 |
| 95 | Ga0070703_10049197 | 3300005406 | Bacteria | 1341 |
| 96 | Ga0070709_10036142 | 3300005434 | Bacteria | 3007 |
| 97 | Ga0070709_10051825 | 3300005434 | Bacteria | 2577 |
| 98 | Ga0070709_10237816 | 3300005434 | Bacteria | 1306 |
| 99 | Ga0070714_100011568 | 3300005435 | Bacteria | 7005 |
| 100 | Ga0070714_100021050 | 3300005435 | Bacteria | 5332 |
| 101 | Ga0070714_100137217 | 3300005435 | Bacteria | 2192 |
| 102 | Ga0070714_100243631 | 3300005435 | Bacteria | 1660 |
| 103 | Ga0070714_100339014 | 3300005435 | Bacteria | 1410 |
| 104 | Ga0070713_100119035 | 3300005436 | Bacteria | 2313 |
| 105 | Ga0070713_100128427 | 3300005436 | Bacteria | 2232 |
| 106 | Ga0070713_100251890 | 3300005436 | Bacteria | 1611 |
| 107 | Ga0070713_100272415 | 3300005436 | Bacteria | 1550 |
| 108 | Ga0070710_10002595 | 3300005437 | Bacteria | 8585 |
| 109 | Ga0070701_10056458 | 3300005438 | Bacteria | 2054 |
| 110 | Ga0070701_10184581 | 3300005438 | Bacteria | 1223 |
| 111 | Ga0070711_100016067 | 3300005439 | Bacteria | 4746 |
| 112 | Ga0070711_100033014 | 3300005439 | Bacteria | 3445 |
| 113 | Ga0070711_100036006 | 3300005439 | Bacteria | 3314 |
| 114 | Ga0070711_100192016 | 3300005439 | Bacteria | 1570 |
| 115 | Ga0070711_100274352 | 3300005439 | Bacteria | 1332 |
| 116 | Ga0070705_100005321 | 3300005440 | Bacteria | 6264 |
| 117 | Ga0070705_100017426 | 3300005440 | Bacteria | 3750 |
| 118 | Ga0070700_100002863 | 3300005441 | Bacteria | 8853 |
| 119 | Ga0070700_100012858 | 3300005441 | Bacteria | 4688 |
| 120 | Ga0070694_100001507 | 3300005444 | Bacteria | 13661 |
| 121 | Ga0070694_100014893 | 3300005444 | Bacteria | 4872 |
| 122 | Ga0070694_100089338 | 3300005444 | Bacteria | 2159 |
| 123 | Ga0070708_100091314 | 3300005445 | Bacteria | 2773 |
| 124 | Ga0070663_100000522 | 3300005455 | Bacteria | 20244 |
| 125 | Ga0070663_100036709 | 3300005455 | Bacteria | 3406 |
| 126 | Ga0070663_100333377 | 3300005455 | Bacteria | 1223 |
| 127 | Ga0070678_100000718 | 3300005456 | Bacteria | 16435 |
| 128 | Ga0070678_100104446 | 3300005456 | Bacteria | 2203 |
| 129 | Ga0070678_100364494 | 3300005456 | Bacteria | 1246 |
| 130 | Ga0070662_100001666 | 3300005457 | Bacteria | 13661 |
| 131 | Ga0070662_100212058 | 3300005457 | Bacteria | 1541 |
| 132 | Ga0070662_100408542 | 3300005457 | Bacteria | 1121 |
| 133 | Ga0070681_10017661 | 3300005458 | Bacteria | 7129 |
| 134 | Ga0070681_10034038 | 3300005458 | Bacteria | 5117 |
| 135 | Ga0070681_10037536 | 3300005458 | Bacteria | 4861 |
| 136 | Ga0070681_10074970 | 3300005458 | Bacteria | 3343 |
| 137 | Ga0070681_10149560 | 3300005458 | Bacteria | 2262 |
| 138 | Ga0070681_10258391 | 3300005458 | Bacteria | 1654 |
| 139 | Ga0068867_100005662 | 3300005459 | Bacteria | 8853 |
| 140 | Ga0070685_10095949 | 3300005466 | Bacteria | 1803 |
| 141 | Ga0070685_10138891 | 3300005466 | Bacteria | 1527 |
| 142 | Ga0070685_10139720 | 3300005466 | Bacteria | 1523 |
| 143 | Ga0070706_100065648 | 3300005467 | Bacteria | 3357 |
| 144 | Ga0070698_100155162 | 3300005471 | Bacteria | 2235 |
| 145 | Ga0070679_100007489 | 3300005530 | Bacteria | 10209 |
| 146 | Ga0070679_100034242 | 3300005530 | Bacteria | 5033 |
| 147 | Ga0070679_100040836 | 3300005530 | Bacteria | 4617 |
| 148 | Ga0070679_100130513 | 3300005530 | Bacteria | 2494 |
| 149 | Ga0070684_100000894 | 3300005535 | Bacteria | 21105 |
| 150 | Ga0070684_100257230 | 3300005535 | Bacteria | 1597 |
| 151 | Ga0070684_100640193 | 3300005535 | Bacteria | 989 |
| 152 | Ga0070697_100000842 | 3300005536 | Bacteria | 23057 |
| 153 | Ga0070697_100244677 | 3300005536 | Bacteria | 1532 |
| 154 | Ga0068853_100010158 | 3300005539 | Bacteria | 7605 |
| 155 | Ga0068853_100048509 | 3300005539 | Bacteria | 3648 |
| 156 | Ga0070672_100011122 | 3300005543 | Bacteria | 6268 |
| 157 | Ga0070672_100203262 | 3300005543 | Bacteria | 1657 |
| 158 | Ga0070672_100210683 | 3300005543 | Bacteria | 1627 |
| 159 | Ga0070686_100000719 | 3300005544 | Bacteria | 19252 |
| 160 | Ga0070686_100039765 | 3300005544 | Bacteria | 2932 |
| 161 | Ga0070686_100107141 | 3300005544 | Bacteria | 1898 |
| 162 | Ga0070695_100000088 | 3300005545 | Bacteria | 38984 |
| 163 | Ga0070695_100172314 | 3300005545 | Bacteria | 1527 |
| 164 | Ga0070696_100005009 | 3300005546 | Bacteria | 8853 |
| 165 | Ga0070696_100171886 | 3300005546 | Bacteria | 1602 |
| 166 | Ga0070693_100000134 | 3300005547 | Bacteria | 33408 |
| 167 | Ga0070693_100014411 | 3300005547 | Bacteria | 4052 |
| 168 | Ga0070665_100080031 | 3300005548 | Bacteria | 3273 |
| 169 | Ga0070665_100178806 | 3300005548 | Bacteria | 2123 |
| 170 | Ga0070665_100281417 | 3300005548 | Bacteria | 1665 |
| 171 | Ga0070704_100000428 | 3300005549 | Bacteria | 19609 |
| 172 | Ga0070704_100027340 | 3300005549 | Bacteria | 3782 |
| 173 | Ga0070704_100116482 | 3300005549 | Bacteria | 2043 |
| 174 | Ga0068855_100007545 | 3300005563 | Bacteria | 13158 |
| 175 | Ga0068855_100060250 | 3300005563 | Bacteria | 4440 |
| 176 | Ga0068855_100125775 | 3300005563 | Bacteria | 2931 |
| 177 | Ga0070664_100002234 | 3300005564 | Bacteria | 15585 |
| 178 | Ga0070664_100171882 | 3300005564 | Bacteria | 1922 |
| 179 | Ga0070664_100241477 | 3300005564 | Bacteria | 1622 |
| 180 | Ga0068857_100011473 | 3300005577 | Bacteria | 7708 |
| 181 | Ga0068854_100005312 | 3300005578 | Bacteria | 8130 |
| 182 | Ga0068856_100002000 | 3300005614 | Bacteria | 21261 |
| 183 | Ga0068856_100283428 | 3300005614 | Bacteria | 1674 |
| 184 | Ga0068856_100284037 | 3300005614 | Bacteria | 1672 |
| 185 | Ga0068856_100350260 | 3300005614 | Bacteria | 1495 |
| 186 | Ga0070702_100000638 | 3300005615 | Bacteria | 12987 |
| 187 | Ga0070702_100011329 | 3300005615 | Bacteria | 4432 |
| 188 | Ga0070702_100350555 | 3300005615 | Bacteria | 1039 |
| 189 | Ga0068852_100002115 | 3300005616 | Bacteria | 13595 |
| 190 | Ga0068859_100006242 | 3300005617 | Bacteria | 12100 |
| 191 | Ga0068859_100224072 | 3300005617 | Bacteria | 1968 |
| 192 | Ga0068859_100370619 | 3300005617 | Bacteria | 1527 |
| 193 | Ga0068864_100189705 | 3300005618 | Bacteria | 1884 |
| 194 | Ga0068866_10000301 | 3300005718 | Bacteria | 23583 |
| 195 | Ga0068861_100021475 | 3300005719 | Bacteria | 4639 |
| 196 | Ga0068861_100142675 | 3300005719 | Bacteria | 1956 |
| 197 | Ga0068851_10058127 | 3300005834 | Bacteria | 1976 |
| 198 | Ga0068870_10000354 | 3300005840 | Bacteria | 17200 |
| 199 | Ga0068863_100000340 | 3300005841 | Bacteria | 47641 |
| 200 | Ga0068863_100280785 | 3300005841 | Bacteria | 1613 |
| 201 | Ga0068863_100292142 | 3300005841 | Bacteria | 1580 |
| 202 | Ga0068863_100634888 | 3300005841 | Bacteria | 1058 |
| 203 | Ga0068858_100000295 | 3300005842 | Bacteria | 53892 |
| 204 | Ga0068858_100468131 | 3300005842 | Bacteria | 1215 |
| 205 | Ga0068858_100513881 | 3300005842 | Bacteria | 1158 |
| 206 | Ga0068860_100013035 | 3300005843 | Bacteria | 8161 |
| 207 | Ga0068860_100246774 | 3300005843 | Bacteria | 1738 |
| 208 | Ga0068860_100294684 | 3300005843 | Bacteria | 1588 |
| 209 | Ga0068860_100311967 | 3300005843 | Bacteria | 1542 |
| 210 | Ga0068862_100098646 | 3300005844 | Bacteria | 2552 |
| 211 | Ga0068862_100105839 | 3300005844 | Bacteria | 2466 |
| 212 | Ga0068862_100367419 | 3300005844 | Bacteria | 1338 |
| 213 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 214 | Ga0081455_10001479 | 3300005937 | Bacteria | 29079 |
| 215 | Ga0081540_1018324 | 3300005983 | Bacteria | 4299 |
| 216 | Ga0070717_10007640 | 3300006028 | Bacteria | 8037 |
| 217 | Ga0070717_10112947 | 3300006028 | Bacteria | 2319 |
| 218 | Ga0070715_10011032 | 3300006163 | Bacteria | 3240 |
| 219 | Ga0070716_100116595 | 3300006173 | Bacteria | 1664 |
| 220 | Ga0070712_100020066 | 3300006175 | Bacteria | 4369 |
| 221 | Ga0070712_100049891 | 3300006175 | Bacteria | 2909 |
| 222 | Ga0070712_100053419 | 3300006175 | Bacteria | 2821 |
| 223 | Ga0070712_100238522 | 3300006175 | Bacteria | 1448 |
| 224 | Ga0075427_10000774 | 3300006194 | Bacteria | 3881 |
| 225 | Ga0097621_100000040 | 3300006237 | Bacteria | 66339 |
| 226 | Ga0097621_100307280 | 3300006237 | Bacteria | 1402 |
| 227 | Ga0075370_10028200 | 3300006353 | Bacteria | 3119 |
| 228 | Ga0075370_10066244 | 3300006353 | Bacteria | 2060 |
| 229 | Ga0068871_100000301 | 3300006358 | Bacteria | 34368 |
| 230 | Ga0068871_100192945 | 3300006358 | Bacteria | 1755 |
| 231 | Ga0068871_100455828 | 3300006358 | Bacteria | 1147 |
| 232 | Ga0075428_100003180 | 3300006844 | Bacteria | 17952 |
| 233 | Ga0075428_100065891 | 3300006844 | Bacteria | 3966 |
| 234 | Ga0075428_100486252 | 3300006844 | Bacteria | 1321 |
| 235 | Ga0075430_100000201 | 3300006846 | Bacteria | 40551 |
| 236 | Ga0075431_100000260 | 3300006847 | Bacteria | 40551 |
| 237 | Ga0075431_100163255 | 3300006847 | Bacteria | 2290 |
| 238 | Ga0075433_10000007 | 3300006852 | Bacteria | 75995 |
| 239 | Ga0075433_10006753 | 3300006852 | Bacteria | 9093 |
| 240 | Ga0075433_10219785 | 3300006852 | Bacteria | 1688 |
| 241 | Ga0075434_100000091 | 3300006871 | Bacteria | 49489 |
| 242 | Ga0075434_100040371 | 3300006871 | Bacteria | 4620 |
| 243 | Ga0075434_100043209 | 3300006871 | Bacteria | 4469 |
| 244 | Ga0075429_100001824 | 3300006880 | Bacteria | 17627 |
| 245 | Ga0068865_100000275 | 3300006881 | Bacteria | 28270 |
| 246 | Ga0068865_100041437 | 3300006881 | Bacteria | 3133 |
| 247 | Ga0068865_100063931 | 3300006881 | Bacteria | 2588 |
| 248 | Ga0068865_100130897 | 3300006881 | Bacteria | 1880 |
| 249 | Ga0075436_100002805 | 3300006914 | Bacteria | 11939 |
| 250 | Ga0075436_100009266 | 3300006914 | Bacteria | 6735 |
| 251 | Ga0075436_100032116 | 3300006914 | Bacteria | 3618 |
| 252 | Ga0075436_100103247 | 3300006914 | Bacteria | 1987 |
| 253 | Ga0075436_100165804 | 3300006914 | Bacteria | 1559 |
| 254 | Ga0075436_100228690 | 3300006914 | Bacteria | 1321 |
| 255 | Ga0075436_100281669 | 3300006914 | Bacteria | 1189 |
| 256 | Ga0097620_100006242 | 3300006931 | Bacteria | 12100 |
| 257 | Ga0097620_100224064 | 3300006931 | Bacteria | 1968 |
| 258 | Ga0097620_100370625 | 3300006931 | Bacteria | 1527 |
| 259 | Ga0075435_100024837 | 3300007076 | Bacteria | 4657 |
| 260 | Ga0075435_100029180 | 3300007076 | Bacteria | 4329 |
| 261 | Ga0075435_100053196 | 3300007076 | Bacteria | 3264 |
| 262 | Ga0099795_10007864 | 3300007788 | Bacteria | 3005 |
| 263 | Ga0105240_10063742 | 3300009093 | Bacteria | 4582 |
| 264 | Ga0105240_10163906 | 3300009093 | Bacteria | 2638 |
| 265 | Ga0105240_10205506 | 3300009093 | Bacteria | 2305 |
| 266 | Ga0111539_10000394 | 3300009094 | Bacteria | 54170 |
| 267 | Ga0111539_10001672 | 3300009094 | Bacteria | 29559 |
| 268 | Ga0111539_10017527 | 3300009094 | Bacteria | 8865 |
| 269 | Ga0111539_10121942 | 3300009094 | Bacteria | 3055 |
| 270 | Ga0111539_10402075 | 3300009094 | Bacteria | 1595 |
| 271 | Ga0105245_10000462 | 3300009098 | Bacteria | 37242 |
| 272 | Ga0105245_10256708 | 3300009098 | Bacteria | 1700 |
| 273 | Ga0105245_10516329 | 3300009098 | Bacteria | 1213 |
| 274 | Ga0105247_10025524 | 3300009101 | Bacteria | 3565 |
| 275 | Ga0105247_10140234 | 3300009101 | Bacteria | 1583 |
| 276 | Ga0114129_10002772 | 3300009147 | Bacteria | 24406 |
| 277 | Ga0114129_10128417 | 3300009147 | Bacteria | 3484 |
| 278 | Ga0105243_10035482 | 3300009148 | Bacteria | 3867 |
| 279 | Ga0105243_10215298 | 3300009148 | Bacteria | 1694 |
| 280 | Ga0105241_10000652 | 3300009174 | Bacteria | 26004 |
| 281 | Ga0105241_10085033 | 3300009174 | Bacteria | 2485 |
| 282 | Ga0105241_10098463 | 3300009174 | Bacteria | 2320 |
| 283 | Ga0105242_10011119 | 3300009176 | Bacteria | 6917 |
| 284 | Ga0105242_10065494 | 3300009176 | Bacteria | 2998 |
| 285 | Ga0105242_10129396 | 3300009176 | Bacteria | 2177 |
| 286 | Ga0105248_10102488 | 3300009177 | Bacteria | 3226 |
| 287 | Ga0105248_10165337 | 3300009177 | Bacteria | 2495 |
| 288 | Ga0105248_10275706 | 3300009177 | Bacteria | 1894 |
| 289 | Ga0105237_10231189 | 3300009545 | Bacteria | 1850 |
| 290 | Ga0105237_10263512 | 3300009545 | Bacteria | 1726 |
| 291 | Ga0105237_10348496 | 3300009545 | Bacteria | 1485 |
| 292 | Ga0105238_10033390 | 3300009551 | Bacteria | 5238 |
| 293 | Ga0105238_10103519 | 3300009551 | Bacteria | 2828 |
| 294 | Ga0105238_10574475 | 3300009551 | Bacteria | 1133 |
| 295 | Ga0105249_10001599 | 3300009553 | Bacteria | 19830 |
| 296 | Ga0105249_10333927 | 3300009553 | Bacteria | 1530 |
| 297 | Ga0099796_10002424 | 3300010159 | Bacteria | 4083 |
| 298 | Ga0105239_10223196 | 3300010375 | Bacteria | 2113 |
| 299 | Ga0105239_10259463 | 3300010375 | Bacteria | 1953 |
| 300 | Ga0105239_10261762 | 3300010375 | Bacteria | 1944 |
| 301 | Ga0105246_10007217 | 3300011119 | Bacteria | 6810 |
| 302 | Ga0105246_10091966 | 3300011119 | Bacteria | 2188 |
| 303 | Ga0105246_10224380 | 3300011119 | Bacteria | 1475 |
| 304 | Ga0157373_10010359 | 3300013100 | Bacteria | 6863 |
| 305 | Ga0157371_10015372 | 3300013102 | Bacteria | 5744 |
| 306 | Ga0157371_10161320 | 3300013102 | Bacteria | 1601 |
| 307 | Ga0157370_10109606 | 3300013104 | Bacteria | 2581 |
| 308 | Ga0157370_10130376 | 3300013104 | Bacteria | 2345 |
| 309 | Ga0157369_10192672 | 3300013105 | Bacteria | 2141 |
| 310 | Ga0157369_10214159 | 3300013105 | Bacteria | 2018 |
| 311 | Ga0157369_10360342 | 3300013105 | Bacteria | 1510 |
| 312 | Ga0157374_10001695 | 3300013296 | Bacteria | 18451 |
| 313 | Ga0157374_10227488 | 3300013296 | Bacteria | 1832 |
| 314 | Ga0157378_10003374 | 3300013297 | Bacteria | 14202 |
| 315 | Ga0157378_10509892 | 3300013297 | Bacteria | 1203 |
| 316 | Ga0163162_10000145 | 3300013306 | Bacteria | 65191 |
| 317 | Ga0163162_10238769 | 3300013306 | Bacteria | 1948 |
| 318 | Ga0157372_10012191 | 3300013307 | Bacteria | 9156 |
| 319 | Ga0157372_10061857 | 3300013307 | Bacteria | 4193 |
| 320 | Ga0157372_10311902 | 3300013307 | Bacteria | 1831 |
| 321 | Ga0157375_10008254 | 3300013308 | Bacteria | 9115 |
| 322 | Ga0157375_10025055 | 3300013308 | Bacteria | 5534 |
| 323 | Ga0157375_10267263 | 3300013308 | Bacteria | 1872 |
| 324 | Ga0157375_10438768 | 3300013308 | Bacteria | 1471 |
| 325 | Ga0163163_10000865 | 3300014325 | Bacteria | 25811 |
| 326 | Ga0163163_10351251 | 3300014325 | Bacteria | 1531 |
| 327 | Ga0163163_10517253 | 3300014325 | Bacteria | 1256 |
| 328 | Ga0157380_10000891 | 3300014326 | Bacteria | 18753 |
| 329 | Ga0182008_10059608 | 3300014497 | Bacteria | 1883 |
| 330 | Ga0182008_10123856 | 3300014497 | Bacteria | 1286 |
| 331 | Ga0157377_10000137 | 3300014745 | Bacteria | 46698 |
| 332 | Ga0157379_10011995 | 3300014968 | Bacteria | 7571 |
| 333 | Ga0157379_10037410 | 3300014968 | Bacteria | 4327 |
| 334 | Ga0157379_10126143 | 3300014968 | Bacteria | 2303 |
| 335 | Ga0157379_10259103 | 3300014968 | Bacteria | 1580 |
| 336 | Ga0157379_10452415 | 3300014968 | Bacteria | 1186 |
| 337 | Ga0157379_10580904 | 3300014968 | Bacteria | 1044 |
| 338 | Ga0157376_10000088 | 3300014969 | Bacteria | 70084 |
| 339 | Ga0157376_10082379 | 3300014969 | Bacteria | 2765 |
| 340 | Ga0157376_10101393 | 3300014969 | Bacteria | 2516 |
| 341 | Ga0157376_10154664 | 3300014969 | Bacteria | 2072 |
| 342 | Ga0182007_10024216 | 3300015262 | Bacteria | 2126 |
| 343 | Ga0163161_10000144 | 3300017792 | Bacteria | 64771 |
| 344 | Ga0213876_10017793 | 3300021384 | Bacteria | 3751 |
| 345 | Ga0213876_10119420 | 3300021384 | Bacteria | 1399 |
| 346 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 347 | Ga0213875_10104928 | 3300021388 | Bacteria | 1319 |
| 348 | Ga0224712_10115145 | 3300022467 | Bacteria | 1158 |
| 349 | Ga0207666_1000059 | 3300025271 | Bacteria | 19909 |
| 350 | Ga0207673_1000772 | 3300025290 | Bacteria | 3452 |
| 351 | Ga0207697_10066949 | 3300025315 | Bacteria | 1501 |
| 352 | Ga0207697_10066975 | 3300025315 | Bacteria | 1501 |
| 353 | Ga0207653_10002734 | 3300025885 | Bacteria | 5612 |
| 354 | Ga0207682_10000509 | 3300025893 | Bacteria | 17874 |
| 355 | Ga0207692_10009116 | 3300025898 | Bacteria | 4131 |
| 356 | Ga0207692_10019295 | 3300025898 | Bacteria | 3079 |
| 357 | Ga0207642_10000762 | 3300025899 | Bacteria | 9965 |
| 358 | Ga0207710_10005834 | 3300025900 | Bacteria | 5281 |
| 359 | Ga0207710_10052006 | 3300025900 | Bacteria | 1841 |
| 360 | Ga0207688_10000167 | 3300025901 | Bacteria | 28809 |
| 361 | Ga0207688_10148818 | 3300025901 | Bacteria | 1382 |
| 362 | Ga0207688_10169275 | 3300025901 | Bacteria | 1298 |
| 363 | Ga0207680_10131419 | 3300025903 | Bacteria | 1650 |
| 364 | Ga0207680_10168986 | 3300025903 | Bacteria | 1472 |
| 365 | Ga0207680_10272248 | 3300025903 | Bacteria | 1175 |
| 366 | Ga0207647_10006799 | 3300025904 | Bacteria | 8296 |
| 367 | Ga0207685_10007282 | 3300025905 | Bacteria | 3073 |
| 368 | Ga0207699_10001444 | 3300025906 | Bacteria | 11277 |
| 369 | Ga0207699_10014521 | 3300025906 | Bacteria | 4062 |
| 370 | Ga0207699_10039355 | 3300025906 | Bacteria | 2716 |
| 371 | Ga0207699_10083606 | 3300025906 | Bacteria | 1986 |
| 372 | Ga0207645_10000100 | 3300025907 | Bacteria | 64057 |
| 373 | Ga0207645_10036624 | 3300025907 | Bacteria | 3151 |
| 374 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 375 | Ga0207705_10070934 | 3300025909 | Bacteria | 2525 |
| 376 | Ga0207705_10235328 | 3300025909 | Bacteria | 1394 |
| 377 | Ga0207684_10088339 | 3300025910 | Bacteria | 2641 |
| 378 | Ga0207654_10000314 | 3300025911 | Bacteria | 29106 |
| 379 | Ga0207654_10080514 | 3300025911 | Bacteria | 1959 |
| 380 | Ga0207707_10005018 | 3300025912 | Bacteria | 11624 |
| 381 | Ga0207707_10016107 | 3300025912 | Bacteria | 6518 |
| 382 | Ga0207707_10025342 | 3300025912 | Bacteria | 5187 |
| 383 | Ga0207707_10046254 | 3300025912 | Bacteria | 3790 |
| 384 | Ga0207695_10129877 | 3300025913 | Bacteria | 2478 |
| 385 | Ga0207695_10162064 | 3300025913 | Bacteria | 2167 |
| 386 | Ga0207693_10004590 | 3300025915 | Bacteria | 11653 |
| 387 | Ga0207693_10007006 | 3300025915 | Bacteria | 9313 |
| 388 | Ga0207693_10007799 | 3300025915 | Bacteria | 8785 |
| 389 | Ga0207693_10018330 | 3300025915 | Bacteria | 5577 |
| 390 | Ga0207693_10190828 | 3300025915 | Bacteria | 1612 |
| 391 | Ga0207693_10274335 | 3300025915 | Bacteria | 1321 |
| 392 | Ga0207693_10437914 | 3300025915 | Bacteria | 1022 |
| 393 | Ga0207663_10041757 | 3300025916 | Bacteria | 2797 |
| 394 | Ga0207663_10110415 | 3300025916 | Bacteria | 1865 |
| 395 | Ga0207663_10230514 | 3300025916 | Bacteria | 1353 |
| 396 | Ga0207660_10000041 | 3300025917 | Bacteria | 63485 |
| 397 | Ga0207660_10032859 | 3300025917 | Bacteria | 3584 |
| 398 | Ga0207660_10038531 | 3300025917 | Bacteria | 3338 |
| 399 | Ga0207660_10051669 | 3300025917 | Bacteria | 2923 |
| 400 | Ga0207660_10184876 | 3300025917 | Bacteria | 1620 |
| 401 | Ga0207660_10193635 | 3300025917 | Bacteria | 1585 |
| 402 | Ga0207662_10141401 | 3300025918 | Bacteria | 1525 |
| 403 | Ga0207662_10158929 | 3300025918 | Bacteria | 1442 |
| 404 | Ga0207657_10002386 | 3300025919 | Bacteria | 20326 |
| 405 | Ga0207657_10030177 | 3300025919 | Bacteria | 4925 |
| 406 | Ga0207657_10095636 | 3300025919 | Bacteria | 2471 |
| 407 | Ga0207649_10001482 | 3300025920 | Bacteria | 13783 |
| 408 | Ga0207652_10002995 | 3300025921 | Bacteria | 14105 |
| 409 | Ga0207652_10009272 | 3300025921 | Bacteria | 7913 |
| 410 | Ga0207652_10046076 | 3300025921 | Bacteria | 3719 |
| 411 | Ga0207652_10056655 | 3300025921 | Bacteria | 3374 |
| 412 | Ga0207652_10357304 | 3300025921 | Bacteria | 1318 |
| 413 | Ga0207652_10486469 | 3300025921 | Bacteria | 1111 |
| 414 | Ga0207681_10001546 | 3300025923 | Bacteria | 14821 |
| 415 | Ga0207681_10101113 | 3300025923 | Bacteria | 2079 |
| 416 | Ga0207694_10032903 | 3300025924 | Bacteria | 3972 |
| 417 | Ga0207694_10195600 | 3300025924 | Bacteria | 1644 |
| 418 | Ga0207650_10001317 | 3300025925 | Bacteria | 17984 |
| 419 | Ga0207650_10020878 | 3300025925 | Bacteria | 4625 |
| 420 | Ga0207650_10038831 | 3300025925 | Bacteria | 3479 |
| 421 | Ga0207687_10000072 | 3300025927 | Bacteria | 76222 |
| 422 | Ga0207700_10001532 | 3300025928 | Bacteria | 13089 |
| 423 | Ga0207700_10021706 | 3300025928 | Bacteria | 4389 |
| 424 | Ga0207700_10046576 | 3300025928 | Bacteria | 3208 |
| 425 | Ga0207700_10121160 | 3300025928 | Bacteria | 2121 |
| 426 | Ga0207700_10129684 | 3300025928 | Bacteria | 2057 |
| 427 | Ga0207700_10165633 | 3300025928 | Bacteria | 1839 |
| 428 | Ga0207664_10059268 | 3300025929 | Bacteria | 3048 |
| 429 | Ga0207664_10145372 | 3300025929 | Bacteria | 2010 |
| 430 | Ga0207644_10001292 | 3300025931 | Bacteria | 16118 |
| 431 | Ga0207644_10002402 | 3300025931 | Bacteria | 12066 |
| 432 | Ga0207644_10158888 | 3300025931 | Bacteria | 1755 |
| 433 | Ga0207690_10004975 | 3300025932 | Bacteria | 7849 |
| 434 | Ga0207706_10110493 | 3300025933 | Bacteria | 2418 |
| 435 | Ga0207706_10116889 | 3300025933 | Bacteria | 2346 |
| 436 | Ga0207706_10264658 | 3300025933 | Bacteria | 1501 |
| 437 | Ga0207706_10264659 | 3300025933 | Bacteria | 1501 |
| 438 | Ga0207686_10001034 | 3300025934 | Bacteria | 16473 |
| 439 | Ga0207686_10009753 | 3300025934 | Bacteria | 5218 |
| 440 | Ga0207709_10001423 | 3300025935 | Bacteria | 16760 |
| 441 | Ga0207709_10169341 | 3300025935 | Bacteria | 1531 |
| 442 | Ga0207670_10005263 | 3300025936 | Bacteria | 7084 |
| 443 | Ga0207670_10155764 | 3300025936 | Bacteria | 1700 |
| 444 | Ga0207670_10264204 | 3300025936 | Bacteria | 1335 |
| 445 | Ga0207670_10305377 | 3300025936 | Bacteria | 1247 |
| 446 | Ga0207669_10000176 | 3300025937 | Bacteria | 29979 |
| 447 | Ga0207669_10215144 | 3300025937 | Bacteria | 1406 |
| 448 | Ga0207704_10027128 | 3300025938 | Bacteria | 3154 |
| 449 | Ga0207665_10000872 | 3300025939 | Bacteria | 20402 |
| 450 | Ga0207665_10029398 | 3300025939 | Bacteria | 3632 |
| 451 | Ga0207665_10030706 | 3300025939 | Bacteria | 3552 |
| 452 | Ga0207691_10008719 | 3300025940 | Bacteria | 9727 |
| 453 | Ga0207691_10131644 | 3300025940 | Bacteria | 2209 |
| 454 | Ga0207711_10001106 | 3300025941 | Bacteria | 25759 |
| 455 | Ga0207711_10145007 | 3300025941 | Bacteria | 2139 |
| 456 | Ga0207689_10000366 | 3300025942 | Bacteria | 42711 |
| 457 | Ga0207689_10053300 | 3300025942 | Bacteria | 3332 |
| 458 | Ga0207661_10000087 | 3300025944 | Bacteria | 63263 |
| 459 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 460 | Ga0207667_10009257 | 3300025949 | Bacteria | 11628 |
| 461 | Ga0207667_10118539 | 3300025949 | Bacteria | 2728 |
| 462 | Ga0207667_10203083 | 3300025949 | Bacteria | 2033 |
| 463 | Ga0207667_10220718 | 3300025949 | Bacteria | 1942 |
| 464 | Ga0207651_10001426 | 3300025960 | Bacteria | 10879 |
| 465 | Ga0207712_10001547 | 3300025961 | Bacteria | 15511 |
| 466 | Ga0207712_10058614 | 3300025961 | Bacteria | 2721 |
| 467 | Ga0207668_10007326 | 3300025972 | Bacteria | 6556 |
| 468 | Ga0207668_10208741 | 3300025972 | Bacteria | 1561 |
| 469 | Ga0207640_10001474 | 3300025981 | Bacteria | 12692 |
| 470 | Ga0207640_10361142 | 3300025981 | Bacteria | 1170 |
| 471 | Ga0207677_10001187 | 3300026023 | Bacteria | 14156 |
| 472 | Ga0207703_10003109 | 3300026035 | Bacteria | 14015 |
| 473 | Ga0207703_10078801 | 3300026035 | Bacteria | 2738 |
| 474 | Ga0207639_10009108 | 3300026041 | Bacteria | 6840 |
| 475 | Ga0207639_10264567 | 3300026041 | Bacteria | 1506 |
| 476 | Ga0207639_10386435 | 3300026041 | Bacteria | 1258 |
| 477 | Ga0207678_10003198 | 3300026067 | Bacteria | 14815 |
| 478 | Ga0207678_10007393 | 3300026067 | Bacteria | 9727 |
| 479 | Ga0207678_10030299 | 3300026067 | Bacteria | 4723 |
| 480 | Ga0207678_10114204 | 3300026067 | Bacteria | 2304 |
| 481 | Ga0207708_10039105 | 3300026075 | Bacteria | 3613 |
| 482 | Ga0207708_10225932 | 3300026075 | Bacteria | 1501 |
| 483 | Ga0207708_10225933 | 3300026075 | Bacteria | 1501 |
| 484 | Ga0207702_10052174 | 3300026078 | Bacteria | 3459 |
| 485 | Ga0207702_10509981 | 3300026078 | Bacteria | 1173 |
| 486 | Ga0207641_10011956 | 3300026088 | Bacteria | 7121 |
| 487 | Ga0207641_10548664 | 3300026088 | Bacteria | 1127 |
| 488 | Ga0207648_10008796 | 3300026089 | Bacteria | 9727 |
| 489 | Ga0207648_10326282 | 3300026089 | Bacteria | 1380 |
| 490 | Ga0207676_10004807 | 3300026095 | Bacteria | 9584 |
| 491 | Ga0207674_10000697 | 3300026116 | Bacteria | 43729 |
| 492 | Ga0207674_10129549 | 3300026116 | Bacteria | 2487 |
| 493 | Ga0207675_100005465 | 3300026118 | Bacteria | 12176 |
| 494 | Ga0207675_100119642 | 3300026118 | Bacteria | 2491 |
| 495 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 496 | Ga0207683_10104349 | 3300026121 | Bacteria | 2533 |
| 497 | Ga0207698_10000523 | 3300026142 | Bacteria | 22323 |
| 498 | Ga0209968_1023991 | 3300027526 | Bacteria | 999 |
| 499 | Ga0209999_1022534 | 3300027543 | Bacteria | 1159 |
| 500 | Ga0210002_1000355 | 3300027617 | Bacteria | 6256 |
| 501 | Ga0209971_1015857 | 3300027682 | Bacteria | 1786 |
| 502 | Ga0209998_10017900 | 3300027717 | Bacteria | 1501 |
| 503 | Ga0209998_10017902 | 3300027717 | Bacteria | 1501 |
| 504 | Ga0209974_10002097 | 3300027876 | Bacteria | 7300 |
| 505 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 506 | Ga0207428_10000115 | 3300027907 | Bacteria | 109072 |
| 507 | Ga0207428_10000228 | 3300027907 | Bacteria | 77812 |
| 508 | Ga0265357_1000271 | 3300028023 | Bacteria | 2684 |
| 509 | Ga0268266_10191530 | 3300028379 | Bacteria | 1867 |
| 510 | Ga0268265_10001240 | 3300028380 | Bacteria | 22083 |
| 511 | Ga0268264_10002968 | 3300028381 | Bacteria | 14738 |
| 512 | Ga0265337_1000241 | 3300028556 | Bacteria | 29659 |
| 513 | Ga0265318_10063408 | 3300028577 | Bacteria | 1376 |
| 514 | Ga0265338_10018779 | 3300028800 | Bacteria | 7379 |
| 515 | Ga0265320_10039293 | 3300031240 | Bacteria | 2368 |
| 516 | Ga0265325_10002684 | 3300031241 | Bacteria | 11907 |
| 517 | Ga0265325_10002820 | 3300031241 | Bacteria | 11596 |
| 518 | Ga0265325_10011649 | 3300031241 | Bacteria | 5050 |
| 519 | Ga0265325_10037774 | 3300031241 | Bacteria | 2551 |
| 520 | Ga0265340_10006632 | 3300031247 | Bacteria | 6350 |
| 521 | Ga0265340_10027388 | 3300031247 | Bacteria | 2874 |
| 522 | Ga0265340_10074310 | 3300031247 | Bacteria | 1608 |
| 523 | Ga0265339_10010233 | 3300031249 | Bacteria | 5836 |
| 524 | Ga0265327_10011275 | 3300031251 | Bacteria | 6178 |
| 525 | Ga0265313_10009061 | 3300031595 | Bacteria | 6515 |
| 526 | Ga0265313_10060100 | 3300031595 | Bacteria | 1784 |
| 527 | Ga0265342_10000290 | 3300031712 | Bacteria | 56854 |
| 528 | Ga0307409_100282837 | 3300031995 | Bacteria | 1534 |
| 529 | Ga0316586_1006485 | 3300033527 | Bacteria | 1679 |
| 530 | Ga0373930_0000262 | 3300034816 | Bacteria | 6703 |
| 531 | Ga0373930_0017015 | 3300034816 | Bacteria | 1382 |
| 532 | Ga0373948_0000210 | 3300034817 | Bacteria | 6761 |
| 533 | Ga0373948_0009877 | 3300034817 | Bacteria | 1655 |
| 534 | Ga0373950_0003575 | 3300034818 | Bacteria | 2229 |
| 535 | Ga0373950_0011431 | 3300034818 | Bacteria | 1450 |
| 536 | Ga0373958_0005354 | 3300034819 | Bacteria | 1946 |
| 537 | Ga0373958_0026058 | 3300034819 | Bacteria | 1117 |
| 538 | Ga0373959_0001913 | 3300034820 | Bacteria | 3325 |
| 539 | Ga0373938_0000290 | 3300034957 | Bacteria | 8088 |
| 540 | Ga0373938_0002477 | 3300034957 | Bacteria | 2983 |
| 541 | Ga0373926_0056127 | 3300035083 | Bacteria | 1428 |
| 542 | Ga0373926_0095669 | 3300035083 | Bacteria | 1107 |
| 543 | Ga0373928_0004318 | 3300035084 | Bacteria | 2712 |
| 544 | Ga0373928_0011140 | 3300035084 | Bacteria | 1776 |
| 545 | Ga0373928_0017956 | 3300035084 | Bacteria | 1461 |
| 546 | Ga0373929_0004247 | 3300035085 | Bacteria | 2569 |
| 547 | Ga0373940_0000332 | 3300035088 | Bacteria | 6972 |
| 548 | Ga0373940_0054836 | 3300035088 | Bacteria | 1128 |
| 549 | Ga0373944_0003020 | 3300035089 | Bacteria | 4324 |
| 550 | Ga0373944_0018212 | 3300035089 | Bacteria | 2003 |
| 551 | Ga0373949_0000938 | 3300035090 | Bacteria | 9087 |
| 552 | Ga0373949_0001649 | 3300035090 | Bacteria | 6227 |
| 553 | Ga0373951_0000715 | 3300035091 | Bacteria | 9107 |
| 554 | Ga0373952_0000298 | 3300035092 | Bacteria | 8236 |
| 555 | Ga0373952_0003879 | 3300035092 | Bacteria | 2705 |
| 556 | Ga0373952_0016205 | 3300035092 | Bacteria | 1512 |
| 557 | Ga0373923_0000280 | 3300035111 | Bacteria | 11171 |
| 558 | Ga0373923_0018997 | 3300035111 | Bacteria | 2654 |
| 559 | Ga0373923_0138040 | 3300035111 | Bacteria | 1100 |
| 560 | Ga0373932_0009427 | 3300035112 | Bacteria | 2347 |
| 561 | Ga0373932_0017477 | 3300035112 | Bacteria | 1841 |
| 562 | Ga0373936_0004177 | 3300035113 | Bacteria | 5443 |
| 563 | Ga0373936_0012261 | 3300035113 | Bacteria | 3259 |
| 564 | Ga0373936_0102672 | 3300035113 | Bacteria | 1207 |
| 565 | Ga0373939_0001253 | 3300035114 | Bacteria | 6203 |
| 566 | Ga0373939_0025286 | 3300035114 | Bacteria | 1663 |
| 567 | Ga0373941_0001751 | 3300035115 | Bacteria | 4665 |
| 568 | Ga0373941_0021604 | 3300035115 | Bacteria | 1818 |
| 569 | Ga0373945_0002996 | 3300035116 | Bacteria | 5310 |
| 570 | Ga0373945_0052530 | 3300035116 | Bacteria | 1501 |
| 571 | Ga0373953_0002355 | 3300035117 | Bacteria | 5692 |
| 572 | Ga0373953_0118784 | 3300035117 | Bacteria | 1122 |
| 573 | Ga0373954_0002351 | 3300035118 | Bacteria | 7904 |
| 574 | Ga0373954_0004478 | 3300035118 | Bacteria | 6013 |
| 575 | Ga0373954_0023532 | 3300035118 | Bacteria | 2802 |
| 576 | Ga0373956_0023237 | 3300035119 | Bacteria | 2659 |
| 577 | Ga0373956_0024780 | 3300035119 | Bacteria | 2589 |
| 578 | Ga0373957_0015820 | 3300035120 | Bacteria | 2603 |
| 579 | Ga0373957_0022808 | 3300035120 | Bacteria | 2233 |
| 580 | Ga0373960_0001089 | 3300035121 | Bacteria | 5876 |
| 581 | Ga0373960_0015474 | 3300035121 | Bacteria | 1948 |
| 582 | Ga0373943_0000373 | 3300035170 | Bacteria | 18988 |
| 583 | Ga0373943_0005733 | 3300035170 | Bacteria | 5572 |
| 584 | Ga0373943_0033152 | 3300035170 | Bacteria | 2458 |
| 585 | Ga0373943_0041002 | 3300035170 | Bacteria | 2237 |
| 586 | Ga0373946_0022913 | 3300035171 | Bacteria | 2435 |
| 587 | Ga0373946_0072727 | 3300035171 | Bacteria | 1489 |
| 588 | Ga0373955_0000078 | 3300035172 | Bacteria | 40040 |
| 589 | Ga0373955_0009449 | 3300035172 | Bacteria | 4566 |
| 590 | Ga0373955_0119297 | 3300035172 | Bacteria | 1532 |
| 591 | Ga0373942_0011920 | 3300035207 | Bacteria | 2068 |
| 592 | Ga0373961_0000196 | 3300035241 | Bacteria | 28662 |
| 593 | Ga0373962_0000310 | 3300035242 | Bacteria | 10526 |
| 594 | Ga0373962_0001593 | 3300035242 | Bacteria | 5381 |
| 595 | Ga0373962_0033188 | 3300035242 | Bacteria | 1423 |
| 596 | Ga0373924_0004057 | 3300035410 | Bacteria | 5089 |
| 597 | Ga0373924_0140556 | 3300035410 | Bacteria | 1053 |
| 598 | Ga0373931_0001534 | 3300035691 | Bacteria | 9955 |
| 599 | Ga0373931_0008759 | 3300035691 | Bacteria | 4815 |
| 600 | Ga0373931_0062414 | 3300035691 | Bacteria | 2012 |
| 601 | Ga0373935_0000113 | 3300035692 | Bacteria | 36955 |
| 602 | Ga0373935_0000982 | 3300035692 | Bacteria | 15489 |
| 603 | Ga0373935_0054963 | 3300035692 | Bacteria | 2537 |
| 604 | Ga0373935_0144368 | 3300035692 | Bacteria | 1610 |
| 605 | Ga0373935_0329839 | 3300035692 | Bacteria | 1084 |
| 606 | Ga0373927_0002538 | 3300035695 | Bacteria | 13320 |
| 607 | Ga0373927_0010839 | 3300035695 | Bacteria | 6071 |
| 608 | Ga0373927_0017453 | 3300035695 | Bacteria | 4723 |
| 609 | Ga0373927_0042520 | 3300035695 | Bacteria | 2943 |
| 610 | Ga0373927_0078895 | 3300035695 | Bacteria | 2132 |
| 611 | Ga0373927_0142440 | 3300035695 | Bacteria | 1568 |
| 612 | Ga0373933_0001949 | 3300035724 | Bacteria | 11918 |
| 613 | Ga0373933_0012773 | 3300035724 | Bacteria | 4642 |
| 614 | Ga0373933_0052422 | 3300035724 | Bacteria | 2441 |
| 615 | Ga0373933_0132409 | 3300035724 | Bacteria | 1569 |
| 616 | Ga0373947_0000288 | 3300035725 | Bacteria | 28482 |
| 617 | Ga0373947_0000934 | 3300035725 | Bacteria | 17750 |
| 618 | Ga0373947_0029468 | 3300035725 | Bacteria | 3221 |
| 619 | Ga0373947_0050347 | 3300035725 | Bacteria | 2505 |
| 620 | Ga0373947_0061319 | 3300035725 | Bacteria | 2285 |
| 621 | Ga0373947_0062498 | 3300035725 | Bacteria | 2266 |
| 622 | Ga0373937_0000007 | 3300036401 | Bacteria | 183537 |
| 623 | Ga0373937_0004998 | 3300036401 | Bacteria | 11284 |
| 624 | Ga0373937_0009954 | 3300036401 | Bacteria | 8291 |
| 625 | Ga0373937_0014259 | 3300036401 | Bacteria | 7014 |
| 626 | Ga0373937_0024746 | 3300036401 | Bacteria | 5418 |
| 627 | Ga0373937_0027048 | 3300036401 | Bacteria | 5184 |
| 628 | Ga0373937_0034499 | 3300036401 | Bacteria | 4602 |
| 629 | Ga0373937_0075875 | 3300036401 | Bacteria | 3104 |
| 630 | Ga0373937_0100832 | 3300036401 | Bacteria | 2679 |
| 631 | Ga0373937_0192622 | 3300036401 | Bacteria | 1916 |
| 632 | Ga0373937_0211922 | 3300036401 | Bacteria | 1823 |
| 633 | Ga0373937_0264904 | 3300036401 | Bacteria | 1621 |
| 634 | Ga0373925_0000011 | 3300037068 | Bacteria | 209840 |
| 635 | Ga0373925_0001787 | 3300037068 | Bacteria | 17936 |
| 636 | Ga0373925_0010625 | 3300037068 | Bacteria | 6676 |
| 637 | Ga0373925_0090779 | 3300037068 | Bacteria | 2335 |
| 638 | Ga0373925_0189927 | 3300037068 | Bacteria | 1629 |
| 639 | Ga0395899_0014950 | 3300037312 | Bacteria | 5920 |
| 640 | Ga0395899_0018863 | 3300037312 | Bacteria | 5242 |
| 641 | Ga0395900_0010287 | 3300037418 | Bacteria | 9570 |
| 642 | Ga0395900_0212098 | 3300037418 | Bacteria | 1955 |
| 643 | Ga0395898_0007621 | 3300037466 | Bacteria | 11490 |
| 644 | Ga0395898_0013074 | 3300037466 | Bacteria | 8556 |
| 645 | Ga0436364_0505381 | 3300037853 | Bacteria | 66783 |
| 646 | Ga0395901_0011914 | 3300038443 | Bacteria | 8817 |
| 647 | Ga0395901_0153883 | 3300038443 | Bacteria | 2415 |
| 648 | Ga0395901_0160275 | 3300038443 | Bacteria | 2363 |
| 649 | Ga0436365_0696741 | 3300039437 | Bacteria | 4616 |
| 650 | Ga0436365_1083195 | 3300039437 | Bacteria | 12022 |
| 651 | Ga0436365_1269332 | 3300039437 | Bacteria | 2002 |
| 652 | Ga0436365_1929669 | 3300039437 | Bacteria | 2063 |
| 653 | Ga0436361_1173655 | 3300039447 | Bacteria | 9158 |
| 654 | Ga0436363_0663955 | 3300039450 | Bacteria | 1301 |
| 655 | Ga0436363_1135969 | 3300039450 | Bacteria | 1279 |
| 656 | Ga0436362_0105609 | 3300039453 | Bacteria | 1009 |
| 657 | Ga0436362_0151274 | 3300039453 | Bacteria | 1662 |
| 658 | Ga0436362_1109229 | 3300039453 | Bacteria | 1049 |
| 659 | Ga0451853_1068548 | 3300041512 | Bacteria | 2572 |
| 660 | Ga0451577_0010248 | 3300042876 | Bacteria | 8976 |
| 661 | Ga0453683_0202260 | 3300044673 | Bacteria | 1261 |
| 662 | Ga0466966_0037977 | 3300044684 | Bacteria | 3104 |
| 663 | Ga0466966_0038661 | 3300044684 | Bacteria | 3075 |
| 664 | Ga0466963_0071294 | 3300044694 | Bacteria | 2338 |
| 665 | Ga0466963_0074308 | 3300044694 | Bacteria | 2292 |
| 666 | Ga0466963_0169673 | 3300044694 | Bacteria | 1521 |
| 667 | Ga0466971_0138565 | 3300044719 | Bacteria | 1132 |
| 668 | Ga0466957_0031501 | 3300044842 | Bacteria | 3169 |
| 669 | Ga0466957_0052111 | 3300044842 | Bacteria | 2491 |
| 670 | Ga0466957_0067608 | 3300044842 | Bacteria | 2204 |
| 671 | Ga0466959_0057425 | 3300045049 | Bacteria | 2837 |
| 672 | Ga0466959_0193792 | 3300045049 | Bacteria | 1417 |
| 673 | Ga0466959_0251485 | 3300045049 | Bacteria | 1219 |
| 674 | Ga0451576_0051817 | 3300045051 | Bacteria | 4302 |
| 675 | Ga0466958_0168530 | 3300045836 | Bacteria | 1386 |
| 676 | Ga0466967_0009267 | 3300045976 | Bacteria | 7293 |
| 677 | Ga0466967_0132046 | 3300045976 | Bacteria | 2319 |
| 678 | Ga0495592_0000067 | 3300046454 | Bacteria | 95019 |
| 679 | Ga0495592_0001873 | 3300046454 | Bacteria | 14799 |
| 680 | Ga0495592_0007718 | 3300046454 | Bacteria | 8056 |
| 681 | Ga0495592_0009025 | 3300046454 | Bacteria | 7493 |
| 682 | Ga0495592_0173991 | 3300046454 | Bacteria | 1472 |
| 683 | Ga0495603_0035806 | 3300046455 | Bacteria | 2980 |
| 684 | Ga0495603_0055998 | 3300046455 | Bacteria | 2335 |
| 685 | Ga0495603_0120439 | 3300046455 | Bacteria | 1529 |
| 686 | Ga0495603_0229187 | 3300046455 | Bacteria | 1071 |
| 687 | Ga0495629_0000183 | 3300046459 | Bacteria | 56534 |
| 688 | Ga0495629_0019092 | 3300046459 | Bacteria | 4902 |
| 689 | Ga0495629_0064865 | 3300046459 | Bacteria | 2550 |
| 690 | Ga0495629_0074785 | 3300046459 | Bacteria | 2365 |
| 691 | Ga0495629_0246610 | 3300046459 | Bacteria | 1229 |
| 692 | Ga0495629_0282231 | 3300046459 | Bacteria | 1139 |
| 693 | Ga0495641_0027339 | 3300046461 | Bacteria | 2775 |
| 694 | Ga0495641_0041688 | 3300046461 | Bacteria | 2132 |
| 695 | Ga0495651_0000422 | 3300046462 | Bacteria | 32733 |
| 696 | Ga0495651_0001256 | 3300046462 | Bacteria | 19642 |
| 697 | Ga0495651_0005032 | 3300046462 | Bacteria | 10095 |
| 698 | Ga0495651_0023671 | 3300046462 | Bacteria | 4776 |
| 699 | Ga0495653_0000070 | 3300046463 | Bacteria | 88725 |
| 700 | Ga0495653_0001017 | 3300046463 | Bacteria | 21626 |
| 701 | Ga0495653_0015222 | 3300046463 | Bacteria | 6268 |
| 702 | Ga0495653_0065126 | 3300046463 | Bacteria | 2743 |
| 703 | Ga0495653_0069483 | 3300046463 | Bacteria | 2639 |
| 704 | Ga0495653_0158425 | 3300046463 | Bacteria | 1574 |
| 705 | Ga0495580_0020515 | 3300046472 | Bacteria | 4889 |
| 706 | Ga0495580_0107578 | 3300046472 | Bacteria | 1936 |
| 707 | Ga0495582_0001748 | 3300046473 | Bacteria | 12256 |
| 708 | Ga0495582_0027604 | 3300046473 | Bacteria | 3113 |
| 709 | Ga0495639_0008034 | 3300046475 | Bacteria | 4530 |
| 710 | Ga0495639_0020418 | 3300046475 | Bacteria | 2895 |
| 711 | Ga0495662_0005174 | 3300046476 | Bacteria | 6540 |
| 712 | Ga0495662_0020212 | 3300046476 | Bacteria | 3220 |
| 713 | Ga0495664_0000019 | 3300046477 | Bacteria | 153012 |
| 714 | Ga0495664_0007322 | 3300046477 | Bacteria | 6125 |
| 715 | Ga0495664_0007547 | 3300046477 | Bacteria | 6046 |
| 716 | Ga0495664_0019440 | 3300046477 | Bacteria | 3906 |
| 717 | Ga0495585_0017046 | 3300046492 | Bacteria | 4203 |
| 718 | Ga0495594_0060098 | 3300046499 | Bacteria | 2102 |
| 719 | Ga0495594_0117917 | 3300046499 | Bacteria | 1499 |
| 720 | Ga0495608_0000026 | 3300046511 | Bacteria | 156234 |
| 721 | Ga0495608_0000646 | 3300046511 | Bacteria | 24033 |
| 722 | Ga0495608_0008321 | 3300046511 | Bacteria | 7277 |
| 723 | Ga0495608_0025668 | 3300046511 | Bacteria | 4023 |
| 724 | Ga0495608_0098164 | 3300046511 | Bacteria | 1890 |
| 725 | Ga0495608_0108842 | 3300046511 | Bacteria | 1782 |
| 726 | Ga0495618_0000015 | 3300046514 | Bacteria | 152478 |
| 727 | Ga0495618_0000819 | 3300046514 | Bacteria | 21634 |
| 728 | Ga0495618_0000846 | 3300046514 | Bacteria | 21227 |
| 729 | Ga0495618_0015583 | 3300046514 | Bacteria | 4640 |
| 730 | Ga0495618_0056386 | 3300046514 | Bacteria | 2487 |
| 731 | Ga0495618_0087750 | 3300046514 | Bacteria | 1989 |
| 732 | Ga0495618_0093590 | 3300046514 | Bacteria | 1922 |
| 733 | Ga0495628_0000006 | 3300046516 | Bacteria | 306606 |
| 734 | Ga0495628_0035414 | 3300046516 | Bacteria | 4011 |
| 735 | Ga0495630_0007670 | 3300046517 | Bacteria | 7717 |
| 736 | Ga0495630_0045226 | 3300046517 | Bacteria | 3289 |
| 737 | Ga0495630_0096873 | 3300046517 | Bacteria | 2230 |
| 738 | Ga0495630_0101092 | 3300046517 | Bacteria | 2181 |
| 739 | Ga0495630_0229133 | 3300046517 | Bacteria | 1419 |
| 740 | Ga0495644_0000234 | 3300046523 | Bacteria | 26118 |
| 741 | Ga0495666_0027336 | 3300046526 | Bacteria | 2808 |
| 742 | Ga0495652_0000030 | 3300046529 | Bacteria | 152921 |
| 743 | Ga0495652_0004015 | 3300046529 | Bacteria | 14236 |
| 744 | Ga0495652_0012330 | 3300046529 | Bacteria | 7715 |
| 745 | Ga0495652_0054165 | 3300046529 | Bacteria | 3416 |
| 746 | Ga0495652_0117559 | 3300046529 | Bacteria | 2127 |
| 747 | Ga0495652_0149492 | 3300046529 | Bacteria | 1827 |
| 748 | Ga0495665_0007484 | 3300046531 | Bacteria | 5909 |
| 749 | Ga0495665_0029361 | 3300046531 | Bacteria | 2946 |
| 750 | Ga0495665_0145358 | 3300046531 | Bacteria | 1238 |
| 751 | Ga0495665_0147040 | 3300046531 | Bacteria | 1231 |
| 752 | Ga0495665_0174274 | 3300046531 | Bacteria | 1119 |
| 753 | Ga0495640_0000013 | 3300046533 | Bacteria | 172438 |
| 754 | Ga0495640_0005303 | 3300046533 | Bacteria | 10244 |
| 755 | Ga0495640_0018843 | 3300046533 | Bacteria | 5107 |
| 756 | Ga0495640_0022747 | 3300046533 | Bacteria | 4577 |
| 757 | Ga0495640_0052021 | 3300046533 | Bacteria | 2813 |
| 758 | Ga0495640_0055958 | 3300046533 | Bacteria | 2697 |
| 759 | Ga0495586_0016757 | 3300046535 | Bacteria | 3899 |
| 760 | Ga0495587_0000021 | 3300046536 | Bacteria | 152895 |
| 761 | Ga0495587_0000770 | 3300046536 | Bacteria | 21359 |
| 762 | Ga0495587_0022488 | 3300046536 | Bacteria | 3882 |
| 763 | Ga0495587_0058489 | 3300046536 | Bacteria | 2264 |
| 764 | Ga0495587_0067082 | 3300046536 | Bacteria | 2092 |
| 765 | Ga0495609_0044096 | 3300046538 | Bacteria | 2001 |
| 766 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 767 | Ga0495645_0067787 | 3300046543 | Bacteria | 2577 |
| 768 | Ga0495645_0095556 | 3300046543 | Bacteria | 2118 |
| 769 | Ga0495622_0028260 | 3300046557 | Bacteria | 2618 |
| 770 | Ga0495667_0000027 | 3300046559 | Bacteria | 152535 |
| 771 | Ga0495667_0011550 | 3300046559 | Bacteria | 5978 |
| 772 | Ga0495667_0012785 | 3300046559 | Bacteria | 5687 |
| 773 | Ga0495667_0016697 | 3300046559 | Bacteria | 4956 |
| 774 | Ga0495667_0052003 | 3300046559 | Bacteria | 2700 |
| 775 | Ga0495667_0108107 | 3300046559 | Bacteria | 1797 |
| 776 | Ga0495656_0000502 | 3300046615 | Bacteria | 12828 |
| 777 | Ga0495634_0000008 | 3300046642 | Bacteria | 163983 |
| 778 | Ga0495634_0005519 | 3300046642 | Bacteria | 9712 |
| 779 | Ga0495634_0005810 | 3300046642 | Bacteria | 9414 |
| 780 | Ga0495634_0012061 | 3300046642 | Bacteria | 6264 |
| 781 | Ga0495634_0019622 | 3300046642 | Bacteria | 4802 |
| 782 | Ga0495634_0024819 | 3300046642 | Bacteria | 4202 |
| 783 | Ga0495634_0029394 | 3300046642 | Bacteria | 3805 |
| 784 | Ga0495634_0070328 | 3300046642 | Bacteria | 2307 |
| 785 | Ga0495634_0102053 | 3300046642 | Bacteria | 1852 |
| 786 | Ga0495634_0125162 | 3300046642 | Bacteria | 1643 |
| 787 | Ga0495611_0022030 | 3300046648 | Bacteria | 2755 |
| 788 | Ga0495635_0000028 | 3300046663 | Bacteria | 121669 |
| 789 | Ga0495635_0000812 | 3300046663 | Bacteria | 20468 |
| 790 | Ga0495635_0011032 | 3300046663 | Bacteria | 6335 |
| 791 | Ga0495635_0017836 | 3300046663 | Bacteria | 4958 |
| 792 | Ga0495635_0088224 | 3300046663 | Bacteria | 2122 |
| 793 | Ga0495635_0094740 | 3300046663 | Bacteria | 2041 |
| 794 | Ga0495659_0030846 | 3300046664 | Bacteria | 1867 |
| 795 | Ga0495661_0204760 | 3300046665 | Bacteria | 1031 |
| 796 | Ga0495588_0024291 | 3300046674 | Bacteria | 3009 |
| 797 | Ga0495657_0000150 | 3300046675 | Bacteria | 63076 |
| 798 | Ga0495657_0005959 | 3300046675 | Bacteria | 9575 |
| 799 | Ga0495657_0015148 | 3300046675 | Bacteria | 5650 |
| 800 | Ga0495657_0038365 | 3300046675 | Bacteria | 3297 |
| 801 | Ga0495657_0165614 | 3300046675 | Bacteria | 1365 |
| 802 | Ga0495599_0000014 | 3300046678 | Bacteria | 177414 |
| 803 | Ga0495599_0014363 | 3300046678 | Bacteria | 4903 |
| 804 | Ga0495599_0021846 | 3300046678 | Bacteria | 3994 |
| 805 | Ga0495623_0000006 | 3300046679 | Bacteria | 140385 |
| 806 | Ga0495623_0001381 | 3300046679 | Bacteria | 16475 |
| 807 | Ga0495623_0010328 | 3300046679 | Bacteria | 6041 |
| 808 | Ga0495646_0000026 | 3300046680 | Bacteria | 100569 |
| 809 | Ga0495646_0006169 | 3300046680 | Bacteria | 7601 |
| 810 | Ga0495647_0011882 | 3300046681 | Bacteria | 2988 |
| 811 | Ga0495647_0021818 | 3300046681 | Bacteria | 2309 |
| 812 | Ga0495647_0066862 | 3300046681 | Bacteria | 1430 |
| 813 | Ga0495658_0035610 | 3300046683 | Bacteria | 2740 |
| 814 | Ga0495658_0036906 | 3300046683 | Bacteria | 2700 |
| 815 | Ga0495658_0121641 | 3300046683 | Bacteria | 1579 |
| 816 | Ga0495613_0050256 | 3300046689 | Bacteria | 3075 |
| 817 | Ga0495613_0292727 | 3300046689 | Bacteria | 1128 |
| 818 | Ga0495624_0097877 | 3300046690 | Bacteria | 1807 |
| 819 | Ga0495670_0001992 | 3300046691 | Bacteria | 10026 |
| 820 | Ga0495600_0000005 | 3300046809 | Bacteria | 171675 |
| 821 | Ga0495600_0010655 | 3300046809 | Bacteria | 5711 |
| 822 | Ga0495600_0021590 | 3300046809 | Bacteria | 4125 |
| 823 | Ga0495600_0088429 | 3300046809 | Bacteria | 2021 |
| 824 | Ga0495600_0266737 | 3300046809 | Bacteria | 1087 |
| 825 | Ga0495581_0004602 | 3300047315 | Bacteria | 7974 |
| 826 | Ga0495581_0039051 | 3300047315 | Bacteria | 2748 |
| 827 | Ga0495581_0126500 | 3300047315 | Bacteria | 1488 |
| 828 | Ga0495604_0000002 | 3300047317 | Bacteria | 530904 |
| 829 | Ga0495604_0000270 | 3300047317 | Bacteria | 46266 |
| 830 | Ga0495604_0019692 | 3300047317 | Bacteria | 5399 |
| 831 | Ga0495604_0023648 | 3300047317 | Bacteria | 4903 |
| 832 | Ga0495674_0000004 | 3300047319 | Bacteria | 531855 |
| 833 | Ga0495674_0012838 | 3300047319 | Bacteria | 7889 |
| 834 | Ga0495674_0014258 | 3300047319 | Bacteria | 7443 |
| 835 | Ga0495674_0016046 | 3300047319 | Bacteria | 6990 |
| 836 | Ga0495674_0021564 | 3300047319 | Bacteria | 5956 |
| 837 | Ga0495674_0044451 | 3300047319 | Bacteria | 3949 |
| 838 | Ga0495676_0019769 | 3300047321 | Bacteria | 5920 |
| 839 | Ga0495676_0045465 | 3300047321 | Bacteria | 3573 |
| 840 | Ga0495680_0001462 | 3300047322 | Bacteria | 25495 |
| 841 | Ga0495680_0002826 | 3300047322 | Bacteria | 17460 |
| 842 | Ga0495680_0006835 | 3300047322 | Bacteria | 10539 |
| 843 | Ga0495680_0016230 | 3300047322 | Bacteria | 6404 |
| 844 | Ga0495680_0016641 | 3300047322 | Bacteria | 6310 |
| 845 | Ga0495680_0043090 | 3300047322 | Bacteria | 3576 |
| 846 | Ga0495675_0007333 | 3300047444 | Bacteria | 6795 |
| 847 | Ga0495675_0007988 | 3300047444 | Bacteria | 6544 |
| 848 | Ga0495675_0013727 | 3300047444 | Bacteria | 5120 |
| 849 | Ga0495675_0077956 | 3300047444 | Bacteria | 2087 |
| 850 | Ga0495684_0000004 | 3300047471 | Bacteria | 307093 |
| 851 | Ga0495684_0003778 | 3300047471 | Bacteria | 11819 |
| 852 | Ga0495684_0006533 | 3300047471 | Bacteria | 9050 |
| 853 | Ga0495684_0008581 | 3300047471 | Bacteria | 7911 |
| 854 | Ga0495684_0025507 | 3300047471 | Bacteria | 4542 |
| 855 | Ga0495684_0033034 | 3300047471 | Bacteria | 3973 |
| 856 | Ga0495684_0162764 | 3300047471 | Bacteria | 1663 |
| 857 | Ga0495593_0001595 | 3300047673 | Bacteria | 13396 |
| 858 | Ga0495593_0020983 | 3300047673 | Bacteria | 3652 |
| 859 | Ga0495593_0036508 | 3300047673 | Bacteria | 2665 |
| 860 | Ga0495602_0000001 | 3300048088 | Bacteria | 510904 |
| 861 | Ga0495602_0001368 | 3300048088 | Bacteria | 24064 |
| 862 | Ga0495602_0021763 | 3300048088 | Bacteria | 6299 |
| 863 | Ga0495602_0026685 | 3300048088 | Bacteria | 5566 |
| 864 | Ga0495602_0053166 | 3300048088 | Bacteria | 3589 |
| 865 | Ga0495602_0116450 | 3300048088 | Bacteria | 2159 |
| 866 | Ga0495614_0015826 | 3300048089 | Bacteria | 3285 |
| 867 | Ga0496100_0006562 | 3300048903 | Bacteria | 6353 |
| 868 | Ga0496100_0019296 | 3300048903 | Bacteria | 4064 |
| 869 | Ga0496100_0037978 | 3300048903 | Bacteria | 3048 |
| 870 | Ga0496101_0000189 | 3300048904 | Bacteria | 48416 |
| 871 | Ga0496101_0051322 | 3300048904 | Bacteria | 2972 |
| 872 | Ga0496101_0171308 | 3300048904 | Bacteria | 1669 |
| 873 | Ga0496101_0304188 | 3300048904 | Bacteria | 1249 |
| 874 | Ga0496102_0006150 | 3300048905 | Bacteria | 10232 |
| 875 | Ga0496102_0062943 | 3300048905 | Bacteria | 3396 |
| 876 | Ga0496102_0145533 | 3300048905 | Bacteria | 2224 |
| 877 | Ga0496102_0189894 | 3300048905 | Bacteria | 1935 |
| 878 | Ga0496103_0018837 | 3300048906 | Bacteria | 4143 |
| 879 | Ga0496103_0136007 | 3300048906 | Bacteria | 1570 |
| 880 | Ga0496104_0040646 | 3300048907 | Bacteria | 4360 |
| 881 | Ga0496104_0078952 | 3300048907 | Bacteria | 3136 |
| 882 | Ga0496104_0092677 | 3300048907 | Bacteria | 2889 |
| 883 | Ga0496104_0131434 | 3300048907 | Bacteria | 2404 |
| 884 | Ga0496104_0362213 | 3300048907 | Bacteria | 1362 |
| 885 | Ga0496105_0027327 | 3300048908 | Bacteria | 4660 |
| 886 | Ga0496105_0312789 | 3300048908 | Bacteria | 1260 |
| 887 | Ga0496106_0002185 | 3300048909 | Bacteria | 14611 |
| 888 | Ga0496106_0022592 | 3300048909 | Bacteria | 4675 |
| 889 | Ga0496106_0028980 | 3300048909 | Bacteria | 4126 |
| 890 | Ga0496106_0207417 | 3300048909 | Bacteria | 1560 |
| 891 | Ga0496107_0007982 | 3300048910 | Bacteria | 7305 |
| 892 | Ga0496107_0030911 | 3300048910 | Bacteria | 3818 |
| 893 | Ga0496107_0098598 | 3300048910 | Bacteria | 2140 |
| 894 | Ga0496107_0466372 | 3300048910 | Bacteria | 938 |
| 895 | Ga0496108_0004716 | 3300048911 | Bacteria | 10994 |
| 896 | Ga0496108_0022285 | 3300048911 | Bacteria | 5208 |
| 897 | Ga0496108_0114222 | 3300048911 | Bacteria | 2312 |
| 898 | Ga0496108_0118881 | 3300048911 | Bacteria | 2266 |
| 899 | Ga0496108_0134412 | 3300048911 | Bacteria | 2127 |
| 900 | Ga0496108_0343513 | 3300048911 | Bacteria | 1302 |
| 901 | Ga0496109_0000488 | 3300048912 | Bacteria | 33914 |
| 902 | Ga0496109_0006180 | 3300048912 | Bacteria | 10066 |
| 903 | Ga0496109_0047269 | 3300048912 | Bacteria | 3912 |
| 904 | Ga0496109_0090830 | 3300048912 | Bacteria | 2824 |
| 905 | Ga0496110_0004294 | 3300048913 | Bacteria | 11032 |
| 906 | Ga0496110_0049541 | 3300048913 | Bacteria | 3685 |
| 907 | Ga0496110_0063048 | 3300048913 | Bacteria | 3275 |
| 908 | Ga0496110_0079229 | 3300048913 | Bacteria | 2924 |
| 909 | Ga0496110_0082453 | 3300048913 | Bacteria | 2868 |
| 910 | Ga0496111_0102574 | 3300048914 | Bacteria | 2103 |
| 911 | Ga0496111_0108910 | 3300048914 | Bacteria | 2039 |
| 912 | Ga0496111_0421990 | 3300048914 | Bacteria | 985 |
| 913 | Ga0496112_0037477 | 3300048915 | Bacteria | 4732 |
| 914 | Ga0496112_0070927 | 3300048915 | Bacteria | 3443 |
| 915 | Ga0496112_0071399 | 3300048915 | Bacteria | 3431 |
| 916 | Ga0496112_0141858 | 3300048915 | Bacteria | 2372 |
| 917 | Ga0496113_0007034 | 3300048916 | Bacteria | 7196 |
| 918 | Ga0496113_0061391 | 3300048916 | Bacteria | 2836 |
| 919 | Ga0496113_0131697 | 3300048916 | Bacteria | 1963 |
| 920 | Ga0496114_0012742 | 3300048917 | Bacteria | 6734 |
| 921 | Ga0496114_0168420 | 3300048917 | Bacteria | 1908 |
| 922 | Ga0496115_0040599 | 3300048918 | Bacteria | 3700 |
| 923 | Ga0496115_0054409 | 3300048918 | Bacteria | 3214 |
| 924 | Ga0496115_0091809 | 3300048918 | Bacteria | 2482 |
| 925 | Ga0496115_0141556 | 3300048918 | Bacteria | 1984 |
| 926 | Ga0496115_0148140 | 3300048918 | Bacteria | 1937 |
| 927 | Ga0496115_0211020 | 3300048918 | Bacteria | 1604 |
| 928 | Ga0496119_0019757 | 3300048922 | Bacteria | 4943 |
| 929 | Ga0501031_0235083 | 3300049568 | Bacteria | 1192 |
| 930 | Ga0501032_0059048 | 3300049569 | Bacteria | 2574 |
| 931 | Ga0501033_0055956 | 3300049570 | Bacteria | 2916 |
| 932 | Ga0501033_0075442 | 3300049570 | Bacteria | 2474 |
| 933 | Ga0501034_0000179 | 3300049571 | Bacteria | 118832 |
| 934 | Ga0501034_0027627 | 3300049571 | Bacteria | 5770 |
| 935 | Ga0501034_0043123 | 3300049571 | Bacteria | 4566 |
| 936 | Ga0501034_0069656 | 3300049571 | Bacteria | 3528 |
| 937 | Ga0501034_0342572 | 3300049571 | Bacteria | 1424 |
| 938 | Ga0501034_0371727 | 3300049571 | Bacteria | 1355 |
| 939 | Ga0501036_0006307 | 3300049572 | Bacteria | 9624 |
| 940 | Ga0501036_0019087 | 3300049572 | Bacteria | 5753 |
| 941 | Ga0501036_0019783 | 3300049572 | Bacteria | 5652 |
| 942 | Ga0501036_0036921 | 3300049572 | Bacteria | 4134 |
| 943 | Ga0501036_0397678 | 3300049572 | Bacteria | 1149 |
| 944 | Ga0501037_0041729 | 3300049573 | Bacteria | 3373 |
| 945 | Ga0501038_0063311 | 3300049574 | Bacteria | 3158 |
| 946 | Ga0501038_0230674 | 3300049574 | Bacteria | 1473 |
| 947 | Ga0501038_0300044 | 3300049574 | Bacteria | 1261 |
| 948 | Ga0501039_0003189 | 3300049575 | Bacteria | 12265 |
| 949 | Ga0501039_0007356 | 3300049575 | Bacteria | 8393 |
| 950 | Ga0501040_0011019 | 3300049576 | Bacteria | 5911 |
| 951 | Ga0501040_0066500 | 3300049576 | Bacteria | 2484 |
| 952 | Ga0501041_0152967 | 3300049577 | Bacteria | 1441 |
| 953 | Ga0501042_0004101 | 3300049578 | Bacteria | 9253 |
| 954 | Ga0501042_0022596 | 3300049578 | Bacteria | 4395 |
| 955 | Ga0501043_0011193 | 3300049579 | Bacteria | 7025 |
| 956 | Ga0501043_0037791 | 3300049579 | Bacteria | 3797 |
| 957 | Ga0501043_0046142 | 3300049579 | Bacteria | 3426 |
| 958 | Ga0501047_0000179 | 3300049581 | Bacteria | 77520 |
| 959 | Ga0501047_0086795 | 3300049581 | Bacteria | 3006 |
| 960 | Ga0501047_0110059 | 3300049581 | Bacteria | 2638 |
| 961 | Ga0501048_0000818 | 3300049582 | Bacteria | 22920 |
| 962 | Ga0501067_0034545 | 3300049583 | Bacteria | 2806 |
| 963 | Ga0501067_0258700 | 3300049583 | Bacteria | 969 |
| 964 | Ga0501068_0007795 | 3300049584 | Bacteria | 5931 |
| 965 | Ga0501068_0074770 | 3300049584 | Bacteria | 2071 |
| 966 | Ga0501068_0196757 | 3300049584 | Bacteria | 1278 |
| 967 | Ga0501069_0070299 | 3300049585 | Bacteria | 1960 |
| 968 | Ga0501070_0032571 | 3300049586 | Bacteria | 4363 |
| 969 | Ga0501070_0061182 | 3300049586 | Bacteria | 3120 |
| 970 | Ga0501070_0500930 | 3300049586 | Bacteria | 976 |
| 971 | Ga0501071_0016364 | 3300049587 | Bacteria | 5098 |
| 972 | Ga0501071_0088384 | 3300049587 | Bacteria | 2273 |
| 973 | Ga0501071_0355560 | 3300049587 | Bacteria | 1115 |
| 974 | Ga0501072_0001783 | 3300049588 | Bacteria | 16017 |
| 975 | Ga0501072_0013703 | 3300049588 | Bacteria | 6208 |
| 976 | Ga0501073_0004333 | 3300049589 | Bacteria | 10653 |
| 977 | Ga0501073_0061875 | 3300049589 | Bacteria | 2611 |
| 978 | Ga0501074_0018841 | 3300049590 | Bacteria | 5013 |
| 979 | Ga0501074_0041951 | 3300049590 | Bacteria | 3311 |
| 980 | Ga0501074_0140698 | 3300049590 | Bacteria | 1726 |
| 981 | Ga0501075_0013043 | 3300049591 | Bacteria | 5923 |
| 982 | Ga0501075_0078572 | 3300049591 | Bacteria | 2497 |
| 983 | Ga0501075_0199599 | 3300049591 | Bacteria | 1526 |
| 984 | Ga0501076_0007455 | 3300049592 | Bacteria | 7964 |
| 985 | Ga0501076_0035483 | 3300049592 | Bacteria | 3901 |
| 986 | Ga0501076_0319723 | 3300049592 | Bacteria | 1273 |
| 987 | Ga0501077_0003786 | 3300049593 | Bacteria | 9108 |
| 988 | Ga0501077_0007239 | 3300049593 | Bacteria | 6844 |
| 989 | Ga0501079_0003565 | 3300049741 | Bacteria | 11449 |
| 990 | Ga0501079_0034499 | 3300049741 | Bacteria | 3893 |
| 991 | Ga0501079_0039524 | 3300049741 | Bacteria | 3638 |
| 992 | Ga0501079_0119430 | 3300049741 | Bacteria | 2050 |
| 993 | Ga0501080_0016303 | 3300049742 | Bacteria | 6860 |
| 994 | Ga0501080_0336906 | 3300049742 | Bacteria | 1363 |
| 995 | Ga0501081_0047614 | 3300049743 | Bacteria | 2949 |
| 996 | Ga0501035_0024635 | 3300049822 | Bacteria | 5517 |
| 997 | Ga0501035_0055535 | 3300049822 | Bacteria | 3535 |
| 998 | Ga0501044_0025172 | 3300049823 | Bacteria | 6310 |
| 999 | Ga0501044_0307221 | 3300049823 | Bacteria | 1513 |
| 1000 | Ga0501045_0002764 | 3300049824 | Bacteria | 11977 |
| 1001 | Ga0501045_0003656 | 3300049824 | Bacteria | 10574 |
| 1002 | nmdc:mga03n38_20507_c1 | 3300050490 | Bacteria | 2645 |
| 1003 | nmdc:mga07m45_70321_c1 | 3300050496 | Bacteria | 1991 |
| 1004 | nmdc:mga05p37_103558_c1 | 3300050507 | Bacteria | 3503 |
| 1005 | nmdc:mga05p37_505_c1 | 3300050507 | Bacteria | 42970 |
| 1006 | nmdc:mga09592_772_c1 | 3300050508 | Bacteria | 24711 |
| 1007 | nmdc:mga0qj67_165_c1 | 3300050509 | Bacteria | 44307 |
| 1008 | nmdc:mga06r32_6147_c1 | 3300050510 | Bacteria | 10781 |
| 1009 | nmdc:mga08y16_1045_c1 | 3300050511 | Bacteria | 27157 |
| 1010 | nmdc:mga08y16_166290_c1 | 3300050511 | Bacteria | 2291 |
| 1011 | nmdc:mga08y16_19941_c1 | 3300050511 | Bacteria | 7074 |
| 1012 | nmdc:mga08y16_2844_c1 | 3300050511 | Bacteria | 17794 |
| 1013 | nmdc:mga0n895_127866_c1 | 3300050512 | Bacteria | 2565 |
| 1014 | nmdc:mga0n895_157283_c1 | 3300050512 | Bacteria | 2303 |
| 1015 | nmdc:mga0n895_28779_c1 | 3300050512 | Bacteria | 5290 |
| 1016 | nmdc:mga0n895_3322_c1 | 3300050512 | Bacteria | 12929 |
| 1017 | nmdc:mga0n895_57667_c1 | 3300050512 | Bacteria | 3828 |
| 1018 | nmdc:mga0n895_64674_c1 | 3300050512 | Bacteria | 3618 |
| 1019 | nmdc:mga0rr50_1278_c1 | 3300050513 | Bacteria | 13714 |
| 1020 | nmdc:mga0rr50_253926_c1 | 3300050513 | Bacteria | 1461 |
| 1021 | nmdc:mga0rr50_353200_c1 | 3300050513 | Bacteria | 1237 |
| 1022 | nmdc:mga0rr50_48694_c1 | 3300050513 | Bacteria | 3134 |
| 1023 | nmdc:mga0rr50_62692_c1 | 3300050513 | Bacteria | 2806 |
| 1024 | nmdc:mga0rr50_9459_c1 | 3300050513 | Bacteria | 4343 |
| 1025 | nmdc:mga08x19_121425_c1 | 3300050514 | Bacteria | 1752 |
| 1026 | nmdc:mga08x19_23872_c1 | 3300050514 | Bacteria | 3795 |
| 1027 | nmdc:mga08x19_24_c1 | 3300050514 | Bacteria | 245940 |
| 1028 | nmdc:mga08x19_298942_c1 | 3300050514 | Bacteria | 1118 |
| 1029 | nmdc:mga08x19_6998_c1 | 3300050514 | Bacteria | 6697 |
| 1030 | nmdc:mga0a205_15415_c1 | 3300050515 | Bacteria | 7143 |
| 1031 | nmdc:mga0a205_1632_c1 | 3300050515 | Bacteria | 19295 |
| 1032 | Ga0495601_0000023 | 3300053077 | Bacteria | 140141 |
| 1033 | Ga0495601_0000936 | 3300053077 | Bacteria | 15866 |
| 1034 | Ga0495601_0000961 | 3300053077 | Bacteria | 15756 |
| 1035 | Ga0495601_0001420 | 3300053077 | Bacteria | 13193 |
| 1036 | Ga0495601_0002082 | 3300053077 | Bacteria | 11234 |
| 1037 | Ga0495601_0004638 | 3300053077 | Bacteria | 7956 |
| 1038 | Ga0495601_0006493 | 3300053077 | Bacteria | 6841 |
| 1039 | Ga0495601_0007872 | 3300053077 | Bacteria | 6275 |
| 1040 | Ga0495601_0074526 | 3300053077 | Bacteria | 2171 |
| 1041 | Ga0495601_0193964 | 3300053077 | Bacteria | 1327 |
| 1042 | Ga0495612_0000005 | 3300053078 | Bacteria | 286943 |
| 1043 | Ga0495612_0002112 | 3300053078 | Bacteria | 8162 |
| 1044 | Ga0495612_0005900 | 3300053078 | Bacteria | 5051 |
| 1045 | Ga0495612_0006592 | 3300053078 | Bacteria | 4764 |
| 1046 | Ga0495612_0011331 | 3300053078 | Bacteria | 3593 |
| 1047 | Ga0495612_0015193 | 3300053078 | Bacteria | 3087 |
| 1048 | Ga0495612_0021322 | 3300053078 | Bacteria | 2599 |
| 1049 | Ga0495595_0000013 | 3300053084 | Bacteria | 160811 |
| 1050 | Ga0495595_0000729 | 3300053084 | Bacteria | 12487 |
| 1051 | Ga0495595_0003492 | 3300053084 | Bacteria | 6245 |
| 1052 | Ga0495595_0004598 | 3300053084 | Bacteria | 5550 |
| 1053 | Ga0495595_0005026 | 3300053084 | Bacteria | 5341 |
| 1054 | Ga0495595_0010301 | 3300053084 | Bacteria | 3884 |
| 1055 | Ga0495595_0039416 | 3300053084 | Bacteria | 2155 |
| 1056 | Ga0495619_0000003 | 3300053085 | Bacteria | 515784 |
| 1057 | Ga0495619_0000211 | 3300053085 | Bacteria | 42390 |
| 1058 | Ga0495619_0000315 | 3300053085 | Bacteria | 33904 |
| 1059 | Ga0495619_0000451 | 3300053085 | Bacteria | 27711 |
| 1060 | Ga0495619_0005328 | 3300053085 | Bacteria | 8144 |
| 1061 | Ga0495619_0011269 | 3300053085 | Bacteria | 5624 |
| 1062 | Ga0495619_0013426 | 3300053085 | Bacteria | 5161 |
| 1063 | Ga0495619_0013769 | 3300053085 | Bacteria | 5102 |
| 1064 | Ga0495619_0030899 | 3300053085 | Bacteria | 3468 |
| 1065 | Ga0495619_0040266 | 3300053085 | Bacteria | 3054 |
| 1066 | Ga0495619_0055033 | 3300053085 | Bacteria | 2635 |
| 1067 | Ga0495619_0119647 | 3300053085 | Bacteria | 1805 |
| 1068 | Ga0495619_0141235 | 3300053085 | Bacteria | 1658 |
| 1069 | Ga0501084_0002298 | 3300054114 | Bacteria | 15354 |
| 1070 | Ga0501084_0010997 | 3300054114 | Bacteria | 7496 |
| 1071 | Ga0501084_0091272 | 3300054114 | Bacteria | 2558 |
| 1072 | Ga0590075_015662 | 3300059424 | Bacteria | 1861 |
| 1073 | Ga0587077_006812 | 3300059493 | Bacteria | 1635 |
| 1074 | Ga0587106_004941 | 3300059605 | Bacteria | 1497 |
| 1075 | Ga0587072_011188 | 3300059643 | Bacteria | 1463 |
| 1076 | Ga0501082_0028331 | 3300060353 | Bacteria | 4826 |
| 1077 | Ga0501082_0065527 | 3300060353 | Bacteria | 3128 |
| 1078 | Ga0466962_0064652 | 3300061719 | Bacteria | 1747 |
| 1079 | Ga0466962_0177100 | 3300061719 | Bacteria | 1039 |
| 1080 | Ga0530510_0003358 | 3300061734 | Bacteria | 11013 |
| 1081 | 2643757036 | 2643221547 | Bacteria | 4740017 |
| 1082 | 2883581431 | 2883577096 | Bacteria | 4709178 |
| 1083 | 2929200338 | 2929199973 | Bacteria | 7260745 |
| 1084 | 8055912484 | 8055909800 | Bacteria | 7278581 |
| 1085 | Ga0495594_0039360 | |||
| 1086 | 2214745210 | |||
| 1087 | ARcpr5oldR_c000695 | |||
| 1088 | ARSoilYngRDRAFT_c00009 | |||
| 1089 | ARcpr5yngRDRAFT_c000006 | |||
| 1090 | ARSoilOldRDRAFT_c000102 | |||
| 1091 | ARCol0oldRDRAFT_c00372 | |||
| 1092 | ARCol0yngRDRAFT_1000031 | |||
| 1093 | JGI24746J21847_1001151 | |||
| 1094 | JGI24747J21853_1000092 | |||
| 1095 | JGI24739J22299_10001142 | |||
| 1096 | JGI24737J22298_10017959 | |||
| 1097 | JGI24737J22298_10037862 | |||
| 1098 | JGI24735J21928_10069260 | |||
| 1099 | JGI24750J21931_1000491 | |||
| 1100 | JGI24745J21846_1001148 | |||
| 1101 | JGI24738J21930_10005466 | |||
| 1102 | JGI24744J21845_10000700 | |||
| 1103 | JGI24035J26624_1001205 | |||
| 1104 | JGI24033J26618_1006830 | |||
| 1105 | JGI24742J22300_10003140 | |||
| 1106 | JGI24751J29686_10006826 | |||
| 1107 | JGI25405J52794_10017981 | |||
| 1108 | Ga0058862_10003908 | |||
| 1109 | Ga0065716_1001696 | |||
| 1110 | Ga0065712_10091161 | |||
| 1111 | Ga0065712_10173397 | |||
| 1112 | Ga0065715_10003882 | |||
| 1113 | Ga0065707_10019357 | |||
| 1114 | Ga0065707_10089297 | |||
| 1115 | Ga0070658_10010506 | |||
| 1116 | Ga0070658_10328280 | |||
| 1117 | Ga0070676_10002898 | |||
| 1118 | Ga0070676_10031581 | |||
| 1119 | Ga0070676_10209316 | |||
| 1120 | Ga0070683_100001166 | |||
| 1121 | Ga0070683_100009942 | |||
| 1122 | Ga0070683_100186558 | |||
| 1123 | Ga0070690_100001038 | |||
| 1124 | Ga0070690_100149465 | |||
| 1125 | Ga0070670_100003635 | |||
| 1126 | Ga0070670_100038180 | |||
| 1127 | Ga0070670_100085731 | |||
| 1128 | Ga0070677_10000126 | |||
| 1129 | Ga0068869_100009659 | |||
| 1130 | Ga0068869_100082414 | |||
| 1131 | Ga0070666_10103670 | |||
| 1132 | Ga0070666_10220254 | |||
| 1133 | Ga0070680_100006676 | |||
| 1134 | Ga0070680_100013378 | |||
| 1135 | Ga0070680_100027427 | |||
| 1136 | Ga0070682_100003724 | |||
| 1137 | Ga0068868_100003027 | |||
| 1138 | Ga0068868_100190218 | |||
| 1139 | Ga0070660_100019513 | |||
| 1140 | Ga0070660_100064566 | |||
| 1141 | Ga0070660_100202467 | |||
| 1142 | Ga0070660_100268543 | |||
| 1143 | Ga0070689_100004527 | |||
| 1144 | Ga0070689_100084015 | |||
| 1145 | Ga0070689_100113844 | |||
| 1146 | Ga0070691_10000994 | |||
| 1147 | Ga0070691_10009230 | |||
| 1148 | Ga0070687_100000085 | |||
| 1149 | Ga0070687_100129834 | |||
| 1150 | Ga0070687_100180981 | |||
| 1151 | Ga0070661_100000307 | |||
| 1152 | Ga0070661_100095552 | |||
| 1153 | Ga0070661_100218325 | |||
| 1154 | Ga0070692_10002518 | |||
| 1155 | Ga0070692_10081215 | |||
| 1156 | Ga0070668_100001248 | |||
| 1157 | Ga0070668_100268383 | |||
| 1158 | Ga0070669_100005868 | |||
| 1159 | Ga0070675_100044851 | |||
| 1160 | Ga0070675_100401123 | |||
| 1161 | Ga0070671_100000104 | |||
| 1162 | Ga0070671_100004422 | |||
| 1163 | Ga0070671_100041645 | |||
| 1164 | Ga0070671_100060686 | |||
| 1165 | Ga0070671_100087407 | |||
| 1166 | Ga0070671_100453080 | |||
| 1167 | Ga0070674_100003469 | |||
| 1168 | Ga0070674_100329133 | |||
| 1169 | Ga0070673_100000152 | |||
| 1170 | Ga0070673_100148341 | |||
| 1171 | Ga0070688_100000558 | |||
| 1172 | Ga0070688_100004316 | |||
| 1173 | Ga0070659_100010268 | |||
| 1174 | Ga0070659_100116631 | |||
| 1175 | Ga0070659_100187852 | |||
| 1176 | Ga0070659_100356791 | |||
| 1177 | Ga0070659_100499375 | |||
| 1178 | Ga0070667_100005640 | |||
| 1179 | Ga0070703_10049197 | |||
| 1180 | Ga0070709_10036142 | |||
| 1181 | Ga0070709_10051825 | |||
| 1182 | Ga0070709_10237816 | |||
| 1183 | Ga0070714_100011568 | |||
| 1184 | Ga0070714_100021050 | |||
| 1185 | Ga0070714_100137217 | |||
| 1186 | Ga0070714_100243631 | |||
| 1187 | Ga0070714_100339014 | |||
| 1188 | Ga0070713_100119035 | |||
| 1189 | Ga0070713_100128427 | |||
| 1190 | Ga0070713_100251890 | |||
| 1191 | Ga0070713_100272415 | |||
| 1192 | Ga0070710_10002595 | |||
| 1193 | Ga0070701_10056458 | |||
| 1194 | Ga0070701_10184581 | |||
| 1195 | Ga0070711_100016067 | |||
| 1196 | Ga0070711_100033014 | |||
| 1197 | Ga0070711_100036006 | |||
| 1198 | Ga0070711_100192016 | |||
| 1199 | Ga0070711_100274352 | |||
| 1200 | Ga0070705_100005321 | |||
| 1201 | Ga0070705_100017426 | |||
| 1202 | Ga0070700_100002863 | |||
| 1203 | Ga0070700_100012858 | |||
| 1204 | Ga0070694_100001507 | |||
| 1205 | Ga0070694_100014893 | |||
| 1206 | Ga0070694_100089338 | |||
| 1207 | Ga0070708_100091314 | |||
| 1208 | Ga0070663_100000522 | |||
| 1209 | Ga0070663_100036709 | |||
| 1210 | Ga0070663_100333377 | |||
| 1211 | Ga0070678_100000718 | |||
| 1212 | Ga0070678_100104446 | |||
| 1213 | Ga0070678_100364494 | |||
| 1214 | Ga0070662_100001666 | |||
| 1215 | Ga0070662_100212058 | |||
| 1216 | Ga0070662_100408542 | |||
| 1217 | Ga0070681_10017661 | |||
| 1218 | Ga0070681_10034038 | |||
| 1219 | Ga0070681_10037536 | |||
| 1220 | Ga0070681_10074970 | |||
| 1221 | Ga0070681_10149560 | |||
| 1222 | Ga0070681_10258391 | |||
| 1223 | Ga0068867_100005662 | |||
| 1224 | Ga0070685_10095949 | |||
| 1225 | Ga0070685_10138891 | |||
| 1226 | Ga0070685_10139720 | |||
| 1227 | Ga0070706_100065648 | |||
| 1228 | Ga0070698_100155162 | |||
| 1229 | Ga0070679_100007489 | |||
| 1230 | Ga0070679_100034242 | |||
| 1231 | Ga0070679_100040836 | |||
| 1232 | Ga0070679_100130513 | |||
| 1233 | Ga0070684_100000894 | |||
| 1234 | Ga0070684_100257230 | |||
| 1235 | Ga0070684_100640193 | |||
| 1236 | Ga0070697_100000842 | |||
| 1237 | Ga0070697_100244677 | |||
| 1238 | Ga0068853_100010158 | |||
| 1239 | Ga0068853_100048509 | |||
| 1240 | Ga0070672_100011122 | |||
| 1241 | Ga0070672_100203262 | |||
| 1242 | Ga0070672_100210683 | |||
| 1243 | Ga0070686_100000719 | |||
| 1244 | Ga0070686_100039765 | |||
| 1245 | Ga0070686_100107141 | |||
| 1246 | Ga0070695_100000088 | |||
| 1247 | Ga0070695_100172314 | |||
| 1248 | Ga0070696_100005009 | |||
| 1249 | Ga0070696_100171886 | |||
| 1250 | Ga0070693_100000134 | |||
| 1251 | Ga0070693_100014411 | |||
| 1252 | Ga0070665_100080031 | |||
| 1253 | Ga0070665_100178806 | |||
| 1254 | Ga0070665_100281417 | |||
| 1255 | Ga0070704_100000428 | |||
| 1256 | Ga0070704_100027340 | |||
| 1257 | Ga0070704_100116482 | |||
| 1258 | Ga0068855_100007545 | |||
| 1259 | Ga0068855_100060250 | |||
| 1260 | Ga0068855_100125775 | |||
| 1261 | Ga0070664_100002234 | |||
| 1262 | Ga0070664_100171882 | |||
| 1263 | Ga0070664_100241477 | |||
| 1264 | Ga0068857_100011473 | |||
| 1265 | Ga0068854_100005312 | |||
| 1266 | Ga0068856_100002000 | |||
| 1267 | Ga0068856_100283428 | |||
| 1268 | Ga0068856_100284037 | |||
| 1269 | Ga0068856_100350260 | |||
| 1270 | Ga0070702_100000638 | |||
| 1271 | Ga0070702_100011329 | |||
| 1272 | Ga0070702_100350555 | |||
| 1273 | Ga0068852_100002115 | |||
| 1274 | Ga0068859_100006242 | |||
| 1275 | Ga0068859_100224072 | |||
| 1276 | Ga0068859_100370619 | |||
| 1277 | Ga0068864_100189705 | |||
| 1278 | Ga0068866_10000301 | |||
| 1279 | Ga0068861_100021475 | |||
| 1280 | Ga0068861_100142675 | |||
| 1281 | Ga0068851_10058127 | |||
| 1282 | Ga0068870_10000354 | |||
| 1283 | Ga0068863_100000340 | |||
| 1284 | Ga0068863_100280785 | |||
| 1285 | Ga0068863_100292142 | |||
| 1286 | Ga0068863_100634888 | |||
| 1287 | Ga0068858_100000295 | |||
| 1288 | Ga0068858_100468131 | |||
| 1289 | Ga0068858_100513881 | |||
| 1290 | Ga0068860_100013035 | |||
| 1291 | Ga0068860_100246774 | |||
| 1292 | Ga0068860_100294684 | |||
| 1293 | Ga0068860_100311967 | |||
| 1294 | Ga0068862_100098646 | |||
| 1295 | Ga0068862_100105839 | |||
| 1296 | Ga0068862_100367419 | |||
| 1297 | Ga0081455_10000007 | |||
| 1298 | Ga0081455_10001479 | |||
| 1299 | Ga0081540_1018324 | |||
| 1300 | Ga0070717_10007640 | |||
| 1301 | Ga0070717_10112947 | |||
| 1302 | Ga0070715_10011032 | |||
| 1303 | Ga0070716_100116595 | |||
| 1304 | Ga0070712_100020066 | |||
| 1305 | Ga0070712_100049891 | |||
| 1306 | Ga0070712_100053419 | |||
| 1307 | Ga0070712_100238522 | |||
| 1308 | Ga0075427_10000774 | |||
| 1309 | Ga0097621_100000040 | |||
| 1310 | Ga0097621_100307280 | |||
| 1311 | Ga0075370_10028200 | |||
| 1312 | Ga0075370_10066244 | |||
| 1313 | Ga0068871_100000301 | |||
| 1314 | Ga0068871_100192945 | |||
| 1315 | Ga0068871_100455828 | |||
| 1316 | Ga0075428_100003180 | |||
| 1317 | Ga0075428_100065891 | |||
| 1318 | Ga0075428_100486252 | |||
| 1319 | Ga0075430_100000201 | |||
| 1320 | Ga0075431_100000260 | |||
| 1321 | Ga0075431_100163255 | |||
| 1322 | Ga0075433_10000007 | |||
| 1323 | Ga0075433_10006753 | |||
| 1324 | Ga0075433_10219785 | |||
| 1325 | Ga0075434_100000091 | |||
| 1326 | Ga0075434_100040371 | |||
| 1327 | Ga0075434_100043209 | |||
| 1328 | Ga0075429_100001824 | |||
| 1329 | Ga0068865_100000275 | |||
| 1330 | Ga0068865_100041437 | |||
| 1331 | Ga0068865_100063931 | |||
| 1332 | Ga0068865_100130897 | |||
| 1333 | Ga0075436_100002805 | |||
| 1334 | Ga0075436_100009266 | |||
| 1335 | Ga0075436_100032116 | |||
| 1336 | Ga0075436_100103247 | |||
| 1337 | Ga0075436_100165804 | |||
| 1338 | Ga0075436_100228690 | |||
| 1339 | Ga0075436_100281669 | |||
| 1340 | Ga0097620_100006242 | |||
| 1341 | Ga0097620_100224064 | |||
| 1342 | Ga0097620_100370625 | |||
| 1343 | Ga0075435_100024837 | |||
| 1344 | Ga0075435_100029180 | |||
| 1345 | Ga0075435_100053196 | |||
| 1346 | Ga0099795_10007864 | |||
| 1347 | Ga0105240_10063742 | |||
| 1348 | Ga0105240_10163906 | |||
| 1349 | Ga0105240_10205506 | |||
| 1350 | Ga0111539_10000394 | |||
| 1351 | Ga0111539_10001672 | |||
| 1352 | Ga0111539_10017527 | |||
| 1353 | Ga0111539_10121942 | |||
| 1354 | Ga0111539_10402075 | |||
| 1355 | Ga0105245_10000462 | |||
| 1356 | Ga0105245_10256708 | |||
| 1357 | Ga0105245_10516329 | |||
| 1358 | Ga0105247_10025524 | |||
| 1359 | Ga0105247_10140234 | |||
| 1360 | Ga0114129_10002772 | |||
| 1361 | Ga0114129_10128417 | |||
| 1362 | Ga0105243_10035482 | |||
| 1363 | Ga0105243_10215298 | |||
| 1364 | Ga0105241_10000652 | |||
| 1365 | Ga0105241_10085033 | |||
| 1366 | Ga0105241_10098463 | |||
| 1367 | Ga0105242_10011119 | |||
| 1368 | Ga0105242_10065494 | |||
| 1369 | Ga0105242_10129396 | |||
| 1370 | Ga0105248_10102488 | |||
| 1371 | Ga0105248_10165337 | |||
| 1372 | Ga0105248_10275706 | |||
| 1373 | Ga0105237_10231189 | |||
| 1374 | Ga0105237_10263512 | |||
| 1375 | Ga0105237_10348496 | |||
| 1376 | Ga0105238_10033390 | |||
| 1377 | Ga0105238_10103519 | |||
| 1378 | Ga0105238_10574475 | |||
| 1379 | Ga0105249_10001599 | |||
| 1380 | Ga0105249_10333927 | |||
| 1381 | Ga0099796_10002424 | |||
| 1382 | Ga0105239_10223196 | |||
| 1383 | Ga0105239_10259463 | |||
| 1384 | Ga0105239_10261762 | |||
| 1385 | Ga0105246_10007217 | |||
| 1386 | Ga0105246_10091966 | |||
| 1387 | Ga0105246_10224380 | |||
| 1388 | Ga0157373_10010359 | |||
| 1389 | Ga0157371_10015372 | |||
| 1390 | Ga0157371_10161320 | |||
| 1391 | Ga0157370_10109606 | |||
| 1392 | Ga0157370_10130376 | |||
| 1393 | Ga0157369_10192672 | |||
| 1394 | Ga0157369_10214159 | |||
| 1395 | Ga0157369_10360342 | |||
| 1396 | Ga0157374_10001695 | |||
| 1397 | Ga0157374_10227488 | |||
| 1398 | Ga0157378_10003374 | |||
| 1399 | Ga0157378_10509892 | |||
| 1400 | Ga0163162_10000145 | |||
| 1401 | Ga0163162_10238769 | |||
| 1402 | Ga0157372_10012191 | |||
| 1403 | Ga0157372_10061857 | |||
| 1404 | Ga0157372_10311902 | |||
| 1405 | Ga0157375_10008254 | |||
| 1406 | Ga0157375_10025055 | |||
| 1407 | Ga0157375_10267263 | |||
| 1408 | Ga0157375_10438768 | |||
| 1409 | Ga0163163_10000865 | |||
| 1410 | Ga0163163_10351251 | |||
| 1411 | Ga0163163_10517253 | |||
| 1412 | Ga0157380_10000891 | |||
| 1413 | Ga0182008_10059608 | |||
| 1414 | Ga0182008_10123856 | |||
| 1415 | Ga0157377_10000137 | |||
| 1416 | Ga0157379_10011995 | |||
| 1417 | Ga0157379_10037410 | |||
| 1418 | Ga0157379_10126143 | |||
| 1419 | Ga0157379_10259103 | |||
| 1420 | Ga0157379_10452415 | |||
| 1421 | Ga0157379_10580904 | |||
| 1422 | Ga0157376_10000088 | |||
| 1423 | Ga0157376_10082379 | |||
| 1424 | Ga0157376_10101393 | |||
| 1425 | Ga0157376_10154664 | |||
| 1426 | Ga0182007_10024216 | |||
| 1427 | Ga0163161_10000144 | |||
| 1428 | Ga0213876_10017793 | |||
| 1429 | Ga0213876_10119420 | |||
| 1430 | Ga0213875_10000003 | |||
| 1431 | Ga0213875_10104928 | |||
| 1432 | Ga0224712_10115145 | |||
| 1433 | Ga0207666_1000059 | |||
| 1434 | Ga0207673_1000772 | |||
| 1435 | Ga0207697_10066949 | |||
| 1436 | Ga0207697_10066975 | |||
| 1437 | Ga0207653_10002734 | |||
| 1438 | Ga0207682_10000509 | |||
| 1439 | Ga0207692_10009116 | |||
| 1440 | Ga0207692_10019295 | |||
| 1441 | Ga0207642_10000762 | |||
| 1442 | Ga0207710_10005834 | |||
| 1443 | Ga0207710_10052006 | |||
| 1444 | Ga0207688_10000167 | |||
| 1445 | Ga0207688_10148818 | |||
| 1446 | Ga0207688_10169275 | |||
| 1447 | Ga0207680_10131419 | |||
| 1448 | Ga0207680_10168986 | |||
| 1449 | Ga0207680_10272248 | |||
| 1450 | Ga0207647_10006799 | |||
| 1451 | Ga0207685_10007282 | |||
| 1452 | Ga0207699_10001444 | |||
| 1453 | Ga0207699_10014521 | |||
| 1454 | Ga0207699_10039355 | |||
| 1455 | Ga0207699_10083606 | |||
| 1456 | Ga0207645_10000100 | |||
| 1457 | Ga0207645_10036624 | |||
| 1458 | Ga0207643_10000007 | |||
| 1459 | Ga0207705_10070934 | |||
| 1460 | Ga0207705_10235328 | |||
| 1461 | Ga0207684_10088339 | |||
| 1462 | Ga0207654_10000314 | |||
| 1463 | Ga0207654_10080514 | |||
| 1464 | Ga0207707_10005018 | |||
| 1465 | Ga0207707_10016107 | |||
| 1466 | Ga0207707_10025342 | |||
| 1467 | Ga0207707_10046254 | |||
| 1468 | Ga0207695_10129877 | |||
| 1469 | Ga0207695_10162064 | |||
| 1470 | Ga0207693_10004590 | |||
| 1471 | Ga0207693_10007006 | |||
| 1472 | Ga0207693_10007799 | |||
| 1473 | Ga0207693_10018330 | |||
| 1474 | Ga0207693_10190828 | |||
| 1475 | Ga0207693_10274335 | |||
| 1476 | Ga0207693_10437914 | |||
| 1477 | Ga0207663_10041757 | |||
| 1478 | Ga0207663_10110415 | |||
| 1479 | Ga0207663_10230514 | |||
| 1480 | Ga0207660_10000041 | |||
| 1481 | Ga0207660_10032859 | |||
| 1482 | Ga0207660_10038531 | |||
| 1483 | Ga0207660_10051669 | |||
| 1484 | Ga0207660_10184876 | |||
| 1485 | Ga0207660_10193635 | |||
| 1486 | Ga0207662_10141401 | |||
| 1487 | Ga0207662_10158929 | |||
| 1488 | Ga0207657_10002386 | |||
| 1489 | Ga0207657_10030177 | |||
| 1490 | Ga0207657_10095636 | |||
| 1491 | Ga0207649_10001482 | |||
| 1492 | Ga0207652_10002995 | |||
| 1493 | Ga0207652_10009272 | |||
| 1494 | Ga0207652_10046076 | |||
| 1495 | Ga0207652_10056655 | |||
| 1496 | Ga0207652_10357304 | |||
| 1497 | Ga0207652_10486469 | |||
| 1498 | Ga0207681_10001546 | |||
| 1499 | Ga0207681_10101113 | |||
| 1500 | Ga0207694_10032903 | |||
| 1501 | Ga0207694_10195600 | |||
| 1502 | Ga0207650_10001317 | |||
| 1503 | Ga0207650_10020878 | |||
| 1504 | Ga0207650_10038831 | |||
| 1505 | Ga0207687_10000072 | |||
| 1506 | Ga0207700_10001532 | |||
| 1507 | Ga0207700_10021706 | |||
| 1508 | Ga0207700_10046576 | |||
| 1509 | Ga0207700_10121160 | |||
| 1510 | Ga0207700_10129684 | |||
| 1511 | Ga0207700_10165633 | |||
| 1512 | Ga0207664_10059268 | |||
| 1513 | Ga0207664_10145372 | |||
| 1514 | Ga0207644_10001292 | |||
| 1515 | Ga0207644_10002402 | |||
| 1516 | Ga0207644_10158888 | |||
| 1517 | Ga0207690_10004975 | |||
| 1518 | Ga0207706_10110493 | |||
| 1519 | Ga0207706_10116889 | |||
| 1520 | Ga0207706_10264658 | |||
| 1521 | Ga0207706_10264659 | |||
| 1522 | Ga0207686_10001034 | |||
| 1523 | Ga0207686_10009753 | |||
| 1524 | Ga0207709_10001423 | |||
| 1525 | Ga0207709_10169341 | |||
| 1526 | Ga0207670_10005263 | |||
| 1527 | Ga0207670_10155764 | |||
| 1528 | Ga0207670_10264204 | |||
| 1529 | Ga0207670_10305377 | |||
| 1530 | Ga0207669_10000176 | |||
| 1531 | Ga0207669_10215144 | |||
| 1532 | Ga0207704_10027128 | |||
| 1533 | Ga0207665_10000872 | |||
| 1534 | Ga0207665_10029398 | |||
| 1535 | Ga0207665_10030706 | |||
| 1536 | Ga0207691_10008719 | |||
| 1537 | Ga0207691_10131644 | |||
| 1538 | Ga0207711_10001106 | |||
| 1539 | Ga0207711_10145007 | |||
| 1540 | Ga0207689_10000366 | |||
| 1541 | Ga0207689_10053300 | |||
| 1542 | Ga0207661_10000087 | |||
| 1543 | Ga0207679_10000029 | |||
| 1544 | Ga0207667_10009257 | |||
| 1545 | Ga0207667_10118539 | |||
| 1546 | Ga0207667_10203083 | |||
| 1547 | Ga0207667_10220718 | |||
| 1548 | Ga0207651_10001426 | |||
| 1549 | Ga0207712_10001547 | |||
| 1550 | Ga0207712_10058614 | |||
| 1551 | Ga0207668_10007326 | |||
| 1552 | Ga0207668_10208741 | |||
| 1553 | Ga0207640_10001474 | |||
| 1554 | Ga0207640_10361142 | |||
| 1555 | Ga0207677_10001187 | |||
| 1556 | Ga0207703_10003109 | |||
| 1557 | Ga0207703_10078801 | |||
| 1558 | Ga0207639_10009108 | |||
| 1559 | Ga0207639_10264567 | |||
| 1560 | Ga0207639_10386435 | |||
| 1561 | Ga0207678_10003198 | |||
| 1562 | Ga0207678_10007393 | |||
| 1563 | Ga0207678_10030299 | |||
| 1564 | Ga0207678_10114204 | |||
| 1565 | Ga0207708_10039105 | |||
| 1566 | Ga0207708_10225932 | |||
| 1567 | Ga0207708_10225933 | |||
| 1568 | Ga0207702_10052174 | |||
| 1569 | Ga0207702_10509981 | |||
| 1570 | Ga0207641_10011956 | |||
| 1571 | Ga0207641_10548664 | |||
| 1572 | Ga0207648_10008796 | |||
| 1573 | Ga0207648_10326282 | |||
| 1574 | Ga0207676_10004807 | |||
| 1575 | Ga0207674_10000697 | |||
| 1576 | Ga0207674_10129549 | |||
| 1577 | Ga0207675_100005465 | |||
| 1578 | Ga0207675_100119642 | |||
| 1579 | Ga0207683_10000029 | |||
| 1580 | Ga0207683_10104349 | |||
| 1581 | Ga0207698_10000523 | |||
| 1582 | Ga0209968_1023991 | |||
| 1583 | Ga0209999_1022534 | |||
| 1584 | Ga0210002_1000355 | |||
| 1585 | Ga0209971_1015857 | |||
| 1586 | Ga0209998_10017900 | |||
| 1587 | Ga0209998_10017902 | |||
| 1588 | Ga0209974_10002097 | |||
| 1589 | Ga0207428_10000100 | |||
| 1590 | Ga0207428_10000115 | |||
| 1591 | Ga0207428_10000228 | |||
| 1592 | Ga0265357_1000271 | |||
| 1593 | Ga0268266_10191530 | |||
| 1594 | Ga0268265_10001240 | |||
| 1595 | Ga0268264_10002968 | |||
| 1596 | Ga0265337_1000241 | |||
| 1597 | Ga0265318_10063408 | |||
| 1598 | Ga0265338_10018779 | |||
| 1599 | Ga0265320_10039293 | |||
| 1600 | Ga0265325_10002684 | |||
| 1601 | Ga0265325_10002820 | |||
| 1602 | Ga0265325_10011649 | |||
| 1603 | Ga0265325_10037774 | |||
| 1604 | Ga0265340_10006632 | |||
| 1605 | Ga0265340_10027388 | |||
| 1606 | Ga0265340_10074310 | |||
| 1607 | Ga0265339_10010233 | |||
| 1608 | Ga0265327_10011275 | |||
| 1609 | Ga0265313_10009061 | |||
| 1610 | Ga0265313_10060100 | |||
| 1611 | Ga0265342_10000290 | |||
| 1612 | Ga0307409_100282837 | |||
| 1613 | Ga0316586_1006485 | |||
| 1614 | Ga0373930_0000262 | |||
| 1615 | Ga0373930_0017015 | |||
| 1616 | Ga0373948_0000210 | |||
| 1617 | Ga0373948_0009877 | |||
| 1618 | Ga0373950_0003575 | |||
| 1619 | Ga0373950_0011431 | |||
| 1620 | Ga0373958_0005354 | |||
| 1621 | Ga0373958_0026058 | |||
| 1622 | Ga0373959_0001913 | |||
| 1623 | Ga0373938_0000290 | |||
| 1624 | Ga0373938_0002477 | |||
| 1625 | Ga0373926_0056127 | |||
| 1626 | Ga0373926_0095669 | |||
| 1627 | Ga0373928_0004318 | |||
| 1628 | Ga0373928_0011140 | |||
| 1629 | Ga0373928_0017956 | |||
| 1630 | Ga0373929_0004247 | |||
| 1631 | Ga0373940_0000332 | |||
| 1632 | Ga0373940_0054836 | |||
| 1633 | Ga0373944_0003020 | |||
| 1634 | Ga0373944_0018212 | |||
| 1635 | Ga0373949_0000938 | |||
| 1636 | Ga0373949_0001649 | |||
| 1637 | Ga0373951_0000715 | |||
| 1638 | Ga0373952_0000298 | |||
| 1639 | Ga0373952_0003879 | |||
| 1640 | Ga0373952_0016205 | |||
| 1641 | Ga0373923_0000280 | |||
| 1642 | Ga0373923_0018997 | |||
| 1643 | Ga0373923_0138040 | |||
| 1644 | Ga0373932_0009427 | |||
| 1645 | Ga0373932_0017477 | |||
| 1646 | Ga0373936_0004177 | |||
| 1647 | Ga0373936_0012261 | |||
| 1648 | Ga0373936_0102672 | |||
| 1649 | Ga0373939_0001253 | |||
| 1650 | Ga0373939_0025286 | |||
| 1651 | Ga0373941_0001751 | |||
| 1652 | Ga0373941_0021604 | |||
| 1653 | Ga0373945_0002996 | |||
| 1654 | Ga0373945_0052530 | |||
| 1655 | Ga0373953_0002355 | |||
| 1656 | Ga0373953_0118784 | |||
| 1657 | Ga0373954_0002351 | |||
| 1658 | Ga0373954_0004478 | |||
| 1659 | Ga0373954_0023532 | |||
| 1660 | Ga0373956_0023237 | |||
| 1661 | Ga0373956_0024780 | |||
| 1662 | Ga0373957_0015820 | |||
| 1663 | Ga0373957_0022808 | |||
| 1664 | Ga0373960_0001089 | |||
| 1665 | Ga0373960_0015474 | |||
| 1666 | Ga0373943_0000373 | |||
| 1667 | Ga0373943_0005733 | |||
| 1668 | Ga0373943_0033152 | |||
| 1669 | Ga0373943_0041002 | |||
| 1670 | Ga0373946_0022913 | |||
| 1671 | Ga0373946_0072727 | |||
| 1672 | Ga0373955_0000078 | |||
| 1673 | Ga0373955_0009449 | |||
| 1674 | Ga0373955_0119297 | |||
| 1675 | Ga0373942_0011920 | |||
| 1676 | Ga0373961_0000196 | |||
| 1677 | Ga0373962_0000310 | |||
| 1678 | Ga0373962_0001593 | |||
| 1679 | Ga0373962_0033188 | |||
| 1680 | Ga0373924_0004057 | |||
| 1681 | Ga0373924_0140556 | |||
| 1682 | Ga0373931_0001534 | |||
| 1683 | Ga0373931_0008759 | |||
| 1684 | Ga0373931_0062414 | |||
| 1685 | Ga0373935_0000113 | |||
| 1686 | Ga0373935_0000982 | |||
| 1687 | Ga0373935_0054963 | |||
| 1688 | Ga0373935_0144368 | |||
| 1689 | Ga0373935_0329839 | |||
| 1690 | Ga0373927_0002538 | |||
| 1691 | Ga0373927_0010839 | |||
| 1692 | Ga0373927_0017453 | |||
| 1693 | Ga0373927_0042520 | |||
| 1694 | Ga0373927_0078895 | |||
| 1695 | Ga0373927_0142440 | |||
| 1696 | Ga0373933_0001949 | |||
| 1697 | Ga0373933_0012773 | |||
| 1698 | Ga0373933_0052422 | |||
| 1699 | Ga0373933_0132409 | |||
| 1700 | Ga0373947_0000288 | |||
| 1701 | Ga0373947_0000934 | |||
| 1702 | Ga0373947_0029468 | |||
| 1703 | Ga0373947_0050347 | |||
| 1704 | Ga0373947_0061319 | |||
| 1705 | Ga0373947_0062498 | |||
| 1706 | Ga0373937_0000007 | |||
| 1707 | Ga0373937_0004998 | |||
| 1708 | Ga0373937_0009954 | |||
| 1709 | Ga0373937_0014259 | |||
| 1710 | Ga0373937_0024746 | |||
| 1711 | Ga0373937_0027048 | |||
| 1712 | Ga0373937_0034499 | |||
| 1713 | Ga0373937_0075875 | |||
| 1714 | Ga0373937_0100832 | |||
| 1715 | Ga0373937_0192622 | |||
| 1716 | Ga0373937_0211922 | |||
| 1717 | Ga0373937_0264904 | |||
| 1718 | Ga0373925_0000011 | |||
| 1719 | Ga0373925_0001787 | |||
| 1720 | Ga0373925_0010625 | |||
| 1721 | Ga0373925_0090779 | |||
| 1722 | Ga0373925_0189927 | |||
| 1723 | Ga0395899_0014950 | |||
| 1724 | Ga0395899_0018863 | |||
| 1725 | Ga0395900_0010287 | |||
| 1726 | Ga0395900_0212098 | |||
| 1727 | Ga0395898_0007621 | |||
| 1728 | Ga0395898_0013074 | |||
| 1729 | Ga0436364_0505381 | |||
| 1730 | Ga0395901_0011914 | |||
| 1731 | Ga0395901_0153883 | |||
| 1732 | Ga0395901_0160275 | |||
| 1733 | Ga0436365_0696741 | |||
| 1734 | Ga0436365_1083195 | |||
| 1735 | Ga0436365_1269332 | |||
| 1736 | Ga0436365_1929669 | |||
| 1737 | Ga0436361_1173655 | |||
| 1738 | Ga0436363_0663955 | |||
| 1739 | Ga0436363_1135969 | |||
| 1740 | Ga0436362_0105609 | |||
| 1741 | Ga0436362_0151274 | |||
| 1742 | Ga0436362_1109229 | |||
| 1743 | Ga0451853_1068548 | |||
| 1744 | Ga0451577_0010248 | |||
| 1745 | Ga0453683_0202260 | |||
| 1746 | Ga0466966_0037977 | |||
| 1747 | Ga0466966_0038661 | |||
| 1748 | Ga0466963_0071294 | |||
| 1749 | Ga0466963_0074308 | |||
| 1750 | Ga0466963_0169673 | |||
| 1751 | Ga0466971_0138565 | |||
| 1752 | Ga0466957_0031501 | |||
| 1753 | Ga0466957_0052111 | |||
| 1754 | Ga0466957_0067608 | |||
| 1755 | Ga0466959_0057425 | |||
| 1756 | Ga0466959_0193792 | |||
| 1757 | Ga0466959_0251485 | |||
| 1758 | Ga0451576_0051817 | |||
| 1759 | Ga0466958_0168530 | |||
| 1760 | Ga0466967_0009267 | |||
| 1761 | Ga0466967_0132046 | |||
| 1762 | Ga0495592_0000067 | |||
| 1763 | Ga0495592_0001873 | |||
| 1764 | Ga0495592_0007718 | |||
| 1765 | Ga0495592_0009025 | |||
| 1766 | Ga0495592_0173991 | |||
| 1767 | Ga0495603_0035806 | |||
| 1768 | Ga0495603_0055998 | |||
| 1769 | Ga0495603_0120439 | |||
| 1770 | Ga0495603_0229187 | |||
| 1771 | Ga0495629_0000183 | |||
| 1772 | Ga0495629_0019092 | |||
| 1773 | Ga0495629_0064865 | |||
| 1774 | Ga0495629_0074785 | |||
| 1775 | Ga0495629_0246610 | |||
| 1776 | Ga0495629_0282231 | |||
| 1777 | Ga0495641_0027339 | |||
| 1778 | Ga0495641_0041688 | |||
| 1779 | Ga0495651_0000422 | |||
| 1780 | Ga0495651_0001256 | |||
| 1781 | Ga0495651_0005032 | |||
| 1782 | Ga0495651_0023671 | |||
| 1783 | Ga0495653_0000070 | |||
| 1784 | Ga0495653_0001017 | |||
| 1785 | Ga0495653_0015222 | |||
| 1786 | Ga0495653_0065126 | |||
| 1787 | Ga0495653_0069483 | |||
| 1788 | Ga0495653_0158425 | |||
| 1789 | Ga0495580_0020515 | |||
| 1790 | Ga0495580_0107578 | |||
| 1791 | Ga0495582_0001748 | |||
| 1792 | Ga0495582_0027604 | |||
| 1793 | Ga0495639_0008034 | |||
| 1794 | Ga0495639_0020418 | |||
| 1795 | Ga0495662_0005174 | |||
| 1796 | Ga0495662_0020212 | |||
| 1797 | Ga0495664_0000019 | |||
| 1798 | Ga0495664_0007322 | |||
| 1799 | Ga0495664_0007547 | |||
| 1800 | Ga0495664_0019440 | |||
| 1801 | Ga0495585_0017046 | |||
| 1802 | Ga0495594_0060098 | |||
| 1803 | Ga0495594_0117917 | |||
| 1804 | Ga0495608_0000026 | |||
| 1805 | Ga0495608_0000646 | |||
| 1806 | Ga0495608_0008321 | |||
| 1807 | Ga0495608_0025668 | |||
| 1808 | Ga0495608_0098164 | |||
| 1809 | Ga0495608_0108842 | |||
| 1810 | Ga0495618_0000015 | |||
| 1811 | Ga0495618_0000819 | |||
| 1812 | Ga0495618_0000846 | |||
| 1813 | Ga0495618_0015583 | |||
| 1814 | Ga0495618_0056386 | |||
| 1815 | Ga0495618_0087750 | |||
| 1816 | Ga0495618_0093590 | |||
| 1817 | Ga0495628_0000006 | |||
| 1818 | Ga0495628_0035414 | |||
| 1819 | Ga0495630_0007670 | |||
| 1820 | Ga0495630_0045226 | |||
| 1821 | Ga0495630_0096873 | |||
| 1822 | Ga0495630_0101092 | |||
| 1823 | Ga0495630_0229133 | |||
| 1824 | Ga0495644_0000234 | |||
| 1825 | Ga0495666_0027336 | |||
| 1826 | Ga0495652_0000030 | |||
| 1827 | Ga0495652_0004015 | |||
| 1828 | Ga0495652_0012330 | |||
| 1829 | Ga0495652_0054165 | |||
| 1830 | Ga0495652_0117559 | |||
| 1831 | Ga0495652_0149492 | |||
| 1832 | Ga0495665_0007484 | |||
| 1833 | Ga0495665_0029361 | |||
| 1834 | Ga0495665_0145358 | |||
| 1835 | Ga0495665_0147040 | |||
| 1836 | Ga0495665_0174274 | |||
| 1837 | Ga0495640_0000013 | |||
| 1838 | Ga0495640_0005303 | |||
| 1839 | Ga0495640_0018843 | |||
| 1840 | Ga0495640_0022747 | |||
| 1841 | Ga0495640_0052021 | |||
| 1842 | Ga0495640_0055958 | |||
| 1843 | Ga0495586_0016757 | |||
| 1844 | Ga0495587_0000021 | |||
| 1845 | Ga0495587_0000770 | |||
| 1846 | Ga0495587_0022488 | |||
| 1847 | Ga0495587_0058489 | |||
| 1848 | Ga0495587_0067082 | |||
| 1849 | Ga0495609_0044096 | |||
| 1850 | Ga0495645_0000001 | |||
| 1851 | Ga0495645_0067787 | |||
| 1852 | Ga0495645_0095556 | |||
| 1853 | Ga0495622_0028260 | |||
| 1854 | Ga0495667_0000027 | |||
| 1855 | Ga0495667_0011550 | |||
| 1856 | Ga0495667_0012785 | |||
| 1857 | Ga0495667_0016697 | |||
| 1858 | Ga0495667_0052003 | |||
| 1859 | Ga0495667_0108107 | |||
| 1860 | Ga0495656_0000502 | |||
| 1861 | Ga0495634_0000008 | |||
| 1862 | Ga0495634_0005519 | |||
| 1863 | Ga0495634_0005810 | |||
| 1864 | Ga0495634_0012061 | |||
| 1865 | Ga0495634_0019622 | |||
| 1866 | Ga0495634_0024819 | |||
| 1867 | Ga0495634_0029394 | |||
| 1868 | Ga0495634_0070328 | |||
| 1869 | Ga0495634_0102053 | |||
| 1870 | Ga0495634_0125162 | |||
| 1871 | Ga0495611_0022030 | |||
| 1872 | Ga0495635_0000028 | |||
| 1873 | Ga0495635_0000812 | |||
| 1874 | Ga0495635_0011032 | |||
| 1875 | Ga0495635_0017836 | |||
| 1876 | Ga0495635_0088224 | |||
| 1877 | Ga0495635_0094740 | |||
| 1878 | Ga0495659_0030846 | |||
| 1879 | Ga0495661_0204760 | |||
| 1880 | Ga0495588_0024291 | |||
| 1881 | Ga0495657_0000150 | |||
| 1882 | Ga0495657_0005959 | |||
| 1883 | Ga0495657_0015148 | |||
| 1884 | Ga0495657_0038365 | |||
| 1885 | Ga0495657_0165614 | |||
| 1886 | Ga0495599_0000014 | |||
| 1887 | Ga0495599_0014363 | |||
| 1888 | Ga0495599_0021846 | |||
| 1889 | Ga0495623_0000006 | |||
| 1890 | Ga0495623_0001381 | |||
| 1891 | Ga0495623_0010328 | |||
| 1892 | Ga0495646_0000026 | |||
| 1893 | Ga0495646_0006169 | |||
| 1894 | Ga0495647_0011882 | |||
| 1895 | Ga0495647_0021818 | |||
| 1896 | Ga0495647_0066862 | |||
| 1897 | Ga0495658_0035610 | |||
| 1898 | Ga0495658_0036906 | |||
| 1899 | Ga0495658_0121641 | |||
| 1900 | Ga0495613_0050256 | |||
| 1901 | Ga0495613_0292727 | |||
| 1902 | Ga0495624_0097877 | |||
| 1903 | Ga0495670_0001992 | |||
| 1904 | Ga0495600_0000005 | |||
| 1905 | Ga0495600_0010655 | |||
| 1906 | Ga0495600_0021590 | |||
| 1907 | Ga0495600_0088429 | |||
| 1908 | Ga0495600_0266737 | |||
| 1909 | Ga0495581_0004602 | |||
| 1910 | Ga0495581_0039051 | |||
| 1911 | Ga0495581_0126500 | |||
| 1912 | Ga0495604_0000002 | |||
| 1913 | Ga0495604_0000270 | |||
| 1914 | Ga0495604_0019692 | |||
| 1915 | Ga0495604_0023648 | |||
| 1916 | Ga0495674_0000004 | |||
| 1917 | Ga0495674_0012838 | |||
| 1918 | Ga0495674_0014258 | |||
| 1919 | Ga0495674_0016046 | |||
| 1920 | Ga0495674_0021564 | |||
| 1921 | Ga0495674_0044451 | |||
| 1922 | Ga0495676_0019769 | |||
| 1923 | Ga0495676_0045465 | |||
| 1924 | Ga0495680_0001462 | |||
| 1925 | Ga0495680_0002826 | |||
| 1926 | Ga0495680_0006835 | |||
| 1927 | Ga0495680_0016230 | |||
| 1928 | Ga0495680_0016641 | |||
| 1929 | Ga0495680_0043090 | |||
| 1930 | Ga0495675_0007333 | |||
| 1931 | Ga0495675_0007988 | |||
| 1932 | Ga0495675_0013727 | |||
| 1933 | Ga0495675_0077956 | |||
| 1934 | Ga0495684_0000004 | |||
| 1935 | Ga0495684_0003778 | |||
| 1936 | Ga0495684_0006533 | |||
| 1937 | Ga0495684_0008581 | |||
| 1938 | Ga0495684_0025507 | |||
| 1939 | Ga0495684_0033034 | |||
| 1940 | Ga0495684_0162764 | |||
| 1941 | Ga0495593_0001595 | |||
| 1942 | Ga0495593_0020983 | |||
| 1943 | Ga0495593_0036508 | |||
| 1944 | Ga0495602_0000001 | |||
| 1945 | Ga0495602_0001368 | |||
| 1946 | Ga0495602_0021763 | |||
| 1947 | Ga0495602_0026685 | |||
| 1948 | Ga0495602_0053166 | |||
| 1949 | Ga0495602_0116450 | |||
| 1950 | Ga0495614_0015826 | |||
| 1951 | Ga0496100_0006562 | |||
| 1952 | Ga0496100_0019296 | |||
| 1953 | Ga0496100_0037978 | |||
| 1954 | Ga0496101_0000189 | |||
| 1955 | Ga0496101_0051322 | |||
| 1956 | Ga0496101_0171308 | |||
| 1957 | Ga0496101_0304188 | |||
| 1958 | Ga0496102_0006150 | |||
| 1959 | Ga0496102_0062943 | |||
| 1960 | Ga0496102_0145533 | |||
| 1961 | Ga0496102_0189894 | |||
| 1962 | Ga0496103_0018837 | |||
| 1963 | Ga0496103_0136007 | |||
| 1964 | Ga0496104_0040646 | |||
| 1965 | Ga0496104_0078952 | |||
| 1966 | Ga0496104_0092677 | |||
| 1967 | Ga0496104_0131434 | |||
| 1968 | Ga0496104_0362213 | |||
| 1969 | Ga0496105_0027327 | |||
| 1970 | Ga0496105_0312789 | |||
| 1971 | Ga0496106_0002185 | |||
| 1972 | Ga0496106_0022592 | |||
| 1973 | Ga0496106_0028980 | |||
| 1974 | Ga0496106_0207417 | |||
| 1975 | Ga0496107_0007982 | |||
| 1976 | Ga0496107_0030911 | |||
| 1977 | Ga0496107_0098598 | |||
| 1978 | Ga0496107_0466372 | |||
| 1979 | Ga0496108_0004716 | |||
| 1980 | Ga0496108_0022285 | |||
| 1981 | Ga0496108_0114222 | |||
| 1982 | Ga0496108_0118881 | |||
| 1983 | Ga0496108_0134412 | |||
| 1984 | Ga0496108_0343513 | |||
| 1985 | Ga0496109_0000488 | |||
| 1986 | Ga0496109_0006180 | |||
| 1987 | Ga0496109_0047269 | |||
| 1988 | Ga0496109_0090830 | |||
| 1989 | Ga0496110_0004294 | |||
| 1990 | Ga0496110_0049541 | |||
| 1991 | Ga0496110_0063048 | |||
| 1992 | Ga0496110_0079229 | |||
| 1993 | Ga0496110_0082453 | |||
| 1994 | Ga0496111_0102574 | |||
| 1995 | Ga0496111_0108910 | |||
| 1996 | Ga0496111_0421990 | |||
| 1997 | Ga0496112_0037477 | |||
| 1998 | Ga0496112_0070927 | |||
| 1999 | Ga0496112_0071399 | |||
| 2000 | Ga0496112_0141858 | |||
| 2001 | Ga0496113_0007034 | |||
| 2002 | Ga0496113_0061391 | |||
| 2003 | Ga0496113_0131697 | |||
| 2004 | Ga0496114_0012742 | |||
| 2005 | Ga0496114_0168420 | |||
| 2006 | Ga0496115_0040599 | |||
| 2007 | Ga0496115_0054409 | |||
| 2008 | Ga0496115_0091809 | |||
| 2009 | Ga0496115_0141556 | |||
| 2010 | Ga0496115_0148140 | |||
| 2011 | Ga0496115_0211020 | |||
| 2012 | Ga0496119_0019757 | |||
| 2013 | Ga0501031_0235083 | |||
| 2014 | Ga0501032_0059048 | |||
| 2015 | Ga0501033_0055956 | |||
| 2016 | Ga0501033_0075442 | |||
| 2017 | Ga0501034_0000179 | |||
| 2018 | Ga0501034_0027627 | |||
| 2019 | Ga0501034_0043123 | |||
| 2020 | Ga0501034_0069656 | |||
| 2021 | Ga0501034_0342572 | |||
| 2022 | Ga0501034_0371727 | |||
| 2023 | Ga0501036_0006307 | |||
| 2024 | Ga0501036_0019087 | |||
| 2025 | Ga0501036_0019783 | |||
| 2026 | Ga0501036_0036921 | |||
| 2027 | Ga0501036_0397678 | |||
| 2028 | Ga0501037_0041729 | |||
| 2029 | Ga0501038_0063311 | |||
| 2030 | Ga0501038_0230674 | |||
| 2031 | Ga0501038_0300044 | |||
| 2032 | Ga0501039_0003189 | |||
| 2033 | Ga0501039_0007356 | |||
| 2034 | Ga0501040_0011019 | |||
| 2035 | Ga0501040_0066500 | |||
| 2036 | Ga0501041_0152967 | |||
| 2037 | Ga0501042_0004101 | |||
| 2038 | Ga0501042_0022596 | |||
| 2039 | Ga0501043_0011193 | |||
| 2040 | Ga0501043_0037791 | |||
| 2041 | Ga0501043_0046142 | |||
| 2042 | Ga0501047_0000179 | |||
| 2043 | Ga0501047_0086795 | |||
| 2044 | Ga0501047_0110059 | |||
| 2045 | Ga0501048_0000818 | |||
| 2046 | Ga0501067_0034545 | |||
| 2047 | Ga0501067_0258700 | |||
| 2048 | Ga0501068_0007795 | |||
| 2049 | Ga0501068_0074770 | |||
| 2050 | Ga0501068_0196757 | |||
| 2051 | Ga0501069_0070299 | |||
| 2052 | Ga0501070_0032571 | |||
| 2053 | Ga0501070_0061182 | |||
| 2054 | Ga0501070_0500930 | |||
| 2055 | Ga0501071_0016364 | |||
| 2056 | Ga0501071_0088384 | |||
| 2057 | Ga0501071_0355560 | |||
| 2058 | Ga0501072_0001783 | |||
| 2059 | Ga0501072_0013703 | |||
| 2060 | Ga0501073_0004333 | |||
| 2061 | Ga0501073_0061875 | |||
| 2062 | Ga0501074_0018841 | |||
| 2063 | Ga0501074_0041951 | |||
| 2064 | Ga0501074_0140698 | |||
| 2065 | Ga0501075_0013043 | |||
| 2066 | Ga0501075_0078572 | |||
| 2067 | Ga0501075_0199599 | |||
| 2068 | Ga0501076_0007455 | |||
| 2069 | Ga0501076_0035483 | |||
| 2070 | Ga0501076_0319723 | |||
| 2071 | Ga0501077_0003786 | |||
| 2072 | Ga0501077_0007239 | |||
| 2073 | Ga0501079_0003565 | |||
| 2074 | Ga0501079_0034499 | |||
| 2075 | Ga0501079_0039524 | |||
| 2076 | Ga0501079_0119430 | |||
| 2077 | Ga0501080_0016303 | |||
| 2078 | Ga0501080_0336906 | |||
| 2079 | Ga0501081_0047614 | |||
| 2080 | Ga0501035_0024635 | |||
| 2081 | Ga0501035_0055535 | |||
| 2082 | Ga0501044_0025172 | |||
| 2083 | Ga0501044_0307221 | |||
| 2084 | Ga0501045_0002764 | |||
| 2085 | Ga0501045_0003656 | |||
| 2086 | nmdc:mga03n38_20507_c1 | |||
| 2087 | nmdc:mga07m45_70321_c1 | |||
| 2088 | nmdc:mga05p37_103558_c1 | |||
| 2089 | nmdc:mga05p37_505_c1 | |||
| 2090 | nmdc:mga09592_772_c1 | |||
| 2091 | nmdc:mga0qj67_165_c1 | |||
| 2092 | nmdc:mga06r32_6147_c1 | |||
| 2093 | nmdc:mga08y16_1045_c1 | |||
| 2094 | nmdc:mga08y16_166290_c1 | |||
| 2095 | nmdc:mga08y16_19941_c1 | |||
| 2096 | nmdc:mga08y16_2844_c1 | |||
| 2097 | nmdc:mga0n895_127866_c1 | |||
| 2098 | nmdc:mga0n895_157283_c1 | |||
| 2099 | nmdc:mga0n895_28779_c1 | |||
| 2100 | nmdc:mga0n895_3322_c1 | |||
| 2101 | nmdc:mga0n895_57667_c1 | |||
| 2102 | nmdc:mga0n895_64674_c1 | |||
| 2103 | nmdc:mga0rr50_1278_c1 | |||
| 2104 | nmdc:mga0rr50_253926_c1 | |||
| 2105 | nmdc:mga0rr50_353200_c1 | |||
| 2106 | nmdc:mga0rr50_48694_c1 | |||
| 2107 | nmdc:mga0rr50_62692_c1 | |||
| 2108 | nmdc:mga0rr50_9459_c1 | |||
| 2109 | nmdc:mga08x19_121425_c1 | |||
| 2110 | nmdc:mga08x19_23872_c1 | |||
| 2111 | nmdc:mga08x19_24_c1 | |||
| 2112 | nmdc:mga08x19_298942_c1 | |||
| 2113 | nmdc:mga08x19_6998_c1 | |||
| 2114 | nmdc:mga0a205_15415_c1 | |||
| 2115 | nmdc:mga0a205_1632_c1 | |||
| 2116 | Ga0495601_0000023 | |||
| 2117 | Ga0495601_0000936 | |||
| 2118 | Ga0495601_0000961 | |||
| 2119 | Ga0495601_0001420 | |||
| 2120 | Ga0495601_0002082 | |||
| 2121 | Ga0495601_0004638 | |||
| 2122 | Ga0495601_0006493 | |||
| 2123 | Ga0495601_0007872 | |||
| 2124 | Ga0495601_0074526 | |||
| 2125 | Ga0495601_0193964 | |||
| 2126 | Ga0495612_0000005 | |||
| 2127 | Ga0495612_0002112 | |||
| 2128 | Ga0495612_0005900 | |||
| 2129 | Ga0495612_0006592 | |||
| 2130 | Ga0495612_0011331 | |||
| 2131 | Ga0495612_0015193 | |||
| 2132 | Ga0495612_0021322 | |||
| 2133 | Ga0495595_0000013 | |||
| 2134 | Ga0495595_0000729 | |||
| 2135 | Ga0495595_0003492 | |||
| 2136 | Ga0495595_0004598 | |||
| 2137 | Ga0495595_0005026 | |||
| 2138 | Ga0495595_0010301 | |||
| 2139 | Ga0495595_0039416 | |||
| 2140 | Ga0495619_0000003 | |||
| 2141 | Ga0495619_0000211 | |||
| 2142 | Ga0495619_0000315 | |||
| 2143 | Ga0495619_0000451 | |||
| 2144 | Ga0495619_0005328 | |||
| 2145 | Ga0495619_0011269 | |||
| 2146 | Ga0495619_0013426 | |||
| 2147 | Ga0495619_0013769 | |||
| 2148 | Ga0495619_0030899 | |||
| 2149 | Ga0495619_0040266 | |||
| 2150 | Ga0495619_0055033 | |||
| 2151 | Ga0495619_0119647 | |||
| 2152 | Ga0495619_0141235 | |||
| 2153 | Ga0501084_0002298 | |||
| 2154 | Ga0501084_0010997 | |||
| 2155 | Ga0501084_0091272 | |||
| 2156 | Ga0590075_015662 | |||
| 2157 | Ga0587077_006812 | |||
| 2158 | Ga0587106_004941 | |||
| 2159 | Ga0587072_011188 | |||
| 2160 | Ga0501082_0028331 | |||
| 2161 | Ga0501082_0065527 | |||
| 2162 | Ga0466962_0064652 | |||
| 2163 | Ga0466962_0177100 | |||
| 2164 | Ga0530510_0003358 | |||
| 2165 | 2643757036 | |||
| 2166 | 2883581431 | |||
| 2167 | 2929200338 | |||
| 2168 | 8055912484 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
129
333
0.9
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8193 | 73 | 304 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8082 | 73 | 305 |
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.8023 | 73 | 300 |
| 2r6g-assembly1.cif.gz_F | the crystal structure of the e. coli maltose transporter | 0.7927 | 73 | 300 |
| 3pv0-assembly1.cif.gz_F | crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide | 0.7774 | 73 | 301 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8331 | 72 | 308 | 1.10.3720.10 |
| af_Q2G1E8_165_419_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8282 | 72 | 312 | 1.10.3720.10 |
| af_P10905_52_292_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8251 | 71 | 309 | 1.10.3720.10 |
| af_P31135_29_312_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8238 | 73 | 309 | 1.10.3720.10 |
| af_P0AFK4_1_269_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8174 | 73 | 308 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1UY65-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.878 | 74 | 305 |
GO:0005886
GO:0055085 |
| AF-A0A2S5IZB5-F1-model_v4 | ABC transporter permease | 0.8615 | 71 | 310 |
GO:0005886
GO:0055085 |
| AF-X1GFF6-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.8589 | 149 | 308 |
GO:0005886
GO:0055085 |
| AF-A0A376TE10-F1-model_v4 | Maltose/maltodextrin transport system permease protein | 0.8575 | 84 | 256 |
GO:0015423
GO:0042956 GO:1990060 |
| AF-A0A535NYU6-F1-model_v4 | Sugar ABC transporter permease | 0.855 | 145 | 302 |
GO:0005886
GO:0055085 |