F489751

General Info

Members Datasets Scaffolds Average Seq Length
1084 321 2168 156

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0101941|Ga0501036_0101941_447_1019
Length 190
Sequence MAVAAAVAVIGDELMADTYYNHWFENRHDHQGDASMSVEVGAKAPDFTLPNQDREPVSLSEQLKSGPVVLAFFPAAFSGTCQKEMCTFRDSASTLNSVKAKVLGISVDTFFALKAWGDENKLNFPLLSDFNKDVIAKYGVVNPDMIGLKNIAKRSVFVIDKGGVVRHREVLEDARNEPNYEKITQTLASL

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
233 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
234 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
235 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
241 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
319 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 1.85
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 20.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0101941 3300049572 Bacteria 2428
2 ARSoilOldRDRAFT_c005815 3300000044 Bacteria 1037
3 JGI24746J21847_1000635 3300001977 Bacteria 5368
4 JGI24751J29686_10024321 3300002459 Bacteria 1256
5 JGI25406J46586_10037792 3300003203 Unclassified 1737
6 rootH2_10206308 3300003320 Bacteria 1125
7 Ga0058859_11634508 3300004798 Unclassified 819
8 Ga0058860_12130943 3300004801 Bacteria 687
9 Ga0065714_10021748 3300005288 Bacteria 1694
10 Ga0065704_10014277 3300005289 Bacteria 2056
11 Ga0065712_10000373 3300005290 Bacteria 15174
12 Ga0065712_10008353 3300005290 Unclassified 4460
13 Ga0065712_10080010 3300005290 Bacteria 3144
14 Ga0065712_10086798 3300005290 Bacteria 2615
15 Ga0065712_10119676 3300005290 Bacteria 1688
16 Ga0065712_10251049 3300005290 Bacteria 960
17 Ga0065712_10369363 3300005290 Unclassified 763
18 Ga0065712_10636686 3300005290 Unclassified 573
19 Ga0065715_10089661 3300005293 Bacteria 9036
20 Ga0065715_10094316 3300005293 Unclassified 4371
21 Ga0065715_10137491 3300005293 Bacteria 1906
22 Ga0065715_10283272 3300005293 Bacteria 1067
23 Ga0065715_10639614 3300005293 Unclassified 683
24 Ga0065707_10107323 3300005295 Unclassified 2559
25 Ga0065707_10107853 3300005295 Bacteria 2536
26 Ga0065707_10195881 3300005295 Bacteria 1336
27 Ga0065707_10342578 3300005295 Bacteria 931
28 Ga0065707_10524797 3300005295 Unclassified 739
29 Ga0065707_10847730 3300005295 Unclassified 583
30 Ga0070676_10115721 3300005328 Bacteria 1676
31 Ga0070676_10169845 3300005328 Bacteria 1410
32 Ga0070676_10277072 3300005328 Unclassified 1129
33 Ga0070676_11239471 3300005328 Unclassified 568
34 Ga0070683_100085861 3300005329 Bacteria 2951
35 Ga0070690_100047569 3300005330 Bacteria 2729
36 Ga0070690_100071050 3300005330 Bacteria 2261
37 Ga0070690_100085097 3300005330 Bacteria 2074
38 Ga0070690_100194594 3300005330 Bacteria 1408
39 Ga0070690_100243194 3300005330 Bacteria 1270
40 Ga0070690_100647491 3300005330 Bacteria 807
41 Ga0070690_100655740 3300005330 Bacteria 802
42 Ga0070690_100803169 3300005330 Unclassified 730
43 Ga0070670_100068895 3300005331 Unclassified 3037
44 Ga0070670_100073656 3300005331 Bacteria 2933
45 Ga0070670_100190877 3300005331 Bacteria 1779
46 Ga0070670_100387010 3300005331 Bacteria 1233
47 Ga0070677_10004638 3300005333 Bacteria 4496
48 Ga0070677_10071396 3300005333 Bacteria 1461
49 Ga0070677_10105968 3300005333 Bacteria 1247
50 Ga0070677_10213751 3300005333 Unclassified 938
51 Ga0070677_10407443 3300005333 Bacteria 718
52 Ga0068869_100005548 3300005334 Bacteria 7941
53 Ga0068869_100008204 3300005334 Bacteria 6719
54 Ga0068869_100096572 3300005334 Bacteria 2231
55 Ga0068869_100358631 3300005334 Bacteria 1190
56 Ga0070666_10039433 3300005335 Bacteria 3148
57 Ga0070666_10332421 3300005335 Bacteria 1085
58 Ga0070666_10575274 3300005335 Bacteria 821
59 Ga0070680_100307806 3300005336 Unclassified 1344
60 Ga0070680_100906617 3300005336 Bacteria 761
61 Ga0070680_100982075 3300005336 Unclassified 729
62 Ga0070680_101036432 3300005336 Bacteria 709
63 Ga0070680_101818216 3300005336 Bacteria 528
64 Ga0070682_101458129 3300005337 Bacteria 587
65 Ga0068868_100188517 3300005338 Bacteria 1714
66 Ga0068868_100390635 3300005338 Bacteria 1199
67 Ga0068868_100630411 3300005338 Bacteria 953
68 Ga0068868_101039303 3300005338 Unclassified 751
69 Ga0068868_102197568 3300005338 Bacteria 526
70 Ga0070660_100082029 3300005339 Bacteria 2532
71 Ga0070660_100154283 3300005339 Unclassified 1848
72 Ga0070660_100361684 3300005339 Bacteria 1196
73 Ga0070660_101052490 3300005339 Unclassified 688
74 Ga0070660_101324747 3300005339 Unclassified 611
75 Ga0070689_100092599 3300005340 Bacteria 2384
76 Ga0070689_100211104 3300005340 Unclassified 1589
77 Ga0070689_100357903 3300005340 Bacteria 1226
78 Ga0070689_100368543 3300005340 Bacteria 1208
79 Ga0070689_100453063 3300005340 Bacteria 1092
80 Ga0070689_100723052 3300005340 Bacteria 871
81 Ga0070691_10271224 3300005341 Bacteria 917
82 Ga0070691_10330129 3300005341 Unclassified 841
83 Ga0070687_100003556 3300005343 Bacteria 6067
84 Ga0070687_100008554 3300005343 Bacteria 4343
85 Ga0070661_100027569 3300005344 Bacteria 4091
86 Ga0070661_100276763 3300005344 Bacteria 1301
87 Ga0070661_100414795 3300005344 Bacteria 1066
88 Ga0070661_101115107 3300005344 Bacteria 658
89 Ga0070692_10070524 3300005345 Bacteria 1861
90 Ga0070668_100100000 3300005347 Bacteria 2297
91 Ga0070668_100148140 3300005347 Bacteria 1896
92 Ga0070668_100177775 3300005347 Bacteria 1737
93 Ga0070668_100252156 3300005347 Bacteria 1465
94 Ga0070668_101486300 3300005347 Bacteria 619
95 Ga0070668_102072717 3300005347 Bacteria 525
96 Ga0070669_100004321 3300005353 Bacteria 10266
97 Ga0070669_100005329 3300005353 Bacteria 9286
98 Ga0070669_100042667 3300005353 Bacteria 3301
99 Ga0070669_100097062 3300005353 Bacteria 2218
100 Ga0070669_100146488 3300005353 Bacteria 1825
101 Ga0070669_100192345 3300005353 Unclassified 1601
102 Ga0070669_100202752 3300005353 Bacteria 1561
103 Ga0070669_100304132 3300005353 Bacteria 1283
104 Ga0070669_100897182 3300005353 Bacteria 757
105 Ga0070669_100917146 3300005353 Bacteria 749
106 Ga0070669_101147984 3300005353 Bacteria 670
107 Ga0070669_101373106 3300005353 Bacteria 613
108 Ga0070675_100011134 3300005354 Bacteria 7038
109 Ga0070675_100015561 3300005354 Bacteria 6017
110 Ga0070675_100075989 3300005354 Bacteria 2793
111 Ga0070675_100104614 3300005354 Bacteria 2388
112 Ga0070675_100141512 3300005354 Unclassified 2057
113 Ga0070675_100245149 3300005354 Bacteria 1566
114 Ga0070675_100259780 3300005354 Unclassified 1522
115 Ga0070675_100281889 3300005354 Bacteria 1460
116 Ga0070675_100854273 3300005354 Bacteria 833
117 Ga0070675_100999716 3300005354 Unclassified 768
118 Ga0070671_100242860 3300005355 Bacteria 1529
119 Ga0070674_100001261 3300005356 Bacteria 13303
120 Ga0070674_100003472 3300005356 Bacteria 8854
121 Ga0070674_100021751 3300005356 Bacteria 4125
122 Ga0070674_100047443 3300005356 Bacteria 2944
123 Ga0070674_100110747 3300005356 Unclassified 2015
124 Ga0070674_100647594 3300005356 Bacteria 898
125 Ga0070674_100843913 3300005356 Unclassified 794
126 Ga0070674_101630815 3300005356 Bacteria 582
127 Ga0070674_101822367 3300005356 Bacteria 552
128 Ga0070673_100006876 3300005364 Bacteria 7440
129 Ga0070673_100179758 3300005364 Bacteria 1810
130 Ga0070673_100241893 3300005364 Unclassified 1569
131 Ga0070673_100348781 3300005364 Bacteria 1313
132 Ga0070673_100373137 3300005364 Bacteria 1270
133 Ga0070673_100425224 3300005364 Bacteria 1191
134 Ga0070673_100863626 3300005364 Bacteria 838
135 Ga0070688_100048853 3300005365 Bacteria 2630
136 Ga0070688_100069819 3300005365 Bacteria 2244
137 Ga0070688_100071597 3300005365 Bacteria 2220
138 Ga0070688_100073223 3300005365 Bacteria 2197
139 Ga0070688_100108645 3300005365 Unclassified 1841
140 Ga0070688_100162799 3300005365 Unclassified 1534
141 Ga0070688_100325846 3300005365 Bacteria 1117
142 Ga0070688_100353396 3300005365 Bacteria 1076
143 Ga0070688_100356709 3300005365 Unclassified 1072
144 Ga0070688_100796916 3300005365 Archaea 739
145 Ga0070659_100355655 3300005366 Bacteria 1229
146 Ga0070667_100028388 3300005367 Bacteria 4658
147 Ga0070667_100091938 3300005367 Bacteria 2610
148 Ga0070667_100329936 3300005367 Bacteria 1378
149 Ga0070667_100430202 3300005367 Unclassified 1204
150 Ga0070667_100560199 3300005367 Unclassified 1051
151 Ga0070703_10367038 3300005406 Bacteria 618
152 Ga0070714_100017981 3300005435 Bacteria 5732
153 Ga0070713_100406918 3300005436 Bacteria 1272
154 Ga0070701_10006936 3300005438 Bacteria 4802
155 Ga0070701_10015284 3300005438 Bacteria 3540
156 Ga0070701_10040039 3300005438 Bacteria 2380
157 Ga0070701_10045069 3300005438 Bacteria 2262
158 Ga0070701_10120202 3300005438 Bacteria 1479
159 Ga0070701_10345288 3300005438 Unclassified 928
160 Ga0070705_100057678 3300005440 Unclassified 2292
161 Ga0070705_100653574 3300005440 Bacteria 820
162 Ga0070700_100002184 3300005441 Bacteria 9939
163 Ga0070700_100007571 3300005441 Bacteria 5871
164 Ga0070700_100015844 3300005441 Bacteria 4283
165 Ga0070700_100040187 3300005441 Bacteria 2862
166 Ga0070700_100047841 3300005441 Bacteria 2649
167 Ga0070700_100048842 3300005441 Bacteria 2624
168 Ga0070700_100060756 3300005441 Bacteria 2382
169 Ga0070700_100106558 3300005441 Bacteria 1856
170 Ga0070700_100519330 3300005441 Unclassified 920
171 Ga0070700_100827293 3300005441 Bacteria 748
172 Ga0070694_100373610 3300005444 Bacteria 1110
173 Ga0070694_100482708 3300005444 Bacteria 984
174 Ga0070694_100822174 3300005444 Unclassified 763
175 Ga0070694_100909293 3300005444 Bacteria 727
176 Ga0070694_101102079 3300005444 Unclassified 662
177 Ga0070708_100211381 3300005445 Bacteria 1818
178 Ga0070708_100303668 3300005445 Bacteria 1503
179 Ga0070708_101977453 3300005445 Bacteria 540
180 Ga0070663_100120008 3300005455 Bacteria 1985
181 Ga0070663_100129798 3300005455 Bacteria 1913
182 Ga0070663_100579498 3300005455 Unclassified 941
183 Ga0070663_100680321 3300005455 Bacteria 873
184 Ga0070663_101891555 3300005455 Unclassified 536
185 Ga0070678_100028346 3300005456 Bacteria 3818
186 Ga0070678_100561889 3300005456 Bacteria 1014
187 Ga0070678_102356987 3300005456 Unclassified 505
188 Ga0070662_100028176 3300005457 Bacteria 3906
189 Ga0070662_100148813 3300005457 Bacteria 1821
190 Ga0070662_100180495 3300005457 Bacteria 1664
191 Ga0070662_100268608 3300005457 Bacteria 1376
192 Ga0070681_10014561 3300005458 Bacteria 7827
193 Ga0068867_100003165 3300005459 Bacteria 11608
194 Ga0068867_100082617 3300005459 Bacteria 2424
195 Ga0068867_100102642 3300005459 Unclassified 2186
196 Ga0068867_100210346 3300005459 Bacteria 1562
197 Ga0068867_100410134 3300005459 Bacteria 1145
198 Ga0068867_100650980 3300005459 Bacteria 924
199 Ga0068867_100867712 3300005459 Bacteria 810
200 Ga0068867_101540035 3300005459 Bacteria 620
201 Ga0070685_10068966 3300005466 Unclassified 2090
202 Ga0070685_10085415 3300005466 Bacteria 1900
203 Ga0070685_10221116 3300005466 Unclassified 1241
204 Ga0070685_10363763 3300005466 Bacteria 992
205 Ga0070685_10815907 3300005466 Unclassified 689
206 Ga0070685_10842732 3300005466 Bacteria 679
207 Ga0070707_100035611 3300005468 Bacteria 4749
208 Ga0070707_100609032 3300005468 Bacteria 1055
209 Ga0070707_100916855 3300005468 Bacteria 841
210 Ga0070698_100129199 3300005471 Bacteria 2483
211 Ga0070698_100493055 3300005471 Bacteria 1163
212 Ga0070698_100601505 3300005471 Unclassified 1040
213 Ga0070699_100002012 3300005518 Bacteria 18361
214 Ga0070699_100705653 3300005518 Bacteria 922
215 Ga0070699_101091497 3300005518 Unclassified 732
216 Ga0070679_100040461 3300005530 Bacteria 4637
217 Ga0070679_100049935 3300005530 Bacteria 4167
218 Ga0070679_101868748 3300005530 Unclassified 549
219 Ga0070684_100187598 3300005535 Bacteria 1881
220 Ga0070697_100170580 3300005536 Bacteria 1841
221 Ga0070697_100327541 3300005536 Bacteria 1320
222 Ga0068853_100196465 3300005539 Bacteria 1835
223 Ga0070672_100043187 3300005543 Bacteria 3475
224 Ga0070672_100063994 3300005543 Bacteria 2905
225 Ga0070672_100084274 3300005543 Bacteria 2552
226 Ga0070672_100199170 3300005543 Bacteria 1674
227 Ga0070672_100784755 3300005543 Unclassified 838
228 Ga0070672_100790618 3300005543 Unclassified 834
229 Ga0070686_100031463 3300005544 Bacteria 3244
230 Ga0070686_100057146 3300005544 Bacteria 2505
231 Ga0070686_100085056 3300005544 Bacteria 2103
232 Ga0070686_100130902 3300005544 Unclassified 1735
233 Ga0070686_100220726 3300005544 Bacteria 1370
234 Ga0070686_100705965 3300005544 Bacteria 805
235 Ga0070686_100737860 3300005544 Bacteria 789
236 Ga0070686_101056086 3300005544 Bacteria 669
237 Ga0070695_100002468 3300005545 Bacteria 10652
238 Ga0070695_100016243 3300005545 Bacteria 4504
239 Ga0070695_100022402 3300005545 Bacteria 3874
240 Ga0070695_100337306 3300005545 Bacteria 1125
241 Ga0070695_100961961 3300005545 Bacteria 693
242 Ga0070696_100016233 3300005546 Bacteria 5011
243 Ga0070696_100036951 3300005546 Bacteria 3369
244 Ga0070696_100160329 3300005546 Bacteria 1657
245 Ga0070665_100322689 3300005548 Bacteria 1548
246 Ga0070704_100009365 3300005549 Bacteria 5912
247 Ga0070704_100119305 3300005549 Bacteria 2023
248 Ga0070704_100222089 3300005549 Bacteria 1537
249 Ga0070704_100255264 3300005549 Bacteria 1442
250 Ga0070704_100287858 3300005549 Bacteria 1364
251 Ga0070704_100526392 3300005549 Bacteria 1030
252 Ga0070704_100654531 3300005549 Unclassified 928
253 Ga0070704_101049520 3300005549 Unclassified 739
254 Ga0068855_100020797 3300005563 Bacteria 7868
255 Ga0070664_100024009 3300005564 Bacteria 5039
256 Ga0070664_100118928 3300005564 Unclassified 2312
257 Ga0070664_100134973 3300005564 Bacteria 2169
258 Ga0070664_100152090 3300005564 Bacteria 2043
259 Ga0070664_100269325 3300005564 Bacteria 1534
260 Ga0068857_100102707 3300005577 Bacteria 2566
261 Ga0068857_100120998 3300005577 Bacteria 2357
262 Ga0068857_100510647 3300005577 Bacteria 1129
263 Ga0068857_100558327 3300005577 Bacteria 1079
264 Ga0068857_100978243 3300005577 Bacteria 814
265 Ga0068854_100022971 3300005578 Bacteria 4256
266 Ga0068854_100054657 3300005578 Bacteria 2872
267 Ga0068856_101662602 3300005614 Unclassified 651
268 Ga0070702_100148269 3300005615 Unclassified 1503
269 Ga0070702_100431735 3300005615 Bacteria 951
270 Ga0070702_100434359 3300005615 Unclassified 948
271 Ga0068852_100166490 3300005616 Bacteria 2063
272 Ga0068852_100761296 3300005616 Bacteria 981
273 Ga0068859_100002669 3300005617 Bacteria 18110
274 Ga0068859_100128259 3300005617 Bacteria 2607
275 Ga0068859_100160182 3300005617 Bacteria 2329
276 Ga0068859_100307837 3300005617 Bacteria 1678
277 Ga0068859_100420487 3300005617 Bacteria 1433
278 Ga0068859_100982350 3300005617 Unclassified 927
279 Ga0068859_101774045 3300005617 Unclassified 682
280 Ga0068864_100040716 3300005618 Bacteria 3974
281 Ga0068864_100167280 3300005618 Bacteria 2002
282 Ga0068864_100320508 3300005618 Bacteria 1456
283 Ga0068864_100804435 3300005618 Bacteria 924
284 Ga0068864_100892196 3300005618 Bacteria 878
285 Ga0068866_10028362 3300005718 Bacteria 2667
286 Ga0068866_10039065 3300005718 Unclassified 2342
287 Ga0068866_10160996 3300005718 Bacteria 1309
288 Ga0068866_10731106 3300005718 Bacteria 682
289 Ga0068861_100023735 3300005719 Bacteria 4428
290 Ga0068861_100038017 3300005719 Bacteria 3580
291 Ga0068861_100204237 3300005719 Bacteria 1660
292 Ga0068861_100410940 3300005719 Bacteria 1203
293 Ga0068861_100743154 3300005719 Bacteria 916
294 Ga0068861_100842988 3300005719 Bacteria 863
295 Ga0068861_101302462 3300005719 Bacteria 706
296 Ga0068861_101750132 3300005719 Bacteria 616
297 Ga0068861_101831395 3300005719 Bacteria 602
298 Ga0068851_10324873 3300005834 Unclassified 890
299 Ga0068870_10397874 3300005840 Unclassified 896
300 Ga0068863_100040460 3300005841 Bacteria 4432
301 Ga0068863_100227413 3300005841 Unclassified 1799
302 Ga0068863_100343678 3300005841 Bacteria 1452
303 Ga0068863_100616346 3300005841 Unclassified 1075
304 Ga0068858_100006376 3300005842 Bacteria 11491
305 Ga0068858_100008903 3300005842 Bacteria 9623
306 Ga0068858_100097573 3300005842 Bacteria 2739
307 Ga0068858_100159796 3300005842 Bacteria 2122
308 Ga0068858_100392959 3300005842 Bacteria 1332
309 Ga0068858_100482562 3300005842 Bacteria 1196
310 Ga0068858_100728342 3300005842 Bacteria 966
311 Ga0068858_101318240 3300005842 Bacteria 711
312 Ga0068860_100137960 3300005843 Bacteria 2343
313 Ga0068860_100351429 3300005843 Unclassified 1451
314 Ga0068860_100440932 3300005843 Bacteria 1293
315 Ga0068860_100764109 3300005843 Bacteria 979
316 Ga0068860_101159720 3300005843 Bacteria 793
317 Ga0068860_101219834 3300005843 Bacteria 773
318 Ga0068860_101751843 3300005843 Bacteria 643
319 Ga0068862_100007706 3300005844 Bacteria 8906
320 Ga0068862_100023168 3300005844 Bacteria 5199
321 Ga0068862_100050972 3300005844 Bacteria 3539
322 Ga0068862_100135111 3300005844 Bacteria 2185
323 Ga0068862_100167788 3300005844 Bacteria 1963
324 Ga0068862_100415906 3300005844 Bacteria 1260
325 Ga0068862_100599307 3300005844 Bacteria 1057
326 Ga0068862_100963408 3300005844 Bacteria 842
327 Ga0068862_101190193 3300005844 Bacteria 760
328 Ga0068862_101281063 3300005844 Bacteria 734
329 Ga0081455_10337282 3300005937 Bacteria 1068
330 Ga0081539_10006423 3300005985 Bacteria 11288
331 Ga0081539_10059806 3300005985 Bacteria 2095
332 Ga0081539_10100662 3300005985 Unclassified 1474
333 Ga0070716_100041497 3300006173 Bacteria 2564
334 Ga0070716_100093604 3300006173 Bacteria 1825
335 Ga0070716_101371777 3300006173 Bacteria 574
336 Ga0070712_100096486 3300006175 Unclassified 2177
337 Ga0070712_100273531 3300006175 Bacteria 1358
338 Ga0097621_100000491 3300006237 Bacteria 27694
339 Ga0097621_100003090 3300006237 Bacteria 11416
340 Ga0097621_100020345 3300006237 Bacteria 5113
341 Ga0097621_100201459 3300006237 Bacteria 1728
342 Ga0097621_100276077 3300006237 Bacteria 1478
343 Ga0097621_101280509 3300006237 Archaea 692
344 Ga0068871_100001107 3300006358 Bacteria 18079
345 Ga0068871_100010512 3300006358 Bacteria 6759
346 Ga0068871_100089251 3300006358 Bacteria 2566
347 Ga0068871_100242880 3300006358 Unclassified 1566
348 Ga0068871_100291792 3300006358 Bacteria 1429
349 Ga0068871_100400444 3300006358 Bacteria 1222
350 Ga0068871_100538957 3300006358 Bacteria 1056
351 Ga0075428_100003764 3300006844 Bacteria 16622
352 Ga0075428_100008503 3300006844 Bacteria 11385
353 Ga0075428_100029789 3300006844 Bacteria 6038
354 Ga0075428_100070369 3300006844 Bacteria 3825
355 Ga0075428_100081829 3300006844 Bacteria 3523
356 Ga0075428_100117167 3300006844 Bacteria 2901
357 Ga0075428_100698484 3300006844 Unclassified 1081
358 Ga0075428_100926372 3300006844 Unclassified 924
359 Ga0075428_101725272 3300006844 Bacteria 653
360 Ga0075430_100002827 3300006846 Bacteria 14521
361 Ga0075430_100009055 3300006846 Bacteria 8414
362 Ga0075430_100025724 3300006846 Bacteria 5008
363 Ga0075430_100168996 3300006846 Bacteria 1819
364 Ga0075430_100423544 3300006846 Unclassified 1099
365 Ga0075430_100535947 3300006846 Bacteria 965
366 Ga0075430_101643218 3300006846 Bacteria 527
367 Ga0075431_100002521 3300006847 Bacteria 17661
368 Ga0075431_100043740 3300006847 Bacteria 4620
369 Ga0075431_100203614 3300006847 Bacteria 2024
370 Ga0075431_100390085 3300006847 Bacteria 1395
371 Ga0075431_100399090 3300006847 Unclassified 1376
372 Ga0075431_101340746 3300006847 Bacteria 676
373 Ga0075433_10000719 3300006852 Bacteria 22669
374 Ga0075433_10003035 3300006852 Bacteria 12898
375 Ga0075433_10046914 3300006852 Bacteria 3758
376 Ga0075433_10344894 3300006852 Bacteria 1316
377 Ga0075433_11372447 3300006852 Unclassified 612
378 Ga0075434_100009384 3300006871 Bacteria 9118
379 Ga0075434_100011803 3300006871 Bacteria 8253
380 Ga0075434_100014191 3300006871 Bacteria 7611
381 Ga0075434_100019206 3300006871 Bacteria 6612
382 Ga0075434_100042252 3300006871 Bacteria 4519
383 Ga0075434_100091844 3300006871 Bacteria 3038
384 Ga0075434_100101935 3300006871 Bacteria 2878
385 Ga0075434_100485330 3300006871 Bacteria 1257
386 Ga0075434_100588711 3300006871 Bacteria 1132
387 Ga0075434_101053817 3300006871 Bacteria 827
388 Ga0075429_100003842 3300006880 Bacteria 12830
389 Ga0075429_100005497 3300006880 Bacteria 10909
390 Ga0075429_100184095 3300006880 Bacteria 1830
391 Ga0075429_100493860 3300006880 Bacteria 1072
392 Ga0075429_100680130 3300006880 Bacteria 902
393 Ga0075429_101696492 3300006880 Bacteria 549
394 Ga0068865_100022104 3300006881 Bacteria 4143
395 Ga0068865_100033189 3300006881 Bacteria 3454
396 Ga0068865_100294951 3300006881 Unclassified 1296
397 Ga0068865_100383542 3300006881 Bacteria 1147
398 Ga0075436_100014387 3300006914 Bacteria 5416
399 Ga0075436_100017806 3300006914 Bacteria 4865
400 Ga0075436_100081102 3300006914 Archaea 2249
401 Ga0075436_100085555 3300006914 Bacteria 2189
402 Ga0075436_100261237 3300006914 Unclassified 1235
403 Ga0097620_100002669 3300006931 Bacteria 18110
404 Ga0097620_100128263 3300006931 Bacteria 2607
405 Ga0097620_100160182 3300006931 Bacteria 2329
406 Ga0097620_100307833 3300006931 Bacteria 1678
407 Ga0097620_100420494 3300006931 Bacteria 1433
408 Ga0097620_100982294 3300006931 Unclassified 927
409 Ga0097620_101774014 3300006931 Unclassified 682
410 Ga0075435_100007120 3300007076 Bacteria 7944
411 Ga0075435_100024515 3300007076 Bacteria 4684
412 Ga0075435_100025018 3300007076 Bacteria 4642
413 Ga0075435_100035427 3300007076 Bacteria 3961
414 Ga0075435_100060351 3300007076 Bacteria 3075
415 Ga0075435_100420801 3300007076 Bacteria 1150
416 Ga0099794_10064534 3300007265 Bacteria 1784
417 Ga0105240_10011543 3300009093 Bacteria 12296
418 Ga0105240_10130144 3300009093 Bacteria 3020
419 Ga0111539_10001096 3300009094 Bacteria 35773
420 Ga0111539_10001535 3300009094 Bacteria 30735
421 Ga0111539_10002877 3300009094 Bacteria 22849
422 Ga0111539_10004585 3300009094 Bacteria 18059
423 Ga0111539_10007218 3300009094 Bacteria 14240
424 Ga0111539_10021062 3300009094 Bacteria 8030
425 Ga0111539_10021248 3300009094 Bacteria 7992
426 Ga0111539_10040375 3300009094 Bacteria 5618
427 Ga0111539_10223930 3300009094 Bacteria 2191
428 Ga0111539_10464300 3300009094 Bacteria 1474
429 Ga0111539_10635646 3300009094 Bacteria 1243
430 Ga0111539_11087557 3300009094 Bacteria 929
431 Ga0111539_11087991 3300009094 Bacteria 929
432 Ga0111539_11236344 3300009094 Bacteria 867
433 Ga0111539_11252228 3300009094 Unclassified 861
434 Ga0105245_10408947 3300009098 Bacteria 1358
435 Ga0105245_10513788 3300009098 Bacteria 1215
436 Ga0105245_11813368 3300009098 Bacteria 663
437 Ga0105247_10003746 3300009101 Bacteria 9860
438 Ga0105247_11147469 3300009101 Bacteria 616
439 Ga0105247_11323955 3300009101 Unclassified 579
440 Ga0114129_10003005 3300009147 Bacteria 23633
441 Ga0114129_10009590 3300009147 Bacteria 13809
442 Ga0114129_10034096 3300009147 Bacteria 7191
443 Ga0114129_10044082 3300009147 Bacteria 6275
444 Ga0114129_10196868 3300009147 Unclassified 2732
445 Ga0114129_10255349 3300009147 Bacteria 2352
446 Ga0114129_10341284 3300009147 Bacteria 1987
447 Ga0114129_10373398 3300009147 Bacteria 1884
448 Ga0114129_10633000 3300009147 Unclassified 1382
449 Ga0114129_10765889 3300009147 Unclassified 1234
450 Ga0114129_10876055 3300009147 Bacteria 1139
451 Ga0114129_11368504 3300009147 Unclassified 875
452 Ga0114129_11563707 3300009147 Bacteria 808
453 Ga0105243_10005747 3300009148 Bacteria 9634
454 Ga0105243_10521592 3300009148 Unclassified 1130
455 Ga0105243_10632245 3300009148 Bacteria 1035
456 Ga0105243_10768920 3300009148 Bacteria 946
457 Ga0105241_10016789 3300009174 Bacteria 5373
458 Ga0105241_10854544 3300009174 Bacteria 842
459 Ga0105241_11263399 3300009174 Unclassified 702
460 Ga0105242_10014745 3300009176 Bacteria 6053
461 Ga0105242_10049063 3300009176 Bacteria 3434
462 Ga0105242_10178766 3300009176 Bacteria 1871
463 Ga0105242_11163647 3300009176 Bacteria 789
464 Ga0105242_12412189 3300009176 Bacteria 573
465 Ga0105248_10025874 3300009177 Bacteria 6528
466 Ga0105248_10051241 3300009177 Bacteria 4632
467 Ga0105248_10058517 3300009177 Bacteria 4328
468 Ga0105248_10065729 3300009177 Bacteria 4072
469 Ga0105248_10662131 3300009177 Bacteria 1178
470 Ga0105248_11382836 3300009177 Bacteria 796
471 Ga0105248_11562907 3300009177 Unclassified 747
472 Ga0105248_11688599 3300009177 Bacteria 718
473 Ga0105237_11681099 3300009545 Unclassified 642
474 Ga0105238_10012691 3300009551 Bacteria 8503
475 Ga0105238_10724325 3300009551 Bacteria 1007
476 Ga0105249_10056160 3300009553 Bacteria 3604
477 Ga0105249_10064382 3300009553 Unclassified 3370
478 Ga0105249_10234697 3300009553 Bacteria 1810
479 Ga0105249_10655349 3300009553 Unclassified 1108
480 Ga0105249_10950119 3300009553 Bacteria 927
481 Ga0105249_11615739 3300009553 Unclassified 721
482 Ga0105249_11674273 3300009553 Unclassified 709
483 Ga0105249_12884872 3300009553 Bacteria 552
484 Ga0105249_12992665 3300009553 Bacteria 543
485 Ga0105239_11456264 3300010375 Bacteria 791
486 Ga0105246_10360153 3300011119 Bacteria 1195
487 Ga0105246_10424975 3300011119 Bacteria 1110
488 Ga0157315_1020076 3300012508 Unclassified 698
489 Ga0157370_10403321 3300013104 Unclassified 1258
490 Ga0157369_11541658 3300013105 Unclassified 676
491 Ga0157374_10275837 3300013296 Bacteria 1659
492 Ga0157374_10367168 3300013296 Bacteria 1432
493 Ga0157378_12002953 3300013297 Bacteria 629
494 Ga0163162_10034885 3300013306 Bacteria 5008
495 Ga0163162_10173920 3300013306 Bacteria 2278
496 Ga0163162_10869929 3300013306 Bacteria 1016
497 Ga0163162_11148816 3300013306 Bacteria 881
498 Ga0157372_10190407 3300013307 Bacteria 2376
499 Ga0157375_10066455 3300013308 Bacteria 3600
500 Ga0157375_10070818 3300013308 Bacteria 3498
501 Ga0157375_10136534 3300013308 Bacteria 2577
502 Ga0157375_10500098 3300013308 Unclassified 1380
503 Ga0157375_10740713 3300013308 Bacteria 1135
504 Ga0157375_11099477 3300013308 Bacteria 930
505 Ga0157375_11348247 3300013308 Unclassified 840
506 Ga0163163_10049669 3300014325 Bacteria 4128
507 Ga0163163_10213898 3300014325 Bacteria 1977
508 Ga0163163_10261905 3300014325 Bacteria 1780
509 Ga0163163_11444192 3300014325 Bacteria 749
510 Ga0157380_10007481 3300014326 Bacteria 7754
511 Ga0157380_10013472 3300014326 Bacteria 5962
512 Ga0157380_10086536 3300014326 Bacteria 2575
513 Ga0157380_10092262 3300014326 Bacteria 2502
514 Ga0157380_10095680 3300014326 Bacteria 2461
515 Ga0157380_10353092 3300014326 Bacteria 1377
516 Ga0157380_10605065 3300014326 Unclassified 1085
517 Ga0157380_10709760 3300014326 Bacteria 1012
518 Ga0157380_10763339 3300014326 Bacteria 980
519 Ga0157380_10777990 3300014326 Bacteria 972
520 Ga0157380_11430781 3300014326 Unclassified 742
521 Ga0157380_12140741 3300014326 Bacteria 623
522 Ga0157377_10011536 3300014745 Bacteria 4414
523 Ga0157377_10031760 3300014745 Bacteria 2872
524 Ga0157377_10220772 3300014745 Bacteria 1213
525 Ga0157377_10319348 3300014745 Bacteria 1031
526 Ga0157377_10328638 3300014745 Bacteria 1018
527 Ga0157377_10340699 3300014745 Unclassified 1002
528 Ga0157379_10005722 3300014968 Bacteria 10693
529 Ga0157379_10048906 3300014968 Bacteria 3775
530 Ga0157379_10067766 3300014968 Bacteria 3190
531 Ga0157379_10116343 3300014968 Bacteria 2404
532 Ga0157379_10500991 3300014968 Archaea 1126
533 Ga0157379_10971797 3300014968 Bacteria 808
534 Ga0157376_10140572 3300014969 Unclassified 2165
535 Ga0157376_10154267 3300014969 Bacteria 2074
536 Ga0157376_10693536 3300014969 Unclassified 1023
537 Ga0157376_12272039 3300014969 Bacteria 581
538 Ga0182005_1245895 3300015265 Bacteria 552
539 Ga0163161_10054592 3300017792 Unclassified 2899
540 Ga0163161_10558140 3300017792 Bacteria 939
541 Ga0207673_1004444 3300025290 Bacteria 1678
542 Ga0207697_10006229 3300025315 Bacteria 5424
543 Ga0207697_10014857 3300025315 Bacteria 3225
544 Ga0207697_10057159 3300025315 Unclassified 1619
545 Ga0207697_10062782 3300025315 Bacteria 1548
546 Ga0207697_10100761 3300025315 Bacteria 1231
547 Ga0207697_10110133 3300025315 Bacteria 1179
548 Ga0207653_10042479 3300025885 Bacteria 1496
549 Ga0207682_10025689 3300025893 Bacteria 2336
550 Ga0207682_10044666 3300025893 Bacteria 1817
551 Ga0207682_10084505 3300025893 Bacteria 1366
552 Ga0207682_10100194 3300025893 Unclassified 1266
553 Ga0207682_10586084 3300025893 Unclassified 526
554 Ga0207642_10015048 3300025899 Bacteria 2872
555 Ga0207642_10084503 3300025899 Bacteria 1550
556 Ga0207642_10193415 3300025899 Bacteria 1118
557 Ga0207642_10420664 3300025899 Unclassified 804
558 Ga0207710_10005377 3300025900 Bacteria 5525
559 Ga0207710_10012471 3300025900 Bacteria 3576
560 Ga0207688_10001167 3300025901 Bacteria 13553
561 Ga0207688_10197285 3300025901 Unclassified 1206
562 Ga0207688_10331306 3300025901 Unclassified 935
563 Ga0207688_10922933 3300025901 Bacteria 553
564 Ga0207680_10136487 3300025903 Bacteria 1622
565 Ga0207680_10200845 3300025903 Bacteria 1358
566 Ga0207680_10575620 3300025903 Bacteria 805
567 Ga0207645_10006799 3300025907 Bacteria 8164
568 Ga0207645_10011628 3300025907 Bacteria 6003
569 Ga0207645_10035884 3300025907 Unclassified 3183
570 Ga0207645_10147272 3300025907 Bacteria 1536
571 Ga0207645_10262055 3300025907 Bacteria 1145
572 Ga0207645_10270858 3300025907 Unclassified 1126
573 Ga0207643_10000421 3300025908 Bacteria 28011
574 Ga0207643_10003973 3300025908 Bacteria 7961
575 Ga0207643_10031908 3300025908 Bacteria 2939
576 Ga0207643_10062430 3300025908 Bacteria 2129
577 Ga0207643_10137132 3300025908 Bacteria 1459
578 Ga0207643_10225562 3300025908 Bacteria 1148
579 Ga0207643_10974830 3300025908 Bacteria 549
580 Ga0207705_10116108 3300025909 Bacteria 1982
581 Ga0207684_10086680 3300025910 Bacteria 2667
582 Ga0207684_10231337 3300025910 Bacteria 1595
583 Ga0207684_10355065 3300025910 Bacteria 1262
584 Ga0207684_10518406 3300025910 Bacteria 1021
585 Ga0207654_10018539 3300025911 Bacteria 3654
586 Ga0207654_10427680 3300025911 Bacteria 925
587 Ga0207654_10811664 3300025911 Unclassified 676
588 Ga0207707_10069371 3300025912 Bacteria 3072
589 Ga0207695_10035464 3300025913 Bacteria 5409
590 Ga0207695_10073089 3300025913 Bacteria 3495
591 Ga0207695_10385596 3300025913 Bacteria 1286
592 Ga0207693_10176989 3300025915 Bacteria 1678
593 Ga0207693_10199072 3300025915 Bacteria 1575
594 Ga0207660_10045755 3300025917 Bacteria 3084
595 Ga0207660_10402687 3300025917 Bacteria 1102
596 Ga0207662_10008088 3300025918 Bacteria 5743
597 Ga0207662_10085309 3300025918 Bacteria 1934
598 Ga0207662_10576440 3300025918 Bacteria 781
599 Ga0207662_10596891 3300025918 Bacteria 768
600 Ga0207657_10000448 3300025919 Bacteria 43812
601 Ga0207657_10622168 3300025919 Bacteria 842
602 Ga0207649_10034873 3300025920 Bacteria 3018
603 Ga0207649_10690565 3300025920 Unclassified 791
604 Ga0207649_10808486 3300025920 Unclassified 732
605 Ga0207649_10818863 3300025920 Bacteria 727
606 Ga0207649_11101091 3300025920 Bacteria 627
607 Ga0207652_10074593 3300025921 Bacteria 2954
608 Ga0207652_10147531 3300025921 Bacteria 2106
609 Ga0207646_10063922 3300025922 Bacteria 3285
610 Ga0207646_10402679 3300025922 Bacteria 1236
611 Ga0207681_10014493 3300025923 Bacteria 4900
612 Ga0207681_10014583 3300025923 Bacteria 4889
613 Ga0207681_10022470 3300025923 Bacteria 4023
614 Ga0207681_10027511 3300025923 Bacteria 3678
615 Ga0207681_10055231 3300025923 Bacteria 2704
616 Ga0207681_10187241 3300025923 Unclassified 1581
617 Ga0207681_10267567 3300025923 Bacteria 1340
618 Ga0207681_10526870 3300025923 Bacteria 970
619 Ga0207681_10574473 3300025923 Bacteria 929
620 Ga0207681_10883352 3300025923 Unclassified 748
621 Ga0207681_11226757 3300025923 Bacteria 630
622 Ga0207681_11234983 3300025923 Unclassified 628
623 Ga0207694_10075167 3300025924 Bacteria 2644
624 Ga0207694_11103807 3300025924 Bacteria 671
625 Ga0207650_10023131 3300025925 Unclassified 4406
626 Ga0207650_10110013 3300025925 Bacteria 2131
627 Ga0207650_10218521 3300025925 Unclassified 1533
628 Ga0207650_10535292 3300025925 Bacteria 981
629 Ga0207659_10014101 3300025926 Bacteria 5146
630 Ga0207659_10082191 3300025926 Bacteria 2384
631 Ga0207659_10107886 3300025926 Unclassified 2111
632 Ga0207659_10117411 3300025926 Bacteria 2033
633 Ga0207659_10249523 3300025926 Unclassified 1439
634 Ga0207659_10279966 3300025926 Bacteria 1363
635 Ga0207659_10299663 3300025926 Bacteria 1320
636 Ga0207687_10180945 3300025927 Bacteria 1633
637 Ga0207687_10727635 3300025927 Bacteria 843
638 Ga0207687_10850048 3300025927 Bacteria 780
639 Ga0207644_10890390 3300025931 Bacteria 746
640 Ga0207690_10073740 3300025932 Unclassified 2362
641 Ga0207706_10013947 3300025933 Bacteria 7287
642 Ga0207706_10016745 3300025933 Bacteria 6617
643 Ga0207706_10078833 3300025933 Unclassified 2897
644 Ga0207706_10094059 3300025933 Bacteria 2636
645 Ga0207686_10008837 3300025934 Bacteria 5447
646 Ga0207686_10019187 3300025934 Bacteria 3884
647 Ga0207709_10108784 3300025935 Unclassified 1849
648 Ga0207709_10148014 3300025935 Bacteria 1623
649 Ga0207709_10197562 3300025935 Bacteria 1434
650 Ga0207709_10736745 3300025935 Bacteria 791
651 Ga0207670_10093496 3300025936 Bacteria 2131
652 Ga0207670_10098961 3300025936 Unclassified 2079
653 Ga0207670_10167320 3300025936 Unclassified 1645
654 Ga0207670_10216198 3300025936 Bacteria 1464
655 Ga0207670_10270448 3300025936 Unclassified 1321
656 Ga0207670_10440253 3300025936 Bacteria 1049
657 Ga0207669_10004678 3300025937 Bacteria 6053
658 Ga0207669_10063861 3300025937 Unclassified 2275
659 Ga0207669_10075630 3300025937 Bacteria 2134
660 Ga0207669_10118812 3300025937 Bacteria 1790
661 Ga0207669_10163537 3300025937 Unclassified 1575
662 Ga0207669_10377140 3300025937 Unclassified 1104
663 Ga0207669_11131837 3300025937 Unclassified 661
664 Ga0207704_10001915 3300025938 Bacteria 9328
665 Ga0207704_10046592 3300025938 Bacteria 2585
666 Ga0207704_10052554 3300025938 Bacteria 2471
667 Ga0207704_10599289 3300025938 Bacteria 902
668 Ga0207704_10773359 3300025938 Bacteria 800
669 Ga0207665_10059331 3300025939 Bacteria 2589
670 Ga0207665_10123932 3300025939 Bacteria 1828
671 Ga0207691_10011048 3300025940 Bacteria 8665
672 Ga0207691_10037771 3300025940 Bacteria 4470
673 Ga0207691_10052143 3300025940 Bacteria 3737
674 Ga0207691_10058452 3300025940 Bacteria 3507
675 Ga0207691_10101756 3300025940 Bacteria 2563
676 Ga0207691_10192560 3300025940 Bacteria 1778
677 Ga0207691_10220937 3300025940 Bacteria 1643
678 Ga0207691_10232816 3300025940 Unclassified 1595
679 Ga0207691_10265102 3300025940 Unclassified 1480
680 Ga0207691_10920530 3300025940 Bacteria 731
681 Ga0207711_10026694 3300025941 Bacteria 4848
682 Ga0207711_10171150 3300025941 Bacteria 1971
683 Ga0207711_10212815 3300025941 Bacteria 1766
684 Ga0207711_10248831 3300025941 Bacteria 1632
685 Ga0207711_11329138 3300025941 Unclassified 661
686 Ga0207689_10009631 3300025942 Bacteria 8328
687 Ga0207689_10012411 3300025942 Bacteria 7285
688 Ga0207689_10032193 3300025942 Bacteria 4362
689 Ga0207689_10365702 3300025942 Bacteria 1200
690 Ga0207689_10426007 3300025942 Unclassified 1108
691 Ga0207661_10098762 3300025944 Bacteria 2447
692 Ga0207679_10007458 3300025945 Bacteria 6940
693 Ga0207679_10021997 3300025945 Bacteria 4335
694 Ga0207679_10106162 3300025945 Unclassified 2207
695 Ga0207679_10196205 3300025945 Unclassified 1683
696 Ga0207679_10306941 3300025945 Unclassified 1370
697 Ga0207679_10594375 3300025945 Unclassified 997
698 Ga0207679_10710492 3300025945 Unclassified 912
699 Ga0207667_10131023 3300025949 Bacteria 2583
700 Ga0207667_10519938 3300025949 Unclassified 1206
701 Ga0207667_11983907 3300025949 Unclassified 542
702 Ga0207651_10026837 3300025960 Bacteria 3606
703 Ga0207651_10045179 3300025960 Bacteria 2953
704 Ga0207651_10048143 3300025960 Bacteria 2880
705 Ga0207651_10196938 3300025960 Bacteria 1611
706 Ga0207651_10359114 3300025960 Bacteria 1229
707 Ga0207651_10566373 3300025960 Bacteria 989
708 Ga0207712_10727976 3300025961 Bacteria 868
709 Ga0207712_11686813 3300025961 Bacteria 568
710 Ga0207712_11863022 3300025961 Bacteria 539
711 Ga0207668_10039855 3300025972 Bacteria 3166
712 Ga0207668_10123390 3300025972 Bacteria 1965
713 Ga0207668_10177611 3300025972 Bacteria 1676
714 Ga0207668_10179344 3300025972 Unclassified 1669
715 Ga0207668_10372496 3300025972 Bacteria 1200
716 Ga0207668_10669683 3300025972 Bacteria 910
717 Ga0207640_10009623 3300025981 Bacteria 5419
718 Ga0207640_10485473 3300025981 Unclassified 1026
719 Ga0207640_10536156 3300025981 Bacteria 981
720 Ga0207640_10880173 3300025981 Bacteria 781
721 Ga0207640_11902215 3300025981 Bacteria 538
722 Ga0207658_10520492 3300025986 Unclassified 1061
723 Ga0207658_10554222 3300025986 Bacteria 1029
724 Ga0207658_10714620 3300025986 Unclassified 906
725 Ga0207658_10824651 3300025986 Archaea 843
726 Ga0207658_11066660 3300025986 Unclassified 738
727 Ga0207677_10118776 3300026023 Bacteria 1984
728 Ga0207677_11499156 3300026023 Unclassified 623
729 Ga0207703_10085378 3300026035 Bacteria 2641
730 Ga0207703_10157010 3300026035 Bacteria 1989
731 Ga0207703_10419059 3300026035 Bacteria 1245
732 Ga0207703_10788649 3300026035 Bacteria 907
733 Ga0207703_10813619 3300026035 Bacteria 892
734 Ga0207639_10161244 3300026041 Bacteria 1890
735 Ga0207639_11013193 3300026041 Unclassified 778
736 Ga0207678_10073614 3300026067 Bacteria 2928
737 Ga0207678_10089975 3300026067 Bacteria 2623
738 Ga0207678_10441441 3300026067 Unclassified 1130
739 Ga0207678_10496826 3300026067 Unclassified 1063
740 Ga0207708_10004076 3300026075 Bacteria 10744
741 Ga0207708_10013130 3300026075 Bacteria 6182
742 Ga0207708_10039098 3300026075 Bacteria 3614
743 Ga0207708_10066324 3300026075 Bacteria 2760
744 Ga0207708_10179488 3300026075 Bacteria 1681
745 Ga0207708_10186032 3300026075 Unclassified 1651
746 Ga0207708_10705813 3300026075 Bacteria 863
747 Ga0207708_11408974 3300026075 Unclassified 612
748 Ga0207641_10142894 3300026088 Bacteria 2161
749 Ga0207641_10437360 3300026088 Bacteria 1262
750 Ga0207641_10546006 3300026088 Unclassified 1130
751 Ga0207648_10000802 3300026089 Bacteria 35458
752 Ga0207648_10017964 3300026089 Bacteria 6414
753 Ga0207648_10073765 3300026089 Bacteria 2974
754 Ga0207648_10142645 3300026089 Unclassified 2112
755 Ga0207648_10160602 3300026089 Bacteria 1985
756 Ga0207648_10307167 3300026089 Bacteria 1423
757 Ga0207648_10351353 3300026089 Bacteria 1329
758 Ga0207648_10503879 3300026089 Bacteria 1108
759 Ga0207648_10624495 3300026089 Unclassified 995
760 Ga0207648_10742489 3300026089 Bacteria 911
761 Ga0207648_10833728 3300026089 Bacteria 859
762 Ga0207648_10931739 3300026089 Unclassified 812
763 Ga0207676_10097975 3300026095 Bacteria 2423
764 Ga0207676_10172785 3300026095 Bacteria 1884
765 Ga0207676_10181467 3300026095 Bacteria 1843
766 Ga0207676_10782536 3300026095 Unclassified 930
767 Ga0207676_10849720 3300026095 Bacteria 893
768 Ga0207674_10076334 3300026116 Bacteria 3359
769 Ga0207674_10172945 3300026116 Unclassified 2113
770 Ga0207674_11073421 3300026116 Bacteria 774
771 Ga0207674_12099102 3300026116 Bacteria 529
772 Ga0207675_100003438 3300026118 Bacteria 15481
773 Ga0207675_100008037 3300026118 Bacteria 9940
774 Ga0207675_100026637 3300026118 Bacteria 5382
775 Ga0207675_100030876 3300026118 Bacteria 4990
776 Ga0207675_100039233 3300026118 Bacteria 4420
777 Ga0207675_100082000 3300026118 Bacteria 3024
778 Ga0207675_100295147 3300026118 Bacteria 1577
779 Ga0207675_100297167 3300026118 Bacteria 1572
780 Ga0207675_100308482 3300026118 Unclassified 1543
781 Ga0207675_100453834 3300026118 Bacteria 1270
782 Ga0207675_101009548 3300026118 Bacteria 850
783 Ga0207683_10042430 3300026121 Bacteria 3973
784 Ga0207683_10051914 3300026121 Unclassified 3593
785 Ga0207683_10153964 3300026121 Unclassified 2076
786 Ga0207683_10532556 3300026121 Unclassified 1086
787 Ga0207698_10088151 3300026142 Unclassified 2530
788 Ga0209971_1078061 3300027682 Bacteria 805
789 Ga0209998_10055051 3300027717 Bacteria 928
790 Ga0209974_10059230 3300027876 Archaea 1295
791 Ga0209974_10062413 3300027876 Bacteria 1262
792 Ga0207428_10000515 3300027907 Bacteria 46261
793 Ga0207428_10002311 3300027907 Bacteria 19090
794 Ga0207428_10006882 3300027907 Bacteria 10421
795 Ga0207428_10008383 3300027907 Bacteria 9335
796 Ga0207428_10058793 3300027907 Bacteria 3050
797 Ga0207428_10327876 3300027907 Bacteria 1129
798 Ga0207428_10752096 3300027907 Bacteria 695
799 Ga0207428_10942401 3300027907 Bacteria 609
800 Ga0268266_10054105 3300028379 Bacteria 3449
801 Ga0268266_10400147 3300028379 Bacteria 1298
802 Ga0268266_10797775 3300028379 Bacteria 912
803 Ga0268265_10004006 3300028380 Bacteria 10369
804 Ga0268265_10030648 3300028380 Bacteria 3876
805 Ga0268265_10154862 3300028380 Bacteria 1938
806 Ga0268265_10188184 3300028380 Unclassified 1780
807 Ga0268265_10195042 3300028380 Bacteria 1752
808 Ga0268265_10234290 3300028380 Bacteria 1616
809 Ga0268265_10258420 3300028380 Bacteria 1547
810 Ga0268265_10352745 3300028380 Bacteria 1344
811 Ga0268265_10389729 3300028380 Bacteria 1284
812 Ga0268265_10664087 3300028380 Unclassified 1003
813 Ga0268265_10749026 3300028380 Bacteria 948
814 Ga0268265_11165060 3300028380 Bacteria 767
815 Ga0268264_10128495 3300028381 Bacteria 2243
816 Ga0268264_10142874 3300028381 Unclassified 2136
817 Ga0268264_10168656 3300028381 Bacteria 1978
818 Ga0268264_10775511 3300028381 Bacteria 956
819 Ga0268264_11184763 3300028381 Bacteria 773
820 Ga0268264_11202200 3300028381 Bacteria 767
821 Ga0268264_11987719 3300028381 Bacteria 591
822 Ga0268264_12128022 3300028381 Bacteria 569
823 Ga0265316_10282318 3300031344 Bacteria 1213
824 Ga0307408_100086674 3300031548 Bacteria 2354
825 Ga0307408_100460014 3300031548 Bacteria 1106
826 Ga0307408_100634881 3300031548 Unclassified 953
827 Ga0265314_10120161 3300031711 Bacteria 1655
828 Ga0307405_10004821 3300031731 Bacteria 6435
829 Ga0307405_10551294 3300031731 Unclassified 933
830 Ga0307413_10126311 3300031824 Bacteria 1742
831 Ga0307413_11005855 3300031824 Unclassified 715
832 Ga0307410_10008571 3300031852 Bacteria 5678
833 Ga0307410_10907490 3300031852 Unclassified 755
834 Ga0307406_10068985 3300031901 Bacteria 2310
835 Ga0307407_10003751 3300031903 Bacteria 6311
836 Ga0307407_10253003 3300031903 Unclassified 1208
837 Ga0307407_10266700 3300031903 Bacteria 1180
838 Ga0307412_10027611 3300031911 Bacteria 3541
839 Ga0307412_10574164 3300031911 Bacteria 951
840 Ga0307412_11397689 3300031911 Unclassified 633
841 Ga0307412_11605491 3300031911 Bacteria 594
842 Ga0307409_100062413 3300031995 Bacteria 2917
843 Ga0307409_101109911 3300031995 Unclassified 812
844 Ga0307416_100097463 3300032002 Unclassified 2546
845 Ga0307416_101080945 3300032002 Unclassified 906
846 Ga0307411_10015044 3300032005 Bacteria 4329
847 Ga0307411_10127862 3300032005 Bacteria 1851
848 Ga0307411_10445419 3300032005 Bacteria 1082
849 Ga0307411_10819585 3300032005 Bacteria 821
850 Ga0307411_11917682 3300032005 Bacteria 552
851 Ga0307415_100024282 3300032126 Bacteria 3781
852 Ga0373948_0006326 3300034817 Bacteria 1953
853 Ga0373938_0152264 3300034957 Bacteria 616
854 Ga0373928_0007511 3300035084 Bacteria 2104
855 Ga0373940_0271815 3300035088 Bacteria 576
856 Ga0373944_0149309 3300035089 Unclassified 823
857 Ga0373949_0002163 3300035090 Bacteria 5149
858 Ga0373951_0007755 3300035091 Bacteria 2436
859 Ga0373952_0003771 3300035092 Bacteria 2740
860 Ga0373932_0006339 3300035112 Bacteria 2796
861 Ga0373932_0111103 3300035112 Bacteria 903
862 Ga0373932_0167821 3300035112 Bacteria 763
863 Ga0373939_0015830 3300035114 Bacteria 1979
864 Ga0373941_0000343 3300035115 Bacteria 9134
865 Ga0373941_0266422 3300035115 Bacteria 673
866 Ga0373954_0046367 3300035118 Bacteria 2032
867 Ga0373956_0223500 3300035119 Bacteria 894
868 Ga0373960_0001256 3300035121 Bacteria 5572
869 Ga0373960_0025199 3300035121 Bacteria 1615
870 Ga0373943_0124050 3300035170 Bacteria 1375
871 Ga0373946_0069755 3300035171 Bacteria 1515
872 Ga0373955_0463325 3300035172 Bacteria 773
873 Ga0373955_0665361 3300035172 Bacteria 639
874 Ga0373961_0022626 3300035241 Bacteria 1683
875 Ga0373961_0062944 3300035241 Bacteria 1130
876 Ga0373962_0001870 3300035242 Bacteria 5016
877 Ga0373931_0001339 3300035691 Bacteria 10529
878 Ga0373931_0082457 3300035691 Bacteria 1778
879 Ga0373931_0120135 3300035691 Bacteria 1501
880 Ga0373937_0159180 3300036401 Bacteria 2117
881 Ga0373925_0241361 3300037068 Bacteria 1447
882 Ga0373925_0496367 3300037068 Bacteria 1002
883 Ga0439453_0022459 3300041408 Unclassified 1144
884 Ga0451800_1621613 3300041459 Bacteria 589
885 Ga0439433_0027879 3300041999 Archaea 1283
886 Ga0439454_100652 3300042011 Unclassified 543
887 Ga0439462_0199881 3300042015 Archaea 569
888 Ga0450914_046764 3300042118 Unclassified 561
889 Ga0439446_0042916 3300042156 Unclassified 1336
890 Ga0439446_0099084 3300042156 Bacteria 920
891 Ga0439434_0057687 3300042435 Bacteria 1211
892 Ga0439435_0092311 3300042436 Bacteria 921
893 Ga0439464_0093384 3300042439 Unclassified 909
894 Ga0439464_0122213 3300042439 Unclassified 802
895 Ga0450916_024858 3300042530 Bacteria 843
896 Ga0439440_0032645 3300042993 Bacteria 1237
897 Ga0439440_0104953 3300042993 Unclassified 772
898 Ga0451576_0010882 3300045051 Bacteria 10408
899 Ga0451576_0679933 3300045051 Unclassified 1081
900 Ga0495592_0322612 3300046454 Archaea 998
901 Ga0495603_0063471 3300046455 Bacteria 2179
902 Ga0495580_0073772 3300046472 Bacteria 2382
903 Ga0495582_0118102 3300046473 Bacteria 1493
904 Ga0495662_0505033 3300046476 Bacteria 593
905 Ga0495664_0695675 3300046477 Archaea 601
906 Ga0495594_0062966 3300046499 Archaea 2055
907 Ga0495583_0160906 3300046506 Unclassified 926
908 Ga0495630_0117208 3300046517 Bacteria 2019
909 Ga0495630_0177025 3300046517 Bacteria 1626
910 Ga0495663_0265200 3300046525 Bacteria 613
911 Ga0495666_0322956 3300046526 Archaea 697
912 Ga0495640_0054769 3300046533 Bacteria 2731
913 Ga0495586_0074839 3300046535 Bacteria 1854
914 Ga0495586_0569150 3300046535 Bacteria 654
915 Ga0495598_0179138 3300046537 Bacteria 755
916 Ga0495621_0054794 3300046539 Bacteria 1434
917 Ga0495621_0097697 3300046539 Unclassified 1114
918 Ga0495645_0011107 3300046543 Bacteria 6332
919 Ga0495633_0143241 3300046558 Bacteria 1105
920 Ga0495634_0423410 3300046642 Bacteria 788
921 Ga0495635_0197813 3300046663 Bacteria 1364
922 Ga0495635_0200578 3300046663 Bacteria 1353
923 Ga0495659_0488488 3300046664 Bacteria 539
924 Ga0495588_0254220 3300046674 Bacteria 926
925 Ga0495599_0366166 3300046678 Bacteria 862
926 Ga0495647_0058426 3300046681 Bacteria 1516
927 Ga0495647_0096855 3300046681 Bacteria 1217
928 Ga0495647_0115562 3300046681 Unclassified 1124
929 Ga0495647_0299780 3300046681 Bacteria 724
930 Ga0495658_0039106 3300046683 Bacteria 2630
931 Ga0495658_0058218 3300046683 Bacteria 2210
932 Ga0495669_0207481 3300046684 Unclassified 938
933 Ga0495636_0064540 3300047318 Unclassified 1554
934 Ga0495674_0106880 3300047319 Bacteria 2376
935 Ga0495674_0186479 3300047319 Bacteria 1726
936 Ga0495680_0126574 3300047322 Bacteria 1881
937 Ga0495680_0943251 3300047322 Bacteria 555
938 Ga0495684_0086028 3300047471 Bacteria 2383
939 Ga0495684_0160441 3300047471 Bacteria 1677
940 Ga0495602_0600681 3300048088 Bacteria 757
941 Ga0496101_1106349 3300048904 Bacteria 622
942 Ga0496102_0067969 3300048905 Bacteria 3269
943 Ga0496102_0091619 3300048905 Bacteria 2814
944 Ga0496102_1415078 3300048905 Unclassified 614
945 Ga0496103_0316398 3300048906 Bacteria 1004
946 Ga0496103_0750067 3300048906 Unclassified 617
947 Ga0496104_1590651 3300048907 Unclassified 556
948 Ga0496106_0485290 3300048909 Bacteria 993
949 Ga0496106_0776202 3300048909 Bacteria 761
950 Ga0496106_1183616 3300048909 Bacteria 597
951 Ga0496108_0025003 3300048911 Bacteria 4919
952 Ga0496109_0331752 3300048912 Bacteria 1436
953 Ga0496109_1098377 3300048912 Unclassified 732
954 Ga0496110_0171743 3300048913 Bacteria 1967
955 Ga0496110_0680971 3300048913 Bacteria 929
956 Ga0496112_0037423 3300048915 Bacteria 4737
957 Ga0496113_0177816 3300048916 Bacteria 1686
958 Ga0496113_0354640 3300048916 Bacteria 1177
959 Ga0496114_0041782 3300048917 Bacteria 3800
960 Ga0501298_030201 3300049521 Unclassified 1059
961 Ga0501033_0720816 3300049570 Unclassified 678
962 Ga0501036_0119187 3300049572 Bacteria 2229
963 Ga0501037_0372352 3300049573 Bacteria 983
964 Ga0501039_0056023 3300049575 Bacteria 3054
965 Ga0501039_0069299 3300049575 Bacteria 2739
966 Ga0501040_0018432 3300049576 Unclassified 4634
967 Ga0501040_0086204 3300049576 Bacteria 2180
968 Ga0501040_0964412 3300049576 Bacteria 618
969 Ga0501041_0064651 3300049577 Bacteria 2240
970 Ga0501041_0189559 3300049577 Bacteria 1288
971 Ga0501042_0025948 3300049578 Bacteria 4118
972 Ga0501042_0062804 3300049578 Bacteria 2654
973 Ga0501046_0001085 3300049580 Bacteria 26670
974 Ga0501048_0063991 3300049582 Bacteria 2601
975 Ga0501048_0088906 3300049582 Bacteria 2179
976 Ga0501067_0625052 3300049583 Bacteria 604
977 Ga0501071_0037006 3300049587 Bacteria 3482
978 Ga0501071_0156786 3300049587 Bacteria 1700
979 Ga0501071_0313238 3300049587 Unclassified 1191
980 Ga0501074_0658231 3300049590 Unclassified 740
981 Ga0501074_1172151 3300049590 Unclassified 539
982 Ga0501075_0003591 3300049591 Bacteria 10393
983 Ga0501075_0077467 3300049591 Bacteria 2516
984 Ga0501075_0276180 3300049591 Bacteria 1280
985 Ga0501075_0480718 3300049591 Bacteria 948
986 Ga0501075_0592558 3300049591 Unclassified 846
987 Ga0501076_0024232 3300049592 Bacteria 4688
988 Ga0501076_0461218 3300049592 Archaea 1046
989 Ga0501076_0854306 3300049592 Bacteria 751
990 Ga0501076_1162535 3300049592 Unclassified 635
991 Ga0501077_0015002 3300049593 Unclassified 4871
992 Ga0501077_0711413 3300049593 Unclassified 645
993 Ga0501249_010075 3300049679 Bacteria 1970
994 Ga0501079_0209458 3300049741 Bacteria 1523
995 Ga0501081_0030039 3300049743 Bacteria 3676
996 Ga0501081_0046932 3300049743 Bacteria 2970
997 Ga0501083_0218121 3300049744 Bacteria 1243
998 Ga0501083_0493680 3300049744 Bacteria 797
999 Ga0501044_1174262 3300049823 Unclassified 636
1000 Ga0501045_0056520 3300049824 Bacteria 2870
1001 nmdc:mga05p37_1035000_c1 3300050507 Bacteria 868
1002 nmdc:mga05p37_11228_c1 3300050507 Bacteria 10650
1003 nmdc:mga05p37_1363605_c1 3300050507 Bacteria 717
1004 nmdc:mga05p37_156059_c1 3300050507 Archaea 2789
1005 nmdc:mga05p37_174100_c1 3300050507 Unclassified 2623
1006 nmdc:mga05p37_299257_c1 3300050507 Bacteria 1912
1007 nmdc:mga05p37_32801_c1 3300050507 Bacteria 6354
1008 nmdc:mga05p37_386041_c1 3300050507 Bacteria 1639
1009 nmdc:mga05p37_406896_c1 3300050507 Unclassified 1587
1010 nmdc:mga05p37_43511_c1 3300050507 Bacteria 5525
1011 nmdc:mga05p37_47284_c1 3300050507 Bacteria 5292
1012 nmdc:mga05p37_81153_c2 3300050507 Bacteria 2482
1013 nmdc:mga05p37_822700_c1 3300050507 Unclassified 1013
1014 nmdc:mga09592_2456_c1 3300050508 Bacteria 14958
1015 nmdc:mga09592_290133_c1 3300050508 Bacteria 1418
1016 nmdc:mga09592_3877_c1 3300050508 Bacteria 12047
1017 nmdc:mga09592_514254_c1 3300050508 Bacteria 1030
1018 nmdc:mga09592_54046_c1 3300050508 Bacteria 3393
1019 nmdc:mga09592_76446_c1 3300050508 Bacteria 2847
1020 nmdc:mga0qj67_1191813_c1 3300050509 Bacteria 593
1021 nmdc:mga0qj67_15050_c1 3300050509 Bacteria 5853
1022 nmdc:mga0qj67_2494_c1 3300050509 Bacteria 13126
1023 nmdc:mga0qj67_49253_c1 3300050509 Bacteria 3330
1024 nmdc:mga0qj67_585652_c1 3300050509 Unclassified 893
1025 nmdc:mga06r32_263642_c1 3300050510 Bacteria 1711
1026 nmdc:mga06r32_31910_c1 3300050510 Bacteria 4951
1027 nmdc:mga06r32_337151_c1 3300050510 Bacteria 1493
1028 nmdc:mga06r32_41442_c1 3300050510 Bacteria 4375
1029 nmdc:mga06r32_6589_c1 3300050510 Bacteria 10431
1030 nmdc:mga08y16_1241992_c1 3300050511 Bacteria 714
1031 nmdc:mga08y16_1271719_c1 3300050511 Bacteria 704
1032 nmdc:mga08y16_168554_c1 3300050511 Bacteria 2275
1033 nmdc:mga08y16_19092_c1 3300050511 Bacteria 7223
1034 nmdc:mga08y16_3326_c2 3300050511 Bacteria 5737
1035 nmdc:mga08y16_37298_c1 3300050511 Bacteria 5105
1036 nmdc:mga08y16_43724_c1 3300050511 Bacteria 4695
1037 nmdc:mga08y16_48345_c1 3300050511 Bacteria 4452
1038 nmdc:mga08y16_526993_c1 3300050511 Unclassified 1198
1039 nmdc:mga08y16_5474_c1 3300050511 Bacteria 13280
1040 nmdc:mga08y16_683_c1 3300050511 Bacteria 32086
1041 nmdc:mga08y16_79251_c1 3300050511 Bacteria 3424
1042 nmdc:mga08y16_800102_c1 3300050511 Bacteria 936
1043 nmdc:mga08y16_976_c1 3300050511 Bacteria 27870
1044 nmdc:mga0n895_1176576_c1 3300050512 Unclassified 741
1045 nmdc:mga0n895_16886_c1 3300050512 Bacteria 6711
1046 nmdc:mga0n895_184334_c1 3300050512 Bacteria 2119
1047 nmdc:mga0n895_357886_c1 3300050512 Bacteria 1478
1048 nmdc:mga0n895_42983_c1 3300050512 Bacteria 4400
1049 nmdc:mga0n895_454300_c1 3300050512 Bacteria 1293
1050 nmdc:mga0n895_632267_c1 3300050512 Bacteria 1070
1051 nmdc:mga0n895_71935_c1 3300050512 Bacteria 3430
1052 nmdc:mga0n895_77894_c1 3300050512 Unclassified 3298
1053 nmdc:mga0n895_8913_c1 3300050512 Bacteria 8740
1054 nmdc:mga0rr50_10783_c1 3300050513 Bacteria 5824
1055 nmdc:mga0rr50_118939_c1 3300050513 Bacteria 2100
1056 nmdc:mga0rr50_1258634_c1 3300050513 Unclassified 628
1057 nmdc:mga0rr50_270267_c1 3300050513 Bacteria 1417
1058 nmdc:mga0rr50_321957_c1 3300050513 Bacteria 1296
1059 nmdc:mga0rr50_373910_c1 3300050513 Bacteria 1201
1060 nmdc:mga0rr50_49091_c1 3300050513 Bacteria 3123
1061 nmdc:mga0rr50_690846_c1 3300050513 Bacteria 871
1062 nmdc:mga08x19_1161462_c1 3300050514 Unclassified 548
1063 nmdc:mga08x19_150702_c1 3300050514 Bacteria 1575
1064 nmdc:mga08x19_245572_c1 3300050514 Unclassified 1235
1065 nmdc:mga08x19_422416_c1 3300050514 Bacteria 936
1066 nmdc:mga08x19_8172_c1 3300050514 Bacteria 6218
1067 nmdc:mga08x19_88202_c1 3300050514 Bacteria 2045
1068 nmdc:mga0a205_1005171_c1 3300050515 Bacteria 681
1069 nmdc:mga0a205_11262_c1 3300050515 Bacteria 8232
1070 nmdc:mga0a205_154044_c1 3300050515 Bacteria 2197
1071 nmdc:mga0a205_200440_c1 3300050515 Unclassified 1886
1072 nmdc:mga0a205_5674_c1 3300050515 Bacteria 11245
1073 nmdc:mga0a205_818286_c1 3300050515 Unclassified 779
1074 nmdc:mga0a205_894_c1 3300050515 Bacteria 23641
1075 Ga0495601_0498053 3300053077 Archaea 786
1076 Ga0495619_0008562 3300053085 Bacteria 6474
1077 Ga0500566_0226009 3300053094 Bacteria 927
1078 Ga0501084_0004609 3300054114 Bacteria 11259
1079 Ga0501084_0073686 3300054114 Bacteria 2859
1080 Ga0590075_045219 3300059424 Unclassified 1128
1081 Ga0590077_091703 3300059426 Archaea 705
1082 Ga0501082_0014744 3300060353 Bacteria 6729
1083 Ga0530510_0032284 3300061734 Bacteria 3766
1084 Ga0530510_1262851 3300061734 Unclassified 566
1085 Ga0501036_0101941
1086 ARSoilOldRDRAFT_c005815
1087 JGI24746J21847_1000635
1088 JGI24751J29686_10024321
1089 JGI25406J46586_10037792
1090 rootH2_10206308
1091 Ga0058859_11634508
1092 Ga0058860_12130943
1093 Ga0065714_10021748
1094 Ga0065704_10014277
1095 Ga0065712_10000373
1096 Ga0065712_10008353
1097 Ga0065712_10080010
1098 Ga0065712_10086798
1099 Ga0065712_10119676
1100 Ga0065712_10251049
1101 Ga0065712_10369363
1102 Ga0065712_10636686
1103 Ga0065715_10089661
1104 Ga0065715_10094316
1105 Ga0065715_10137491
1106 Ga0065715_10283272
1107 Ga0065715_10639614
1108 Ga0065707_10107323
1109 Ga0065707_10107853
1110 Ga0065707_10195881
1111 Ga0065707_10342578
1112 Ga0065707_10524797
1113 Ga0065707_10847730
1114 Ga0070676_10115721
1115 Ga0070676_10169845
1116 Ga0070676_10277072
1117 Ga0070676_11239471
1118 Ga0070683_100085861
1119 Ga0070690_100047569
1120 Ga0070690_100071050
1121 Ga0070690_100085097
1122 Ga0070690_100194594
1123 Ga0070690_100243194
1124 Ga0070690_100647491
1125 Ga0070690_100655740
1126 Ga0070690_100803169
1127 Ga0070670_100068895
1128 Ga0070670_100073656
1129 Ga0070670_100190877
1130 Ga0070670_100387010
1131 Ga0070677_10004638
1132 Ga0070677_10071396
1133 Ga0070677_10105968
1134 Ga0070677_10213751
1135 Ga0070677_10407443
1136 Ga0068869_100005548
1137 Ga0068869_100008204
1138 Ga0068869_100096572
1139 Ga0068869_100358631
1140 Ga0070666_10039433
1141 Ga0070666_10332421
1142 Ga0070666_10575274
1143 Ga0070680_100307806
1144 Ga0070680_100906617
1145 Ga0070680_100982075
1146 Ga0070680_101036432
1147 Ga0070680_101818216
1148 Ga0070682_101458129
1149 Ga0068868_100188517
1150 Ga0068868_100390635
1151 Ga0068868_100630411
1152 Ga0068868_101039303
1153 Ga0068868_102197568
1154 Ga0070660_100082029
1155 Ga0070660_100154283
1156 Ga0070660_100361684
1157 Ga0070660_101052490
1158 Ga0070660_101324747
1159 Ga0070689_100092599
1160 Ga0070689_100211104
1161 Ga0070689_100357903
1162 Ga0070689_100368543
1163 Ga0070689_100453063
1164 Ga0070689_100723052
1165 Ga0070691_10271224
1166 Ga0070691_10330129
1167 Ga0070687_100003556
1168 Ga0070687_100008554
1169 Ga0070661_100027569
1170 Ga0070661_100276763
1171 Ga0070661_100414795
1172 Ga0070661_101115107
1173 Ga0070692_10070524
1174 Ga0070668_100100000
1175 Ga0070668_100148140
1176 Ga0070668_100177775
1177 Ga0070668_100252156
1178 Ga0070668_101486300
1179 Ga0070668_102072717
1180 Ga0070669_100004321
1181 Ga0070669_100005329
1182 Ga0070669_100042667
1183 Ga0070669_100097062
1184 Ga0070669_100146488
1185 Ga0070669_100192345
1186 Ga0070669_100202752
1187 Ga0070669_100304132
1188 Ga0070669_100897182
1189 Ga0070669_100917146
1190 Ga0070669_101147984
1191 Ga0070669_101373106
1192 Ga0070675_100011134
1193 Ga0070675_100015561
1194 Ga0070675_100075989
1195 Ga0070675_100104614
1196 Ga0070675_100141512
1197 Ga0070675_100245149
1198 Ga0070675_100259780
1199 Ga0070675_100281889
1200 Ga0070675_100854273
1201 Ga0070675_100999716
1202 Ga0070671_100242860
1203 Ga0070674_100001261
1204 Ga0070674_100003472
1205 Ga0070674_100021751
1206 Ga0070674_100047443
1207 Ga0070674_100110747
1208 Ga0070674_100647594
1209 Ga0070674_100843913
1210 Ga0070674_101630815
1211 Ga0070674_101822367
1212 Ga0070673_100006876
1213 Ga0070673_100179758
1214 Ga0070673_100241893
1215 Ga0070673_100348781
1216 Ga0070673_100373137
1217 Ga0070673_100425224
1218 Ga0070673_100863626
1219 Ga0070688_100048853
1220 Ga0070688_100069819
1221 Ga0070688_100071597
1222 Ga0070688_100073223
1223 Ga0070688_100108645
1224 Ga0070688_100162799
1225 Ga0070688_100325846
1226 Ga0070688_100353396
1227 Ga0070688_100356709
1228 Ga0070688_100796916
1229 Ga0070659_100355655
1230 Ga0070667_100028388
1231 Ga0070667_100091938
1232 Ga0070667_100329936
1233 Ga0070667_100430202
1234 Ga0070667_100560199
1235 Ga0070703_10367038
1236 Ga0070714_100017981
1237 Ga0070713_100406918
1238 Ga0070701_10006936
1239 Ga0070701_10015284
1240 Ga0070701_10040039
1241 Ga0070701_10045069
1242 Ga0070701_10120202
1243 Ga0070701_10345288
1244 Ga0070705_100057678
1245 Ga0070705_100653574
1246 Ga0070700_100002184
1247 Ga0070700_100007571
1248 Ga0070700_100015844
1249 Ga0070700_100040187
1250 Ga0070700_100047841
1251 Ga0070700_100048842
1252 Ga0070700_100060756
1253 Ga0070700_100106558
1254 Ga0070700_100519330
1255 Ga0070700_100827293
1256 Ga0070694_100373610
1257 Ga0070694_100482708
1258 Ga0070694_100822174
1259 Ga0070694_100909293
1260 Ga0070694_101102079
1261 Ga0070708_100211381
1262 Ga0070708_100303668
1263 Ga0070708_101977453
1264 Ga0070663_100120008
1265 Ga0070663_100129798
1266 Ga0070663_100579498
1267 Ga0070663_100680321
1268 Ga0070663_101891555
1269 Ga0070678_100028346
1270 Ga0070678_100561889
1271 Ga0070678_102356987
1272 Ga0070662_100028176
1273 Ga0070662_100148813
1274 Ga0070662_100180495
1275 Ga0070662_100268608
1276 Ga0070681_10014561
1277 Ga0068867_100003165
1278 Ga0068867_100082617
1279 Ga0068867_100102642
1280 Ga0068867_100210346
1281 Ga0068867_100410134
1282 Ga0068867_100650980
1283 Ga0068867_100867712
1284 Ga0068867_101540035
1285 Ga0070685_10068966
1286 Ga0070685_10085415
1287 Ga0070685_10221116
1288 Ga0070685_10363763
1289 Ga0070685_10815907
1290 Ga0070685_10842732
1291 Ga0070707_100035611
1292 Ga0070707_100609032
1293 Ga0070707_100916855
1294 Ga0070698_100129199
1295 Ga0070698_100493055
1296 Ga0070698_100601505
1297 Ga0070699_100002012
1298 Ga0070699_100705653
1299 Ga0070699_101091497
1300 Ga0070679_100040461
1301 Ga0070679_100049935
1302 Ga0070679_101868748
1303 Ga0070684_100187598
1304 Ga0070697_100170580
1305 Ga0070697_100327541
1306 Ga0068853_100196465
1307 Ga0070672_100043187
1308 Ga0070672_100063994
1309 Ga0070672_100084274
1310 Ga0070672_100199170
1311 Ga0070672_100784755
1312 Ga0070672_100790618
1313 Ga0070686_100031463
1314 Ga0070686_100057146
1315 Ga0070686_100085056
1316 Ga0070686_100130902
1317 Ga0070686_100220726
1318 Ga0070686_100705965
1319 Ga0070686_100737860
1320 Ga0070686_101056086
1321 Ga0070695_100002468
1322 Ga0070695_100016243
1323 Ga0070695_100022402
1324 Ga0070695_100337306
1325 Ga0070695_100961961
1326 Ga0070696_100016233
1327 Ga0070696_100036951
1328 Ga0070696_100160329
1329 Ga0070665_100322689
1330 Ga0070704_100009365
1331 Ga0070704_100119305
1332 Ga0070704_100222089
1333 Ga0070704_100255264
1334 Ga0070704_100287858
1335 Ga0070704_100526392
1336 Ga0070704_100654531
1337 Ga0070704_101049520
1338 Ga0068855_100020797
1339 Ga0070664_100024009
1340 Ga0070664_100118928
1341 Ga0070664_100134973
1342 Ga0070664_100152090
1343 Ga0070664_100269325
1344 Ga0068857_100102707
1345 Ga0068857_100120998
1346 Ga0068857_100510647
1347 Ga0068857_100558327
1348 Ga0068857_100978243
1349 Ga0068854_100022971
1350 Ga0068854_100054657
1351 Ga0068856_101662602
1352 Ga0070702_100148269
1353 Ga0070702_100431735
1354 Ga0070702_100434359
1355 Ga0068852_100166490
1356 Ga0068852_100761296
1357 Ga0068859_100002669
1358 Ga0068859_100128259
1359 Ga0068859_100160182
1360 Ga0068859_100307837
1361 Ga0068859_100420487
1362 Ga0068859_100982350
1363 Ga0068859_101774045
1364 Ga0068864_100040716
1365 Ga0068864_100167280
1366 Ga0068864_100320508
1367 Ga0068864_100804435
1368 Ga0068864_100892196
1369 Ga0068866_10028362
1370 Ga0068866_10039065
1371 Ga0068866_10160996
1372 Ga0068866_10731106
1373 Ga0068861_100023735
1374 Ga0068861_100038017
1375 Ga0068861_100204237
1376 Ga0068861_100410940
1377 Ga0068861_100743154
1378 Ga0068861_100842988
1379 Ga0068861_101302462
1380 Ga0068861_101750132
1381 Ga0068861_101831395
1382 Ga0068851_10324873
1383 Ga0068870_10397874
1384 Ga0068863_100040460
1385 Ga0068863_100227413
1386 Ga0068863_100343678
1387 Ga0068863_100616346
1388 Ga0068858_100006376
1389 Ga0068858_100008903
1390 Ga0068858_100097573
1391 Ga0068858_100159796
1392 Ga0068858_100392959
1393 Ga0068858_100482562
1394 Ga0068858_100728342
1395 Ga0068858_101318240
1396 Ga0068860_100137960
1397 Ga0068860_100351429
1398 Ga0068860_100440932
1399 Ga0068860_100764109
1400 Ga0068860_101159720
1401 Ga0068860_101219834
1402 Ga0068860_101751843
1403 Ga0068862_100007706
1404 Ga0068862_100023168
1405 Ga0068862_100050972
1406 Ga0068862_100135111
1407 Ga0068862_100167788
1408 Ga0068862_100415906
1409 Ga0068862_100599307
1410 Ga0068862_100963408
1411 Ga0068862_101190193
1412 Ga0068862_101281063
1413 Ga0081455_10337282
1414 Ga0081539_10006423
1415 Ga0081539_10059806
1416 Ga0081539_10100662
1417 Ga0070716_100041497
1418 Ga0070716_100093604
1419 Ga0070716_101371777
1420 Ga0070712_100096486
1421 Ga0070712_100273531
1422 Ga0097621_100000491
1423 Ga0097621_100003090
1424 Ga0097621_100020345
1425 Ga0097621_100201459
1426 Ga0097621_100276077
1427 Ga0097621_101280509
1428 Ga0068871_100001107
1429 Ga0068871_100010512
1430 Ga0068871_100089251
1431 Ga0068871_100242880
1432 Ga0068871_100291792
1433 Ga0068871_100400444
1434 Ga0068871_100538957
1435 Ga0075428_100003764
1436 Ga0075428_100008503
1437 Ga0075428_100029789
1438 Ga0075428_100070369
1439 Ga0075428_100081829
1440 Ga0075428_100117167
1441 Ga0075428_100698484
1442 Ga0075428_100926372
1443 Ga0075428_101725272
1444 Ga0075430_100002827
1445 Ga0075430_100009055
1446 Ga0075430_100025724
1447 Ga0075430_100168996
1448 Ga0075430_100423544
1449 Ga0075430_100535947
1450 Ga0075430_101643218
1451 Ga0075431_100002521
1452 Ga0075431_100043740
1453 Ga0075431_100203614
1454 Ga0075431_100390085
1455 Ga0075431_100399090
1456 Ga0075431_101340746
1457 Ga0075433_10000719
1458 Ga0075433_10003035
1459 Ga0075433_10046914
1460 Ga0075433_10344894
1461 Ga0075433_11372447
1462 Ga0075434_100009384
1463 Ga0075434_100011803
1464 Ga0075434_100014191
1465 Ga0075434_100019206
1466 Ga0075434_100042252
1467 Ga0075434_100091844
1468 Ga0075434_100101935
1469 Ga0075434_100485330
1470 Ga0075434_100588711
1471 Ga0075434_101053817
1472 Ga0075429_100003842
1473 Ga0075429_100005497
1474 Ga0075429_100184095
1475 Ga0075429_100493860
1476 Ga0075429_100680130
1477 Ga0075429_101696492
1478 Ga0068865_100022104
1479 Ga0068865_100033189
1480 Ga0068865_100294951
1481 Ga0068865_100383542
1482 Ga0075436_100014387
1483 Ga0075436_100017806
1484 Ga0075436_100081102
1485 Ga0075436_100085555
1486 Ga0075436_100261237
1487 Ga0097620_100002669
1488 Ga0097620_100128263
1489 Ga0097620_100160182
1490 Ga0097620_100307833
1491 Ga0097620_100420494
1492 Ga0097620_100982294
1493 Ga0097620_101774014
1494 Ga0075435_100007120
1495 Ga0075435_100024515
1496 Ga0075435_100025018
1497 Ga0075435_100035427
1498 Ga0075435_100060351
1499 Ga0075435_100420801
1500 Ga0099794_10064534
1501 Ga0105240_10011543
1502 Ga0105240_10130144
1503 Ga0111539_10001096
1504 Ga0111539_10001535
1505 Ga0111539_10002877
1506 Ga0111539_10004585
1507 Ga0111539_10007218
1508 Ga0111539_10021062
1509 Ga0111539_10021248
1510 Ga0111539_10040375
1511 Ga0111539_10223930
1512 Ga0111539_10464300
1513 Ga0111539_10635646
1514 Ga0111539_11087557
1515 Ga0111539_11087991
1516 Ga0111539_11236344
1517 Ga0111539_11252228
1518 Ga0105245_10408947
1519 Ga0105245_10513788
1520 Ga0105245_11813368
1521 Ga0105247_10003746
1522 Ga0105247_11147469
1523 Ga0105247_11323955
1524 Ga0114129_10003005
1525 Ga0114129_10009590
1526 Ga0114129_10034096
1527 Ga0114129_10044082
1528 Ga0114129_10196868
1529 Ga0114129_10255349
1530 Ga0114129_10341284
1531 Ga0114129_10373398
1532 Ga0114129_10633000
1533 Ga0114129_10765889
1534 Ga0114129_10876055
1535 Ga0114129_11368504
1536 Ga0114129_11563707
1537 Ga0105243_10005747
1538 Ga0105243_10521592
1539 Ga0105243_10632245
1540 Ga0105243_10768920
1541 Ga0105241_10016789
1542 Ga0105241_10854544
1543 Ga0105241_11263399
1544 Ga0105242_10014745
1545 Ga0105242_10049063
1546 Ga0105242_10178766
1547 Ga0105242_11163647
1548 Ga0105242_12412189
1549 Ga0105248_10025874
1550 Ga0105248_10051241
1551 Ga0105248_10058517
1552 Ga0105248_10065729
1553 Ga0105248_10662131
1554 Ga0105248_11382836
1555 Ga0105248_11562907
1556 Ga0105248_11688599
1557 Ga0105237_11681099
1558 Ga0105238_10012691
1559 Ga0105238_10724325
1560 Ga0105249_10056160
1561 Ga0105249_10064382
1562 Ga0105249_10234697
1563 Ga0105249_10655349
1564 Ga0105249_10950119
1565 Ga0105249_11615739
1566 Ga0105249_11674273
1567 Ga0105249_12884872
1568 Ga0105249_12992665
1569 Ga0105239_11456264
1570 Ga0105246_10360153
1571 Ga0105246_10424975
1572 Ga0157315_1020076
1573 Ga0157370_10403321
1574 Ga0157369_11541658
1575 Ga0157374_10275837
1576 Ga0157374_10367168
1577 Ga0157378_12002953
1578 Ga0163162_10034885
1579 Ga0163162_10173920
1580 Ga0163162_10869929
1581 Ga0163162_11148816
1582 Ga0157372_10190407
1583 Ga0157375_10066455
1584 Ga0157375_10070818
1585 Ga0157375_10136534
1586 Ga0157375_10500098
1587 Ga0157375_10740713
1588 Ga0157375_11099477
1589 Ga0157375_11348247
1590 Ga0163163_10049669
1591 Ga0163163_10213898
1592 Ga0163163_10261905
1593 Ga0163163_11444192
1594 Ga0157380_10007481
1595 Ga0157380_10013472
1596 Ga0157380_10086536
1597 Ga0157380_10092262
1598 Ga0157380_10095680
1599 Ga0157380_10353092
1600 Ga0157380_10605065
1601 Ga0157380_10709760
1602 Ga0157380_10763339
1603 Ga0157380_10777990
1604 Ga0157380_11430781
1605 Ga0157380_12140741
1606 Ga0157377_10011536
1607 Ga0157377_10031760
1608 Ga0157377_10220772
1609 Ga0157377_10319348
1610 Ga0157377_10328638
1611 Ga0157377_10340699
1612 Ga0157379_10005722
1613 Ga0157379_10048906
1614 Ga0157379_10067766
1615 Ga0157379_10116343
1616 Ga0157379_10500991
1617 Ga0157379_10971797
1618 Ga0157376_10140572
1619 Ga0157376_10154267
1620 Ga0157376_10693536
1621 Ga0157376_12272039
1622 Ga0182005_1245895
1623 Ga0163161_10054592
1624 Ga0163161_10558140
1625 Ga0207673_1004444
1626 Ga0207697_10006229
1627 Ga0207697_10014857
1628 Ga0207697_10057159
1629 Ga0207697_10062782
1630 Ga0207697_10100761
1631 Ga0207697_10110133
1632 Ga0207653_10042479
1633 Ga0207682_10025689
1634 Ga0207682_10044666
1635 Ga0207682_10084505
1636 Ga0207682_10100194
1637 Ga0207682_10586084
1638 Ga0207642_10015048
1639 Ga0207642_10084503
1640 Ga0207642_10193415
1641 Ga0207642_10420664
1642 Ga0207710_10005377
1643 Ga0207710_10012471
1644 Ga0207688_10001167
1645 Ga0207688_10197285
1646 Ga0207688_10331306
1647 Ga0207688_10922933
1648 Ga0207680_10136487
1649 Ga0207680_10200845
1650 Ga0207680_10575620
1651 Ga0207645_10006799
1652 Ga0207645_10011628
1653 Ga0207645_10035884
1654 Ga0207645_10147272
1655 Ga0207645_10262055
1656 Ga0207645_10270858
1657 Ga0207643_10000421
1658 Ga0207643_10003973
1659 Ga0207643_10031908
1660 Ga0207643_10062430
1661 Ga0207643_10137132
1662 Ga0207643_10225562
1663 Ga0207643_10974830
1664 Ga0207705_10116108
1665 Ga0207684_10086680
1666 Ga0207684_10231337
1667 Ga0207684_10355065
1668 Ga0207684_10518406
1669 Ga0207654_10018539
1670 Ga0207654_10427680
1671 Ga0207654_10811664
1672 Ga0207707_10069371
1673 Ga0207695_10035464
1674 Ga0207695_10073089
1675 Ga0207695_10385596
1676 Ga0207693_10176989
1677 Ga0207693_10199072
1678 Ga0207660_10045755
1679 Ga0207660_10402687
1680 Ga0207662_10008088
1681 Ga0207662_10085309
1682 Ga0207662_10576440
1683 Ga0207662_10596891
1684 Ga0207657_10000448
1685 Ga0207657_10622168
1686 Ga0207649_10034873
1687 Ga0207649_10690565
1688 Ga0207649_10808486
1689 Ga0207649_10818863
1690 Ga0207649_11101091
1691 Ga0207652_10074593
1692 Ga0207652_10147531
1693 Ga0207646_10063922
1694 Ga0207646_10402679
1695 Ga0207681_10014493
1696 Ga0207681_10014583
1697 Ga0207681_10022470
1698 Ga0207681_10027511
1699 Ga0207681_10055231
1700 Ga0207681_10187241
1701 Ga0207681_10267567
1702 Ga0207681_10526870
1703 Ga0207681_10574473
1704 Ga0207681_10883352
1705 Ga0207681_11226757
1706 Ga0207681_11234983
1707 Ga0207694_10075167
1708 Ga0207694_11103807
1709 Ga0207650_10023131
1710 Ga0207650_10110013
1711 Ga0207650_10218521
1712 Ga0207650_10535292
1713 Ga0207659_10014101
1714 Ga0207659_10082191
1715 Ga0207659_10107886
1716 Ga0207659_10117411
1717 Ga0207659_10249523
1718 Ga0207659_10279966
1719 Ga0207659_10299663
1720 Ga0207687_10180945
1721 Ga0207687_10727635
1722 Ga0207687_10850048
1723 Ga0207644_10890390
1724 Ga0207690_10073740
1725 Ga0207706_10013947
1726 Ga0207706_10016745
1727 Ga0207706_10078833
1728 Ga0207706_10094059
1729 Ga0207686_10008837
1730 Ga0207686_10019187
1731 Ga0207709_10108784
1732 Ga0207709_10148014
1733 Ga0207709_10197562
1734 Ga0207709_10736745
1735 Ga0207670_10093496
1736 Ga0207670_10098961
1737 Ga0207670_10167320
1738 Ga0207670_10216198
1739 Ga0207670_10270448
1740 Ga0207670_10440253
1741 Ga0207669_10004678
1742 Ga0207669_10063861
1743 Ga0207669_10075630
1744 Ga0207669_10118812
1745 Ga0207669_10163537
1746 Ga0207669_10377140
1747 Ga0207669_11131837
1748 Ga0207704_10001915
1749 Ga0207704_10046592
1750 Ga0207704_10052554
1751 Ga0207704_10599289
1752 Ga0207704_10773359
1753 Ga0207665_10059331
1754 Ga0207665_10123932
1755 Ga0207691_10011048
1756 Ga0207691_10037771
1757 Ga0207691_10052143
1758 Ga0207691_10058452
1759 Ga0207691_10101756
1760 Ga0207691_10192560
1761 Ga0207691_10220937
1762 Ga0207691_10232816
1763 Ga0207691_10265102
1764 Ga0207691_10920530
1765 Ga0207711_10026694
1766 Ga0207711_10171150
1767 Ga0207711_10212815
1768 Ga0207711_10248831
1769 Ga0207711_11329138
1770 Ga0207689_10009631
1771 Ga0207689_10012411
1772 Ga0207689_10032193
1773 Ga0207689_10365702
1774 Ga0207689_10426007
1775 Ga0207661_10098762
1776 Ga0207679_10007458
1777 Ga0207679_10021997
1778 Ga0207679_10106162
1779 Ga0207679_10196205
1780 Ga0207679_10306941
1781 Ga0207679_10594375
1782 Ga0207679_10710492
1783 Ga0207667_10131023
1784 Ga0207667_10519938
1785 Ga0207667_11983907
1786 Ga0207651_10026837
1787 Ga0207651_10045179
1788 Ga0207651_10048143
1789 Ga0207651_10196938
1790 Ga0207651_10359114
1791 Ga0207651_10566373
1792 Ga0207712_10727976
1793 Ga0207712_11686813
1794 Ga0207712_11863022
1795 Ga0207668_10039855
1796 Ga0207668_10123390
1797 Ga0207668_10177611
1798 Ga0207668_10179344
1799 Ga0207668_10372496
1800 Ga0207668_10669683
1801 Ga0207640_10009623
1802 Ga0207640_10485473
1803 Ga0207640_10536156
1804 Ga0207640_10880173
1805 Ga0207640_11902215
1806 Ga0207658_10520492
1807 Ga0207658_10554222
1808 Ga0207658_10714620
1809 Ga0207658_10824651
1810 Ga0207658_11066660
1811 Ga0207677_10118776
1812 Ga0207677_11499156
1813 Ga0207703_10085378
1814 Ga0207703_10157010
1815 Ga0207703_10419059
1816 Ga0207703_10788649
1817 Ga0207703_10813619
1818 Ga0207639_10161244
1819 Ga0207639_11013193
1820 Ga0207678_10073614
1821 Ga0207678_10089975
1822 Ga0207678_10441441
1823 Ga0207678_10496826
1824 Ga0207708_10004076
1825 Ga0207708_10013130
1826 Ga0207708_10039098
1827 Ga0207708_10066324
1828 Ga0207708_10179488
1829 Ga0207708_10186032
1830 Ga0207708_10705813
1831 Ga0207708_11408974
1832 Ga0207641_10142894
1833 Ga0207641_10437360
1834 Ga0207641_10546006
1835 Ga0207648_10000802
1836 Ga0207648_10017964
1837 Ga0207648_10073765
1838 Ga0207648_10142645
1839 Ga0207648_10160602
1840 Ga0207648_10307167
1841 Ga0207648_10351353
1842 Ga0207648_10503879
1843 Ga0207648_10624495
1844 Ga0207648_10742489
1845 Ga0207648_10833728
1846 Ga0207648_10931739
1847 Ga0207676_10097975
1848 Ga0207676_10172785
1849 Ga0207676_10181467
1850 Ga0207676_10782536
1851 Ga0207676_10849720
1852 Ga0207674_10076334
1853 Ga0207674_10172945
1854 Ga0207674_11073421
1855 Ga0207674_12099102
1856 Ga0207675_100003438
1857 Ga0207675_100008037
1858 Ga0207675_100026637
1859 Ga0207675_100030876
1860 Ga0207675_100039233
1861 Ga0207675_100082000
1862 Ga0207675_100295147
1863 Ga0207675_100297167
1864 Ga0207675_100308482
1865 Ga0207675_100453834
1866 Ga0207675_101009548
1867 Ga0207683_10042430
1868 Ga0207683_10051914
1869 Ga0207683_10153964
1870 Ga0207683_10532556
1871 Ga0207698_10088151
1872 Ga0209971_1078061
1873 Ga0209998_10055051
1874 Ga0209974_10059230
1875 Ga0209974_10062413
1876 Ga0207428_10000515
1877 Ga0207428_10002311
1878 Ga0207428_10006882
1879 Ga0207428_10008383
1880 Ga0207428_10058793
1881 Ga0207428_10327876
1882 Ga0207428_10752096
1883 Ga0207428_10942401
1884 Ga0268266_10054105
1885 Ga0268266_10400147
1886 Ga0268266_10797775
1887 Ga0268265_10004006
1888 Ga0268265_10030648
1889 Ga0268265_10154862
1890 Ga0268265_10188184
1891 Ga0268265_10195042
1892 Ga0268265_10234290
1893 Ga0268265_10258420
1894 Ga0268265_10352745
1895 Ga0268265_10389729
1896 Ga0268265_10664087
1897 Ga0268265_10749026
1898 Ga0268265_11165060
1899 Ga0268264_10128495
1900 Ga0268264_10142874
1901 Ga0268264_10168656
1902 Ga0268264_10775511
1903 Ga0268264_11184763
1904 Ga0268264_11202200
1905 Ga0268264_11987719
1906 Ga0268264_12128022
1907 Ga0265316_10282318
1908 Ga0307408_100086674
1909 Ga0307408_100460014
1910 Ga0307408_100634881
1911 Ga0265314_10120161
1912 Ga0307405_10004821
1913 Ga0307405_10551294
1914 Ga0307413_10126311
1915 Ga0307413_11005855
1916 Ga0307410_10008571
1917 Ga0307410_10907490
1918 Ga0307406_10068985
1919 Ga0307407_10003751
1920 Ga0307407_10253003
1921 Ga0307407_10266700
1922 Ga0307412_10027611
1923 Ga0307412_10574164
1924 Ga0307412_11397689
1925 Ga0307412_11605491
1926 Ga0307409_100062413
1927 Ga0307409_101109911
1928 Ga0307416_100097463
1929 Ga0307416_101080945
1930 Ga0307411_10015044
1931 Ga0307411_10127862
1932 Ga0307411_10445419
1933 Ga0307411_10819585
1934 Ga0307411_11917682
1935 Ga0307415_100024282
1936 Ga0373948_0006326
1937 Ga0373938_0152264
1938 Ga0373928_0007511
1939 Ga0373940_0271815
1940 Ga0373944_0149309
1941 Ga0373949_0002163
1942 Ga0373951_0007755
1943 Ga0373952_0003771
1944 Ga0373932_0006339
1945 Ga0373932_0111103
1946 Ga0373932_0167821
1947 Ga0373939_0015830
1948 Ga0373941_0000343
1949 Ga0373941_0266422
1950 Ga0373954_0046367
1951 Ga0373956_0223500
1952 Ga0373960_0001256
1953 Ga0373960_0025199
1954 Ga0373943_0124050
1955 Ga0373946_0069755
1956 Ga0373955_0463325
1957 Ga0373955_0665361
1958 Ga0373961_0022626
1959 Ga0373961_0062944
1960 Ga0373962_0001870
1961 Ga0373931_0001339
1962 Ga0373931_0082457
1963 Ga0373931_0120135
1964 Ga0373937_0159180
1965 Ga0373925_0241361
1966 Ga0373925_0496367
1967 Ga0439453_0022459
1968 Ga0451800_1621613
1969 Ga0439433_0027879
1970 Ga0439454_100652
1971 Ga0439462_0199881
1972 Ga0450914_046764
1973 Ga0439446_0042916
1974 Ga0439446_0099084
1975 Ga0439434_0057687
1976 Ga0439435_0092311
1977 Ga0439464_0093384
1978 Ga0439464_0122213
1979 Ga0450916_024858
1980 Ga0439440_0032645
1981 Ga0439440_0104953
1982 Ga0451576_0010882
1983 Ga0451576_0679933
1984 Ga0495592_0322612
1985 Ga0495603_0063471
1986 Ga0495580_0073772
1987 Ga0495582_0118102
1988 Ga0495662_0505033
1989 Ga0495664_0695675
1990 Ga0495594_0062966
1991 Ga0495583_0160906
1992 Ga0495630_0117208
1993 Ga0495630_0177025
1994 Ga0495663_0265200
1995 Ga0495666_0322956
1996 Ga0495640_0054769
1997 Ga0495586_0074839
1998 Ga0495586_0569150
1999 Ga0495598_0179138
2000 Ga0495621_0054794
2001 Ga0495621_0097697
2002 Ga0495645_0011107
2003 Ga0495633_0143241
2004 Ga0495634_0423410
2005 Ga0495635_0197813
2006 Ga0495635_0200578
2007 Ga0495659_0488488
2008 Ga0495588_0254220
2009 Ga0495599_0366166
2010 Ga0495647_0058426
2011 Ga0495647_0096855
2012 Ga0495647_0115562
2013 Ga0495647_0299780
2014 Ga0495658_0039106
2015 Ga0495658_0058218
2016 Ga0495669_0207481
2017 Ga0495636_0064540
2018 Ga0495674_0106880
2019 Ga0495674_0186479
2020 Ga0495680_0126574
2021 Ga0495680_0943251
2022 Ga0495684_0086028
2023 Ga0495684_0160441
2024 Ga0495602_0600681
2025 Ga0496101_1106349
2026 Ga0496102_0067969
2027 Ga0496102_0091619
2028 Ga0496102_1415078
2029 Ga0496103_0316398
2030 Ga0496103_0750067
2031 Ga0496104_1590651
2032 Ga0496106_0485290
2033 Ga0496106_0776202
2034 Ga0496106_1183616
2035 Ga0496108_0025003
2036 Ga0496109_0331752
2037 Ga0496109_1098377
2038 Ga0496110_0171743
2039 Ga0496110_0680971
2040 Ga0496112_0037423
2041 Ga0496113_0177816
2042 Ga0496113_0354640
2043 Ga0496114_0041782
2044 Ga0501298_030201
2045 Ga0501033_0720816
2046 Ga0501036_0119187
2047 Ga0501037_0372352
2048 Ga0501039_0056023
2049 Ga0501039_0069299
2050 Ga0501040_0018432
2051 Ga0501040_0086204
2052 Ga0501040_0964412
2053 Ga0501041_0064651
2054 Ga0501041_0189559
2055 Ga0501042_0025948
2056 Ga0501042_0062804
2057 Ga0501046_0001085
2058 Ga0501048_0063991
2059 Ga0501048_0088906
2060 Ga0501067_0625052
2061 Ga0501071_0037006
2062 Ga0501071_0156786
2063 Ga0501071_0313238
2064 Ga0501074_0658231
2065 Ga0501074_1172151
2066 Ga0501075_0003591
2067 Ga0501075_0077467
2068 Ga0501075_0276180
2069 Ga0501075_0480718
2070 Ga0501075_0592558
2071 Ga0501076_0024232
2072 Ga0501076_0461218
2073 Ga0501076_0854306
2074 Ga0501076_1162535
2075 Ga0501077_0015002
2076 Ga0501077_0711413
2077 Ga0501249_010075
2078 Ga0501079_0209458
2079 Ga0501081_0030039
2080 Ga0501081_0046932
2081 Ga0501083_0218121
2082 Ga0501083_0493680
2083 Ga0501044_1174262
2084 Ga0501045_0056520
2085 nmdc:mga05p37_1035000_c1
2086 nmdc:mga05p37_11228_c1
2087 nmdc:mga05p37_1363605_c1
2088 nmdc:mga05p37_156059_c1
2089 nmdc:mga05p37_174100_c1
2090 nmdc:mga05p37_299257_c1
2091 nmdc:mga05p37_32801_c1
2092 nmdc:mga05p37_386041_c1
2093 nmdc:mga05p37_406896_c1
2094 nmdc:mga05p37_43511_c1
2095 nmdc:mga05p37_47284_c1
2096 nmdc:mga05p37_81153_c2
2097 nmdc:mga05p37_822700_c1
2098 nmdc:mga09592_2456_c1
2099 nmdc:mga09592_290133_c1
2100 nmdc:mga09592_3877_c1
2101 nmdc:mga09592_514254_c1
2102 nmdc:mga09592_54046_c1
2103 nmdc:mga09592_76446_c1
2104 nmdc:mga0qj67_1191813_c1
2105 nmdc:mga0qj67_15050_c1
2106 nmdc:mga0qj67_2494_c1
2107 nmdc:mga0qj67_49253_c1
2108 nmdc:mga0qj67_585652_c1
2109 nmdc:mga06r32_263642_c1
2110 nmdc:mga06r32_31910_c1
2111 nmdc:mga06r32_337151_c1
2112 nmdc:mga06r32_41442_c1
2113 nmdc:mga06r32_6589_c1
2114 nmdc:mga08y16_1241992_c1
2115 nmdc:mga08y16_1271719_c1
2116 nmdc:mga08y16_168554_c1
2117 nmdc:mga08y16_19092_c1
2118 nmdc:mga08y16_3326_c2
2119 nmdc:mga08y16_37298_c1
2120 nmdc:mga08y16_43724_c1
2121 nmdc:mga08y16_48345_c1
2122 nmdc:mga08y16_526993_c1
2123 nmdc:mga08y16_5474_c1
2124 nmdc:mga08y16_683_c1
2125 nmdc:mga08y16_79251_c1
2126 nmdc:mga08y16_800102_c1
2127 nmdc:mga08y16_976_c1
2128 nmdc:mga0n895_1176576_c1
2129 nmdc:mga0n895_16886_c1
2130 nmdc:mga0n895_184334_c1
2131 nmdc:mga0n895_357886_c1
2132 nmdc:mga0n895_42983_c1
2133 nmdc:mga0n895_454300_c1
2134 nmdc:mga0n895_632267_c1
2135 nmdc:mga0n895_71935_c1
2136 nmdc:mga0n895_77894_c1
2137 nmdc:mga0n895_8913_c1
2138 nmdc:mga0rr50_10783_c1
2139 nmdc:mga0rr50_118939_c1
2140 nmdc:mga0rr50_1258634_c1
2141 nmdc:mga0rr50_270267_c1
2142 nmdc:mga0rr50_321957_c1
2143 nmdc:mga0rr50_373910_c1
2144 nmdc:mga0rr50_49091_c1
2145 nmdc:mga0rr50_690846_c1
2146 nmdc:mga08x19_1161462_c1
2147 nmdc:mga08x19_150702_c1
2148 nmdc:mga08x19_245572_c1
2149 nmdc:mga08x19_422416_c1
2150 nmdc:mga08x19_8172_c1
2151 nmdc:mga08x19_88202_c1
2152 nmdc:mga0a205_1005171_c1
2153 nmdc:mga0a205_11262_c1
2154 nmdc:mga0a205_154044_c1
2155 nmdc:mga0a205_200440_c1
2156 nmdc:mga0a205_5674_c1
2157 nmdc:mga0a205_818286_c1
2158 nmdc:mga0a205_894_c1
2159 Ga0495601_0498053
2160 Ga0495619_0008562
2161 Ga0500566_0226009
2162 Ga0501084_0004609
2163 Ga0501084_0073686
2164 Ga0590075_045219
2165 Ga0590077_091703
2166 Ga0501082_0014744
2167 Ga0530510_0032284
2168 Ga0530510_1262851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

40

168

0.98

PF08534

Redoxin

Redoxin

39

184

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9613 3 154
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.9608 3 153
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9431 3 154
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.9367 3 153
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9287 1 154
ID Description Score Start End Superfamily
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9435 1 153 3.40.30.10
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9317 1 153 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9189 1 154 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9116 1 154 3.40.30.10
2yzhD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9101 1 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A818UNV0-F1-model_v4 Thioredoxin domain-containing protein 0.9778 2 153 GO:0016209
GO:0016491
AF-A0A7J4AB69-F1-model_v4 Peroxiredoxin 0.9769 3 154 GO:0016209
GO:0016491
AF-A0A818UKB0-F1-model_v4 Thioredoxin domain-containing protein 0.9768 1 151 GO:0016209
GO:0016491
AF-A0A7C2XF79-F1-model_v4 Peroxiredoxin 0.9766 3 154 GO:0016209
GO:0016491
AF-A0A817PIK7-F1-model_v4 Thioredoxin domain-containing protein 0.9762 1 153 GO:0016209
GO:0016491

Map