F489758
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1085 | 348 | 1085 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100410868|Ga0068859_1004108682 |
| Length | 110 |
| Sequence | MPGLKARPTGIMNIQKMMQQAQEMQXRLQKQMADMRVDATAGGGMVTVVVSGHKQLMKITIDPEVVSKDDVPMLQDLILAAINDAHRKVDQALAQQMSGLMGGMQNSGLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 211 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 216 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 217 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 218 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 219 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 220 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 221 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 222 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 223 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 224 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 225 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 226 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 227 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 228 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 229 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 230 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 231 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 234 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 235 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 236 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 237 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 288 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 316 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 317 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 329 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 331 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 345 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 346 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 347 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.21 |
| Nodule | 0 |
| Rhizoplane | 2.58 |
| Rhizosphere | 94.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10083124 | 3300003203 | Bacteria | 978 |
| 2 | JGI25406J46586_10092444 | 3300003203 | Bacteria | 911 |
| 3 | JGI25406J46586_10213409 | 3300003203 | Unclassified | 564 |
| 4 | Ga0065714_10106583 | 3300005288 | Bacteria | 1546 |
| 5 | Ga0065712_10025310 | 3300005290 | Bacteria | 1411 |
| 6 | Ga0065712_10153694 | 3300005290 | Bacteria | 1350 |
| 7 | Ga0065715_10138994 | 3300005293 | Bacteria | 1883 |
| 8 | Ga0065715_10149341 | 3300005293 | Bacteria | 1748 |
| 9 | Ga0065707_10086703 | 3300005295 | Bacteria | 5336 |
| 10 | Ga0065707_10149428 | 3300005295 | Bacteria | 1675 |
| 11 | Ga0065707_10170689 | 3300005295 | Bacteria | 1487 |
| 12 | Ga0065707_10591340 | 3300005295 | Bacteria | 695 |
| 13 | Ga0065707_10707279 | 3300005295 | Unclassified | 636 |
| 14 | Ga0065707_11046822 | 3300005295 | Bacteria | 528 |
| 15 | Ga0065707_11122576 | 3300005295 | Unclassified | 511 |
| 16 | Ga0065707_11136378 | 3300005295 | Bacteria | 507 |
| 17 | Ga0070676_10028956 | 3300005328 | Bacteria | 3147 |
| 18 | Ga0070683_100007552 | 3300005329 | Bacteria | 9189 |
| 19 | Ga0070690_100027789 | 3300005330 | Bacteria | 3500 |
| 20 | Ga0070690_100149010 | 3300005330 | Bacteria | 1594 |
| 21 | Ga0070690_100170683 | 3300005330 | Bacteria | 1497 |
| 22 | Ga0070690_100257315 | 3300005330 | Bacteria | 1237 |
| 23 | Ga0070670_100004413 | 3300005331 | Bacteria | 11779 |
| 24 | Ga0070670_100007462 | 3300005331 | Bacteria | 9285 |
| 25 | Ga0070670_100464699 | 3300005331 | Unclassified | 1122 |
| 26 | Ga0070677_10762496 | 3300005333 | Bacteria | 550 |
| 27 | Ga0068869_100058451 | 3300005334 | Bacteria | 2820 |
| 28 | Ga0068869_100084729 | 3300005334 | Bacteria | 2373 |
| 29 | Ga0068869_100823931 | 3300005334 | Bacteria | 799 |
| 30 | Ga0070666_10045960 | 3300005335 | Bacteria | 2927 |
| 31 | Ga0070666_10063575 | 3300005335 | Bacteria | 2502 |
| 32 | Ga0070666_10859068 | 3300005335 | Bacteria | 670 |
| 33 | Ga0070666_10908227 | 3300005335 | Bacteria | 651 |
| 34 | Ga0070680_100111780 | 3300005336 | Bacteria | 2275 |
| 35 | Ga0070680_100415668 | 3300005336 | Bacteria | 1147 |
| 36 | Ga0070680_100778601 | 3300005336 | Bacteria | 824 |
| 37 | Ga0070680_101163650 | 3300005336 | Bacteria | 667 |
| 38 | Ga0070682_100493593 | 3300005337 | Bacteria | 947 |
| 39 | Ga0070682_101400767 | 3300005337 | Bacteria | 598 |
| 40 | Ga0070682_101904942 | 3300005337 | Bacteria | 521 |
| 41 | Ga0068868_100315931 | 3300005338 | Unclassified | 1330 |
| 42 | Ga0068868_100389144 | 3300005338 | Bacteria | 1201 |
| 43 | Ga0070660_101496559 | 3300005339 | Bacteria | 574 |
| 44 | Ga0070689_100030548 | 3300005340 | Bacteria | 4090 |
| 45 | Ga0070689_100176159 | 3300005340 | Bacteria | 1735 |
| 46 | Ga0070689_100256727 | 3300005340 | Bacteria | 1444 |
| 47 | Ga0070689_100275519 | 3300005340 | Bacteria | 1394 |
| 48 | Ga0070689_100725728 | 3300005340 | Bacteria | 869 |
| 49 | Ga0070689_102143232 | 3300005340 | Bacteria | 512 |
| 50 | Ga0070691_10017904 | 3300005341 | Bacteria | 3261 |
| 51 | Ga0070691_10182267 | 3300005341 | Bacteria | 1094 |
| 52 | Ga0070687_100008463 | 3300005343 | Bacteria | 4361 |
| 53 | Ga0070687_100023052 | 3300005343 | Bacteria | 2954 |
| 54 | Ga0070687_100051971 | 3300005343 | Bacteria | 2125 |
| 55 | Ga0070661_100012520 | 3300005344 | Bacteria | 5935 |
| 56 | Ga0070661_100098211 | 3300005344 | Bacteria | 2175 |
| 57 | Ga0070692_10028201 | 3300005345 | Bacteria | 2789 |
| 58 | Ga0070692_10314983 | 3300005345 | Bacteria | 960 |
| 59 | Ga0070668_100269987 | 3300005347 | Unclassified | 1417 |
| 60 | Ga0070668_100636083 | 3300005347 | Bacteria | 936 |
| 61 | Ga0070668_100763258 | 3300005347 | Bacteria | 857 |
| 62 | Ga0070668_101644322 | 3300005347 | Bacteria | 589 |
| 63 | Ga0070669_100051895 | 3300005353 | Bacteria | 2998 |
| 64 | Ga0070669_100102174 | 3300005353 | Bacteria | 2164 |
| 65 | Ga0070669_100155395 | 3300005353 | Bacteria | 1773 |
| 66 | Ga0070669_100156483 | 3300005353 | Bacteria | 1768 |
| 67 | Ga0070669_100336184 | 3300005353 | Bacteria | 1223 |
| 68 | Ga0070669_100350581 | 3300005353 | Bacteria | 1198 |
| 69 | Ga0070669_100960175 | 3300005353 | Bacteria | 732 |
| 70 | Ga0070669_101158658 | 3300005353 | Bacteria | 667 |
| 71 | Ga0070675_100016827 | 3300005354 | Bacteria | 5806 |
| 72 | Ga0070675_100179773 | 3300005354 | Bacteria | 1828 |
| 73 | Ga0070675_100197845 | 3300005354 | Bacteria | 1744 |
| 74 | Ga0070675_100253317 | 3300005354 | Bacteria | 1541 |
| 75 | Ga0070675_100597189 | 3300005354 | Bacteria | 1001 |
| 76 | Ga0070675_100702999 | 3300005354 | Bacteria | 921 |
| 77 | Ga0070675_102161713 | 3300005354 | Bacteria | 513 |
| 78 | Ga0070671_100037051 | 3300005355 | Bacteria | 4044 |
| 79 | Ga0070671_100409430 | 3300005355 | Bacteria | 1161 |
| 80 | Ga0070671_101165111 | 3300005355 | Bacteria | 678 |
| 81 | Ga0070674_100168717 | 3300005356 | Bacteria | 1667 |
| 82 | Ga0070674_100724991 | 3300005356 | Bacteria | 852 |
| 83 | Ga0070674_101939626 | 3300005356 | Bacteria | 536 |
| 84 | Ga0070673_100011151 | 3300005364 | Bacteria | 6127 |
| 85 | Ga0070673_100016210 | 3300005364 | Bacteria | 5261 |
| 86 | Ga0070673_100409025 | 3300005364 | Bacteria | 1214 |
| 87 | Ga0070688_100025746 | 3300005365 | Bacteria | 3488 |
| 88 | Ga0070688_100095705 | 3300005365 | Bacteria | 1949 |
| 89 | Ga0070688_100112936 | 3300005365 | Bacteria | 1809 |
| 90 | Ga0070688_100217497 | 3300005365 | Unclassified | 1345 |
| 91 | Ga0070688_100428286 | 3300005365 | Bacteria | 985 |
| 92 | Ga0070688_100526803 | 3300005365 | Bacteria | 895 |
| 93 | Ga0070688_100631478 | 3300005365 | Bacteria | 823 |
| 94 | Ga0070688_100854438 | 3300005365 | Bacteria | 715 |
| 95 | Ga0070688_101624904 | 3300005365 | Bacteria | 528 |
| 96 | Ga0070659_100100205 | 3300005366 | Bacteria | 2331 |
| 97 | Ga0070659_100976545 | 3300005366 | Bacteria | 743 |
| 98 | Ga0070667_100102344 | 3300005367 | Bacteria | 2475 |
| 99 | Ga0070667_100105118 | 3300005367 | Bacteria | 2443 |
| 100 | Ga0070667_100166117 | 3300005367 | Bacteria | 1947 |
| 101 | Ga0070667_100579633 | 3300005367 | Bacteria | 1033 |
| 102 | Ga0070667_102254858 | 3300005367 | Bacteria | 513 |
| 103 | Ga0070709_10429129 | 3300005434 | Bacteria | 992 |
| 104 | Ga0070714_100012428 | 3300005435 | Bacteria | 6798 |
| 105 | Ga0070713_100371955 | 3300005436 | Bacteria | 1330 |
| 106 | Ga0070701_10019829 | 3300005438 | Bacteria | 3182 |
| 107 | Ga0070701_10043041 | 3300005438 | Bacteria | 2308 |
| 108 | Ga0070701_10325118 | 3300005438 | Bacteria | 953 |
| 109 | Ga0070701_10332515 | 3300005438 | Bacteria | 943 |
| 110 | Ga0070701_10890246 | 3300005438 | Unclassified | 614 |
| 111 | Ga0070701_11346115 | 3300005438 | Bacteria | 512 |
| 112 | Ga0070705_100010925 | 3300005440 | Bacteria | 4562 |
| 113 | Ga0070705_100077195 | 3300005440 | Bacteria | 2034 |
| 114 | Ga0070705_100383867 | 3300005440 | Bacteria | 1035 |
| 115 | Ga0070700_100044430 | 3300005441 | Bacteria | 2736 |
| 116 | Ga0070700_100067920 | 3300005441 | Bacteria | 2265 |
| 117 | Ga0070700_100111792 | 3300005441 | Bacteria | 1817 |
| 118 | Ga0070700_100229740 | 3300005441 | Bacteria | 1320 |
| 119 | Ga0070700_100288007 | 3300005441 | Bacteria | 1194 |
| 120 | Ga0070700_101225102 | 3300005441 | Bacteria | 628 |
| 121 | Ga0070700_101391223 | 3300005441 | Bacteria | 593 |
| 122 | Ga0070700_101766357 | 3300005441 | Bacteria | 532 |
| 123 | Ga0070694_100002811 | 3300005444 | Bacteria | 10330 |
| 124 | Ga0070694_100006907 | 3300005444 | Bacteria | 6898 |
| 125 | Ga0070694_100097721 | 3300005444 | Bacteria | 2072 |
| 126 | Ga0070694_100420609 | 3300005444 | Bacteria | 1050 |
| 127 | Ga0070694_100673681 | 3300005444 | Bacteria | 839 |
| 128 | Ga0070694_100952934 | 3300005444 | Bacteria | 711 |
| 129 | Ga0070663_100219852 | 3300005455 | Bacteria | 1491 |
| 130 | Ga0070678_100505484 | 3300005456 | Bacteria | 1067 |
| 131 | Ga0070678_100676007 | 3300005456 | Bacteria | 928 |
| 132 | Ga0070662_101702549 | 3300005457 | Bacteria | 544 |
| 133 | Ga0070681_10570750 | 3300005458 | Bacteria | 1045 |
| 134 | Ga0068867_100087743 | 3300005459 | Bacteria | 2356 |
| 135 | Ga0068867_100203840 | 3300005459 | Bacteria | 1585 |
| 136 | Ga0068867_100256849 | 3300005459 | Bacteria | 1423 |
| 137 | Ga0068867_100286403 | 3300005459 | Unclassified | 1353 |
| 138 | Ga0068867_100470492 | 3300005459 | Bacteria | 1075 |
| 139 | Ga0068867_100648207 | 3300005459 | Bacteria | 926 |
| 140 | Ga0070685_10038256 | 3300005466 | Bacteria | 2720 |
| 141 | Ga0070685_10263185 | 3300005466 | Unclassified | 1148 |
| 142 | Ga0070685_10267026 | 3300005466 | Bacteria | 1140 |
| 143 | Ga0070685_11021502 | 3300005466 | Bacteria | 621 |
| 144 | Ga0070685_11391578 | 3300005466 | Bacteria | 538 |
| 145 | Ga0070706_100059841 | 3300005467 | Bacteria | 3516 |
| 146 | Ga0070706_101859534 | 3300005467 | Bacteria | 547 |
| 147 | Ga0070707_100328591 | 3300005468 | Bacteria | 1486 |
| 148 | Ga0070707_100550545 | 3300005468 | Bacteria | 1116 |
| 149 | Ga0070707_100964469 | 3300005468 | Unclassified | 818 |
| 150 | Ga0070707_101543588 | 3300005468 | Bacteria | 631 |
| 151 | Ga0070698_100001914 | 3300005471 | Bacteria | 23193 |
| 152 | Ga0070698_100008781 | 3300005471 | Bacteria | 10875 |
| 153 | Ga0070698_100367484 | 3300005471 | Bacteria | 1371 |
| 154 | Ga0070698_100734923 | 3300005471 | Bacteria | 930 |
| 155 | Ga0070698_101784181 | 3300005471 | Bacteria | 568 |
| 156 | Ga0070699_100005726 | 3300005518 | Bacteria | 10873 |
| 157 | Ga0070699_100005918 | 3300005518 | Bacteria | 10685 |
| 158 | Ga0070699_100021870 | 3300005518 | Bacteria | 5512 |
| 159 | Ga0070699_100927027 | 3300005518 | Bacteria | 798 |
| 160 | Ga0070679_100677308 | 3300005530 | Bacteria | 974 |
| 161 | Ga0070684_100005231 | 3300005535 | Bacteria | 9925 |
| 162 | Ga0070684_100245419 | 3300005535 | Bacteria | 1636 |
| 163 | Ga0070684_100578208 | 3300005535 | Bacteria | 1044 |
| 164 | Ga0070697_100597651 | 3300005536 | Bacteria | 970 |
| 165 | Ga0070697_100864185 | 3300005536 | Bacteria | 802 |
| 166 | Ga0068853_101811238 | 3300005539 | Bacteria | 592 |
| 167 | Ga0070672_100041632 | 3300005543 | Bacteria | 3533 |
| 168 | Ga0070672_100471306 | 3300005543 | Bacteria | 1083 |
| 169 | Ga0070672_101492071 | 3300005543 | Bacteria | 606 |
| 170 | Ga0070672_101977229 | 3300005543 | Bacteria | 525 |
| 171 | Ga0070686_100031148 | 3300005544 | Bacteria | 3259 |
| 172 | Ga0070686_100190371 | 3300005544 | Bacteria | 1464 |
| 173 | Ga0070686_100611433 | 3300005544 | Bacteria | 860 |
| 174 | Ga0070686_101393912 | 3300005544 | Unclassified | 588 |
| 175 | Ga0070695_100110617 | 3300005545 | Bacteria | 1863 |
| 176 | Ga0070695_100496908 | 3300005545 | Unclassified | 943 |
| 177 | Ga0070695_100980094 | 3300005545 | Bacteria | 686 |
| 178 | Ga0070695_100998378 | 3300005545 | Bacteria | 681 |
| 179 | Ga0070696_100005487 | 3300005546 | Bacteria | 8462 |
| 180 | Ga0070696_100050068 | 3300005546 | Bacteria | 2903 |
| 181 | Ga0070693_100185296 | 3300005547 | Bacteria | 1343 |
| 182 | Ga0070693_100469191 | 3300005547 | Bacteria | 887 |
| 183 | Ga0070693_100699894 | 3300005547 | Archaea | 742 |
| 184 | Ga0070665_100033864 | 3300005548 | Bacteria | 5139 |
| 185 | Ga0070665_101164879 | 3300005548 | Bacteria | 782 |
| 186 | Ga0070704_100031294 | 3300005549 | Bacteria | 3577 |
| 187 | Ga0070704_100057843 | 3300005549 | Bacteria | 2759 |
| 188 | Ga0070704_100464129 | 3300005549 | Bacteria | 1093 |
| 189 | Ga0070704_100466830 | 3300005549 | Bacteria | 1090 |
| 190 | Ga0070704_100736766 | 3300005549 | Bacteria | 877 |
| 191 | Ga0070704_100739832 | 3300005549 | Unclassified | 875 |
| 192 | Ga0070704_100985458 | 3300005549 | Bacteria | 762 |
| 193 | Ga0070704_101122451 | 3300005549 | Bacteria | 715 |
| 194 | Ga0070664_100001608 | 3300005564 | Bacteria | 18074 |
| 195 | Ga0070664_100026140 | 3300005564 | Bacteria | 4841 |
| 196 | Ga0070664_100095017 | 3300005564 | Bacteria | 2585 |
| 197 | Ga0070664_100257859 | 3300005564 | Unclassified | 1568 |
| 198 | Ga0068857_100021160 | 3300005577 | Bacteria | 5724 |
| 199 | Ga0068857_100417081 | 3300005577 | Bacteria | 1251 |
| 200 | Ga0068854_100015949 | 3300005578 | Bacteria | 4995 |
| 201 | Ga0070702_100111378 | 3300005615 | Bacteria | 1697 |
| 202 | Ga0070702_100152589 | 3300005615 | Unclassified | 1485 |
| 203 | Ga0070702_100677648 | 3300005615 | Bacteria | 783 |
| 204 | Ga0068852_101063555 | 3300005616 | Bacteria | 829 |
| 205 | Ga0068859_100027743 | 3300005617 | Bacteria | 5679 |
| 206 | Ga0068859_100197425 | 3300005617 | Bacteria | 2096 |
| 207 | Ga0068859_100244855 | 3300005617 | Bacteria | 1882 |
| 208 | Ga0068859_100379594 | 3300005617 | Bacteria | 1509 |
| 209 | Ga0068859_100410868 | 3300005617 | Bacteria | 1449 |
| 210 | Ga0068859_100505474 | 3300005617 | Unclassified | 1304 |
| 211 | Ga0068859_102508717 | 3300005617 | Unclassified | 568 |
| 212 | Ga0068859_102628729 | 3300005617 | Bacteria | 554 |
| 213 | Ga0068864_100016044 | 3300005618 | Bacteria | 6232 |
| 214 | Ga0068864_100593820 | 3300005618 | Bacteria | 1074 |
| 215 | Ga0068864_101179039 | 3300005618 | Bacteria | 764 |
| 216 | Ga0068864_102118915 | 3300005618 | Bacteria | 569 |
| 217 | Ga0068866_10108018 | 3300005718 | Bacteria | 1547 |
| 218 | Ga0068866_11236171 | 3300005718 | Bacteria | 540 |
| 219 | Ga0068861_100030884 | 3300005719 | Bacteria | 3930 |
| 220 | Ga0068861_100137258 | 3300005719 | Bacteria | 1991 |
| 221 | Ga0068861_100429375 | 3300005719 | Bacteria | 1179 |
| 222 | Ga0068861_101097131 | 3300005719 | Bacteria | 765 |
| 223 | Ga0068851_10041209 | 3300005834 | Bacteria | 2321 |
| 224 | Ga0068870_10154775 | 3300005840 | Bacteria | 1354 |
| 225 | Ga0068870_10458441 | 3300005840 | Bacteria | 842 |
| 226 | Ga0068863_100429611 | 3300005841 | Bacteria | 1295 |
| 227 | Ga0068863_101602832 | 3300005841 | Bacteria | 660 |
| 228 | Ga0068858_100014560 | 3300005842 | Bacteria | 7411 |
| 229 | Ga0068858_100119501 | 3300005842 | Bacteria | 2464 |
| 230 | Ga0068858_100221343 | 3300005842 | Bacteria | 1792 |
| 231 | Ga0068858_100298054 | 3300005842 | Unclassified | 1538 |
| 232 | Ga0068858_100405010 | 3300005842 | Bacteria | 1311 |
| 233 | Ga0068858_100700445 | 3300005842 | Bacteria | 986 |
| 234 | Ga0068858_100991570 | 3300005842 | Bacteria | 823 |
| 235 | Ga0068858_101841938 | 3300005842 | Bacteria | 598 |
| 236 | Ga0068860_100288994 | 3300005843 | Bacteria | 1604 |
| 237 | Ga0068860_100382474 | 3300005843 | Unclassified | 1390 |
| 238 | Ga0068860_100430620 | 3300005843 | Bacteria | 1309 |
| 239 | Ga0068860_101142187 | 3300005843 | Bacteria | 799 |
| 240 | Ga0068860_102243004 | 3300005843 | Bacteria | 567 |
| 241 | Ga0068862_100023246 | 3300005844 | Bacteria | 5192 |
| 242 | Ga0068862_100479185 | 3300005844 | Unclassified | 1177 |
| 243 | Ga0068862_100577193 | 3300005844 | Bacteria | 1077 |
| 244 | Ga0068862_100772970 | 3300005844 | Bacteria | 936 |
| 245 | Ga0068862_100842579 | 3300005844 | Bacteria | 898 |
| 246 | Ga0068862_100966043 | 3300005844 | Bacteria | 841 |
| 247 | Ga0068862_101822497 | 3300005844 | Unclassified | 618 |
| 248 | Ga0068862_102209706 | 3300005844 | Bacteria | 562 |
| 249 | Ga0081539_10001702 | 3300005985 | Bacteria | 35478 |
| 250 | Ga0081539_10038590 | 3300005985 | Bacteria | 2828 |
| 251 | Ga0081539_10040663 | 3300005985 | Bacteria | 2727 |
| 252 | Ga0081539_10075209 | 3300005985 | Bacteria | 1795 |
| 253 | Ga0070717_11791795 | 3300006028 | Bacteria | 555 |
| 254 | Ga0075365_10022822 | 3300006038 | Bacteria | 3926 |
| 255 | Ga0075368_10107148 | 3300006042 | Bacteria | 1150 |
| 256 | Ga0075363_100266427 | 3300006048 | Archaea | 989 |
| 257 | Ga0075364_10021212 | 3300006051 | Bacteria | 4093 |
| 258 | Ga0075364_10087665 | 3300006051 | Bacteria | 2063 |
| 259 | Ga0075364_10288778 | 3300006051 | Bacteria | 1116 |
| 260 | Ga0075432_10210689 | 3300006058 | Bacteria | 773 |
| 261 | Ga0075432_10474815 | 3300006058 | Bacteria | 553 |
| 262 | Ga0070716_101529411 | 3300006173 | Bacteria | 546 |
| 263 | Ga0070712_100295073 | 3300006175 | Bacteria | 1310 |
| 264 | Ga0075362_10006980 | 3300006177 | Bacteria | 4240 |
| 265 | Ga0075367_10055938 | 3300006178 | Bacteria | 2343 |
| 266 | Ga0075369_10335085 | 3300006186 | Archaea | 709 |
| 267 | Ga0075366_10009667 | 3300006195 | Bacteria | 5390 |
| 268 | Ga0097621_100073548 | 3300006237 | Bacteria | 2829 |
| 269 | Ga0097621_100183506 | 3300006237 | Unclassified | 1809 |
| 270 | Ga0097621_102434840 | 3300006237 | Unclassified | 501 |
| 271 | Ga0075370_10033251 | 3300006353 | Bacteria | 2887 |
| 272 | Ga0068871_100064962 | 3300006358 | Bacteria | 2988 |
| 273 | Ga0068871_100297997 | 3300006358 | Bacteria | 1415 |
| 274 | Ga0068871_100402308 | 3300006358 | Bacteria | 1219 |
| 275 | Ga0068871_100927422 | 3300006358 | Bacteria | 808 |
| 276 | Ga0068871_100996510 | 3300006358 | Bacteria | 780 |
| 277 | Ga0068871_101599655 | 3300006358 | Bacteria | 617 |
| 278 | Ga0068871_101686193 | 3300006358 | Bacteria | 601 |
| 279 | Ga0075428_100010724 | 3300006844 | Bacteria | 10187 |
| 280 | Ga0075428_100071091 | 3300006844 | Bacteria | 3803 |
| 281 | Ga0075428_100132288 | 3300006844 | Bacteria | 2713 |
| 282 | Ga0075428_100336039 | 3300006844 | Bacteria | 1622 |
| 283 | Ga0075428_100941311 | 3300006844 | Bacteria | 915 |
| 284 | Ga0075428_101148545 | 3300006844 | Bacteria | 819 |
| 285 | Ga0075428_102631023 | 3300006844 | Bacteria | 514 |
| 286 | Ga0075430_100017805 | 3300006846 | Bacteria | 6048 |
| 287 | Ga0075430_100019061 | 3300006846 | Bacteria | 5837 |
| 288 | Ga0075430_100061518 | 3300006846 | Bacteria | 3155 |
| 289 | Ga0075430_100202398 | 3300006846 | Unclassified | 1648 |
| 290 | Ga0075430_100382920 | 3300006846 | Unclassified | 1161 |
| 291 | Ga0075430_100708444 | 3300006846 | Bacteria | 830 |
| 292 | Ga0075430_100866753 | 3300006846 | Bacteria | 744 |
| 293 | Ga0075430_101112134 | 3300006846 | Bacteria | 651 |
| 294 | Ga0075430_101263071 | 3300006846 | Bacteria | 608 |
| 295 | Ga0075431_100595588 | 3300006847 | Bacteria | 1090 |
| 296 | Ga0075431_101231372 | 3300006847 | Archaea | 711 |
| 297 | Ga0075431_101264756 | 3300006847 | Unclassified | 699 |
| 298 | Ga0075431_101418004 | 3300006847 | Unclassified | 654 |
| 299 | Ga0075433_10026046 | 3300006852 | Bacteria | 4947 |
| 300 | Ga0075433_10028333 | 3300006852 | Bacteria | 4760 |
| 301 | Ga0075433_10104570 | 3300006852 | Bacteria | 2508 |
| 302 | Ga0075433_10500118 | 3300006852 | Bacteria | 1070 |
| 303 | Ga0075433_10895592 | 3300006852 | Bacteria | 774 |
| 304 | Ga0075434_100002784 | 3300006871 | Bacteria | 15480 |
| 305 | Ga0075434_100027981 | 3300006871 | Bacteria | 5535 |
| 306 | Ga0075434_100031212 | 3300006871 | Bacteria | 5252 |
| 307 | Ga0075434_100116835 | 3300006871 | Unclassified | 2681 |
| 308 | Ga0075434_100295964 | 3300006871 | Bacteria | 1638 |
| 309 | Ga0075434_100419277 | 3300006871 | Bacteria | 1360 |
| 310 | Ga0075434_100848793 | 3300006871 | Bacteria | 929 |
| 311 | Ga0075434_101276311 | 3300006871 | Unclassified | 745 |
| 312 | Ga0075429_100031024 | 3300006880 | Bacteria | 4645 |
| 313 | Ga0075429_100031059 | 3300006880 | Bacteria | 4643 |
| 314 | Ga0075429_100131023 | 3300006880 | Bacteria | 2193 |
| 315 | Ga0075429_100131370 | 3300006880 | Bacteria | 2190 |
| 316 | Ga0075429_100152347 | 3300006880 | Bacteria | 2024 |
| 317 | Ga0075429_100235486 | 3300006880 | Unclassified | 1604 |
| 318 | Ga0075429_100310362 | 3300006880 | Bacteria | 1381 |
| 319 | Ga0075429_100633518 | 3300006880 | Bacteria | 937 |
| 320 | Ga0075429_101413257 | 3300006880 | Bacteria | 606 |
| 321 | Ga0068865_100121111 | 3300006881 | Bacteria | 1946 |
| 322 | Ga0068865_100187815 | 3300006881 | Bacteria | 1596 |
| 323 | Ga0068865_100415698 | 3300006881 | Bacteria | 1105 |
| 324 | Ga0068865_101291166 | 3300006881 | Bacteria | 649 |
| 325 | Ga0075436_100015139 | 3300006914 | Bacteria | 5286 |
| 326 | Ga0075436_100090650 | 3300006914 | Bacteria | 2125 |
| 327 | Ga0097620_100027741 | 3300006931 | Bacteria | 5679 |
| 328 | Ga0097620_100197407 | 3300006931 | Bacteria | 2096 |
| 329 | Ga0097620_100244853 | 3300006931 | Bacteria | 1882 |
| 330 | Ga0097620_100379593 | 3300006931 | Bacteria | 1509 |
| 331 | Ga0097620_100410879 | 3300006931 | Bacteria | 1449 |
| 332 | Ga0097620_100505469 | 3300006931 | Unclassified | 1304 |
| 333 | Ga0097620_101849231 | 3300006931 | Bacteria | 667 |
| 334 | Ga0097620_102508684 | 3300006931 | Unclassified | 568 |
| 335 | Ga0097620_102628332 | 3300006931 | Bacteria | 554 |
| 336 | Ga0075435_100102968 | 3300007076 | Bacteria | 2367 |
| 337 | Ga0075435_101178059 | 3300007076 | Unclassified | 670 |
| 338 | Ga0105250_10262023 | 3300009092 | Bacteria | 740 |
| 339 | Ga0105240_10635565 | 3300009093 | Bacteria | 1171 |
| 340 | Ga0111539_10000002 | 3300009094 | Bacteria | 983359 |
| 341 | Ga0111539_10000494 | 3300009094 | Bacteria | 50039 |
| 342 | Ga0111539_10000981 | 3300009094 | Bacteria | 37479 |
| 343 | Ga0111539_10004818 | 3300009094 | Bacteria | 17588 |
| 344 | Ga0111539_10009303 | 3300009094 | Bacteria | 12406 |
| 345 | Ga0111539_10014610 | 3300009094 | Bacteria | 9799 |
| 346 | Ga0111539_10031561 | 3300009094 | Bacteria | 6435 |
| 347 | Ga0111539_10031711 | 3300009094 | Bacteria | 6420 |
| 348 | Ga0111539_10088335 | 3300009094 | Bacteria | 3642 |
| 349 | Ga0111539_10211131 | 3300009094 | Bacteria | 2262 |
| 350 | Ga0111539_10375909 | 3300009094 | Bacteria | 1654 |
| 351 | Ga0111539_10718218 | 3300009094 | Unclassified | 1163 |
| 352 | Ga0111539_10729901 | 3300009094 | Bacteria | 1153 |
| 353 | Ga0111539_11166340 | 3300009094 | Unclassified | 895 |
| 354 | Ga0111539_11225417 | 3300009094 | Bacteria | 871 |
| 355 | Ga0111539_11775921 | 3300009094 | Bacteria | 715 |
| 356 | Ga0111539_12396531 | 3300009094 | Bacteria | 612 |
| 357 | Ga0111539_12407837 | 3300009094 | Bacteria | 611 |
| 358 | Ga0111539_12423775 | 3300009094 | Bacteria | 609 |
| 359 | Ga0111539_13278058 | 3300009094 | Bacteria | 521 |
| 360 | Ga0105245_10362090 | 3300009098 | Unclassified | 1440 |
| 361 | Ga0105245_11009328 | 3300009098 | Bacteria | 877 |
| 362 | Ga0105245_11092064 | 3300009098 | Bacteria | 844 |
| 363 | Ga0105247_10766862 | 3300009101 | Bacteria | 733 |
| 364 | Ga0114129_10000410 | 3300009147 | Bacteria | 50569 |
| 365 | Ga0114129_10010375 | 3300009147 | Bacteria | 13286 |
| 366 | Ga0114129_10021226 | 3300009147 | Bacteria | 9221 |
| 367 | Ga0114129_10103495 | 3300009147 | Bacteria | 3936 |
| 368 | Ga0114129_10131662 | 3300009147 | Bacteria | 3434 |
| 369 | Ga0114129_10448604 | 3300009147 | Bacteria | 1692 |
| 370 | Ga0114129_10491555 | 3300009147 | Bacteria | 1604 |
| 371 | Ga0114129_10491991 | 3300009147 | Bacteria | 1603 |
| 372 | Ga0114129_11290882 | 3300009147 | Bacteria | 905 |
| 373 | Ga0114129_11439070 | 3300009147 | Bacteria | 849 |
| 374 | Ga0114129_11785621 | 3300009147 | Bacteria | 748 |
| 375 | Ga0114129_12031475 | 3300009147 | Bacteria | 695 |
| 376 | Ga0114129_12975644 | 3300009147 | Bacteria | 558 |
| 377 | Ga0105243_10214883 | 3300009148 | Bacteria | 1696 |
| 378 | Ga0105243_10499044 | 3300009148 | Unclassified | 1153 |
| 379 | Ga0105243_10540476 | 3300009148 | Bacteria | 1111 |
| 380 | Ga0105243_11355771 | 3300009148 | Bacteria | 730 |
| 381 | Ga0105243_12573886 | 3300009148 | Bacteria | 548 |
| 382 | Ga0105241_10227160 | 3300009174 | Bacteria | 1572 |
| 383 | Ga0105241_11718821 | 3300009174 | Bacteria | 610 |
| 384 | Ga0105242_10027112 | 3300009176 | Bacteria | 4546 |
| 385 | Ga0105242_10148153 | 3300009176 | Bacteria | 2044 |
| 386 | Ga0105242_10704730 | 3300009176 | Bacteria | 988 |
| 387 | Ga0105242_11123983 | 3300009176 | Bacteria | 801 |
| 388 | Ga0105242_11429965 | 3300009176 | Bacteria | 720 |
| 389 | Ga0105242_12066370 | 3300009176 | Bacteria | 613 |
| 390 | Ga0105242_12556086 | 3300009176 | Bacteria | 559 |
| 391 | Ga0105242_12829305 | 3300009176 | Bacteria | 536 |
| 392 | Ga0105248_10056208 | 3300009177 | Bacteria | 4415 |
| 393 | Ga0105248_10078834 | 3300009177 | Bacteria | 3702 |
| 394 | Ga0105248_10185719 | 3300009177 | Bacteria | 2343 |
| 395 | Ga0105248_10200924 | 3300009177 | Bacteria | 2246 |
| 396 | Ga0105248_10268822 | 3300009177 | Bacteria | 1920 |
| 397 | Ga0105248_10588409 | 3300009177 | Bacteria | 1256 |
| 398 | Ga0105248_10639528 | 3300009177 | Bacteria | 1200 |
| 399 | Ga0105237_10789770 | 3300009545 | Bacteria | 956 |
| 400 | Ga0105249_10193204 | 3300009553 | Unclassified | 1988 |
| 401 | Ga0105249_10288108 | 3300009553 | Unclassified | 1643 |
| 402 | Ga0105249_10334000 | 3300009553 | Bacteria | 1530 |
| 403 | Ga0105249_10536530 | 3300009553 | Bacteria | 1219 |
| 404 | Ga0105249_11500721 | 3300009553 | Bacteria | 746 |
| 405 | Ga0105249_12119870 | 3300009553 | Bacteria | 635 |
| 406 | Ga0105249_12177084 | 3300009553 | Bacteria | 627 |
| 407 | Ga0105249_13359684 | 3300009553 | Bacteria | 515 |
| 408 | Ga0105239_13254207 | 3300010375 | Bacteria | 529 |
| 409 | Ga0105246_10072654 | 3300011119 | Bacteria | 2426 |
| 410 | Ga0105246_10655482 | 3300011119 | Bacteria | 914 |
| 411 | Ga0105246_11465365 | 3300011119 | Bacteria | 640 |
| 412 | Ga0157370_10473771 | 3300013104 | Bacteria | 1151 |
| 413 | Ga0157370_11605225 | 3300013104 | Bacteria | 584 |
| 414 | Ga0157374_10091418 | 3300013296 | Bacteria | 2902 |
| 415 | Ga0157374_10392762 | 3300013296 | Bacteria | 1383 |
| 416 | Ga0157378_10493590 | 3300013297 | Bacteria | 1222 |
| 417 | Ga0157378_10701691 | 3300013297 | Bacteria | 1031 |
| 418 | Ga0157378_10705802 | 3300013297 | Bacteria | 1028 |
| 419 | Ga0157378_10816167 | 3300013297 | Bacteria | 959 |
| 420 | Ga0157378_11217201 | 3300013297 | Unclassified | 793 |
| 421 | Ga0157378_11424839 | 3300013297 | Bacteria | 736 |
| 422 | Ga0163162_10081557 | 3300013306 | Bacteria | 3305 |
| 423 | Ga0163162_10916219 | 3300013306 | Bacteria | 989 |
| 424 | Ga0163162_12960292 | 3300013306 | Bacteria | 546 |
| 425 | Ga0157375_10122515 | 3300013308 | Bacteria | 2712 |
| 426 | Ga0157375_10748925 | 3300013308 | Bacteria | 1128 |
| 427 | Ga0157375_10922867 | 3300013308 | Bacteria | 1016 |
| 428 | Ga0157375_12004728 | 3300013308 | Bacteria | 688 |
| 429 | Ga0163163_10000663 | 3300014325 | Bacteria | 29504 |
| 430 | Ga0163163_10051186 | 3300014325 | Bacteria | 4072 |
| 431 | Ga0163163_10051300 | 3300014325 | Bacteria | 4067 |
| 432 | Ga0163163_12535584 | 3300014325 | Bacteria | 571 |
| 433 | Ga0157380_10019060 | 3300014326 | Bacteria | 5107 |
| 434 | Ga0157380_10147873 | 3300014326 | Bacteria | 2027 |
| 435 | Ga0157380_10159384 | 3300014326 | Bacteria | 1960 |
| 436 | Ga0157380_10244769 | 3300014326 | Bacteria | 1619 |
| 437 | Ga0157380_10377514 | 3300014326 | Unclassified | 1337 |
| 438 | Ga0157380_11045784 | 3300014326 | Bacteria | 852 |
| 439 | Ga0157380_11440155 | 3300014326 | Unclassified | 740 |
| 440 | Ga0157380_11467623 | 3300014326 | Bacteria | 734 |
| 441 | Ga0157380_11483884 | 3300014326 | Unclassified | 731 |
| 442 | Ga0157380_13327703 | 3300014326 | Unclassified | 514 |
| 443 | Ga0157377_10168058 | 3300014745 | Bacteria | 1369 |
| 444 | Ga0157377_10182204 | 3300014745 | Bacteria | 1322 |
| 445 | Ga0157377_10409306 | 3300014745 | Bacteria | 926 |
| 446 | Ga0157379_10018789 | 3300014968 | Bacteria | 6095 |
| 447 | Ga0157379_10362481 | 3300014968 | Unclassified | 1328 |
| 448 | Ga0157379_10739262 | 3300014968 | Bacteria | 926 |
| 449 | Ga0157379_10961823 | 3300014968 | Bacteria | 813 |
| 450 | Ga0157379_11628553 | 3300014968 | Bacteria | 631 |
| 451 | Ga0157376_10102217 | 3300014969 | Bacteria | 2507 |
| 452 | Ga0157376_10932279 | 3300014969 | Bacteria | 888 |
| 453 | Ga0157376_10947980 | 3300014969 | Bacteria | 881 |
| 454 | Ga0157376_11326572 | 3300014969 | Bacteria | 750 |
| 455 | Ga0157376_12532350 | 3300014969 | Bacteria | 553 |
| 456 | Ga0163161_10344775 | 3300017792 | Bacteria | 1183 |
| 457 | Ga0163161_10598561 | 3300017792 | Bacteria | 909 |
| 458 | Ga0207697_10028355 | 3300025315 | Bacteria | 2290 |
| 459 | Ga0207697_10104649 | 3300025315 | Bacteria | 1209 |
| 460 | Ga0207656_10114764 | 3300025321 | Bacteria | 1248 |
| 461 | Ga0207682_10141899 | 3300025893 | Bacteria | 1078 |
| 462 | Ga0207642_10361294 | 3300025899 | Bacteria | 859 |
| 463 | Ga0207642_10390764 | 3300025899 | Bacteria | 830 |
| 464 | Ga0207642_10564474 | 3300025899 | Bacteria | 704 |
| 465 | Ga0207710_10728913 | 3300025900 | Bacteria | 520 |
| 466 | Ga0207688_10411373 | 3300025901 | Bacteria | 840 |
| 467 | Ga0207688_10641101 | 3300025901 | Bacteria | 670 |
| 468 | Ga0207680_10012973 | 3300025903 | Bacteria | 4261 |
| 469 | Ga0207680_10175344 | 3300025903 | Bacteria | 1446 |
| 470 | Ga0207680_10802893 | 3300025903 | Bacteria | 675 |
| 471 | Ga0207680_11198531 | 3300025903 | Bacteria | 541 |
| 472 | Ga0207647_10353135 | 3300025904 | Bacteria | 832 |
| 473 | Ga0207699_10369831 | 3300025906 | Bacteria | 1016 |
| 474 | Ga0207645_10006858 | 3300025907 | Bacteria | 8126 |
| 475 | Ga0207645_10092758 | 3300025907 | Bacteria | 1942 |
| 476 | Ga0207645_10139529 | 3300025907 | Bacteria | 1579 |
| 477 | Ga0207643_10160496 | 3300025908 | Bacteria | 1352 |
| 478 | Ga0207643_10468671 | 3300025908 | Bacteria | 803 |
| 479 | Ga0207684_10050119 | 3300025910 | Bacteria | 3542 |
| 480 | Ga0207707_10755878 | 3300025912 | Bacteria | 813 |
| 481 | Ga0207693_10404735 | 3300025915 | Bacteria | 1067 |
| 482 | Ga0207660_10126900 | 3300025917 | Bacteria | 1938 |
| 483 | Ga0207660_10489262 | 3300025917 | Bacteria | 997 |
| 484 | Ga0207662_10000724 | 3300025918 | Bacteria | 15073 |
| 485 | Ga0207662_10036889 | 3300025918 | Bacteria | 2859 |
| 486 | Ga0207662_10079506 | 3300025918 | Bacteria | 1998 |
| 487 | Ga0207662_10213307 | 3300025918 | Bacteria | 1254 |
| 488 | Ga0207649_10014442 | 3300025920 | Bacteria | 4422 |
| 489 | Ga0207649_10074085 | 3300025920 | Bacteria | 2184 |
| 490 | Ga0207652_10753920 | 3300025921 | Bacteria | 866 |
| 491 | Ga0207646_10119235 | 3300025922 | Bacteria | 2370 |
| 492 | Ga0207646_10452790 | 3300025922 | Bacteria | 1158 |
| 493 | Ga0207646_10683837 | 3300025922 | Unclassified | 918 |
| 494 | Ga0207646_11431012 | 3300025922 | Bacteria | 600 |
| 495 | Ga0207681_10108834 | 3300025923 | Bacteria | 2012 |
| 496 | Ga0207681_10170620 | 3300025923 | Bacteria | 1649 |
| 497 | Ga0207681_10242915 | 3300025923 | Bacteria | 1402 |
| 498 | Ga0207681_10849591 | 3300025923 | Bacteria | 763 |
| 499 | Ga0207681_11180808 | 3300025923 | Bacteria | 643 |
| 500 | Ga0207650_10005949 | 3300025925 | Bacteria | 8327 |
| 501 | Ga0207650_10212934 | 3300025925 | Bacteria | 1552 |
| 502 | Ga0207650_10862600 | 3300025925 | Bacteria | 768 |
| 503 | Ga0207659_10070657 | 3300025926 | Bacteria | 2546 |
| 504 | Ga0207659_10218667 | 3300025926 | Bacteria | 1530 |
| 505 | Ga0207659_10245933 | 3300025926 | Bacteria | 1449 |
| 506 | Ga0207659_10860743 | 3300025926 | Bacteria | 779 |
| 507 | Ga0207659_11157736 | 3300025926 | Bacteria | 665 |
| 508 | Ga0207687_10424821 | 3300025927 | Unclassified | 1097 |
| 509 | Ga0207687_10455804 | 3300025927 | Bacteria | 1061 |
| 510 | Ga0207687_10735457 | 3300025927 | Bacteria | 839 |
| 511 | Ga0207700_10407357 | 3300025928 | Bacteria | 1192 |
| 512 | Ga0207664_10019126 | 3300025929 | Bacteria | 5057 |
| 513 | Ga0207644_10025621 | 3300025931 | Bacteria | 4056 |
| 514 | Ga0207644_11804282 | 3300025931 | Bacteria | 512 |
| 515 | Ga0207690_10090510 | 3300025932 | Bacteria | 2160 |
| 516 | Ga0207706_10255567 | 3300025933 | Bacteria | 1530 |
| 517 | Ga0207706_11009822 | 3300025933 | Unclassified | 699 |
| 518 | Ga0207686_10586134 | 3300025934 | Bacteria | 876 |
| 519 | Ga0207686_10829244 | 3300025934 | Unclassified | 743 |
| 520 | Ga0207709_10218683 | 3300025935 | Bacteria | 1372 |
| 521 | Ga0207709_11603613 | 3300025935 | Archaea | 541 |
| 522 | Ga0207670_10009947 | 3300025936 | Bacteria | 5451 |
| 523 | Ga0207670_10055982 | 3300025936 | Bacteria | 2668 |
| 524 | Ga0207670_10154626 | 3300025936 | Bacteria | 1706 |
| 525 | Ga0207670_10213452 | 3300025936 | Bacteria | 1473 |
| 526 | Ga0207670_10856524 | 3300025936 | Bacteria | 759 |
| 527 | Ga0207670_10882285 | 3300025936 | Bacteria | 748 |
| 528 | Ga0207670_11124515 | 3300025936 | Bacteria | 664 |
| 529 | Ga0207669_10163951 | 3300025937 | Bacteria | 1574 |
| 530 | Ga0207669_10513240 | 3300025937 | Bacteria | 961 |
| 531 | Ga0207669_10577353 | 3300025937 | Bacteria | 911 |
| 532 | Ga0207669_10949103 | 3300025937 | Bacteria | 721 |
| 533 | Ga0207704_10293654 | 3300025938 | Bacteria | 1242 |
| 534 | Ga0207665_10708488 | 3300025939 | Bacteria | 792 |
| 535 | Ga0207691_10035117 | 3300025940 | Bacteria | 4658 |
| 536 | Ga0207691_10589775 | 3300025940 | Bacteria | 941 |
| 537 | Ga0207711_10052374 | 3300025941 | Bacteria | 3498 |
| 538 | Ga0207711_10059255 | 3300025941 | Bacteria | 3296 |
| 539 | Ga0207711_10231968 | 3300025941 | Bacteria | 1691 |
| 540 | Ga0207711_10449608 | 3300025941 | Bacteria | 1199 |
| 541 | Ga0207711_11147549 | 3300025941 | Bacteria | 718 |
| 542 | Ga0207711_11383338 | 3300025941 | Bacteria | 646 |
| 543 | Ga0207689_10006797 | 3300025942 | Bacteria | 10066 |
| 544 | Ga0207689_10089587 | 3300025942 | Bacteria | 2527 |
| 545 | Ga0207689_10155386 | 3300025942 | Bacteria | 1886 |
| 546 | Ga0207689_10276070 | 3300025942 | Bacteria | 1391 |
| 547 | Ga0207661_10003359 | 3300025944 | Bacteria | 11114 |
| 548 | Ga0207679_10003327 | 3300025945 | Bacteria | 9926 |
| 549 | Ga0207679_10099569 | 3300025945 | Bacteria | 2270 |
| 550 | Ga0207679_10743898 | 3300025945 | Unclassified | 892 |
| 551 | Ga0207679_10775176 | 3300025945 | Bacteria | 873 |
| 552 | Ga0207651_10063293 | 3300025960 | Bacteria | 2583 |
| 553 | Ga0207651_10113967 | 3300025960 | Bacteria | 2035 |
| 554 | Ga0207651_10146104 | 3300025960 | Bacteria | 1834 |
| 555 | Ga0207651_10284456 | 3300025960 | Bacteria | 1368 |
| 556 | Ga0207712_10684787 | 3300025961 | Bacteria | 894 |
| 557 | Ga0207712_11565837 | 3300025961 | Bacteria | 591 |
| 558 | Ga0207712_11928752 | 3300025961 | Unclassified | 529 |
| 559 | Ga0207668_10241305 | 3300025972 | Unclassified | 1462 |
| 560 | Ga0207668_10388884 | 3300025972 | Bacteria | 1176 |
| 561 | Ga0207668_10566262 | 3300025972 | Bacteria | 986 |
| 562 | Ga0207640_10136137 | 3300025981 | Bacteria | 1783 |
| 563 | Ga0207640_10425090 | 3300025981 | Unclassified | 1088 |
| 564 | Ga0207658_10177662 | 3300025986 | Bacteria | 1759 |
| 565 | Ga0207658_10219745 | 3300025986 | Bacteria | 1598 |
| 566 | Ga0207658_10233156 | 3300025986 | Bacteria | 1555 |
| 567 | Ga0207658_10471730 | 3300025986 | Bacteria | 1114 |
| 568 | Ga0207658_10571006 | 3300025986 | Bacteria | 1014 |
| 569 | Ga0207677_11892456 | 3300026023 | Bacteria | 554 |
| 570 | Ga0207677_11922384 | 3300026023 | Unclassified | 550 |
| 571 | Ga0207703_10028166 | 3300026035 | Bacteria | 4426 |
| 572 | Ga0207703_10277807 | 3300026035 | Bacteria | 1520 |
| 573 | Ga0207703_10481808 | 3300026035 | Bacteria | 1162 |
| 574 | Ga0207703_11466846 | 3300026035 | Bacteria | 656 |
| 575 | Ga0207639_10948082 | 3300026041 | Bacteria | 805 |
| 576 | Ga0207678_10003414 | 3300026067 | Bacteria | 14300 |
| 577 | Ga0207678_10036078 | 3300026067 | Bacteria | 4303 |
| 578 | Ga0207678_11021343 | 3300026067 | Bacteria | 732 |
| 579 | Ga0207678_11704107 | 3300026067 | Bacteria | 553 |
| 580 | Ga0207708_10008073 | 3300026075 | Bacteria | 7802 |
| 581 | Ga0207708_10035538 | 3300026075 | Bacteria | 3791 |
| 582 | Ga0207708_10050949 | 3300026075 | Bacteria | 3152 |
| 583 | Ga0207708_10097773 | 3300026075 | Bacteria | 2269 |
| 584 | Ga0207708_10383685 | 3300026075 | Bacteria | 1159 |
| 585 | Ga0207708_11271275 | 3300026075 | Bacteria | 644 |
| 586 | Ga0207641_10190676 | 3300026088 | Bacteria | 1884 |
| 587 | Ga0207641_10491030 | 3300026088 | Bacteria | 1191 |
| 588 | Ga0207641_10689032 | 3300026088 | Bacteria | 1006 |
| 589 | Ga0207641_10753911 | 3300026088 | Bacteria | 961 |
| 590 | Ga0207648_10034858 | 3300026089 | Bacteria | 4437 |
| 591 | Ga0207648_10049704 | 3300026089 | Bacteria | 3668 |
| 592 | Ga0207648_10138059 | 3300026089 | Bacteria | 2148 |
| 593 | Ga0207648_10484744 | 3300026089 | Bacteria | 1130 |
| 594 | Ga0207648_10878959 | 3300026089 | Bacteria | 836 |
| 595 | Ga0207676_10057882 | 3300026095 | Bacteria | 3054 |
| 596 | Ga0207676_10232121 | 3300026095 | Bacteria | 1650 |
| 597 | Ga0207676_10764784 | 3300026095 | Bacteria | 940 |
| 598 | Ga0207674_10029870 | 3300026116 | Bacteria | 5735 |
| 599 | Ga0207674_10284441 | 3300026116 | Bacteria | 1602 |
| 600 | Ga0207674_10509282 | 3300026116 | Bacteria | 1163 |
| 601 | Ga0207674_10775663 | 3300026116 | Unclassified | 925 |
| 602 | Ga0207674_11322739 | 3300026116 | Bacteria | 690 |
| 603 | Ga0207675_100056601 | 3300026118 | Bacteria | 3658 |
| 604 | Ga0207675_100125191 | 3300026118 | Bacteria | 2434 |
| 605 | Ga0207675_100152156 | 3300026118 | Bacteria | 2202 |
| 606 | Ga0207675_100224347 | 3300026118 | Bacteria | 1811 |
| 607 | Ga0207675_100252953 | 3300026118 | Bacteria | 1706 |
| 608 | Ga0207675_100278724 | 3300026118 | Bacteria | 1624 |
| 609 | Ga0207675_100927920 | 3300026118 | Bacteria | 887 |
| 610 | Ga0207675_100972704 | 3300026118 | Bacteria | 867 |
| 611 | Ga0207675_101036903 | 3300026118 | Bacteria | 839 |
| 612 | Ga0207675_102309182 | 3300026118 | Bacteria | 552 |
| 613 | Ga0207683_11075672 | 3300026121 | Bacteria | 746 |
| 614 | Ga0207683_11153016 | 3300026121 | Bacteria | 719 |
| 615 | Ga0209969_1023274 | 3300027360 | Bacteria | 928 |
| 616 | Ga0209967_1062605 | 3300027364 | Unclassified | 578 |
| 617 | Ga0209974_10469283 | 3300027876 | Bacteria | 501 |
| 618 | Ga0207428_10000004 | 3300027907 | Bacteria | 727800 |
| 619 | Ga0207428_10000066 | 3300027907 | Bacteria | 150622 |
| 620 | Ga0207428_10001093 | 3300027907 | Bacteria | 29501 |
| 621 | Ga0207428_10005537 | 3300027907 | Bacteria | 11764 |
| 622 | Ga0207428_10055858 | 3300027907 | Bacteria | 3138 |
| 623 | Ga0207428_10066960 | 3300027907 | Bacteria | 2829 |
| 624 | Ga0207428_10071304 | 3300027907 | Bacteria | 2729 |
| 625 | Ga0207428_10092199 | 3300027907 | Bacteria | 2351 |
| 626 | Ga0207428_10384192 | 3300027907 | Bacteria | 1030 |
| 627 | Ga0207428_11004282 | 3300027907 | Bacteria | 586 |
| 628 | Ga0268266_10212024 | 3300028379 | Bacteria | 1776 |
| 629 | Ga0268266_11470027 | 3300028379 | Bacteria | 657 |
| 630 | Ga0268265_11107770 | 3300028380 | Bacteria | 786 |
| 631 | Ga0268265_11319233 | 3300028380 | Bacteria | 722 |
| 632 | Ga0268265_11349863 | 3300028380 | Bacteria | 714 |
| 633 | Ga0268265_12339696 | 3300028380 | Bacteria | 541 |
| 634 | Ga0268264_10115035 | 3300028381 | Bacteria | 2363 |
| 635 | Ga0268264_10192729 | 3300028381 | Bacteria | 1859 |
| 636 | Ga0268264_10527165 | 3300028381 | Unclassified | 1155 |
| 637 | Ga0268264_10594671 | 3300028381 | Bacteria | 1090 |
| 638 | Ga0268264_11086496 | 3300028381 | Bacteria | 808 |
| 639 | Ga0268264_11789745 | 3300028381 | Bacteria | 624 |
| 640 | Ga0268264_12631312 | 3300028381 | Bacteria | 507 |
| 641 | Ga0307408_100023632 | 3300031548 | Bacteria | 4190 |
| 642 | Ga0307408_100261771 | 3300031548 | Bacteria | 1432 |
| 643 | Ga0307408_100402624 | 3300031548 | Bacteria | 1175 |
| 644 | Ga0307405_10006893 | 3300031731 | Bacteria | 5637 |
| 645 | Ga0307405_10221650 | 3300031731 | Bacteria | 1388 |
| 646 | Ga0307413_10239745 | 3300031824 | Bacteria | 1338 |
| 647 | Ga0307413_10331048 | 3300031824 | Bacteria | 1167 |
| 648 | Ga0307413_10364976 | 3300031824 | Bacteria | 1119 |
| 649 | Ga0307413_10382255 | 3300031824 | Unclassified | 1097 |
| 650 | Ga0307413_10417206 | 3300031824 | Bacteria | 1056 |
| 651 | Ga0307413_10519559 | 3300031824 | Bacteria | 960 |
| 652 | Ga0307413_10626788 | 3300031824 | Bacteria | 884 |
| 653 | Ga0307410_10002658 | 3300031852 | Bacteria | 8714 |
| 654 | Ga0307410_10042686 | 3300031852 | Bacteria | 3000 |
| 655 | Ga0307410_10147912 | 3300031852 | Bacteria | 1745 |
| 656 | Ga0307410_10508726 | 3300031852 | Bacteria | 992 |
| 657 | Ga0307410_10782691 | 3300031852 | Bacteria | 810 |
| 658 | Ga0307406_10030254 | 3300031901 | Bacteria | 3286 |
| 659 | Ga0307406_10098326 | 3300031901 | Bacteria | 1987 |
| 660 | Ga0307406_10736648 | 3300031901 | Bacteria | 826 |
| 661 | Ga0307407_10033690 | 3300031903 | Bacteria | 2797 |
| 662 | Ga0307407_10051437 | 3300031903 | Bacteria | 2362 |
| 663 | Ga0307407_10090709 | 3300031903 | Bacteria | 1872 |
| 664 | Ga0307407_10331626 | 3300031903 | Bacteria | 1071 |
| 665 | Ga0307407_10411242 | 3300031903 | Bacteria | 973 |
| 666 | Ga0307412_10002780 | 3300031911 | Bacteria | 9729 |
| 667 | Ga0307412_10281513 | 3300031911 | Bacteria | 1306 |
| 668 | Ga0307412_10367850 | 3300031911 | Unclassified | 1160 |
| 669 | Ga0307412_10941510 | 3300031911 | Bacteria | 760 |
| 670 | Ga0307412_11208239 | 3300031911 | Bacteria | 677 |
| 671 | Ga0307409_100026062 | 3300031995 | Bacteria | 4116 |
| 672 | Ga0307409_100027404 | 3300031995 | Bacteria | 4037 |
| 673 | Ga0307409_100061598 | 3300031995 | Bacteria | 2933 |
| 674 | Ga0307409_100067913 | 3300031995 | Bacteria | 2817 |
| 675 | Ga0307409_100110777 | 3300031995 | Bacteria | 2301 |
| 676 | Ga0307409_100188142 | 3300031995 | Bacteria | 1835 |
| 677 | Ga0307416_100064487 | 3300032002 | Bacteria | 3005 |
| 678 | Ga0307416_100084872 | 3300032002 | Bacteria | 2693 |
| 679 | Ga0307416_100163096 | 3300032002 | Bacteria | 2063 |
| 680 | Ga0307416_100374872 | 3300032002 | Bacteria | 1450 |
| 681 | Ga0307416_100634802 | 3300032002 | Bacteria | 1151 |
| 682 | Ga0307416_100812870 | 3300032002 | Bacteria | 1031 |
| 683 | Ga0307416_102169404 | 3300032002 | Unclassified | 657 |
| 684 | Ga0307414_10188975 | 3300032004 | Bacteria | 1665 |
| 685 | Ga0307414_10235540 | 3300032004 | Bacteria | 1512 |
| 686 | Ga0307414_10371664 | 3300032004 | Bacteria | 1233 |
| 687 | Ga0307414_10400370 | 3300032004 | Bacteria | 1192 |
| 688 | Ga0307414_11165783 | 3300032004 | Bacteria | 713 |
| 689 | Ga0307411_10111433 | 3300032005 | Bacteria | 1959 |
| 690 | Ga0307411_10219441 | 3300032005 | Bacteria | 1474 |
| 691 | Ga0307411_10267673 | 3300032005 | Bacteria | 1353 |
| 692 | Ga0307411_10301332 | 3300032005 | Bacteria | 1285 |
| 693 | Ga0307411_10329942 | 3300032005 | Bacteria | 1236 |
| 694 | Ga0307411_10469000 | 3300032005 | Unclassified | 1057 |
| 695 | Ga0307411_10469203 | 3300032005 | Bacteria | 1057 |
| 696 | Ga0307411_11645149 | 3300032005 | Unclassified | 593 |
| 697 | Ga0307415_100043485 | 3300032126 | Bacteria | 2997 |
| 698 | Ga0307415_100179480 | 3300032126 | Bacteria | 1660 |
| 699 | Ga0307415_100347555 | 3300032126 | Bacteria | 1247 |
| 700 | Ga0307415_100829886 | 3300032126 | Unclassified | 846 |
| 701 | Ga0307415_101304893 | 3300032126 | Bacteria | 688 |
| 702 | Ga0373938_0188269 | 3300034957 | Archaea | 567 |
| 703 | Ga0373936_0400656 | 3300035113 | Bacteria | 630 |
| 704 | Ga0373936_0611281 | 3300035113 | Bacteria | 512 |
| 705 | Ga0373954_0047240 | 3300035118 | Bacteria | 2014 |
| 706 | Ga0373957_0007399 | 3300035120 | Bacteria | 3513 |
| 707 | Ga0373960_0190300 | 3300035121 | Bacteria | 721 |
| 708 | Ga0373955_0012700 | 3300035172 | Bacteria | 4055 |
| 709 | Ga0373955_0499374 | 3300035172 | Bacteria | 743 |
| 710 | Ga0373955_0865220 | 3300035172 | Bacteria | 556 |
| 711 | Ga0373961_0445509 | 3300035241 | Bacteria | 504 |
| 712 | Ga0373933_0003937 | 3300035724 | Bacteria | 8198 |
| 713 | Ga0373937_0002473 | 3300036401 | Bacteria | 15364 |
| 714 | Ga0373937_0185689 | 3300036401 | Bacteria | 1953 |
| 715 | Ga0373937_1732953 | 3300036401 | Bacteria | 571 |
| 716 | Ga0395898_1768798 | 3300037466 | Bacteria | 540 |
| 717 | Ga0436362_0045085 | 3300039453 | Bacteria | 801 |
| 718 | Ga0439453_0185251 | 3300041408 | Bacteria | 510 |
| 719 | Ga0451795_0189527 | 3300041456 | Bacteria | 621 |
| 720 | Ga0451800_0575700 | 3300041459 | Bacteria | 1231 |
| 721 | Ga0451807_0021731 | 3300041486 | Bacteria | 520 |
| 722 | Ga0451807_0526429 | 3300041486 | Bacteria | 721 |
| 723 | Ga0451807_0793962 | 3300041486 | Bacteria | 618 |
| 724 | Ga0451839_0563425 | 3300041496 | Bacteria | 702 |
| 725 | Ga0451849_1226666 | 3300041505 | Bacteria | 548 |
| 726 | Ga0451853_2084722 | 3300041512 | Bacteria | 759 |
| 727 | Ga0451853_2545316 | 3300041512 | Bacteria | 1419 |
| 728 | Ga0451853_3669051 | 3300041512 | Bacteria | 859 |
| 729 | Ga0451853_3745927 | 3300041512 | Bacteria | 1019 |
| 730 | Ga0439433_0083770 | 3300041999 | Bacteria | 778 |
| 731 | Ga0439443_055794 | 3300042003 | Bacteria | 699 |
| 732 | Ga0439454_099419 | 3300042011 | Bacteria | 545 |
| 733 | Ga0439456_161775 | 3300042013 | Bacteria | 524 |
| 734 | Ga0450923_018237 | 3300042125 | Bacteria | 1341 |
| 735 | Ga0450923_021563 | 3300042125 | Bacteria | 1257 |
| 736 | Ga0450923_040523 | 3300042125 | Bacteria | 977 |
| 737 | Ga0450890_041317 | 3300042127 | Bacteria | 683 |
| 738 | Ga0450897_038392 | 3300042128 | Bacteria | 558 |
| 739 | Ga0450892_010298 | 3300042130 | Bacteria | 818 |
| 740 | Ga0450894_003529 | 3300042131 | Bacteria | 2044 |
| 741 | Ga0450895_024623 | 3300042132 | Bacteria | 570 |
| 742 | Ga0450896_024701 | 3300042133 | Bacteria | 891 |
| 743 | Ga0450899_021474 | 3300042135 | Unclassified | 756 |
| 744 | Ga0450906_021096 | 3300042145 | Bacteria | 1165 |
| 745 | Ga0450909_009430 | 3300042185 | Bacteria | 1425 |
| 746 | Ga0439434_0245718 | 3300042435 | Bacteria | 611 |
| 747 | Ga0439435_0072151 | 3300042436 | Bacteria | 1024 |
| 748 | Ga0439464_0033332 | 3300042439 | Bacteria | 1450 |
| 749 | Ga0439460_0181914 | 3300042461 | Unclassified | 711 |
| 750 | Ga0450916_008974 | 3300042530 | Bacteria | 1228 |
| 751 | Ga0450916_096513 | 3300042530 | Bacteria | 520 |
| 752 | Ga0450918_034014 | 3300042531 | Bacteria | 905 |
| 753 | Ga0450893_0098999 | 3300042532 | Bacteria | 592 |
| 754 | Ga0451577_0132777 | 3300042876 | Bacteria | 2234 |
| 755 | Ga0453683_0623424 | 3300044673 | Bacteria | 704 |
| 756 | Ga0453683_0726699 | 3300044673 | Bacteria | 651 |
| 757 | Ga0453684_0107756 | 3300044712 | Bacteria | 3392 |
| 758 | Ga0466960_0876213 | 3300044901 | Bacteria | 547 |
| 759 | Ga0451576_0023050 | 3300045051 | Bacteria | 6747 |
| 760 | Ga0451576_2085483 | 3300045051 | Bacteria | 583 |
| 761 | Ga0451576_2247038 | 3300045051 | Unclassified | 560 |
| 762 | Ga0466967_0877877 | 3300045976 | Bacteria | 892 |
| 763 | Ga0466967_1607584 | 3300045976 | Bacteria | 647 |
| 764 | Ga0495592_0475807 | 3300046454 | Bacteria | 779 |
| 765 | Ga0495603_0209070 | 3300046455 | Bacteria | 1127 |
| 766 | Ga0495651_0076455 | 3300046462 | Bacteria | 2536 |
| 767 | Ga0495653_0708482 | 3300046463 | Bacteria | 611 |
| 768 | Ga0495582_0361365 | 3300046473 | Bacteria | 836 |
| 769 | Ga0495664_0707613 | 3300046477 | Bacteria | 595 |
| 770 | Ga0495584_0031669 | 3300046491 | Bacteria | 2676 |
| 771 | Ga0495594_0669086 | 3300046499 | Bacteria | 587 |
| 772 | Ga0495628_0940909 | 3300046516 | Bacteria | 597 |
| 773 | Ga0495630_0715786 | 3300046517 | Bacteria | 766 |
| 774 | Ga0495637_0207938 | 3300046520 | Bacteria | 717 |
| 775 | Ga0495643_0001941 | 3300046522 | Bacteria | 17402 |
| 776 | Ga0495663_0134012 | 3300046525 | Bacteria | 837 |
| 777 | Ga0495587_0098139 | 3300046536 | Bacteria | 1689 |
| 778 | Ga0495598_0009390 | 3300046537 | Bacteria | 2311 |
| 779 | Ga0495598_0015886 | 3300046537 | Bacteria | 1910 |
| 780 | Ga0495598_0134260 | 3300046537 | Bacteria | 851 |
| 781 | Ga0495609_0079851 | 3300046538 | Bacteria | 1431 |
| 782 | Ga0495621_0094454 | 3300046539 | Bacteria | 1131 |
| 783 | Ga0495621_0167157 | 3300046539 | Bacteria | 872 |
| 784 | Ga0495597_0351223 | 3300046542 | Unclassified | 566 |
| 785 | Ga0495633_0193656 | 3300046558 | Bacteria | 934 |
| 786 | Ga0495656_0107445 | 3300046615 | Bacteria | 1300 |
| 787 | Ga0495659_0102391 | 3300046664 | Bacteria | 1110 |
| 788 | Ga0495647_0003465 | 3300046681 | Bacteria | 5047 |
| 789 | Ga0495647_0275437 | 3300046681 | Bacteria | 754 |
| 790 | Ga0495647_0324119 | 3300046681 | Bacteria | 698 |
| 791 | Ga0495669_0114625 | 3300046684 | Bacteria | 1261 |
| 792 | Ga0495669_0338223 | 3300046684 | Bacteria | 727 |
| 793 | Ga0495649_0409512 | 3300046694 | Bacteria | 680 |
| 794 | Ga0495604_0347158 | 3300047317 | Unclassified | 987 |
| 795 | Ga0495672_0320193 | 3300047320 | Bacteria | 729 |
| 796 | Ga0495680_0380536 | 3300047322 | Bacteria | 978 |
| 797 | Ga0495675_0755088 | 3300047444 | Bacteria | 541 |
| 798 | Ga0495685_080951 | 3300047447 | Bacteria | 1081 |
| 799 | Ga0495614_0230281 | 3300048089 | Bacteria | 844 |
| 800 | Ga0495615_0145672 | 3300048090 | Bacteria | 702 |
| 801 | Ga0496101_0614809 | 3300048904 | Bacteria | 859 |
| 802 | Ga0496104_0003082 | 3300048907 | Bacteria | 14367 |
| 803 | Ga0496104_1271719 | 3300048907 | Bacteria | 639 |
| 804 | Ga0496105_0019761 | 3300048908 | Bacteria | 5435 |
| 805 | Ga0496105_0343643 | 3300048908 | Bacteria | 1193 |
| 806 | Ga0496106_0249197 | 3300048909 | Bacteria | 1420 |
| 807 | Ga0496106_0500743 | 3300048909 | Bacteria | 976 |
| 808 | Ga0496107_0318703 | 3300048910 | Bacteria | 1157 |
| 809 | Ga0496108_0003036 | 3300048911 | Bacteria | 13496 |
| 810 | Ga0496108_1012114 | 3300048911 | Bacteria | 709 |
| 811 | Ga0496109_0004537 | 3300048912 | Bacteria | 11602 |
| 812 | Ga0496109_0818684 | 3300048912 | Bacteria | 869 |
| 813 | Ga0496110_0004868 | 3300048913 | Bacteria | 10477 |
| 814 | Ga0496110_0215709 | 3300048913 | Bacteria | 1745 |
| 815 | Ga0496110_0891015 | 3300048913 | Bacteria | 796 |
| 816 | Ga0496111_0005731 | 3300048914 | Bacteria | 8009 |
| 817 | Ga0496111_0127638 | 3300048914 | Bacteria | 1881 |
| 818 | Ga0496112_0001468 | 3300048915 | Bacteria | 18097 |
| 819 | Ga0496113_0167493 | 3300048916 | Bacteria | 1739 |
| 820 | Ga0496113_0994574 | 3300048916 | Bacteria | 661 |
| 821 | Ga0496114_0053394 | 3300048917 | Bacteria | 3369 |
| 822 | Ga0496114_0171724 | 3300048917 | Bacteria | 1890 |
| 823 | Ga0496114_1337213 | 3300048917 | Bacteria | 603 |
| 824 | Ga0501300_021039 | 3300049523 | Bacteria | 953 |
| 825 | Ga0501311_082027 | 3300049527 | Bacteria | 550 |
| 826 | Ga0501031_0046471 | 3300049568 | Bacteria | 2831 |
| 827 | Ga0501031_0511735 | 3300049568 | Bacteria | 774 |
| 828 | Ga0501032_0520296 | 3300049569 | Bacteria | 759 |
| 829 | Ga0501033_0037295 | 3300049570 | Bacteria | 3639 |
| 830 | Ga0501034_0115513 | 3300049571 | Bacteria | 2672 |
| 831 | Ga0501034_0705034 | 3300049571 | Bacteria | 907 |
| 832 | Ga0501036_0104742 | 3300049572 | Unclassified | 2392 |
| 833 | Ga0501036_0273501 | 3300049572 | Bacteria | 1414 |
| 834 | Ga0501036_0521110 | 3300049572 | Bacteria | 989 |
| 835 | Ga0501036_0591953 | 3300049572 | Bacteria | 920 |
| 836 | Ga0501036_0652360 | 3300049572 | Bacteria | 871 |
| 837 | Ga0501036_0865534 | 3300049572 | Bacteria | 742 |
| 838 | Ga0501036_1015335 | 3300049572 | Bacteria | 679 |
| 839 | Ga0501037_0098874 | 3300049573 | Bacteria | 2107 |
| 840 | Ga0501037_0557127 | 3300049573 | Bacteria | 773 |
| 841 | Ga0501037_0728156 | 3300049573 | Bacteria | 658 |
| 842 | Ga0501038_0135132 | 3300049574 | Bacteria | 2021 |
| 843 | Ga0501038_0399459 | 3300049574 | Bacteria | 1063 |
| 844 | Ga0501038_0589329 | 3300049574 | Bacteria | 842 |
| 845 | Ga0501038_0834415 | 3300049574 | Bacteria | 683 |
| 846 | Ga0501039_0089734 | 3300049575 | Bacteria | 2395 |
| 847 | Ga0501039_0258539 | 3300049575 | Bacteria | 1369 |
| 848 | Ga0501039_0368660 | 3300049575 | Bacteria | 1128 |
| 849 | Ga0501039_0497179 | 3300049575 | Bacteria | 958 |
| 850 | Ga0501039_0504529 | 3300049575 | Bacteria | 950 |
| 851 | Ga0501040_0068905 | 3300049576 | Bacteria | 2440 |
| 852 | Ga0501040_0286680 | 3300049576 | Bacteria | 1176 |
| 853 | Ga0501040_0511750 | 3300049576 | Bacteria | 865 |
| 854 | Ga0501040_1230390 | 3300049576 | Bacteria | 543 |
| 855 | Ga0501041_0144688 | 3300049577 | Bacteria | 1483 |
| 856 | Ga0501041_0235132 | 3300049577 | Bacteria | 1151 |
| 857 | Ga0501041_0427339 | 3300049577 | Bacteria | 840 |
| 858 | Ga0501041_0530679 | 3300049577 | Bacteria | 750 |
| 859 | Ga0501042_0075928 | 3300049578 | Bacteria | 2405 |
| 860 | Ga0501042_0085131 | 3300049578 | Bacteria | 2267 |
| 861 | Ga0501042_0210948 | 3300049578 | Bacteria | 1401 |
| 862 | Ga0501042_0233859 | 3300049578 | Bacteria | 1326 |
| 863 | Ga0501042_0874338 | 3300049578 | Bacteria | 654 |
| 864 | Ga0501042_1258217 | 3300049578 | Bacteria | 540 |
| 865 | Ga0501042_1373781 | 3300049578 | Bacteria | 515 |
| 866 | Ga0501043_0106136 | 3300049579 | Bacteria | 2206 |
| 867 | Ga0501046_0015798 | 3300049580 | Bacteria | 6334 |
| 868 | Ga0501046_0046528 | 3300049580 | Bacteria | 3443 |
| 869 | Ga0501046_0285268 | 3300049580 | Bacteria | 1209 |
| 870 | Ga0501046_0536254 | 3300049580 | Bacteria | 835 |
| 871 | Ga0501046_0610915 | 3300049580 | Bacteria | 773 |
| 872 | Ga0501046_1168724 | 3300049580 | Bacteria | 530 |
| 873 | Ga0501047_0006623 | 3300049581 | Bacteria | 10895 |
| 874 | Ga0501047_0071383 | 3300049581 | Bacteria | 3342 |
| 875 | Ga0501047_0988841 | 3300049581 | Bacteria | 654 |
| 876 | Ga0501048_0200008 | 3300049582 | Bacteria | 1416 |
| 877 | Ga0501067_0144682 | 3300049583 | Bacteria | 1324 |
| 878 | Ga0501067_0544826 | 3300049583 | Bacteria | 650 |
| 879 | Ga0501067_0588831 | 3300049583 | Bacteria | 623 |
| 880 | Ga0501068_0058634 | 3300049584 | Bacteria | 2336 |
| 881 | Ga0501068_0075221 | 3300049584 | Bacteria | 2066 |
| 882 | Ga0501068_0211500 | 3300049584 | Bacteria | 1231 |
| 883 | Ga0501069_0006243 | 3300049585 | Bacteria | 6228 |
| 884 | Ga0501070_0343688 | 3300049586 | Bacteria | 1212 |
| 885 | Ga0501070_0661706 | 3300049586 | Bacteria | 828 |
| 886 | Ga0501070_1497282 | 3300049586 | Bacteria | 511 |
| 887 | Ga0501071_0149591 | 3300049587 | Bacteria | 1741 |
| 888 | Ga0501071_0159629 | 3300049587 | Bacteria | 1685 |
| 889 | Ga0501071_0166359 | 3300049587 | Bacteria | 1650 |
| 890 | Ga0501071_0189283 | 3300049587 | Bacteria | 1543 |
| 891 | Ga0501071_0239367 | 3300049587 | Bacteria | 1368 |
| 892 | Ga0501071_0435316 | 3300049587 | Bacteria | 1003 |
| 893 | Ga0501071_0484897 | 3300049587 | Bacteria | 948 |
| 894 | Ga0501071_0672350 | 3300049587 | Bacteria | 797 |
| 895 | Ga0501071_1099832 | 3300049587 | Bacteria | 614 |
| 896 | Ga0501072_0075990 | 3300049588 | Bacteria | 2657 |
| 897 | Ga0501072_0109368 | 3300049588 | Bacteria | 2200 |
| 898 | Ga0501072_0127443 | 3300049588 | Bacteria | 2028 |
| 899 | Ga0501072_0210167 | 3300049588 | Bacteria | 1551 |
| 900 | Ga0501072_0220493 | 3300049588 | Bacteria | 1512 |
| 901 | Ga0501072_0254797 | 3300049588 | Bacteria | 1397 |
| 902 | Ga0501073_0347179 | 3300049589 | Bacteria | 1024 |
| 903 | Ga0501073_0454940 | 3300049589 | Bacteria | 885 |
| 904 | Ga0501073_0580333 | 3300049589 | Bacteria | 774 |
| 905 | Ga0501073_1058910 | 3300049589 | Bacteria | 558 |
| 906 | Ga0501074_0017869 | 3300049590 | Bacteria | 5153 |
| 907 | Ga0501074_0162295 | 3300049590 | Bacteria | 1596 |
| 908 | Ga0501074_0194780 | 3300049590 | Bacteria | 1445 |
| 909 | Ga0501074_0314169 | 3300049590 | Bacteria | 1113 |
| 910 | Ga0501074_0929107 | 3300049590 | Bacteria | 612 |
| 911 | Ga0501075_0121589 | 3300049591 | Bacteria | 1987 |
| 912 | Ga0501075_0144066 | 3300049591 | Bacteria | 1816 |
| 913 | Ga0501075_0165360 | 3300049591 | Bacteria | 1688 |
| 914 | Ga0501075_0423995 | 3300049591 | Bacteria | 1014 |
| 915 | Ga0501075_0606554 | 3300049591 | Bacteria | 835 |
| 916 | Ga0501075_1375790 | 3300049591 | Bacteria | 535 |
| 917 | Ga0501075_1442648 | 3300049591 | Bacteria | 521 |
| 918 | Ga0501075_1530664 | 3300049591 | Bacteria | 505 |
| 919 | Ga0501076_0085979 | 3300049592 | Bacteria | 2527 |
| 920 | Ga0501076_0159376 | 3300049592 | Bacteria | 1838 |
| 921 | Ga0501076_0185119 | 3300049592 | Bacteria | 1698 |
| 922 | Ga0501076_0347888 | 3300049592 | Bacteria | 1217 |
| 923 | Ga0501076_0404539 | 3300049592 | Bacteria | 1122 |
| 924 | Ga0501076_0454774 | 3300049592 | Bacteria | 1054 |
| 925 | Ga0501076_0472907 | 3300049592 | Bacteria | 1032 |
| 926 | Ga0501076_0517199 | 3300049592 | Bacteria | 984 |
| 927 | Ga0501076_0546117 | 3300049592 | Bacteria | 955 |
| 928 | Ga0501076_0979298 | 3300049592 | Bacteria | 697 |
| 929 | Ga0501076_1557296 | 3300049592 | Bacteria | 542 |
| 930 | Ga0501077_0102406 | 3300049593 | Bacteria | 1814 |
| 931 | Ga0501077_0253061 | 3300049593 | Bacteria | 1120 |
| 932 | Ga0501077_0384601 | 3300049593 | Bacteria | 897 |
| 933 | Ga0501077_0454925 | 3300049593 | Bacteria | 820 |
| 934 | Ga0501077_0488621 | 3300049593 | Unclassified | 789 |
| 935 | Ga0501077_0747206 | 3300049593 | Unclassified | 629 |
| 936 | Ga0501077_0835607 | 3300049593 | Bacteria | 592 |
| 937 | Ga0501211_043925 | 3300049658 | Bacteria | 539 |
| 938 | Ga0501243_130230 | 3300049675 | Unclassified | 525 |
| 939 | Ga0501079_0027969 | 3300049741 | Bacteria | 4325 |
| 940 | Ga0501079_0332455 | 3300049741 | Bacteria | 1190 |
| 941 | Ga0501079_0832907 | 3300049741 | Unclassified | 726 |
| 942 | Ga0501080_0019050 | 3300049742 | Bacteria | 6354 |
| 943 | Ga0501080_0102787 | 3300049742 | Bacteria | 2651 |
| 944 | Ga0501080_0393028 | 3300049742 | Bacteria | 1248 |
| 945 | Ga0501080_1833734 | 3300049742 | Bacteria | 509 |
| 946 | Ga0501081_0046801 | 3300049743 | Bacteria | 2975 |
| 947 | Ga0501081_0354441 | 3300049743 | Bacteria | 1082 |
| 948 | Ga0501081_0398270 | 3300049743 | Bacteria | 1019 |
| 949 | Ga0501083_0009096 | 3300049744 | Bacteria | 7015 |
| 950 | Ga0501083_0139058 | 3300049744 | Bacteria | 1590 |
| 951 | Ga0501083_0180486 | 3300049744 | Bacteria | 1378 |
| 952 | Ga0501083_1035306 | 3300049744 | Bacteria | 534 |
| 953 | Ga0501035_0128300 | 3300049822 | Bacteria | 2212 |
| 954 | Ga0501035_0250609 | 3300049822 | Bacteria | 1504 |
| 955 | Ga0501035_0296453 | 3300049822 | Bacteria | 1363 |
| 956 | Ga0501035_0812271 | 3300049822 | Bacteria | 746 |
| 957 | Ga0501044_0116255 | 3300049823 | Bacteria | 2680 |
| 958 | Ga0501044_0144191 | 3300049823 | Bacteria | 2368 |
| 959 | Ga0501044_0723691 | 3300049823 | Bacteria | 879 |
| 960 | Ga0501045_0013621 | 3300049824 | Bacteria | 5748 |
| 961 | Ga0501045_0026599 | 3300049824 | Bacteria | 4164 |
| 962 | Ga0501045_0044615 | 3300049824 | Bacteria | 3230 |
| 963 | Ga0501045_0091558 | 3300049824 | Bacteria | 2248 |
| 964 | Ga0501045_0984409 | 3300049824 | Bacteria | 619 |
| 965 | nmdc:mga03683_152060_c1 | 3300050489 | Bacteria | 1045 |
| 966 | nmdc:mga03n38_328724_c1 | 3300050490 | Archaea | 827 |
| 967 | nmdc:mga00v17_169127_c1 | 3300050491 | Bacteria | 1409 |
| 968 | nmdc:mga00v17_373533_c1 | 3300050491 | Bacteria | 927 |
| 969 | nmdc:mga0yw44_16488_c1 | 3300050492 | Unclassified | 1930 |
| 970 | nmdc:mga0k408_11298_c1 | 3300050493 | Bacteria | 4858 |
| 971 | nmdc:mga0k408_601469_c1 | 3300050493 | Bacteria | 648 |
| 972 | nmdc:mga0k408_842942_c1 | 3300050493 | Bacteria | 533 |
| 973 | nmdc:mga06z11_128855_c1 | 3300050494 | Bacteria | 1419 |
| 974 | nmdc:mga06z11_640735_c1 | 3300050494 | Bacteria | 647 |
| 975 | nmdc:mga04h51_80670_c1 | 3300050495 | Bacteria | 1154 |
| 976 | nmdc:mga07m45_99236_c1 | 3300050496 | Bacteria | 1249 |
| 977 | nmdc:mga05p37_1102340_c1 | 3300050507 | Bacteria | 831 |
| 978 | nmdc:mga05p37_11849_c1 | 3300050507 | Bacteria | 10393 |
| 979 | nmdc:mga05p37_1408827_c1 | 3300050507 | Bacteria | 701 |
| 980 | nmdc:mga05p37_1775674_c1 | 3300050507 | Bacteria | 597 |
| 981 | nmdc:mga05p37_2244117_c1 | 3300050507 | Bacteria | 505 |
| 982 | nmdc:mga05p37_288705_c1 | 3300050507 | Bacteria | 1953 |
| 983 | nmdc:mga05p37_359328_c1 | 3300050507 | Bacteria | 1712 |
| 984 | nmdc:mga05p37_39335_c1 | 3300050507 | Bacteria | 5806 |
| 985 | nmdc:mga05p37_54_c2 | 3300050507 | Bacteria | 73831 |
| 986 | nmdc:mga05p37_554256_c1 | 3300050507 | Bacteria | 1308 |
| 987 | nmdc:mga05p37_59208_c1 | 3300050507 | Bacteria | 4717 |
| 988 | nmdc:mga05p37_62626_c1 | 3300050507 | Bacteria | 4578 |
| 989 | nmdc:mga05p37_69250_c1 | 3300050507 | Bacteria | 4340 |
| 990 | nmdc:mga05p37_979152_c1 | 3300050507 | Bacteria | 901 |
| 991 | nmdc:mga09592_1053806_c1 | 3300050508 | Bacteria | 678 |
| 992 | nmdc:mga09592_1101508_c1 | 3300050508 | Bacteria | 660 |
| 993 | nmdc:mga09592_1258644_c1 | 3300050508 | Unclassified | 610 |
| 994 | nmdc:mga09592_1521423_c1 | 3300050508 | Bacteria | 544 |
| 995 | nmdc:mga09592_1709847_c1 | 3300050508 | Unclassified | 507 |
| 996 | nmdc:mga09592_27877_c1 | 3300050508 | Bacteria | 4688 |
| 997 | nmdc:mga09592_475652_c1 | 3300050508 | Bacteria | 1077 |
| 998 | nmdc:mga09592_553605_c1 | 3300050508 | Bacteria | 988 |
| 999 | nmdc:mga09592_624290_c1 | 3300050508 | Bacteria | 922 |
| 1000 | nmdc:mga09592_686212_c1 | 3300050508 | Bacteria | 872 |
| 1001 | nmdc:mga09592_848199_c1 | 3300050508 | Bacteria | 771 |
| 1002 | nmdc:mga0qj67_146515_c1 | 3300050509 | Bacteria | 1914 |
| 1003 | nmdc:mga0qj67_23200_c1 | 3300050509 | Unclassified | 4771 |
| 1004 | nmdc:mga0qj67_325561_c1 | 3300050509 | Bacteria | 1244 |
| 1005 | nmdc:mga0qj67_398643_c1 | 3300050509 | Bacteria | 1110 |
| 1006 | nmdc:mga0qj67_496222_c1 | 3300050509 | Bacteria | 982 |
| 1007 | nmdc:mga0qj67_563773_c1 | 3300050509 | Bacteria | 913 |
| 1008 | nmdc:mga0qj67_566669_c1 | 3300050509 | Bacteria | 910 |
| 1009 | nmdc:mga0qj67_61432_c1 | 3300050509 | Bacteria | 2983 |
| 1010 | nmdc:mga0qj67_915933_c1 | 3300050509 | Bacteria | 690 |
| 1011 | nmdc:mga06r32_128077_c1 | 3300050510 | Bacteria | 2509 |
| 1012 | nmdc:mga06r32_672116_c1 | 3300050510 | Unclassified | 1003 |
| 1013 | nmdc:mga06r32_71740_c1 | 3300050510 | Bacteria | 3352 |
| 1014 | nmdc:mga08y16_1015049_c1 | 3300050511 | Bacteria | 809 |
| 1015 | nmdc:mga08y16_1141985_c1 | 3300050511 | Bacteria | 752 |
| 1016 | nmdc:mga08y16_1172445_c1 | 3300050511 | Unclassified | 740 |
| 1017 | nmdc:mga08y16_1409804_c1 | 3300050511 | Bacteria | 660 |
| 1018 | nmdc:mga08y16_1947641_c1 | 3300050511 | Bacteria | 538 |
| 1019 | nmdc:mga08y16_19906_c1 | 3300050511 | Bacteria | 7079 |
| 1020 | nmdc:mga08y16_19984_c1 | 3300050511 | Bacteria | 7066 |
| 1021 | nmdc:mga08y16_244307_c1 | 3300050511 | Bacteria | 1855 |
| 1022 | nmdc:mga08y16_2979_c1 | 3300050511 | Bacteria | 17456 |
| 1023 | nmdc:mga08y16_2_c1 | 3300050511 | Bacteria | 983367 |
| 1024 | nmdc:mga08y16_46458_c1 | 3300050511 | Bacteria | 4546 |
| 1025 | nmdc:mga08y16_53015_c1 | 3300050511 | Bacteria | 4242 |
| 1026 | nmdc:mga08y16_53496_c1 | 3300050511 | Bacteria | 4222 |
| 1027 | nmdc:mga08y16_634696_c1 | 3300050511 | Bacteria | 1074 |
| 1028 | nmdc:mga08y16_67967_c1 | 3300050511 | Bacteria | 3717 |
| 1029 | nmdc:mga08y16_87982_c1 | 3300050511 | Bacteria | 3237 |
| 1030 | nmdc:mga0n895_1424093_c1 | 3300050512 | Bacteria | 661 |
| 1031 | nmdc:mga0n895_1576179_c1 | 3300050512 | Unclassified | 622 |
| 1032 | nmdc:mga0n895_2047167_c1 | 3300050512 | Bacteria | 530 |
| 1033 | nmdc:mga0n895_220970_c1 | 3300050512 | Bacteria | 1923 |
| 1034 | nmdc:mga0n895_281_c1 | 3300050512 | Bacteria | 33522 |
| 1035 | nmdc:mga0n895_285856_c1 | 3300050512 | Unclassified | 1672 |
| 1036 | nmdc:mga0n895_31613_c1 | 3300050512 | Bacteria | 5071 |
| 1037 | nmdc:mga0n895_35411_c1 | 3300050512 | Bacteria | 4813 |
| 1038 | nmdc:mga0n895_627410_c1 | 3300050512 | Bacteria | 1075 |
| 1039 | nmdc:mga0n895_73517_c1 | 3300050512 | Bacteria | 3394 |
| 1040 | nmdc:mga0rr50_12769_c1 | 3300050513 | Bacteria | 5443 |
| 1041 | nmdc:mga0rr50_597653_c1 | 3300050513 | Bacteria | 941 |
| 1042 | nmdc:mga0rr50_99442_c1 | 3300050513 | Bacteria | 2282 |
| 1043 | nmdc:mga08x19_1442_c1 | 3300050514 | Bacteria | 14702 |
| 1044 | nmdc:mga08x19_15948_c1 | 3300050514 | Bacteria | 4578 |
| 1045 | nmdc:mga0a205_1430760_c1 | 3300050515 | Bacteria | 539 |
| 1046 | nmdc:mga0a205_205039_c1 | 3300050515 | Bacteria | 1861 |
| 1047 | nmdc:mga0a205_249539_c1 | 3300050515 | Bacteria | 1655 |
| 1048 | nmdc:mga0a205_34105_c1 | 3300050515 | Bacteria | 4883 |
| 1049 | nmdc:mga0a205_469_c1 | 3300050515 | Bacteria | 31359 |
| 1050 | nmdc:mga0a205_495605_c1 | 3300050515 | Bacteria | 1079 |
| 1051 | nmdc:mga0a205_509325_c1 | 3300050515 | Bacteria | 1060 |
| 1052 | nmdc:mga0a205_516667_c1 | 3300050515 | Bacteria | 1051 |
| 1053 | nmdc:mga0a205_56533_c1 | 3300050515 | Bacteria | 3788 |
| 1054 | nmdc:mga0a205_964118_c1 | 3300050515 | Bacteria | 700 |
| 1055 | nmdc:mga0sz30_200081_c1 | 3300050516 | Unclassified | 887 |
| 1056 | Ga0495619_0465123 | 3300053085 | Bacteria | 871 |
| 1057 | Ga0501084_0028026 | 3300054114 | Bacteria | 4706 |
| 1058 | Ga0501084_0087693 | 3300054114 | Bacteria | 2613 |
| 1059 | Ga0501084_0221203 | 3300054114 | Bacteria | 1598 |
| 1060 | Ga0501084_0516083 | 3300054114 | Bacteria | 1010 |
| 1061 | Ga0501084_0617930 | 3300054114 | Bacteria | 915 |
| 1062 | Ga0501084_1046619 | 3300054114 | Bacteria | 685 |
| 1063 | Ga0501084_1642936 | 3300054114 | Bacteria | 537 |
| 1064 | Ga0590071_056342 | 3300059421 | Bacteria | 956 |
| 1065 | Ga0590074_115496 | 3300059423 | Bacteria | 532 |
| 1066 | Ga0590077_000518 | 3300059426 | Bacteria | 10686 |
| 1067 | Ga0590077_030411 | 3300059426 | Bacteria | 1177 |
| 1068 | Ga0501082_0037262 | 3300060353 | Bacteria | 4191 |
| 1069 | Ga0501082_0164047 | 3300060353 | Bacteria | 1931 |
| 1070 | Ga0501082_0198840 | 3300060353 | Bacteria | 1744 |
| 1071 | Ga0501082_0258610 | 3300060353 | Bacteria | 1514 |
| 1072 | Ga0501082_0340092 | 3300060353 | Bacteria | 1308 |
| 1073 | Ga0501082_0342075 | 3300060353 | Bacteria | 1304 |
| 1074 | Ga0501082_0449738 | 3300060353 | Bacteria | 1125 |
| 1075 | Ga0501082_0558647 | 3300060353 | Bacteria | 1001 |
| 1076 | Ga0501082_1486509 | 3300060353 | Bacteria | 592 |
| 1077 | Ga0501082_1712595 | 3300060353 | Bacteria | 548 |
| 1078 | Ga0501082_1850452 | 3300060353 | Bacteria | 526 |
| 1079 | Ga0530510_0011089 | 3300061734 | Bacteria | 6323 |
| 1080 | Ga0530510_0247570 | 3300061734 | Bacteria | 1328 |
| 1081 | Ga0530510_0332525 | 3300061734 | Bacteria | 1140 |
| 1082 | Ga0530510_0439828 | 3300061734 | Bacteria | 985 |
| 1083 | Ga0530510_0564265 | 3300061734 | Bacteria | 865 |
| 1084 | Ga0530510_0942225 | 3300061734 | Bacteria | 660 |
| 1085 | Ga0530510_0987283 | 3300061734 | Unclassified | 644 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10493590 | Ga0157378_104935901 | 82 |
| 2 | 3300014968 | Ga0157379_10739262 | Ga0157379_107392622 | 85 |
| 3 | 3300031911 | Ga0307412_11208239 | Ga0307412_112082391 | 86 |
| 4 | 3300049523 | Ga0501300_021039 | Ga0501300_021039_215_526 | 86 |
| 5 | 3300014969 | Ga0157376_12532350 | Ga0157376_125323502 | 87 |
| 6 | 3300005295 | Ga0065707_10149428 | Ga0065707_101494282 | 88 |
| 7 | 3300005295 | Ga0065707_11122576 | Ga0065707_111225761 | 88 |
| 8 | 3300005335 | Ga0070666_10908227 | Ga0070666_109082272 | 88 |
| 9 | 3300005339 | Ga0070660_101496559 | Ga0070660_1014965592 | 88 |
| 10 | 3300005353 | Ga0070669_100350581 | Ga0070669_1003505812 | 88 |
| 11 | 3300005441 | Ga0070700_100229740 | Ga0070700_1002297402 | 88 |
| 12 | 3300005459 | Ga0068867_100256849 | Ga0068867_1002568492 | 88 |
| 13 | 3300005617 | Ga0068859_102628729 | Ga0068859_1026287292 | 88 |
| 14 | 3300005842 | Ga0068858_100119501 | Ga0068858_1001195014 | 88 |
| 15 | 3300005844 | Ga0068862_100023246 | Ga0068862_1000232462 | 88 |
| 16 | 3300006846 | Ga0075430_101112134 | Ga0075430_1011121342 | 88 |
| 17 | 3300006931 | Ga0097620_102628332 | Ga0097620_1026283322 | 88 |
| 18 | 3300009094 | Ga0111539_13278058 | Ga0111539_132780582 | 88 |
| 19 | 3300009101 | Ga0105247_10766862 | Ga0105247_107668622 | 88 |
| 20 | 3300009176 | Ga0105242_11123983 | Ga0105242_111239832 | 88 |
| 21 | 3300009177 | Ga0105248_10639528 | Ga0105248_106395282 | 88 |
| 22 | 3300009553 | Ga0105249_13359684 | Ga0105249_133596842 | 88 |
| 23 | 3300013104 | Ga0157370_11605225 | Ga0157370_116052252 | 88 |
| 24 | 3300013297 | Ga0157378_10705802 | Ga0157378_107058022 | 88 |
| 25 | 3300014326 | Ga0157380_10159384 | Ga0157380_101593842 | 88 |
| 26 | 3300014968 | Ga0157379_11628553 | Ga0157379_116285532 | 88 |
| 27 | 3300025922 | Ga0207646_11431012 | Ga0207646_114310122 | 88 |
| 28 | 3300025923 | Ga0207681_10108834 | Ga0207681_101088344 | 88 |
| 29 | 3300025960 | Ga0207651_10284456 | Ga0207651_102844562 | 88 |
| 30 | 3300005295 | Ga0065707_10086703 | Ga0065707_100867036 | 89 |
| 31 | 3300005545 | Ga0070695_100998378 | Ga0070695_1009983781 | 89 |
| 32 | 3300006871 | Ga0075434_100116835 | Ga0075434_1001168354 | 89 |
| 33 | 3300009094 | Ga0111539_10000002 | Ga0111539_10000002138 | 89 |
| 34 | 3300009094 | Ga0111539_10014610 | Ga0111539_1001461013 | 89 |
| 35 | 3300009147 | Ga0114129_11785621 | Ga0114129_117856211 | 89 |
| 36 | 3300027907 | Ga0207428_10000004 | Ga0207428_10000004519 | 89 |
| 37 | 3300027907 | Ga0207428_10092199 | Ga0207428_100921992 | 89 |
| 38 | 3300049586 | Ga0501070_1497282 | Ga0501070_1497282_64_360 | 89 |
| 39 | 3300049589 | Ga0501073_1058910 | Ga0501073_1058910_248_544 | 89 |
| 40 | 3300049591 | Ga0501075_1375790 | Ga0501075_1375790_77_373 | 89 |
| 41 | 3300050509 | nmdc:mga0qj67_325561_c1 | nmdc:mga0qj67_325561_c1_875_1174 | 89 |
| 42 | 3300050511 | nmdc:mga08y16_2_c1 | nmdc:mga08y16_2_c1_808795_809094 | 89 |
| 43 | 3300050511 | nmdc:mga08y16_53015_c1 | nmdc:mga08y16_53015_c1_2120_2419 | 89 |
| 44 | 3300050512 | nmdc:mga0n895_285856_c1 | nmdc:mga0n895_285856_c1_994_1293 | 89 |
| 45 | 3300005336 | Ga0070680_100415668 | Ga0070680_1004156682 | 90 |
| 46 | 3300025918 | Ga0207662_10213307 | Ga0207662_102133072 | 90 |
| 47 | 3300035113 | Ga0373936_0611281 | Ga0373936_0611281_183_455 | 90 |
| 48 | 3300037466 | Ga0395898_1768798 | Ga0395898_1768798_94_366 | 90 |
| 49 | 3300039453 | Ga0436362_0045085 | Ga0436362_0045085_410_685 | 90 |
| 50 | 3300041456 | Ga0451795_0189527 | Ga0451795_0189527_181_480 | 90 |
| 51 | 3300046477 | Ga0495664_0707613 | Ga0495664_0707613_190_462 | 90 |
| 52 | 3300050507 | nmdc:mga05p37_1102340_c1 | nmdc:mga05p37_1102340_c1_414_686 | 90 |
| 53 | 3300050512 | nmdc:mga0n895_627410_c1 | nmdc:mga0n895_627410_c1_711_998 | 90 |
| 54 | 3300050515 | nmdc:mga0a205_495605_c1 | nmdc:mga0a205_495605_c1_431_718 | 90 |
| 55 | 3300005468 | Ga0070707_100550545 | Ga0070707_1005505452 | 91 |
| 56 | 3300005535 | Ga0070684_100578208 | Ga0070684_1005782081 | 91 |
| 57 | 3300005842 | Ga0068858_100405010 | Ga0068858_1004050101 | 91 |
| 58 | 3300006358 | Ga0068871_100402308 | Ga0068871_1004023082 | 91 |
| 59 | 3300006847 | Ga0075431_101418004 | Ga0075431_1014180042 | 91 |
| 60 | 3300006914 | Ga0075436_100015139 | Ga0075436_1000151397 | 91 |
| 61 | 3300014325 | Ga0163163_10000663 | Ga0163163_1000066317 | 91 |
| 62 | 3300014969 | Ga0157376_10932279 | Ga0157376_109322792 | 91 |
| 63 | 3300025922 | Ga0207646_10452790 | Ga0207646_104527902 | 91 |
| 64 | 3300026035 | Ga0207703_10481808 | Ga0207703_104818082 | 91 |
| 65 | 3300035118 | Ga0373954_0047240 | Ga0373954_0047240_1541_1840 | 91 |
| 66 | 3300035120 | Ga0373957_0007399 | Ga0373957_0007399_1053_1352 | 91 |
| 67 | 3300035172 | Ga0373955_0012700 | Ga0373955_0012700_467_766 | 91 |
| 68 | 3300035724 | Ga0373933_0003937 | Ga0373933_0003937_2733_3032 | 91 |
| 69 | 3300036401 | Ga0373937_0002473 | Ga0373937_0002473_6505_6804 | 91 |
| 70 | 3300036401 | Ga0373937_0185689 | Ga0373937_0185689_577_876 | 91 |
| 71 | 3300044673 | Ga0453683_0726699 | Ga0453683_0726699_84_383 | 91 |
| 72 | 3300045051 | Ga0451576_0023050 | Ga0451576_0023050_366_665 | 91 |
| 73 | 3300046462 | Ga0495651_0076455 | Ga0495651_0076455_503_802 | 91 |
| 74 | 3300046516 | Ga0495628_0940909 | Ga0495628_0940909_32_334 | 91 |
| 75 | 3300046517 | Ga0495630_0715786 | Ga0495630_0715786_401_700 | 91 |
| 76 | 3300048913 | Ga0496110_0215709 | Ga0496110_0215709_745_1044 | 91 |
| 77 | 3300048914 | Ga0496111_0127638 | Ga0496111_0127638_43_342 | 91 |
| 78 | 3300048916 | Ga0496113_0994574 | Ga0496113_0994574_290_589 | 91 |
| 79 | 3300048917 | Ga0496114_0171724 | Ga0496114_0171724_784_1083 | 91 |
| 80 | 3300050508 | nmdc:mga09592_1709847_c1 | nmdc:mga09592_1709847_c1_39_335 | 91 |
| 81 | 3300050509 | nmdc:mga0qj67_398643_c1 | nmdc:mga0qj67_398643_c1_316_612 | 91 |
| 82 | 3300050510 | nmdc:mga06r32_672116_c1 | nmdc:mga06r32_672116_c1_333_629 | 91 |
| 83 | 3300050514 | nmdc:mga08x19_1442_c1 | nmdc:mga08x19_1442_c1_1867_2166 | 91 |
| 84 | 3300053085 | Ga0495619_0465123 | Ga0495619_0465123_246_545 | 91 |
| 85 | 3300005328 | Ga0070676_10028956 | Ga0070676_100289562 | 92 |
| 86 | 3300005333 | Ga0070677_10762496 | Ga0070677_107624961 | 92 |
| 87 | 3300005335 | Ga0070666_10045960 | Ga0070666_100459602 | 92 |
| 88 | 3300005338 | Ga0068868_100389144 | Ga0068868_1003891442 | 92 |
| 89 | 3300005341 | Ga0070691_10017904 | Ga0070691_100179042 | 92 |
| 90 | 3300005343 | Ga0070687_100051971 | Ga0070687_1000519713 | 92 |
| 91 | 3300005347 | Ga0070668_101644322 | Ga0070668_1016443222 | 92 |
| 92 | 3300005353 | Ga0070669_100155395 | Ga0070669_1001553951 | 92 |
| 93 | 3300005354 | Ga0070675_100197845 | Ga0070675_1001978452 | 92 |
| 94 | 3300005364 | Ga0070673_100409025 | Ga0070673_1004090252 | 92 |
| 95 | 3300005367 | Ga0070667_100166117 | Ga0070667_1001661173 | 92 |
| 96 | 3300005367 | Ga0070667_100579633 | Ga0070667_1005796332 | 92 |
| 97 | 3300005440 | Ga0070705_100077195 | Ga0070705_1000771951 | 92 |
| 98 | 3300005441 | Ga0070700_100067920 | Ga0070700_1000679202 | 92 |
| 99 | 3300005459 | Ga0068867_100087743 | Ga0068867_1000877431 | 92 |
| 100 | 3300005544 | Ga0070686_101393912 | Ga0070686_1013939122 | 92 |
| 101 | 3300005545 | Ga0070695_100110617 | Ga0070695_1001106172 | 92 |
| 102 | 3300005548 | Ga0070665_100033864 | Ga0070665_1000338648 | 92 |
| 103 | 3300005615 | Ga0070702_100111378 | Ga0070702_1001113782 | 92 |
| 104 | 3300005618 | Ga0068864_100593820 | Ga0068864_1005938202 | 92 |
| 105 | 3300005842 | Ga0068858_100014560 | Ga0068858_1000145603 | 92 |
| 106 | 3300005842 | Ga0068858_100700445 | Ga0068858_1007004452 | 92 |
| 107 | 3300006237 | Ga0097621_100073548 | Ga0097621_1000735482 | 92 |
| 108 | 3300009094 | Ga0111539_12423775 | Ga0111539_124237751 | 92 |
| 109 | 3300025901 | Ga0207688_10411373 | Ga0207688_104113731 | 92 |
| 110 | 3300025917 | Ga0207660_10489262 | Ga0207660_104892622 | 92 |
| 111 | 3300025941 | Ga0207711_10052374 | Ga0207711_100523743 | 92 |
| 112 | 3300026035 | Ga0207703_10028166 | Ga0207703_100281664 | 92 |
| 113 | 3300027907 | Ga0207428_10066960 | Ga0207428_100669603 | 92 |
| 114 | 3300028379 | Ga0268266_10212024 | Ga0268266_102120242 | 92 |
| 115 | 3300046558 | Ga0495633_0193656 | Ga0495633_0193656_629_907 | 92 |
| 116 | 3300049593 | Ga0501077_0454925 | Ga0501077_0454925_358_636 | 92 |
| 117 | 3300005438 | Ga0070701_11346115 | Ga0070701_113461151 | 93 |
| 118 | 3300005440 | Ga0070705_100010925 | Ga0070705_1000109252 | 93 |
| 119 | 3300005444 | Ga0070694_100002811 | Ga0070694_1000028117 | 93 |
| 120 | 3300005444 | Ga0070694_100006907 | Ga0070694_1000069072 | 93 |
| 121 | 3300005468 | Ga0070707_100328591 | Ga0070707_1003285912 | 93 |
| 122 | 3300005518 | Ga0070699_100005918 | Ga0070699_10000591813 | 93 |
| 123 | 3300005535 | Ga0070684_100245419 | Ga0070684_1002454192 | 93 |
| 124 | 3300005539 | Ga0068853_101811238 | Ga0068853_1018112381 | 93 |
| 125 | 3300005543 | Ga0070672_101492071 | Ga0070672_1014920711 | 93 |
| 126 | 3300005543 | Ga0070672_101977229 | Ga0070672_1019772292 | 93 |
| 127 | 3300005549 | Ga0070704_100031294 | Ga0070704_1000312945 | 93 |
| 128 | 3300005549 | Ga0070704_100464129 | Ga0070704_1004641292 | 93 |
| 129 | 3300005564 | Ga0070664_100095017 | Ga0070664_1000950172 | 93 |
| 130 | 3300005578 | Ga0068854_100015949 | Ga0068854_1000159495 | 93 |
| 131 | 3300005719 | Ga0068861_100137258 | Ga0068861_1001372582 | 93 |
| 132 | 3300005843 | Ga0068860_100430620 | Ga0068860_1004306202 | 93 |
| 133 | 3300006051 | Ga0075364_10288778 | Ga0075364_102887782 | 93 |
| 134 | 3300006358 | Ga0068871_100297997 | Ga0068871_1002979972 | 93 |
| 135 | 3300006852 | Ga0075433_10026046 | Ga0075433_100260465 | 93 |
| 136 | 3300006871 | Ga0075434_100031212 | Ga0075434_1000312126 | 93 |
| 137 | 3300006871 | Ga0075434_101276311 | Ga0075434_1012763112 | 93 |
| 138 | 3300006881 | Ga0068865_100187815 | Ga0068865_1001878153 | 93 |
| 139 | 3300006914 | Ga0075436_100090650 | Ga0075436_1000906502 | 93 |
| 140 | 3300007076 | Ga0075435_100102968 | Ga0075435_1001029682 | 93 |
| 141 | 3300014325 | Ga0163163_12535584 | Ga0163163_125355842 | 93 |
| 142 | 3300014326 | Ga0157380_10147873 | Ga0157380_101478732 | 93 |
| 143 | 3300025321 | Ga0207656_10114764 | Ga0207656_101147642 | 93 |
| 144 | 3300025899 | Ga0207642_10390764 | Ga0207642_103907642 | 93 |
| 145 | 3300025907 | Ga0207645_10006858 | Ga0207645_100068587 | 93 |
| 146 | 3300025921 | Ga0207652_10753920 | Ga0207652_107539201 | 93 |
| 147 | 3300025922 | Ga0207646_10119235 | Ga0207646_101192353 | 93 |
| 148 | 3300025926 | Ga0207659_10070657 | Ga0207659_100706574 | 93 |
| 149 | 3300025927 | Ga0207687_10455804 | Ga0207687_104558042 | 93 |
| 150 | 3300025932 | Ga0207690_10090510 | Ga0207690_100905102 | 93 |
| 151 | 3300025935 | Ga0207709_10218683 | Ga0207709_102186832 | 93 |
| 152 | 3300025936 | Ga0207670_11124515 | Ga0207670_111245152 | 93 |
| 153 | 3300025940 | Ga0207691_10589775 | Ga0207691_105897752 | 93 |
| 154 | 3300025945 | Ga0207679_10099569 | Ga0207679_100995694 | 93 |
| 155 | 3300025960 | Ga0207651_10146104 | Ga0207651_101461043 | 93 |
| 156 | 3300025981 | Ga0207640_10136137 | Ga0207640_101361373 | 93 |
| 157 | 3300025986 | Ga0207658_10219745 | Ga0207658_102197453 | 93 |
| 158 | 3300025986 | Ga0207658_10471730 | Ga0207658_104717302 | 93 |
| 159 | 3300026075 | Ga0207708_10097773 | Ga0207708_100977732 | 93 |
| 160 | 3300026088 | Ga0207641_10190676 | Ga0207641_101906763 | 93 |
| 161 | 3300026089 | Ga0207648_10034858 | Ga0207648_100348582 | 93 |
| 162 | 3300026089 | Ga0207648_10878959 | Ga0207648_108789592 | 93 |
| 163 | 3300026118 | Ga0207675_100056601 | Ga0207675_1000566013 | 93 |
| 164 | 3300027364 | Ga0209967_1062605 | Ga0209967_10626052 | 93 |
| 165 | 3300028380 | Ga0268265_11319233 | Ga0268265_113192332 | 93 |
| 166 | 3300028381 | Ga0268264_10115035 | Ga0268264_101150352 | 93 |
| 167 | 3300041408 | Ga0439453_0185251 | Ga0439453_0185251_65_346 | 93 |
| 168 | 3300042011 | Ga0439454_099419 | Ga0439454_099419_218_499 | 93 |
| 169 | 3300042436 | Ga0439435_0072151 | Ga0439435_0072151_419_700 | 93 |
| 170 | 3300044673 | Ga0453683_0623424 | Ga0453683_0623424_160_441 | 93 |
| 171 | 3300045051 | Ga0451576_2085483 | Ga0451576_2085483_92_373 | 93 |
| 172 | 3300045051 | Ga0451576_2247038 | Ga0451576_2247038_218_502 | 93 |
| 173 | 3300048910 | Ga0496107_0318703 | Ga0496107_0318703_209_493 | 93 |
| 174 | 3300049574 | Ga0501038_0589329 | Ga0501038_0589329_287_568 | 93 |
| 175 | 3300049578 | Ga0501042_0874338 | Ga0501042_0874338_13_294 | 93 |
| 176 | 3300050491 | nmdc:mga00v17_169127_c1 | nmdc:mga00v17_169127_c1_707_991 | 93 |
| 177 | 3300050507 | nmdc:mga05p37_288705_c1 | nmdc:mga05p37_288705_c1_44_328 | 93 |
| 178 | 3300050511 | nmdc:mga08y16_1947641_c1 | nmdc:mga08y16_1947641_c1_80_364 | 93 |
| 179 | 3300005366 | Ga0070659_100100205 | Ga0070659_1001002052 | 94 |
| 180 | 3300005456 | Ga0070678_100505484 | Ga0070678_1005054842 | 94 |
| 181 | 3300005458 | Ga0070681_10570750 | Ga0070681_105707502 | 94 |
| 182 | 3300005466 | Ga0070685_11021502 | Ga0070685_110215021 | 94 |
| 183 | 3300005530 | Ga0070679_100677308 | Ga0070679_1006773082 | 94 |
| 184 | 3300006844 | Ga0075428_100010724 | Ga0075428_1000107243 | 94 |
| 185 | 3300006846 | Ga0075430_100019061 | Ga0075430_1000190612 | 94 |
| 186 | 3300006847 | Ga0075431_100595588 | Ga0075431_1005955882 | 94 |
| 187 | 3300006880 | Ga0075429_100031059 | Ga0075429_1000310593 | 94 |
| 188 | 3300009147 | Ga0114129_10010375 | Ga0114129_100103754 | 94 |
| 189 | 3300009148 | Ga0105243_10214883 | Ga0105243_102148833 | 94 |
| 190 | 3300009176 | Ga0105242_10704730 | Ga0105242_107047302 | 94 |
| 191 | 3300025899 | Ga0207642_10361294 | Ga0207642_103612942 | 94 |
| 192 | 3300025912 | Ga0207707_10755878 | Ga0207707_107558781 | 94 |
| 193 | 3300026116 | Ga0207674_11322739 | Ga0207674_113227392 | 94 |
| 194 | 3300032002 | Ga0307416_102169404 | Ga0307416_1021694042 | 94 |
| 195 | 3300035172 | Ga0373955_0499374 | Ga0373955_0499374_142_426 | 94 |
| 196 | 3300036401 | Ga0373937_1732953 | Ga0373937_1732953_152_436 | 94 |
| 197 | 3300042127 | Ga0450890_041317 | Ga0450890_041317_277_561 | 94 |
| 198 | 3300042435 | Ga0439434_0245718 | Ga0439434_0245718_13_297 | 94 |
| 199 | 3300047444 | Ga0495675_0755088 | Ga0495675_0755088_119_403 | 94 |
| 200 | 3300048907 | Ga0496104_1271719 | Ga0496104_1271719_210_494 | 94 |
| 201 | 3300048913 | Ga0496110_0891015 | Ga0496110_0891015_16_300 | 94 |
| 202 | 3300048917 | Ga0496114_1337213 | Ga0496114_1337213_146_430 | 94 |
| 203 | 3300049587 | Ga0501071_0189283 | Ga0501071_0189283_119_403 | 94 |
| 204 | 3300049588 | Ga0501072_0210167 | Ga0501072_0210167_1120_1404 | 94 |
| 205 | 3300049592 | Ga0501076_0347888 | Ga0501076_0347888_787_1071 | 94 |
| 206 | 3300050507 | nmdc:mga05p37_39335_c1 | nmdc:mga05p37_39335_c1_4867_5151 | 94 |
| 207 | 3300050508 | nmdc:mga09592_1101508_c1 | nmdc:mga09592_1101508_c1_195_479 | 94 |
| 208 | 3300050508 | nmdc:mga09592_27877_c1 | nmdc:mga09592_27877_c1_1922_2206 | 94 |
| 209 | 3300050509 | nmdc:mga0qj67_566669_c1 | nmdc:mga0qj67_566669_c1_371_655 | 94 |
| 210 | 3300050511 | nmdc:mga08y16_634696_c1 | nmdc:mga08y16_634696_c1_538_822 | 94 |
| 211 | 3300050512 | nmdc:mga0n895_1424093_c1 | nmdc:mga0n895_1424093_c1_299_583 | 94 |
| 212 | 3300050515 | nmdc:mga0a205_1430760_c1 | nmdc:mga0a205_1430760_c1_68_352 | 94 |
| 213 | 3300060353 | Ga0501082_0558647 | Ga0501082_0558647_107_391 | 94 |
| 214 | 3300061734 | Ga0530510_0247570 | Ga0530510_0247570_771_1055 | 94 |
| 215 | 3300025937 | Ga0207669_10949103 | Ga0207669_109491032 | 95 |
| 216 | 3300025941 | Ga0207711_11383338 | Ga0207711_113833381 | 95 |
| 217 | 3300042130 | Ga0450892_010298 | Ga0450892_010298_87_374 | 95 |
| 218 | 3300042530 | Ga0450916_008974 | Ga0450916_008974_327_614 | 95 |
| 219 | 3300049577 | Ga0501041_0427339 | Ga0501041_0427339_305_592 | 95 |
| 220 | 3300049591 | Ga0501075_0606554 | Ga0501075_0606554_266_553 | 95 |
| 221 | 3300049592 | Ga0501076_1557296 | Ga0501076_1557296_207_494 | 95 |
| 222 | 3300005471 | Ga0070698_100734923 | Ga0070698_1007349232 | 96 |
| 223 | 3300006844 | Ga0075428_100071091 | Ga0075428_1000710915 | 96 |
| 224 | 3300006846 | Ga0075430_100017805 | Ga0075430_1000178053 | 96 |
| 225 | 3300006852 | Ga0075433_10028333 | Ga0075433_100283336 | 96 |
| 226 | 3300006871 | Ga0075434_100002784 | Ga0075434_10000278413 | 96 |
| 227 | 3300006871 | Ga0075434_100848793 | Ga0075434_1008487932 | 96 |
| 228 | 3300006880 | Ga0075429_100131370 | Ga0075429_1001313702 | 96 |
| 229 | 3300009094 | Ga0111539_10000494 | Ga0111539_100004948 | 96 |
| 230 | 3300009147 | Ga0114129_10131662 | Ga0114129_101316625 | 96 |
| 231 | 3300009147 | Ga0114129_10491555 | Ga0114129_104915552 | 96 |
| 232 | 3300025939 | Ga0207665_10708488 | Ga0207665_107084881 | 96 |
| 233 | 3300027907 | Ga0207428_10001093 | Ga0207428_100010933 | 96 |
| 234 | 3300042132 | Ga0450895_024623 | Ga0450895_024623_63_353 | 96 |
| 235 | 3300050507 | nmdc:mga05p37_2244117_c1 | nmdc:mga05p37_2244117_c1_58_348 | 96 |
| 236 | 3300050507 | nmdc:mga05p37_62626_c1 | nmdc:mga05p37_62626_c1_2417_2707 | 96 |
| 237 | 3300050508 | nmdc:mga09592_848199_c1 | nmdc:mga09592_848199_c1_237_527 | 96 |
| 238 | 3300050509 | nmdc:mga0qj67_496222_c1 | nmdc:mga0qj67_496222_c1_629_919 | 96 |
| 239 | 3300050510 | nmdc:mga06r32_71740_c1 | nmdc:mga06r32_71740_c1_1460_1750 | 96 |
| 240 | 3300050511 | nmdc:mga08y16_53496_c1 | nmdc:mga08y16_53496_c1_3695_3985 | 96 |
| 241 | 3300050512 | nmdc:mga0n895_281_c1 | nmdc:mga0n895_281_c1_2641_2931 | 96 |
| 242 | 3300050512 | nmdc:mga0n895_73517_c1 | nmdc:mga0n895_73517_c1_1823_2113 | 96 |
| 243 | 3300050513 | nmdc:mga0rr50_12769_c1 | nmdc:mga0rr50_12769_c1_1821_2111 | 96 |
| 244 | 3300050515 | nmdc:mga0a205_34105_c1 | nmdc:mga0a205_34105_c1_2062_2352 | 96 |
| 245 | 3300050515 | nmdc:mga0a205_469_c1 | nmdc:mga0a205_469_c1_28517_28807 | 96 |
| 246 | 3300005331 | Ga0070670_100464699 | Ga0070670_1004646993 | 97 |
| 247 | 3300005354 | Ga0070675_100253317 | Ga0070675_1002533172 | 97 |
| 248 | 3300005365 | Ga0070688_100217497 | Ga0070688_1002174972 | 97 |
| 249 | 3300005365 | Ga0070688_100526803 | Ga0070688_1005268031 | 97 |
| 250 | 3300005549 | Ga0070704_100466830 | Ga0070704_1004668301 | 97 |
| 251 | 3300005549 | Ga0070704_101122451 | Ga0070704_1011224512 | 97 |
| 252 | 3300005617 | Ga0068859_100505474 | Ga0068859_1005054742 | 97 |
| 253 | 3300005719 | Ga0068861_100429375 | Ga0068861_1004293752 | 97 |
| 254 | 3300005844 | Ga0068862_100842579 | Ga0068862_1008425792 | 97 |
| 255 | 3300005844 | Ga0068862_101822497 | Ga0068862_1018224971 | 97 |
| 256 | 3300006051 | Ga0075364_10087665 | Ga0075364_100876652 | 97 |
| 257 | 3300006931 | Ga0097620_100505469 | Ga0097620_1005054692 | 97 |
| 258 | 3300009094 | Ga0111539_10031561 | Ga0111539_100315612 | 97 |
| 259 | 3300009094 | Ga0111539_10375909 | Ga0111539_103759092 | 97 |
| 260 | 3300009553 | Ga0105249_10193204 | Ga0105249_101932042 | 97 |
| 261 | 3300009553 | Ga0105249_10536530 | Ga0105249_105365302 | 97 |
| 262 | 3300014326 | Ga0157380_11440155 | Ga0157380_114401552 | 97 |
| 263 | 3300014326 | Ga0157380_11483884 | Ga0157380_114838842 | 97 |
| 264 | 3300025923 | Ga0207681_11180808 | Ga0207681_111808082 | 97 |
| 265 | 3300025925 | Ga0207650_10862600 | Ga0207650_108626002 | 97 |
| 266 | 3300025926 | Ga0207659_10860743 | Ga0207659_108607432 | 97 |
| 267 | 3300025937 | Ga0207669_10577353 | Ga0207669_105773532 | 97 |
| 268 | 3300025961 | Ga0207712_10684787 | Ga0207712_106847871 | 97 |
| 269 | 3300025961 | Ga0207712_11928752 | Ga0207712_119287521 | 97 |
| 270 | 3300026118 | Ga0207675_100152156 | Ga0207675_1001521563 | 97 |
| 271 | 3300028380 | Ga0268265_11349863 | Ga0268265_113498632 | 97 |
| 272 | 3300042125 | Ga0450923_021563 | Ga0450923_021563_469_762 | 97 |
| 273 | 3300042125 | Ga0450923_040523 | Ga0450923_040523_572_865 | 97 |
| 274 | 3300042128 | Ga0450897_038392 | Ga0450897_038392_20_313 | 97 |
| 275 | 3300042131 | Ga0450894_003529 | Ga0450894_003529_1706_1999 | 97 |
| 276 | 3300042133 | Ga0450896_024701 | Ga0450896_024701_11_304 | 97 |
| 277 | 3300042135 | Ga0450899_021474 | Ga0450899_021474_403_696 | 97 |
| 278 | 3300042145 | Ga0450906_021096 | Ga0450906_021096_100_393 | 97 |
| 279 | 3300042185 | Ga0450909_009430 | Ga0450909_009430_311_604 | 97 |
| 280 | 3300049580 | Ga0501046_1168724 | Ga0501046_1168724_84_377 | 97 |
| 281 | 3300050511 | nmdc:mga08y16_1409804_c1 | nmdc:mga08y16_1409804_c1_52_345 | 97 |
| 282 | 3300005288 | Ga0065714_10106583 | Ga0065714_101065833 | 98 |
| 283 | 3300005290 | Ga0065712_10025310 | Ga0065712_100253103 | 98 |
| 284 | 3300005293 | Ga0065715_10138994 | Ga0065715_101389942 | 98 |
| 285 | 3300005295 | Ga0065707_10591340 | Ga0065707_105913402 | 98 |
| 286 | 3300005295 | Ga0065707_10707279 | Ga0065707_107072792 | 98 |
| 287 | 3300005295 | Ga0065707_11046822 | Ga0065707_110468221 | 98 |
| 288 | 3300005330 | Ga0070690_100027789 | Ga0070690_1000277892 | 98 |
| 289 | 3300005331 | Ga0070670_100007462 | Ga0070670_1000074627 | 98 |
| 290 | 3300005336 | Ga0070680_100111780 | Ga0070680_1001117803 | 98 |
| 291 | 3300005340 | Ga0070689_100176159 | Ga0070689_1001761592 | 98 |
| 292 | 3300005340 | Ga0070689_102143232 | Ga0070689_1021432322 | 98 |
| 293 | 3300005343 | Ga0070687_100023052 | Ga0070687_1000230522 | 98 |
| 294 | 3300005344 | Ga0070661_100098211 | Ga0070661_1000982112 | 98 |
| 295 | 3300005345 | Ga0070692_10028201 | Ga0070692_100282012 | 98 |
| 296 | 3300005345 | Ga0070692_10314983 | Ga0070692_103149832 | 98 |
| 297 | 3300005347 | Ga0070668_100763258 | Ga0070668_1007632582 | 98 |
| 298 | 3300005353 | Ga0070669_100051895 | Ga0070669_1000518953 | 98 |
| 299 | 3300005353 | Ga0070669_101158658 | Ga0070669_1011586581 | 98 |
| 300 | 3300005354 | Ga0070675_100016827 | Ga0070675_1000168272 | 98 |
| 301 | 3300005354 | Ga0070675_100597189 | Ga0070675_1005971891 | 98 |
| 302 | 3300005355 | Ga0070671_100409430 | Ga0070671_1004094302 | 98 |
| 303 | 3300005356 | Ga0070674_100168717 | Ga0070674_1001687172 | 98 |
| 304 | 3300005356 | Ga0070674_100724991 | Ga0070674_1007249912 | 98 |
| 305 | 3300005356 | Ga0070674_101939626 | Ga0070674_1019396261 | 98 |
| 306 | 3300005364 | Ga0070673_100011151 | Ga0070673_1000111512 | 98 |
| 307 | 3300005365 | Ga0070688_100025746 | Ga0070688_1000257462 | 98 |
| 308 | 3300005365 | Ga0070688_100095705 | Ga0070688_1000957052 | 98 |
| 309 | 3300005365 | Ga0070688_100112936 | Ga0070688_1001129362 | 98 |
| 310 | 3300005365 | Ga0070688_100631478 | Ga0070688_1006314782 | 98 |
| 311 | 3300005434 | Ga0070709_10429129 | Ga0070709_104291292 | 98 |
| 312 | 3300005435 | Ga0070714_100012428 | Ga0070714_1000124283 | 98 |
| 313 | 3300005436 | Ga0070713_100371955 | Ga0070713_1003719552 | 98 |
| 314 | 3300005438 | Ga0070701_10019829 | Ga0070701_100198294 | 98 |
| 315 | 3300005438 | Ga0070701_10325118 | Ga0070701_103251182 | 98 |
| 316 | 3300005438 | Ga0070701_10332515 | Ga0070701_103325152 | 98 |
| 317 | 3300005440 | Ga0070705_100383867 | Ga0070705_1003838672 | 98 |
| 318 | 3300005441 | Ga0070700_100044430 | Ga0070700_1000444302 | 98 |
| 319 | 3300005441 | Ga0070700_100288007 | Ga0070700_1002880072 | 98 |
| 320 | 3300005441 | Ga0070700_101225102 | Ga0070700_1012251022 | 98 |
| 321 | 3300005441 | Ga0070700_101391223 | Ga0070700_1013912232 | 98 |
| 322 | 3300005444 | Ga0070694_100097721 | Ga0070694_1000977212 | 98 |
| 323 | 3300005444 | Ga0070694_100420609 | Ga0070694_1004206092 | 98 |
| 324 | 3300005444 | Ga0070694_100673681 | Ga0070694_1006736811 | 98 |
| 325 | 3300005444 | Ga0070694_100952934 | Ga0070694_1009529342 | 98 |
| 326 | 3300005459 | Ga0068867_100203840 | Ga0068867_1002038402 | 98 |
| 327 | 3300005466 | Ga0070685_10038256 | Ga0070685_100382562 | 98 |
| 328 | 3300005467 | Ga0070706_100059841 | Ga0070706_1000598412 | 98 |
| 329 | 3300005468 | Ga0070707_100964469 | Ga0070707_1009644691 | 98 |
| 330 | 3300005471 | Ga0070698_100001914 | Ga0070698_10000191414 | 98 |
| 331 | 3300005471 | Ga0070698_100008781 | Ga0070698_1000087813 | 98 |
| 332 | 3300005471 | Ga0070698_100367484 | Ga0070698_1003674842 | 98 |
| 333 | 3300005471 | Ga0070698_101784181 | Ga0070698_1017841812 | 98 |
| 334 | 3300005518 | Ga0070699_100005726 | Ga0070699_1000057265 | 98 |
| 335 | 3300005518 | Ga0070699_100927027 | Ga0070699_1009270272 | 98 |
| 336 | 3300005536 | Ga0070697_100597651 | Ga0070697_1005976512 | 98 |
| 337 | 3300005536 | Ga0070697_100864185 | Ga0070697_1008641851 | 98 |
| 338 | 3300005543 | Ga0070672_100041632 | Ga0070672_1000416322 | 98 |
| 339 | 3300005544 | Ga0070686_100190371 | Ga0070686_1001903712 | 98 |
| 340 | 3300005545 | Ga0070695_100980094 | Ga0070695_1009800942 | 98 |
| 341 | 3300005546 | Ga0070696_100005487 | Ga0070696_1000054875 | 98 |
| 342 | 3300005549 | Ga0070704_100057843 | Ga0070704_1000578433 | 98 |
| 343 | 3300005549 | Ga0070704_100736766 | Ga0070704_1007367662 | 98 |
| 344 | 3300005549 | Ga0070704_100985458 | Ga0070704_1009854582 | 98 |
| 345 | 3300005564 | Ga0070664_100026140 | Ga0070664_1000261402 | 98 |
| 346 | 3300005577 | Ga0068857_100417081 | Ga0068857_1004170813 | 98 |
| 347 | 3300005616 | Ga0068852_101063555 | Ga0068852_1010635552 | 98 |
| 348 | 3300005617 | Ga0068859_100027743 | Ga0068859_1000277433 | 98 |
| 349 | 3300005617 | Ga0068859_100379594 | Ga0068859_1003795942 | 98 |
| 350 | 3300005618 | Ga0068864_100016044 | Ga0068864_1000160443 | 98 |
| 351 | 3300005840 | Ga0068870_10154775 | Ga0068870_101547752 | 98 |
| 352 | 3300005840 | Ga0068870_10458441 | Ga0068870_104584412 | 98 |
| 353 | 3300005842 | Ga0068858_100991570 | Ga0068858_1009915702 | 98 |
| 354 | 3300005843 | Ga0068860_102243004 | Ga0068860_1022430042 | 98 |
| 355 | 3300005844 | Ga0068862_100577193 | Ga0068862_1005771932 | 98 |
| 356 | 3300006028 | Ga0070717_11791795 | Ga0070717_117917952 | 98 |
| 357 | 3300006058 | Ga0075432_10210689 | Ga0075432_102106892 | 98 |
| 358 | 3300006173 | Ga0070716_101529411 | Ga0070716_1015294111 | 98 |
| 359 | 3300006175 | Ga0070712_100295073 | Ga0070712_1002950732 | 98 |
| 360 | 3300006237 | Ga0097621_102434840 | Ga0097621_1024348402 | 98 |
| 361 | 3300006358 | Ga0068871_100996510 | Ga0068871_1009965102 | 98 |
| 362 | 3300006844 | Ga0075428_100941311 | Ga0075428_1009413112 | 98 |
| 363 | 3300006844 | Ga0075428_101148545 | Ga0075428_1011485452 | 98 |
| 364 | 3300006844 | Ga0075428_102631023 | Ga0075428_1026310232 | 98 |
| 365 | 3300006846 | Ga0075430_100866753 | Ga0075430_1008667532 | 98 |
| 366 | 3300006846 | Ga0075430_101263071 | Ga0075430_1012630712 | 98 |
| 367 | 3300006852 | Ga0075433_10104570 | Ga0075433_101045704 | 98 |
| 368 | 3300006871 | Ga0075434_100419277 | Ga0075434_1004192772 | 98 |
| 369 | 3300006880 | Ga0075429_100131023 | Ga0075429_1001310232 | 98 |
| 370 | 3300006880 | Ga0075429_100152347 | Ga0075429_1001523472 | 98 |
| 371 | 3300006880 | Ga0075429_100310362 | Ga0075429_1003103622 | 98 |
| 372 | 3300006880 | Ga0075429_100633518 | Ga0075429_1006335181 | 98 |
| 373 | 3300006931 | Ga0097620_100027741 | Ga0097620_1000277413 | 98 |
| 374 | 3300006931 | Ga0097620_100379593 | Ga0097620_1003795932 | 98 |
| 375 | 3300006931 | Ga0097620_101849231 | Ga0097620_1018492312 | 98 |
| 376 | 3300009092 | Ga0105250_10262023 | Ga0105250_102620231 | 98 |
| 377 | 3300009093 | Ga0105240_10635565 | Ga0105240_106355652 | 98 |
| 378 | 3300009094 | Ga0111539_10031711 | Ga0111539_100317117 | 98 |
| 379 | 3300009094 | Ga0111539_10088335 | Ga0111539_100883352 | 98 |
| 380 | 3300009094 | Ga0111539_10729901 | Ga0111539_107299011 | 98 |
| 381 | 3300009094 | Ga0111539_11166340 | Ga0111539_111663402 | 98 |
| 382 | 3300009094 | Ga0111539_11225417 | Ga0111539_112254172 | 98 |
| 383 | 3300009094 | Ga0111539_11775921 | Ga0111539_117759212 | 98 |
| 384 | 3300009094 | Ga0111539_12396531 | Ga0111539_123965311 | 98 |
| 385 | 3300009094 | Ga0111539_12407837 | Ga0111539_124078371 | 98 |
| 386 | 3300009147 | Ga0114129_10103495 | Ga0114129_101034953 | 98 |
| 387 | 3300009147 | Ga0114129_10448604 | Ga0114129_104486042 | 98 |
| 388 | 3300009147 | Ga0114129_10491991 | Ga0114129_104919912 | 98 |
| 389 | 3300009147 | Ga0114129_11439070 | Ga0114129_114390702 | 98 |
| 390 | 3300009147 | Ga0114129_12031475 | Ga0114129_120314752 | 98 |
| 391 | 3300009148 | Ga0105243_12573886 | Ga0105243_125738862 | 98 |
| 392 | 3300009174 | Ga0105241_10227160 | Ga0105241_102271603 | 98 |
| 393 | 3300009176 | Ga0105242_10027112 | Ga0105242_100271122 | 98 |
| 394 | 3300009177 | Ga0105248_10078834 | Ga0105248_100788343 | 98 |
| 395 | 3300009177 | Ga0105248_10588409 | Ga0105248_105884092 | 98 |
| 396 | 3300009545 | Ga0105237_10789770 | Ga0105237_107897702 | 98 |
| 397 | 3300011119 | Ga0105246_10655482 | Ga0105246_106554822 | 98 |
| 398 | 3300011119 | Ga0105246_11465365 | Ga0105246_114653652 | 98 |
| 399 | 3300013308 | Ga0157375_10122515 | Ga0157375_101225152 | 98 |
| 400 | 3300013308 | Ga0157375_10748925 | Ga0157375_107489252 | 98 |
| 401 | 3300013308 | Ga0157375_10922867 | Ga0157375_109228673 | 98 |
| 402 | 3300013308 | Ga0157375_12004728 | Ga0157375_120047282 | 98 |
| 403 | 3300014325 | Ga0163163_10051300 | Ga0163163_100513003 | 98 |
| 404 | 3300014326 | Ga0157380_10019060 | Ga0157380_100190603 | 98 |
| 405 | 3300014326 | Ga0157380_10244769 | Ga0157380_102447693 | 98 |
| 406 | 3300014326 | Ga0157380_11045784 | Ga0157380_110457842 | 98 |
| 407 | 3300014326 | Ga0157380_11467623 | Ga0157380_114676232 | 98 |
| 408 | 3300014326 | Ga0157380_13327703 | Ga0157380_133277032 | 98 |
| 409 | 3300014745 | Ga0157377_10168058 | Ga0157377_101680582 | 98 |
| 410 | 3300014745 | Ga0157377_10409306 | Ga0157377_104093062 | 98 |
| 411 | 3300014968 | Ga0157379_10018789 | Ga0157379_100187897 | 98 |
| 412 | 3300014969 | Ga0157376_10102217 | Ga0157376_101022172 | 98 |
| 413 | 3300025893 | Ga0207682_10141899 | Ga0207682_101418991 | 98 |
| 414 | 3300025903 | Ga0207680_10175344 | Ga0207680_101753442 | 98 |
| 415 | 3300025903 | Ga0207680_11198531 | Ga0207680_111985312 | 98 |
| 416 | 3300025906 | Ga0207699_10369831 | Ga0207699_103698312 | 98 |
| 417 | 3300025907 | Ga0207645_10139529 | Ga0207645_101395293 | 98 |
| 418 | 3300025908 | Ga0207643_10468671 | Ga0207643_104686712 | 98 |
| 419 | 3300025910 | Ga0207684_10050119 | Ga0207684_100501194 | 98 |
| 420 | 3300025915 | Ga0207693_10404735 | Ga0207693_104047352 | 98 |
| 421 | 3300025917 | Ga0207660_10126900 | Ga0207660_101269002 | 98 |
| 422 | 3300025918 | Ga0207662_10036889 | Ga0207662_100368895 | 98 |
| 423 | 3300025918 | Ga0207662_10079506 | Ga0207662_100795062 | 98 |
| 424 | 3300025920 | Ga0207649_10074085 | Ga0207649_100740852 | 98 |
| 425 | 3300025922 | Ga0207646_10683837 | Ga0207646_106838372 | 98 |
| 426 | 3300025923 | Ga0207681_10242915 | Ga0207681_102429152 | 98 |
| 427 | 3300025925 | Ga0207650_10212934 | Ga0207650_102129342 | 98 |
| 428 | 3300025926 | Ga0207659_10245933 | Ga0207659_102459332 | 98 |
| 429 | 3300025926 | Ga0207659_11157736 | Ga0207659_111577361 | 98 |
| 430 | 3300025928 | Ga0207700_10407357 | Ga0207700_104073572 | 98 |
| 431 | 3300025929 | Ga0207664_10019126 | Ga0207664_100191265 | 98 |
| 432 | 3300025933 | Ga0207706_10255567 | Ga0207706_102555672 | 98 |
| 433 | 3300025936 | Ga0207670_10856524 | Ga0207670_108565242 | 98 |
| 434 | 3300025936 | Ga0207670_10882285 | Ga0207670_108822852 | 98 |
| 435 | 3300025937 | Ga0207669_10163951 | Ga0207669_101639512 | 98 |
| 436 | 3300025937 | Ga0207669_10513240 | Ga0207669_105132402 | 98 |
| 437 | 3300025960 | Ga0207651_10113967 | Ga0207651_101139673 | 98 |
| 438 | 3300025972 | Ga0207668_10388884 | Ga0207668_103888842 | 98 |
| 439 | 3300026023 | Ga0207677_11892456 | Ga0207677_118924561 | 98 |
| 440 | 3300026023 | Ga0207677_11922384 | Ga0207677_119223842 | 98 |
| 441 | 3300026035 | Ga0207703_11466846 | Ga0207703_114668462 | 98 |
| 442 | 3300026041 | Ga0207639_10948082 | Ga0207639_109480821 | 98 |
| 443 | 3300026067 | Ga0207678_11021343 | Ga0207678_110213431 | 98 |
| 444 | 3300026075 | Ga0207708_10035538 | Ga0207708_100355382 | 98 |
| 445 | 3300026075 | Ga0207708_10050949 | Ga0207708_100509493 | 98 |
| 446 | 3300026075 | Ga0207708_10383685 | Ga0207708_103836851 | 98 |
| 447 | 3300026075 | Ga0207708_11271275 | Ga0207708_112712752 | 98 |
| 448 | 3300026088 | Ga0207641_10491030 | Ga0207641_104910303 | 98 |
| 449 | 3300026088 | Ga0207641_10689032 | Ga0207641_106890322 | 98 |
| 450 | 3300026089 | Ga0207648_10138059 | Ga0207648_101380593 | 98 |
| 451 | 3300026095 | Ga0207676_10057882 | Ga0207676_100578822 | 98 |
| 452 | 3300026095 | Ga0207676_10764784 | Ga0207676_107647842 | 98 |
| 453 | 3300026116 | Ga0207674_10284441 | Ga0207674_102844411 | 98 |
| 454 | 3300026118 | Ga0207675_100224347 | Ga0207675_1002243473 | 98 |
| 455 | 3300026118 | Ga0207675_100927920 | Ga0207675_1009279202 | 98 |
| 456 | 3300027360 | Ga0209969_1023274 | Ga0209969_10232741 | 98 |
| 457 | 3300027876 | Ga0209974_10469283 | Ga0209974_104692832 | 98 |
| 458 | 3300027907 | Ga0207428_10055858 | Ga0207428_100558582 | 98 |
| 459 | 3300027907 | Ga0207428_10071304 | Ga0207428_100713042 | 98 |
| 460 | 3300027907 | Ga0207428_10384192 | Ga0207428_103841922 | 98 |
| 461 | 3300027907 | Ga0207428_11004282 | Ga0207428_110042822 | 98 |
| 462 | 3300028381 | Ga0268264_10594671 | Ga0268264_105946712 | 98 |
| 463 | 3300028381 | Ga0268264_12631312 | Ga0268264_126313122 | 98 |
| 464 | 3300031548 | Ga0307408_100023632 | Ga0307408_1000236322 | 98 |
| 465 | 3300031548 | Ga0307408_100261771 | Ga0307408_1002617712 | 98 |
| 466 | 3300031731 | Ga0307405_10006893 | Ga0307405_100068933 | 98 |
| 467 | 3300031824 | Ga0307413_10239745 | Ga0307413_102397453 | 98 |
| 468 | 3300031824 | Ga0307413_10331048 | Ga0307413_103310482 | 98 |
| 469 | 3300031824 | Ga0307413_10382255 | Ga0307413_103822552 | 98 |
| 470 | 3300031824 | Ga0307413_10417206 | Ga0307413_104172062 | 98 |
| 471 | 3300031824 | Ga0307413_10626788 | Ga0307413_106267882 | 98 |
| 472 | 3300031852 | Ga0307410_10002658 | Ga0307410_100026587 | 98 |
| 473 | 3300031852 | Ga0307410_10042686 | Ga0307410_100426864 | 98 |
| 474 | 3300031852 | Ga0307410_10508726 | Ga0307410_105087262 | 98 |
| 475 | 3300031852 | Ga0307410_10782691 | Ga0307410_107826912 | 98 |
| 476 | 3300031901 | Ga0307406_10030254 | Ga0307406_100302544 | 98 |
| 477 | 3300031901 | Ga0307406_10098326 | Ga0307406_100983264 | 98 |
| 478 | 3300031903 | Ga0307407_10051437 | Ga0307407_100514372 | 98 |
| 479 | 3300031903 | Ga0307407_10090709 | Ga0307407_100907092 | 98 |
| 480 | 3300031903 | Ga0307407_10331626 | Ga0307407_103316262 | 98 |
| 481 | 3300031903 | Ga0307407_10411242 | Ga0307407_104112422 | 98 |
| 482 | 3300031911 | Ga0307412_10002780 | Ga0307412_100027804 | 98 |
| 483 | 3300031911 | Ga0307412_10281513 | Ga0307412_102815132 | 98 |
| 484 | 3300031911 | Ga0307412_10367850 | Ga0307412_103678502 | 98 |
| 485 | 3300031911 | Ga0307412_10941510 | Ga0307412_109415102 | 98 |
| 486 | 3300031995 | Ga0307409_100026062 | Ga0307409_1000260622 | 98 |
| 487 | 3300031995 | Ga0307409_100061598 | Ga0307409_1000615982 | 98 |
| 488 | 3300031995 | Ga0307409_100067913 | Ga0307409_1000679132 | 98 |
| 489 | 3300031995 | Ga0307409_100110777 | Ga0307409_1001107774 | 98 |
| 490 | 3300031995 | Ga0307409_100188142 | Ga0307409_1001881423 | 98 |
| 491 | 3300032002 | Ga0307416_100064487 | Ga0307416_1000644874 | 98 |
| 492 | 3300032002 | Ga0307416_100084872 | Ga0307416_1000848722 | 98 |
| 493 | 3300032002 | Ga0307416_100163096 | Ga0307416_1001630963 | 98 |
| 494 | 3300032002 | Ga0307416_100634802 | Ga0307416_1006348022 | 98 |
| 495 | 3300032002 | Ga0307416_100812870 | Ga0307416_1008128702 | 98 |
| 496 | 3300032004 | Ga0307414_10188975 | Ga0307414_101889751 | 98 |
| 497 | 3300032004 | Ga0307414_10235540 | Ga0307414_102355402 | 98 |
| 498 | 3300032004 | Ga0307414_10400370 | Ga0307414_104003702 | 98 |
| 499 | 3300032004 | Ga0307414_11165783 | Ga0307414_111657832 | 98 |
| 500 | 3300032005 | Ga0307411_10111433 | Ga0307411_101114332 | 98 |
| 501 | 3300032005 | Ga0307411_10219441 | Ga0307411_102194412 | 98 |
| 502 | 3300032005 | Ga0307411_10301332 | Ga0307411_103013322 | 98 |
| 503 | 3300032005 | Ga0307411_10329942 | Ga0307411_103299422 | 98 |
| 504 | 3300032005 | Ga0307411_10469203 | Ga0307411_104692032 | 98 |
| 505 | 3300032005 | Ga0307411_11645149 | Ga0307411_116451492 | 98 |
| 506 | 3300032126 | Ga0307415_100043485 | Ga0307415_1000434854 | 98 |
| 507 | 3300032126 | Ga0307415_100179480 | Ga0307415_1001794803 | 98 |
| 508 | 3300032126 | Ga0307415_100347555 | Ga0307415_1003475552 | 98 |
| 509 | 3300032126 | Ga0307415_101304893 | Ga0307415_1013048932 | 98 |
| 510 | 3300035121 | Ga0373960_0190300 | Ga0373960_0190300_14_310 | 98 |
| 511 | 3300041459 | Ga0451800_0575700 | Ga0451800_0575700_432_728 | 98 |
| 512 | 3300041486 | Ga0451807_0526429 | Ga0451807_0526429_326_622 | 98 |
| 513 | 3300041486 | Ga0451807_0793962 | Ga0451807_0793962_282_578 | 98 |
| 514 | 3300041496 | Ga0451839_0563425 | Ga0451839_0563425_193_489 | 98 |
| 515 | 3300041505 | Ga0451849_1226666 | Ga0451849_1226666_175_471 | 98 |
| 516 | 3300041512 | Ga0451853_2084722 | Ga0451853_2084722_297_593 | 98 |
| 517 | 3300041512 | Ga0451853_2545316 | Ga0451853_2545316_796_1092 | 98 |
| 518 | 3300041512 | Ga0451853_3745927 | Ga0451853_3745927_39_335 | 98 |
| 519 | 3300041999 | Ga0439433_0083770 | Ga0439433_0083770_38_334 | 98 |
| 520 | 3300042125 | Ga0450923_018237 | Ga0450923_018237_866_1162 | 98 |
| 521 | 3300042439 | Ga0439464_0033332 | Ga0439464_0033332_836_1132 | 98 |
| 522 | 3300042461 | Ga0439460_0181914 | Ga0439460_0181914_122_418 | 98 |
| 523 | 3300042531 | Ga0450918_034014 | Ga0450918_034014_487_783 | 98 |
| 524 | 3300044901 | Ga0466960_0876213 | Ga0466960_0876213_116_424 | 98 |
| 525 | 3300045976 | Ga0466967_1607584 | Ga0466967_1607584_315_611 | 98 |
| 526 | 3300046491 | Ga0495584_0031669 | Ga0495584_0031669_408_704 | 98 |
| 527 | 3300046520 | Ga0495637_0207938 | Ga0495637_0207938_74_370 | 98 |
| 528 | 3300046522 | Ga0495643_0001941 | Ga0495643_0001941_8957_9253 | 98 |
| 529 | 3300046525 | Ga0495663_0134012 | Ga0495663_0134012_478_774 | 98 |
| 530 | 3300046537 | Ga0495598_0009390 | Ga0495598_0009390_127_423 | 98 |
| 531 | 3300046537 | Ga0495598_0015886 | Ga0495598_0015886_1212_1508 | 98 |
| 532 | 3300046537 | Ga0495598_0134260 | Ga0495598_0134260_18_314 | 98 |
| 533 | 3300046538 | Ga0495609_0079851 | Ga0495609_0079851_463_759 | 98 |
| 534 | 3300046539 | Ga0495621_0094454 | Ga0495621_0094454_337_633 | 98 |
| 535 | 3300046539 | Ga0495621_0167157 | Ga0495621_0167157_79_375 | 98 |
| 536 | 3300046542 | Ga0495597_0351223 | Ga0495597_0351223_94_390 | 98 |
| 537 | 3300046615 | Ga0495656_0107445 | Ga0495656_0107445_812_1108 | 98 |
| 538 | 3300046664 | Ga0495659_0102391 | Ga0495659_0102391_723_1019 | 98 |
| 539 | 3300046681 | Ga0495647_0003465 | Ga0495647_0003465_1319_1618 | 98 |
| 540 | 3300046684 | Ga0495669_0114625 | Ga0495669_0114625_844_1140 | 98 |
| 541 | 3300046684 | Ga0495669_0338223 | Ga0495669_0338223_45_341 | 98 |
| 542 | 3300047447 | Ga0495685_080951 | Ga0495685_080951_100_396 | 98 |
| 543 | 3300048090 | Ga0495615_0145672 | Ga0495615_0145672_92_388 | 98 |
| 544 | 3300048908 | Ga0496105_0343643 | Ga0496105_0343643_71_370 | 98 |
| 545 | 3300048917 | Ga0496114_0053394 | Ga0496114_0053394_1670_1969 | 98 |
| 546 | 3300049572 | Ga0501036_0273501 | Ga0501036_0273501_590_886 | 98 |
| 547 | 3300049572 | Ga0501036_0591953 | Ga0501036_0591953_55_351 | 98 |
| 548 | 3300049572 | Ga0501036_0652360 | Ga0501036_0652360_471_767 | 98 |
| 549 | 3300049572 | Ga0501036_1015335 | Ga0501036_1015335_311_607 | 98 |
| 550 | 3300049574 | Ga0501038_0834415 | Ga0501038_0834415_201_497 | 98 |
| 551 | 3300049575 | Ga0501039_0258539 | Ga0501039_0258539_1054_1350 | 98 |
| 552 | 3300049576 | Ga0501040_0286680 | Ga0501040_0286680_764_1060 | 98 |
| 553 | 3300049576 | Ga0501040_1230390 | Ga0501040_1230390_229_525 | 98 |
| 554 | 3300049577 | Ga0501041_0235132 | Ga0501041_0235132_140_436 | 98 |
| 555 | 3300049577 | Ga0501041_0530679 | Ga0501041_0530679_226_522 | 98 |
| 556 | 3300049578 | Ga0501042_0075928 | Ga0501042_0075928_2003_2299 | 98 |
| 557 | 3300049578 | Ga0501042_0085131 | Ga0501042_0085131_1299_1595 | 98 |
| 558 | 3300049578 | Ga0501042_0210948 | Ga0501042_0210948_891_1187 | 98 |
| 559 | 3300049578 | Ga0501042_1258217 | Ga0501042_1258217_101_397 | 98 |
| 560 | 3300049578 | Ga0501042_1373781 | Ga0501042_1373781_192_488 | 98 |
| 561 | 3300049580 | Ga0501046_0610915 | Ga0501046_0610915_296_592 | 98 |
| 562 | 3300049583 | Ga0501067_0544826 | Ga0501067_0544826_268_567 | 98 |
| 563 | 3300049584 | Ga0501068_0075221 | Ga0501068_0075221_1269_1565 | 98 |
| 564 | 3300049587 | Ga0501071_0159629 | Ga0501071_0159629_334_630 | 98 |
| 565 | 3300049587 | Ga0501071_0239367 | Ga0501071_0239367_35_331 | 98 |
| 566 | 3300049587 | Ga0501071_0435316 | Ga0501071_0435316_513_809 | 98 |
| 567 | 3300049587 | Ga0501071_0672350 | Ga0501071_0672350_61_357 | 98 |
| 568 | 3300049587 | Ga0501071_1099832 | Ga0501071_1099832_190_486 | 98 |
| 569 | 3300049588 | Ga0501072_0109368 | Ga0501072_0109368_59_355 | 98 |
| 570 | 3300049590 | Ga0501074_0194780 | Ga0501074_0194780_330_626 | 98 |
| 571 | 3300049590 | Ga0501074_0314169 | Ga0501074_0314169_622_918 | 98 |
| 572 | 3300049591 | Ga0501075_0121589 | Ga0501075_0121589_1188_1484 | 98 |
| 573 | 3300049592 | Ga0501076_0085979 | Ga0501076_0085979_177_473 | 98 |
| 574 | 3300049592 | Ga0501076_0159376 | Ga0501076_0159376_803_1099 | 98 |
| 575 | 3300049592 | Ga0501076_0185119 | Ga0501076_0185119_535_831 | 98 |
| 576 | 3300049592 | Ga0501076_0546117 | Ga0501076_0546117_452_748 | 98 |
| 577 | 3300049593 | Ga0501077_0253061 | Ga0501077_0253061_731_1027 | 98 |
| 578 | 3300049593 | Ga0501077_0488621 | Ga0501077_0488621_97_393 | 98 |
| 579 | 3300049593 | Ga0501077_0835607 | Ga0501077_0835607_56_352 | 98 |
| 580 | 3300049658 | Ga0501211_043925 | Ga0501211_043925_40_336 | 98 |
| 581 | 3300049742 | Ga0501080_0393028 | Ga0501080_0393028_347_643 | 98 |
| 582 | 3300049743 | Ga0501081_0354441 | Ga0501081_0354441_31_327 | 98 |
| 583 | 3300049744 | Ga0501083_1035306 | Ga0501083_1035306_120_416 | 98 |
| 584 | 3300049824 | Ga0501045_0091558 | Ga0501045_0091558_726_1022 | 98 |
| 585 | 3300050491 | nmdc:mga00v17_373533_c1 | nmdc:mga00v17_373533_c1_185_481 | 98 |
| 586 | 3300050493 | nmdc:mga0k408_601469_c1 | nmdc:mga0k408_601469_c1_99_395 | 98 |
| 587 | 3300050493 | nmdc:mga0k408_842942_c1 | nmdc:mga0k408_842942_c1_94_390 | 98 |
| 588 | 3300050494 | nmdc:mga06z11_640735_c1 | nmdc:mga06z11_640735_c1_80_376 | 98 |
| 589 | 3300050507 | nmdc:mga05p37_554256_c1 | nmdc:mga05p37_554256_c1_234_530 | 98 |
| 590 | 3300050507 | nmdc:mga05p37_59208_c1 | nmdc:mga05p37_59208_c1_3153_3449 | 98 |
| 591 | 3300050507 | nmdc:mga05p37_979152_c1 | nmdc:mga05p37_979152_c1_152_451 | 98 |
| 592 | 3300050508 | nmdc:mga09592_1053806_c1 | nmdc:mga09592_1053806_c1_353_652 | 98 |
| 593 | 3300050508 | nmdc:mga09592_1521423_c1 | nmdc:mga09592_1521423_c1_56_352 | 98 |
| 594 | 3300050508 | nmdc:mga09592_553605_c1 | nmdc:mga09592_553605_c1_642_938 | 98 |
| 595 | 3300050509 | nmdc:mga0qj67_915933_c1 | nmdc:mga0qj67_915933_c1_152_451 | 98 |
| 596 | 3300050511 | nmdc:mga08y16_1015049_c1 | nmdc:mga08y16_1015049_c1_63_359 | 98 |
| 597 | 3300050511 | nmdc:mga08y16_1141985_c1 | nmdc:mga08y16_1141985_c1_396_692 | 98 |
| 598 | 3300050511 | nmdc:mga08y16_19906_c1 | nmdc:mga08y16_19906_c1_999_1295 | 98 |
| 599 | 3300050511 | nmdc:mga08y16_67967_c1 | nmdc:mga08y16_67967_c1_1945_2241 | 98 |
| 600 | 3300050511 | nmdc:mga08y16_87982_c1 | nmdc:mga08y16_87982_c1_125_421 | 98 |
| 601 | 3300050512 | nmdc:mga0n895_1576179_c1 | nmdc:mga0n895_1576179_c1_249_545 | 98 |
| 602 | 3300050512 | nmdc:mga0n895_31613_c1 | nmdc:mga0n895_31613_c1_2028_2327 | 98 |
| 603 | 3300050513 | nmdc:mga0rr50_597653_c1 | nmdc:mga0rr50_597653_c1_161_460 | 98 |
| 604 | 3300050513 | nmdc:mga0rr50_99442_c1 | nmdc:mga0rr50_99442_c1_1929_2225 | 98 |
| 605 | 3300050514 | nmdc:mga08x19_15948_c1 | nmdc:mga08x19_15948_c1_3347_3646 | 98 |
| 606 | 3300050515 | nmdc:mga0a205_249539_c1 | nmdc:mga0a205_249539_c1_444_740 | 98 |
| 607 | 3300050515 | nmdc:mga0a205_509325_c1 | nmdc:mga0a205_509325_c1_262_561 | 98 |
| 608 | 3300050515 | nmdc:mga0a205_56533_c1 | nmdc:mga0a205_56533_c1_1881_2180 | 98 |
| 609 | 3300054114 | Ga0501084_0087693 | Ga0501084_0087693_2288_2584 | 98 |
| 610 | 3300054114 | Ga0501084_0516083 | Ga0501084_0516083_344_640 | 98 |
| 611 | 3300054114 | Ga0501084_1642936 | Ga0501084_1642936_215_511 | 98 |
| 612 | 3300059421 | Ga0590071_056342 | Ga0590071_056342_45_341 | 98 |
| 613 | 3300059426 | Ga0590077_030411 | Ga0590077_030411_158_454 | 98 |
| 614 | 3300060353 | Ga0501082_0164047 | Ga0501082_0164047_565_861 | 98 |
| 615 | 3300060353 | Ga0501082_0198840 | Ga0501082_0198840_417_713 | 98 |
| 616 | 3300060353 | Ga0501082_0342075 | Ga0501082_0342075_62_358 | 98 |
| 617 | 3300060353 | Ga0501082_1850452 | Ga0501082_1850452_161_457 | 98 |
| 618 | 3300061734 | Ga0530510_0332525 | Ga0530510_0332525_405_701 | 98 |
| 619 | 3300061734 | Ga0530510_0439828 | Ga0530510_0439828_287_583 | 98 |
| 620 | 3300061734 | Ga0530510_0564265 | Ga0530510_0564265_199_495 | 98 |
| 621 | 3300003203 | JGI25406J46586_10083124 | JGI25406J46586_100831241 | 99 |
| 622 | 3300003203 | JGI25406J46586_10092444 | JGI25406J46586_100924441 | 99 |
| 623 | 3300003203 | JGI25406J46586_10213409 | JGI25406J46586_102134091 | 99 |
| 624 | 3300005290 | Ga0065712_10153694 | Ga0065712_101536943 | 99 |
| 625 | 3300005293 | Ga0065715_10149341 | Ga0065715_101493412 | 99 |
| 626 | 3300005295 | Ga0065707_10170689 | Ga0065707_101706892 | 99 |
| 627 | 3300005295 | Ga0065707_11136378 | Ga0065707_111363782 | 99 |
| 628 | 3300005329 | Ga0070683_100007552 | Ga0070683_1000075526 | 99 |
| 629 | 3300005330 | Ga0070690_100149010 | Ga0070690_1001490101 | 99 |
| 630 | 3300005330 | Ga0070690_100170683 | Ga0070690_1001706832 | 99 |
| 631 | 3300005330 | Ga0070690_100257315 | Ga0070690_1002573152 | 99 |
| 632 | 3300005331 | Ga0070670_100004413 | Ga0070670_1000044137 | 99 |
| 633 | 3300005334 | Ga0068869_100058451 | Ga0068869_1000584513 | 99 |
| 634 | 3300005334 | Ga0068869_100084729 | Ga0068869_1000847292 | 99 |
| 635 | 3300005334 | Ga0068869_100823931 | Ga0068869_1008239312 | 99 |
| 636 | 3300005335 | Ga0070666_10063575 | Ga0070666_100635752 | 99 |
| 637 | 3300005335 | Ga0070666_10859068 | Ga0070666_108590682 | 99 |
| 638 | 3300005336 | Ga0070680_100778601 | Ga0070680_1007786012 | 99 |
| 639 | 3300005336 | Ga0070680_101163650 | Ga0070680_1011636501 | 99 |
| 640 | 3300005337 | Ga0070682_100493593 | Ga0070682_1004935932 | 99 |
| 641 | 3300005337 | Ga0070682_101400767 | Ga0070682_1014007672 | 99 |
| 642 | 3300005337 | Ga0070682_101904942 | Ga0070682_1019049421 | 99 |
| 643 | 3300005338 | Ga0068868_100315931 | Ga0068868_1003159312 | 99 |
| 644 | 3300005340 | Ga0070689_100030548 | Ga0070689_1000305483 | 99 |
| 645 | 3300005340 | Ga0070689_100256727 | Ga0070689_1002567271 | 99 |
| 646 | 3300005340 | Ga0070689_100275519 | Ga0070689_1002755192 | 99 |
| 647 | 3300005340 | Ga0070689_100725728 | Ga0070689_1007257282 | 99 |
| 648 | 3300005341 | Ga0070691_10182267 | Ga0070691_101822673 | 99 |
| 649 | 3300005343 | Ga0070687_100008463 | Ga0070687_1000084633 | 99 |
| 650 | 3300005344 | Ga0070661_100012520 | Ga0070661_1000125203 | 99 |
| 651 | 3300005347 | Ga0070668_100269987 | Ga0070668_1002699872 | 99 |
| 652 | 3300005347 | Ga0070668_100636083 | Ga0070668_1006360832 | 99 |
| 653 | 3300005353 | Ga0070669_100102174 | Ga0070669_1001021742 | 99 |
| 654 | 3300005353 | Ga0070669_100156483 | Ga0070669_1001564833 | 99 |
| 655 | 3300005353 | Ga0070669_100336184 | Ga0070669_1003361843 | 99 |
| 656 | 3300005353 | Ga0070669_100960175 | Ga0070669_1009601752 | 99 |
| 657 | 3300005354 | Ga0070675_100179773 | Ga0070675_1001797733 | 99 |
| 658 | 3300005354 | Ga0070675_100702999 | Ga0070675_1007029993 | 99 |
| 659 | 3300005354 | Ga0070675_102161713 | Ga0070675_1021617131 | 99 |
| 660 | 3300005355 | Ga0070671_100037051 | Ga0070671_1000370513 | 99 |
| 661 | 3300005355 | Ga0070671_101165111 | Ga0070671_1011651111 | 99 |
| 662 | 3300005364 | Ga0070673_100016210 | Ga0070673_1000162105 | 99 |
| 663 | 3300005365 | Ga0070688_100428286 | Ga0070688_1004282862 | 99 |
| 664 | 3300005365 | Ga0070688_100854438 | Ga0070688_1008544382 | 99 |
| 665 | 3300005365 | Ga0070688_101624904 | Ga0070688_1016249041 | 99 |
| 666 | 3300005366 | Ga0070659_100976545 | Ga0070659_1009765452 | 99 |
| 667 | 3300005367 | Ga0070667_100102344 | Ga0070667_1001023443 | 99 |
| 668 | 3300005367 | Ga0070667_100105118 | Ga0070667_1001051182 | 99 |
| 669 | 3300005367 | Ga0070667_102254858 | Ga0070667_1022548581 | 99 |
| 670 | 3300005438 | Ga0070701_10043041 | Ga0070701_100430411 | 99 |
| 671 | 3300005438 | Ga0070701_10890246 | Ga0070701_108902461 | 99 |
| 672 | 3300005441 | Ga0070700_100111792 | Ga0070700_1001117922 | 99 |
| 673 | 3300005441 | Ga0070700_101766357 | Ga0070700_1017663571 | 99 |
| 674 | 3300005455 | Ga0070663_100219852 | Ga0070663_1002198522 | 99 |
| 675 | 3300005456 | Ga0070678_100676007 | Ga0070678_1006760072 | 99 |
| 676 | 3300005457 | Ga0070662_101702549 | Ga0070662_1017025491 | 99 |
| 677 | 3300005459 | Ga0068867_100286403 | Ga0068867_1002864033 | 99 |
| 678 | 3300005459 | Ga0068867_100470492 | Ga0068867_1004704922 | 99 |
| 679 | 3300005459 | Ga0068867_100648207 | Ga0068867_1006482072 | 99 |
| 680 | 3300005466 | Ga0070685_10263185 | Ga0070685_102631851 | 99 |
| 681 | 3300005466 | Ga0070685_10267026 | Ga0070685_102670262 | 99 |
| 682 | 3300005466 | Ga0070685_11391578 | Ga0070685_113915781 | 99 |
| 683 | 3300005467 | Ga0070706_101859534 | Ga0070706_1018595341 | 99 |
| 684 | 3300005468 | Ga0070707_101543588 | Ga0070707_1015435881 | 99 |
| 685 | 3300005518 | Ga0070699_100021870 | Ga0070699_1000218703 | 99 |
| 686 | 3300005535 | Ga0070684_100005231 | Ga0070684_1000052313 | 99 |
| 687 | 3300005543 | Ga0070672_100471306 | Ga0070672_1004713062 | 99 |
| 688 | 3300005544 | Ga0070686_100031148 | Ga0070686_1000311483 | 99 |
| 689 | 3300005544 | Ga0070686_100611433 | Ga0070686_1006114332 | 99 |
| 690 | 3300005545 | Ga0070695_100496908 | Ga0070695_1004969083 | 99 |
| 691 | 3300005546 | Ga0070696_100050068 | Ga0070696_1000500682 | 99 |
| 692 | 3300005547 | Ga0070693_100185296 | Ga0070693_1001852963 | 99 |
| 693 | 3300005547 | Ga0070693_100469191 | Ga0070693_1004691912 | 99 |
| 694 | 3300005547 | Ga0070693_100699894 | Ga0070693_1006998941 | 99 |
| 695 | 3300005548 | Ga0070665_101164879 | Ga0070665_1011648792 | 99 |
| 696 | 3300005549 | Ga0070704_100739832 | Ga0070704_1007398321 | 99 |
| 697 | 3300005564 | Ga0070664_100001608 | Ga0070664_1000016089 | 99 |
| 698 | 3300005564 | Ga0070664_100257859 | Ga0070664_1002578593 | 99 |
| 699 | 3300005577 | Ga0068857_100021160 | Ga0068857_1000211603 | 99 |
| 700 | 3300005615 | Ga0070702_100152589 | Ga0070702_1001525893 | 99 |
| 701 | 3300005615 | Ga0070702_100677648 | Ga0070702_1006776482 | 99 |
| 702 | 3300005617 | Ga0068859_100197425 | Ga0068859_1001974252 | 99 |
| 703 | 3300005617 | Ga0068859_100244855 | Ga0068859_1002448551 | 99 |
| 704 | 3300005617 | Ga0068859_100410868 | Ga0068859_1004108682 | 99 |
| 705 | 3300005617 | Ga0068859_102508717 | Ga0068859_1025087171 | 99 |
| 706 | 3300005618 | Ga0068864_101179039 | Ga0068864_1011790391 | 99 |
| 707 | 3300005618 | Ga0068864_102118915 | Ga0068864_1021189151 | 99 |
| 708 | 3300005718 | Ga0068866_10108018 | Ga0068866_101080183 | 99 |
| 709 | 3300005718 | Ga0068866_11236171 | Ga0068866_112361711 | 99 |
| 710 | 3300005719 | Ga0068861_100030884 | Ga0068861_1000308844 | 99 |
| 711 | 3300005719 | Ga0068861_101097131 | Ga0068861_1010971312 | 99 |
| 712 | 3300005834 | Ga0068851_10041209 | Ga0068851_100412092 | 99 |
| 713 | 3300005841 | Ga0068863_100429611 | Ga0068863_1004296113 | 99 |
| 714 | 3300005841 | Ga0068863_101602832 | Ga0068863_1016028322 | 99 |
| 715 | 3300005842 | Ga0068858_100221343 | Ga0068858_1002213433 | 99 |
| 716 | 3300005842 | Ga0068858_100298054 | Ga0068858_1002980542 | 99 |
| 717 | 3300005842 | Ga0068858_101841938 | Ga0068858_1018419382 | 99 |
| 718 | 3300005843 | Ga0068860_100288994 | Ga0068860_1002889942 | 99 |
| 719 | 3300005843 | Ga0068860_100382474 | Ga0068860_1003824743 | 99 |
| 720 | 3300005843 | Ga0068860_101142187 | Ga0068860_1011421871 | 99 |
| 721 | 3300005844 | Ga0068862_100479185 | Ga0068862_1004791851 | 99 |
| 722 | 3300005844 | Ga0068862_100772970 | Ga0068862_1007729702 | 99 |
| 723 | 3300005844 | Ga0068862_100966043 | Ga0068862_1009660432 | 99 |
| 724 | 3300005844 | Ga0068862_102209706 | Ga0068862_1022097062 | 99 |
| 725 | 3300005985 | Ga0081539_10001702 | Ga0081539_1000170225 | 99 |
| 726 | 3300005985 | Ga0081539_10038590 | Ga0081539_100385902 | 99 |
| 727 | 3300005985 | Ga0081539_10040663 | Ga0081539_100406632 | 99 |
| 728 | 3300005985 | Ga0081539_10075209 | Ga0081539_100752092 | 99 |
| 729 | 3300006038 | Ga0075365_10022822 | Ga0075365_100228223 | 99 |
| 730 | 3300006042 | Ga0075368_10107148 | Ga0075368_101071482 | 99 |
| 731 | 3300006048 | Ga0075363_100266427 | Ga0075363_1002664272 | 99 |
| 732 | 3300006051 | Ga0075364_10021212 | Ga0075364_100212123 | 99 |
| 733 | 3300006058 | Ga0075432_10474815 | Ga0075432_104748152 | 99 |
| 734 | 3300006177 | Ga0075362_10006980 | Ga0075362_100069804 | 99 |
| 735 | 3300006178 | Ga0075367_10055938 | Ga0075367_100559381 | 99 |
| 736 | 3300006186 | Ga0075369_10335085 | Ga0075369_103350852 | 99 |
| 737 | 3300006195 | Ga0075366_10009667 | Ga0075366_100096672 | 99 |
| 738 | 3300006237 | Ga0097621_100183506 | Ga0097621_1001835063 | 99 |
| 739 | 3300006353 | Ga0075370_10033251 | Ga0075370_100332512 | 99 |
| 740 | 3300006358 | Ga0068871_100064962 | Ga0068871_1000649622 | 99 |
| 741 | 3300006358 | Ga0068871_100927422 | Ga0068871_1009274222 | 99 |
| 742 | 3300006358 | Ga0068871_101599655 | Ga0068871_1015996552 | 99 |
| 743 | 3300006358 | Ga0068871_101686193 | Ga0068871_1016861932 | 99 |
| 744 | 3300006844 | Ga0075428_100132288 | Ga0075428_1001322882 | 99 |
| 745 | 3300006844 | Ga0075428_100336039 | Ga0075428_1003360392 | 99 |
| 746 | 3300006846 | Ga0075430_100061518 | Ga0075430_1000615182 | 99 |
| 747 | 3300006846 | Ga0075430_100202398 | Ga0075430_1002023982 | 99 |
| 748 | 3300006846 | Ga0075430_100382920 | Ga0075430_1003829202 | 99 |
| 749 | 3300006846 | Ga0075430_100708444 | Ga0075430_1007084442 | 99 |
| 750 | 3300006847 | Ga0075431_101231372 | Ga0075431_1012313721 | 99 |
| 751 | 3300006847 | Ga0075431_101264756 | Ga0075431_1012647562 | 99 |
| 752 | 3300006852 | Ga0075433_10500118 | Ga0075433_105001182 | 99 |
| 753 | 3300006852 | Ga0075433_10895592 | Ga0075433_108955921 | 99 |
| 754 | 3300006871 | Ga0075434_100027981 | Ga0075434_1000279813 | 99 |
| 755 | 3300006871 | Ga0075434_100295964 | Ga0075434_1002959642 | 99 |
| 756 | 3300006880 | Ga0075429_100031024 | Ga0075429_1000310243 | 99 |
| 757 | 3300006880 | Ga0075429_100235486 | Ga0075429_1002354863 | 99 |
| 758 | 3300006880 | Ga0075429_101413257 | Ga0075429_1014132571 | 99 |
| 759 | 3300006881 | Ga0068865_100121111 | Ga0068865_1001211111 | 99 |
| 760 | 3300006881 | Ga0068865_100415698 | Ga0068865_1004156982 | 99 |
| 761 | 3300006881 | Ga0068865_101291166 | Ga0068865_1012911662 | 99 |
| 762 | 3300006931 | Ga0097620_100197407 | Ga0097620_1001974072 | 99 |
| 763 | 3300006931 | Ga0097620_100244853 | Ga0097620_1002448531 | 99 |
| 764 | 3300006931 | Ga0097620_100410879 | Ga0097620_1004108792 | 99 |
| 765 | 3300006931 | Ga0097620_102508684 | Ga0097620_1025086841 | 99 |
| 766 | 3300007076 | Ga0075435_101178059 | Ga0075435_1011780592 | 99 |
| 767 | 3300009094 | Ga0111539_10000981 | Ga0111539_1000098120 | 99 |
| 768 | 3300009094 | Ga0111539_10004818 | Ga0111539_1000481816 | 99 |
| 769 | 3300009094 | Ga0111539_10009303 | Ga0111539_100093034 | 99 |
| 770 | 3300009094 | Ga0111539_10211131 | Ga0111539_102111312 | 99 |
| 771 | 3300009094 | Ga0111539_10718218 | Ga0111539_107182182 | 99 |
| 772 | 3300009098 | Ga0105245_10362090 | Ga0105245_103620902 | 99 |
| 773 | 3300009098 | Ga0105245_11009328 | Ga0105245_110093281 | 99 |
| 774 | 3300009098 | Ga0105245_11092064 | Ga0105245_110920642 | 99 |
| 775 | 3300009147 | Ga0114129_10000410 | Ga0114129_100004107 | 99 |
| 776 | 3300009147 | Ga0114129_10021226 | Ga0114129_100212262 | 99 |
| 777 | 3300009147 | Ga0114129_11290882 | Ga0114129_112908822 | 99 |
| 778 | 3300009147 | Ga0114129_12975644 | Ga0114129_129756442 | 99 |
| 779 | 3300009148 | Ga0105243_10499044 | Ga0105243_104990442 | 99 |
| 780 | 3300009148 | Ga0105243_10540476 | Ga0105243_105404761 | 99 |
| 781 | 3300009148 | Ga0105243_11355771 | Ga0105243_113557712 | 99 |
| 782 | 3300009174 | Ga0105241_11718821 | Ga0105241_117188212 | 99 |
| 783 | 3300009176 | Ga0105242_10148153 | Ga0105242_101481532 | 99 |
| 784 | 3300009176 | Ga0105242_11429965 | Ga0105242_114299652 | 99 |
| 785 | 3300009176 | Ga0105242_12066370 | Ga0105242_120663702 | 99 |
| 786 | 3300009176 | Ga0105242_12556086 | Ga0105242_125560861 | 99 |
| 787 | 3300009176 | Ga0105242_12829305 | Ga0105242_128293052 | 99 |
| 788 | 3300009177 | Ga0105248_10056208 | Ga0105248_100562085 | 99 |
| 789 | 3300009177 | Ga0105248_10185719 | Ga0105248_101857192 | 99 |
| 790 | 3300009177 | Ga0105248_10200924 | Ga0105248_102009242 | 99 |
| 791 | 3300009177 | Ga0105248_10268822 | Ga0105248_102688223 | 99 |
| 792 | 3300009553 | Ga0105249_10288108 | Ga0105249_102881083 | 99 |
| 793 | 3300009553 | Ga0105249_10334000 | Ga0105249_103340002 | 99 |
| 794 | 3300009553 | Ga0105249_11500721 | Ga0105249_115007212 | 99 |
| 795 | 3300009553 | Ga0105249_12119870 | Ga0105249_121198701 | 99 |
| 796 | 3300009553 | Ga0105249_12177084 | Ga0105249_121770841 | 99 |
| 797 | 3300010375 | Ga0105239_13254207 | Ga0105239_132542072 | 99 |
| 798 | 3300011119 | Ga0105246_10072654 | Ga0105246_100726543 | 99 |
| 799 | 3300013104 | Ga0157370_10473771 | Ga0157370_104737712 | 99 |
| 800 | 3300013296 | Ga0157374_10091418 | Ga0157374_100914182 | 99 |
| 801 | 3300013296 | Ga0157374_10392762 | Ga0157374_103927622 | 99 |
| 802 | 3300013297 | Ga0157378_10701691 | Ga0157378_107016911 | 99 |
| 803 | 3300013297 | Ga0157378_10816167 | Ga0157378_108161672 | 99 |
| 804 | 3300013297 | Ga0157378_11217201 | Ga0157378_112172012 | 99 |
| 805 | 3300013297 | Ga0157378_11424839 | Ga0157378_114248392 | 99 |
| 806 | 3300013306 | Ga0163162_10081557 | Ga0163162_100815573 | 99 |
| 807 | 3300013306 | Ga0163162_10916219 | Ga0163162_109162192 | 99 |
| 808 | 3300013306 | Ga0163162_12960292 | Ga0163162_129602922 | 99 |
| 809 | 3300014325 | Ga0163163_10051186 | Ga0163163_100511862 | 99 |
| 810 | 3300014326 | Ga0157380_10377514 | Ga0157380_103775143 | 99 |
| 811 | 3300014745 | Ga0157377_10182204 | Ga0157377_101822042 | 99 |
| 812 | 3300014968 | Ga0157379_10362481 | Ga0157379_103624811 | 99 |
| 813 | 3300014968 | Ga0157379_10961823 | Ga0157379_109618232 | 99 |
| 814 | 3300014969 | Ga0157376_10947980 | Ga0157376_109479802 | 99 |
| 815 | 3300014969 | Ga0157376_11326572 | Ga0157376_113265722 | 99 |
| 816 | 3300017792 | Ga0163161_10344775 | Ga0163161_103447752 | 99 |
| 817 | 3300017792 | Ga0163161_10598561 | Ga0163161_105985612 | 99 |
| 818 | 3300025315 | Ga0207697_10028355 | Ga0207697_100283553 | 99 |
| 819 | 3300025315 | Ga0207697_10104649 | Ga0207697_101046492 | 99 |
| 820 | 3300025899 | Ga0207642_10564474 | Ga0207642_105644741 | 99 |
| 821 | 3300025900 | Ga0207710_10728913 | Ga0207710_107289132 | 99 |
| 822 | 3300025901 | Ga0207688_10641101 | Ga0207688_106411011 | 99 |
| 823 | 3300025903 | Ga0207680_10012973 | Ga0207680_100129733 | 99 |
| 824 | 3300025903 | Ga0207680_10802893 | Ga0207680_108028932 | 99 |
| 825 | 3300025904 | Ga0207647_10353135 | Ga0207647_103531352 | 99 |
| 826 | 3300025907 | Ga0207645_10092758 | Ga0207645_100927583 | 99 |
| 827 | 3300025908 | Ga0207643_10160496 | Ga0207643_101604962 | 99 |
| 828 | 3300025918 | Ga0207662_10000724 | Ga0207662_100007242 | 99 |
| 829 | 3300025920 | Ga0207649_10014442 | Ga0207649_100144421 | 99 |
| 830 | 3300025923 | Ga0207681_10170620 | Ga0207681_101706203 | 99 |
| 831 | 3300025923 | Ga0207681_10849591 | Ga0207681_108495912 | 99 |
| 832 | 3300025925 | Ga0207650_10005949 | Ga0207650_100059496 | 99 |
| 833 | 3300025926 | Ga0207659_10218667 | Ga0207659_102186671 | 99 |
| 834 | 3300025927 | Ga0207687_10424821 | Ga0207687_104248212 | 99 |
| 835 | 3300025927 | Ga0207687_10735457 | Ga0207687_107354572 | 99 |
| 836 | 3300025931 | Ga0207644_10025621 | Ga0207644_100256214 | 99 |
| 837 | 3300025931 | Ga0207644_11804282 | Ga0207644_118042822 | 99 |
| 838 | 3300025933 | Ga0207706_11009822 | Ga0207706_110098221 | 99 |
| 839 | 3300025934 | Ga0207686_10586134 | Ga0207686_105861342 | 99 |
| 840 | 3300025934 | Ga0207686_10829244 | Ga0207686_108292441 | 99 |
| 841 | 3300025935 | Ga0207709_11603613 | Ga0207709_116036131 | 99 |
| 842 | 3300025936 | Ga0207670_10009947 | Ga0207670_100099473 | 99 |
| 843 | 3300025936 | Ga0207670_10055982 | Ga0207670_100559822 | 99 |
| 844 | 3300025936 | Ga0207670_10154626 | Ga0207670_101546262 | 99 |
| 845 | 3300025936 | Ga0207670_10213452 | Ga0207670_102134522 | 99 |
| 846 | 3300025938 | Ga0207704_10293654 | Ga0207704_102936542 | 99 |
| 847 | 3300025940 | Ga0207691_10035117 | Ga0207691_100351173 | 99 |
| 848 | 3300025941 | Ga0207711_10059255 | Ga0207711_100592554 | 99 |
| 849 | 3300025941 | Ga0207711_10231968 | Ga0207711_102319682 | 99 |
| 850 | 3300025941 | Ga0207711_10449608 | Ga0207711_104496082 | 99 |
| 851 | 3300025941 | Ga0207711_11147549 | Ga0207711_111475491 | 99 |
| 852 | 3300025942 | Ga0207689_10006797 | Ga0207689_100067972 | 99 |
| 853 | 3300025942 | Ga0207689_10089587 | Ga0207689_100895872 | 99 |
| 854 | 3300025942 | Ga0207689_10155386 | Ga0207689_101553863 | 99 |
| 855 | 3300025942 | Ga0207689_10276070 | Ga0207689_102760702 | 99 |
| 856 | 3300025944 | Ga0207661_10003359 | Ga0207661_100033593 | 99 |
| 857 | 3300025945 | Ga0207679_10003327 | Ga0207679_100033273 | 99 |
| 858 | 3300025945 | Ga0207679_10743898 | Ga0207679_107438982 | 99 |
| 859 | 3300025945 | Ga0207679_10775176 | Ga0207679_107751762 | 99 |
| 860 | 3300025960 | Ga0207651_10063293 | Ga0207651_100632933 | 99 |
| 861 | 3300025961 | Ga0207712_11565837 | Ga0207712_115658372 | 99 |
| 862 | 3300025972 | Ga0207668_10241305 | Ga0207668_102413052 | 99 |
| 863 | 3300025972 | Ga0207668_10566262 | Ga0207668_105662622 | 99 |
| 864 | 3300025981 | Ga0207640_10425090 | Ga0207640_104250901 | 99 |
| 865 | 3300025986 | Ga0207658_10177662 | Ga0207658_101776622 | 99 |
| 866 | 3300025986 | Ga0207658_10233156 | Ga0207658_102331561 | 99 |
| 867 | 3300025986 | Ga0207658_10571006 | Ga0207658_105710062 | 99 |
| 868 | 3300026035 | Ga0207703_10277807 | Ga0207703_102778073 | 99 |
| 869 | 3300026067 | Ga0207678_10003414 | Ga0207678_100034149 | 99 |
| 870 | 3300026067 | Ga0207678_10036078 | Ga0207678_100360783 | 99 |
| 871 | 3300026067 | Ga0207678_11704107 | Ga0207678_117041071 | 99 |
| 872 | 3300026075 | Ga0207708_10008073 | Ga0207708_100080738 | 99 |
| 873 | 3300026088 | Ga0207641_10753911 | Ga0207641_107539112 | 99 |
| 874 | 3300026089 | Ga0207648_10049704 | Ga0207648_100497043 | 99 |
| 875 | 3300026089 | Ga0207648_10484744 | Ga0207648_104847442 | 99 |
| 876 | 3300026095 | Ga0207676_10232121 | Ga0207676_102321212 | 99 |
| 877 | 3300026116 | Ga0207674_10029870 | Ga0207674_100298703 | 99 |
| 878 | 3300026116 | Ga0207674_10509282 | Ga0207674_105092822 | 99 |
| 879 | 3300026116 | Ga0207674_10775663 | Ga0207674_107756631 | 99 |
| 880 | 3300026118 | Ga0207675_100125191 | Ga0207675_1001251912 | 99 |
| 881 | 3300026118 | Ga0207675_100252953 | Ga0207675_1002529532 | 99 |
| 882 | 3300026118 | Ga0207675_100278724 | Ga0207675_1002787242 | 99 |
| 883 | 3300026118 | Ga0207675_100972704 | Ga0207675_1009727042 | 99 |
| 884 | 3300026118 | Ga0207675_101036903 | Ga0207675_1010369032 | 99 |
| 885 | 3300026118 | Ga0207675_102309182 | Ga0207675_1023091822 | 99 |
| 886 | 3300026121 | Ga0207683_11075672 | Ga0207683_110756722 | 99 |
| 887 | 3300026121 | Ga0207683_11153016 | Ga0207683_111530162 | 99 |
| 888 | 3300027907 | Ga0207428_10000066 | Ga0207428_1000006684 | 99 |
| 889 | 3300027907 | Ga0207428_10005537 | Ga0207428_100055376 | 99 |
| 890 | 3300028379 | Ga0268266_11470027 | Ga0268266_114700272 | 99 |
| 891 | 3300028380 | Ga0268265_11107770 | Ga0268265_111077702 | 99 |
| 892 | 3300028380 | Ga0268265_12339696 | Ga0268265_123396962 | 99 |
| 893 | 3300028381 | Ga0268264_10192729 | Ga0268264_101927292 | 99 |
| 894 | 3300028381 | Ga0268264_10527165 | Ga0268264_105271653 | 99 |
| 895 | 3300028381 | Ga0268264_11086496 | Ga0268264_110864962 | 99 |
| 896 | 3300028381 | Ga0268264_11789745 | Ga0268264_117897452 | 99 |
| 897 | 3300031548 | Ga0307408_100402624 | Ga0307408_1004026242 | 99 |
| 898 | 3300031731 | Ga0307405_10221650 | Ga0307405_102216503 | 99 |
| 899 | 3300031824 | Ga0307413_10364976 | Ga0307413_103649762 | 99 |
| 900 | 3300031824 | Ga0307413_10519559 | Ga0307413_105195592 | 99 |
| 901 | 3300031852 | Ga0307410_10147912 | Ga0307410_101479123 | 99 |
| 902 | 3300031901 | Ga0307406_10736648 | Ga0307406_107366482 | 99 |
| 903 | 3300031903 | Ga0307407_10033690 | Ga0307407_100336903 | 99 |
| 904 | 3300031995 | Ga0307409_100027404 | Ga0307409_1000274043 | 99 |
| 905 | 3300032002 | Ga0307416_100374872 | Ga0307416_1003748723 | 99 |
| 906 | 3300032004 | Ga0307414_10371664 | Ga0307414_103716643 | 99 |
| 907 | 3300032005 | Ga0307411_10267673 | Ga0307411_102676732 | 99 |
| 908 | 3300032005 | Ga0307411_10469000 | Ga0307411_104690002 | 99 |
| 909 | 3300032126 | Ga0307415_100829886 | Ga0307415_1008298862 | 99 |
| 910 | 3300034957 | Ga0373938_0188269 | Ga0373938_0188269_31_330 | 99 |
| 911 | 3300035113 | Ga0373936_0400656 | Ga0373936_0400656_25_324 | 99 |
| 912 | 3300035172 | Ga0373955_0865220 | Ga0373955_0865220_59_358 | 99 |
| 913 | 3300035241 | Ga0373961_0445509 | Ga0373961_0445509_20_319 | 99 |
| 914 | 3300041486 | Ga0451807_0021731 | Ga0451807_0021731_26_325 | 99 |
| 915 | 3300041512 | Ga0451853_3669051 | Ga0451853_3669051_168_467 | 99 |
| 916 | 3300042003 | Ga0439443_055794 | Ga0439443_055794_13_312 | 99 |
| 917 | 3300042013 | Ga0439456_161775 | Ga0439456_161775_38_337 | 99 |
| 918 | 3300042530 | Ga0450916_096513 | Ga0450916_096513_115_414 | 99 |
| 919 | 3300042532 | Ga0450893_0098999 | Ga0450893_0098999_154_453 | 99 |
| 920 | 3300042876 | Ga0451577_0132777 | Ga0451577_0132777_1281_1580 | 99 |
| 921 | 3300044712 | Ga0453684_0107756 | Ga0453684_0107756_2877_3176 | 99 |
| 922 | 3300045976 | Ga0466967_0877877 | Ga0466967_0877877_235_534 | 99 |
| 923 | 3300046454 | Ga0495592_0475807 | Ga0495592_0475807_180_479 | 99 |
| 924 | 3300046455 | Ga0495603_0209070 | Ga0495603_0209070_150_449 | 99 |
| 925 | 3300046463 | Ga0495653_0708482 | Ga0495653_0708482_221_520 | 99 |
| 926 | 3300046473 | Ga0495582_0361365 | Ga0495582_0361365_207_506 | 99 |
| 927 | 3300046499 | Ga0495594_0669086 | Ga0495594_0669086_252_551 | 99 |
| 928 | 3300046536 | Ga0495587_0098139 | Ga0495587_0098139_1035_1334 | 99 |
| 929 | 3300046681 | Ga0495647_0275437 | Ga0495647_0275437_198_497 | 99 |
| 930 | 3300046681 | Ga0495647_0324119 | Ga0495647_0324119_321_620 | 99 |
| 931 | 3300046694 | Ga0495649_0409512 | Ga0495649_0409512_20_319 | 99 |
| 932 | 3300047317 | Ga0495604_0347158 | Ga0495604_0347158_621_920 | 99 |
| 933 | 3300047320 | Ga0495672_0320193 | Ga0495672_0320193_64_363 | 99 |
| 934 | 3300047322 | Ga0495680_0380536 | Ga0495680_0380536_239_538 | 99 |
| 935 | 3300048089 | Ga0495614_0230281 | Ga0495614_0230281_511_810 | 99 |
| 936 | 3300048904 | Ga0496101_0614809 | Ga0496101_0614809_83_382 | 99 |
| 937 | 3300048907 | Ga0496104_0003082 | Ga0496104_0003082_5759_6058 | 99 |
| 938 | 3300048908 | Ga0496105_0019761 | Ga0496105_0019761_138_437 | 99 |
| 939 | 3300048909 | Ga0496106_0249197 | Ga0496106_0249197_149_448 | 99 |
| 940 | 3300048909 | Ga0496106_0500743 | Ga0496106_0500743_331_630 | 99 |
| 941 | 3300048911 | Ga0496108_0003036 | Ga0496108_0003036_8549_8848 | 99 |
| 942 | 3300048911 | Ga0496108_1012114 | Ga0496108_1012114_111_410 | 99 |
| 943 | 3300048912 | Ga0496109_0004537 | Ga0496109_0004537_9439_9738 | 99 |
| 944 | 3300048912 | Ga0496109_0818684 | Ga0496109_0818684_66_365 | 99 |
| 945 | 3300048913 | Ga0496110_0004868 | Ga0496110_0004868_7206_7505 | 99 |
| 946 | 3300048914 | Ga0496111_0005731 | Ga0496111_0005731_345_644 | 99 |
| 947 | 3300048915 | Ga0496112_0001468 | Ga0496112_0001468_5802_6101 | 99 |
| 948 | 3300048916 | Ga0496113_0167493 | Ga0496113_0167493_777_1076 | 99 |
| 949 | 3300049527 | Ga0501311_082027 | Ga0501311_082027_32_331 | 99 |
| 950 | 3300049568 | Ga0501031_0046471 | Ga0501031_0046471_1211_1510 | 99 |
| 951 | 3300049568 | Ga0501031_0511735 | Ga0501031_0511735_164_463 | 99 |
| 952 | 3300049569 | Ga0501032_0520296 | Ga0501032_0520296_287_586 | 99 |
| 953 | 3300049570 | Ga0501033_0037295 | Ga0501033_0037295_1115_1414 | 99 |
| 954 | 3300049571 | Ga0501034_0115513 | Ga0501034_0115513_2333_2632 | 99 |
| 955 | 3300049571 | Ga0501034_0705034 | Ga0501034_0705034_318_617 | 99 |
| 956 | 3300049572 | Ga0501036_0104742 | Ga0501036_0104742_1264_1563 | 99 |
| 957 | 3300049572 | Ga0501036_0521110 | Ga0501036_0521110_492_791 | 99 |
| 958 | 3300049572 | Ga0501036_0865534 | Ga0501036_0865534_288_587 | 99 |
| 959 | 3300049573 | Ga0501037_0098874 | Ga0501037_0098874_1752_2051 | 99 |
| 960 | 3300049573 | Ga0501037_0557127 | Ga0501037_0557127_442_741 | 99 |
| 961 | 3300049573 | Ga0501037_0728156 | Ga0501037_0728156_318_617 | 99 |
| 962 | 3300049574 | Ga0501038_0135132 | Ga0501038_0135132_271_570 | 99 |
| 963 | 3300049574 | Ga0501038_0399459 | Ga0501038_0399459_609_908 | 99 |
| 964 | 3300049575 | Ga0501039_0089734 | Ga0501039_0089734_1294_1593 | 99 |
| 965 | 3300049575 | Ga0501039_0368660 | Ga0501039_0368660_524_823 | 99 |
| 966 | 3300049575 | Ga0501039_0497179 | Ga0501039_0497179_13_312 | 99 |
| 967 | 3300049575 | Ga0501039_0504529 | Ga0501039_0504529_24_323 | 99 |
| 968 | 3300049576 | Ga0501040_0068905 | Ga0501040_0068905_140_439 | 99 |
| 969 | 3300049576 | Ga0501040_0511750 | Ga0501040_0511750_310_609 | 99 |
| 970 | 3300049577 | Ga0501041_0144688 | Ga0501041_0144688_733_1032 | 99 |
| 971 | 3300049578 | Ga0501042_0233859 | Ga0501042_0233859_296_595 | 99 |
| 972 | 3300049579 | Ga0501043_0106136 | Ga0501043_0106136_1670_1969 | 99 |
| 973 | 3300049580 | Ga0501046_0015798 | Ga0501046_0015798_734_1033 | 99 |
| 974 | 3300049580 | Ga0501046_0046528 | Ga0501046_0046528_302_601 | 99 |
| 975 | 3300049580 | Ga0501046_0285268 | Ga0501046_0285268_170_469 | 99 |
| 976 | 3300049580 | Ga0501046_0536254 | Ga0501046_0536254_526_825 | 99 |
| 977 | 3300049581 | Ga0501047_0006623 | Ga0501047_0006623_10579_10878 | 99 |
| 978 | 3300049581 | Ga0501047_0071383 | Ga0501047_0071383_3003_3302 | 99 |
| 979 | 3300049581 | Ga0501047_0988841 | Ga0501047_0988841_173_472 | 99 |
| 980 | 3300049582 | Ga0501048_0200008 | Ga0501048_0200008_568_867 | 99 |
| 981 | 3300049583 | Ga0501067_0144682 | Ga0501067_0144682_328_627 | 99 |
| 982 | 3300049583 | Ga0501067_0588831 | Ga0501067_0588831_177_476 | 99 |
| 983 | 3300049584 | Ga0501068_0058634 | Ga0501068_0058634_1234_1533 | 99 |
| 984 | 3300049584 | Ga0501068_0211500 | Ga0501068_0211500_198_497 | 99 |
| 985 | 3300049585 | Ga0501069_0006243 | Ga0501069_0006243_441_740 | 99 |
| 986 | 3300049586 | Ga0501070_0343688 | Ga0501070_0343688_414_713 | 99 |
| 987 | 3300049586 | Ga0501070_0661706 | Ga0501070_0661706_323_622 | 99 |
| 988 | 3300049587 | Ga0501071_0149591 | Ga0501071_0149591_367_666 | 99 |
| 989 | 3300049587 | Ga0501071_0166359 | Ga0501071_0166359_1323_1622 | 99 |
| 990 | 3300049587 | Ga0501071_0484897 | Ga0501071_0484897_527_826 | 99 |
| 991 | 3300049588 | Ga0501072_0075990 | Ga0501072_0075990_239_538 | 99 |
| 992 | 3300049588 | Ga0501072_0127443 | Ga0501072_0127443_599_898 | 99 |
| 993 | 3300049588 | Ga0501072_0220493 | Ga0501072_0220493_642_941 | 99 |
| 994 | 3300049588 | Ga0501072_0254797 | Ga0501072_0254797_202_501 | 99 |
| 995 | 3300049589 | Ga0501073_0347179 | Ga0501073_0347179_392_691 | 99 |
| 996 | 3300049589 | Ga0501073_0454940 | Ga0501073_0454940_211_510 | 99 |
| 997 | 3300049589 | Ga0501073_0580333 | Ga0501073_0580333_359_658 | 99 |
| 998 | 3300049590 | Ga0501074_0017869 | Ga0501074_0017869_1144_1443 | 99 |
| 999 | 3300049590 | Ga0501074_0162295 | Ga0501074_0162295_427_726 | 99 |
| 1000 | 3300049590 | Ga0501074_0929107 | Ga0501074_0929107_153_455 | 99 |
| 1001 | 3300049591 | Ga0501075_0144066 | Ga0501075_0144066_887_1186 | 99 |
| 1002 | 3300049591 | Ga0501075_0165360 | Ga0501075_0165360_332_631 | 99 |
| 1003 | 3300049591 | Ga0501075_0423995 | Ga0501075_0423995_85_384 | 99 |
| 1004 | 3300049591 | Ga0501075_1442648 | Ga0501075_1442648_14_313 | 99 |
| 1005 | 3300049591 | Ga0501075_1530664 | Ga0501075_1530664_66_365 | 99 |
| 1006 | 3300049592 | Ga0501076_0404539 | Ga0501076_0404539_800_1099 | 99 |
| 1007 | 3300049592 | Ga0501076_0454774 | Ga0501076_0454774_132_431 | 99 |
| 1008 | 3300049592 | Ga0501076_0472907 | Ga0501076_0472907_477_776 | 99 |
| 1009 | 3300049592 | Ga0501076_0517199 | Ga0501076_0517199_310_609 | 99 |
| 1010 | 3300049592 | Ga0501076_0979298 | Ga0501076_0979298_292_594 | 99 |
| 1011 | 3300049593 | Ga0501077_0102406 | Ga0501077_0102406_79_378 | 99 |
| 1012 | 3300049593 | Ga0501077_0384601 | Ga0501077_0384601_398_697 | 99 |
| 1013 | 3300049593 | Ga0501077_0747206 | Ga0501077_0747206_55_354 | 99 |
| 1014 | 3300049675 | Ga0501243_130230 | Ga0501243_130230_33_332 | 99 |
| 1015 | 3300049741 | Ga0501079_0027969 | Ga0501079_0027969_758_1057 | 99 |
| 1016 | 3300049741 | Ga0501079_0332455 | Ga0501079_0332455_136_435 | 99 |
| 1017 | 3300049741 | Ga0501079_0832907 | Ga0501079_0832907_35_334 | 99 |
| 1018 | 3300049742 | Ga0501080_0019050 | Ga0501080_0019050_4503_4802 | 99 |
| 1019 | 3300049742 | Ga0501080_0102787 | Ga0501080_0102787_228_527 | 99 |
| 1020 | 3300049742 | Ga0501080_1833734 | Ga0501080_1833734_151_450 | 99 |
| 1021 | 3300049743 | Ga0501081_0046801 | Ga0501081_0046801_1706_2005 | 99 |
| 1022 | 3300049743 | Ga0501081_0398270 | Ga0501081_0398270_94_393 | 99 |
| 1023 | 3300049744 | Ga0501083_0009096 | Ga0501083_0009096_6609_6908 | 99 |
| 1024 | 3300049744 | Ga0501083_0139058 | Ga0501083_0139058_999_1298 | 99 |
| 1025 | 3300049744 | Ga0501083_0180486 | Ga0501083_0180486_336_635 | 99 |
| 1026 | 3300049822 | Ga0501035_0128300 | Ga0501035_0128300_1222_1521 | 99 |
| 1027 | 3300049822 | Ga0501035_0250609 | Ga0501035_0250609_560_859 | 99 |
| 1028 | 3300049822 | Ga0501035_0296453 | Ga0501035_0296453_765_1064 | 99 |
| 1029 | 3300049822 | Ga0501035_0812271 | Ga0501035_0812271_35_334 | 99 |
| 1030 | 3300049823 | Ga0501044_0116255 | Ga0501044_0116255_168_467 | 99 |
| 1031 | 3300049823 | Ga0501044_0144191 | Ga0501044_0144191_174_473 | 99 |
| 1032 | 3300049823 | Ga0501044_0723691 | Ga0501044_0723691_453_752 | 99 |
| 1033 | 3300049824 | Ga0501045_0013621 | Ga0501045_0013621_1286_1585 | 99 |
| 1034 | 3300049824 | Ga0501045_0026599 | Ga0501045_0026599_1508_1807 | 99 |
| 1035 | 3300049824 | Ga0501045_0044615 | Ga0501045_0044615_1114_1413 | 99 |
| 1036 | 3300049824 | Ga0501045_0984409 | Ga0501045_0984409_156_455 | 99 |
| 1037 | 3300050489 | nmdc:mga03683_152060_c1 | nmdc:mga03683_152060_c1_281_580 | 99 |
| 1038 | 3300050490 | nmdc:mga03n38_328724_c1 | nmdc:mga03n38_328724_c1_59_358 | 99 |
| 1039 | 3300050492 | nmdc:mga0yw44_16488_c1 | nmdc:mga0yw44_16488_c1_869_1168 | 99 |
| 1040 | 3300050493 | nmdc:mga0k408_11298_c1 | nmdc:mga0k408_11298_c1_1723_2022 | 99 |
| 1041 | 3300050494 | nmdc:mga06z11_128855_c1 | nmdc:mga06z11_128855_c1_1069_1368 | 99 |
| 1042 | 3300050495 | nmdc:mga04h51_80670_c1 | nmdc:mga04h51_80670_c1_249_548 | 99 |
| 1043 | 3300050496 | nmdc:mga07m45_99236_c1 | nmdc:mga07m45_99236_c1_319_618 | 99 |
| 1044 | 3300050507 | nmdc:mga05p37_11849_c1 | nmdc:mga05p37_11849_c1_4876_5175 | 99 |
| 1045 | 3300050507 | nmdc:mga05p37_1408827_c1 | nmdc:mga05p37_1408827_c1_280_579 | 99 |
| 1046 | 3300050507 | nmdc:mga05p37_1775674_c1 | nmdc:mga05p37_1775674_c1_69_368 | 99 |
| 1047 | 3300050507 | nmdc:mga05p37_359328_c1 | nmdc:mga05p37_359328_c1_73_372 | 99 |
| 1048 | 3300050507 | nmdc:mga05p37_54_c2 | nmdc:mga05p37_54_c2_20261_20560 | 99 |
| 1049 | 3300050507 | nmdc:mga05p37_69250_c1 | nmdc:mga05p37_69250_c1_3876_4175 | 99 |
| 1050 | 3300050508 | nmdc:mga09592_1258644_c1 | nmdc:mga09592_1258644_c1_155_454 | 99 |
| 1051 | 3300050508 | nmdc:mga09592_475652_c1 | nmdc:mga09592_475652_c1_717_1016 | 99 |
| 1052 | 3300050508 | nmdc:mga09592_624290_c1 | nmdc:mga09592_624290_c1_21_320 | 99 |
| 1053 | 3300050508 | nmdc:mga09592_686212_c1 | nmdc:mga09592_686212_c1_152_451 | 99 |
| 1054 | 3300050509 | nmdc:mga0qj67_146515_c1 | nmdc:mga0qj67_146515_c1_253_552 | 99 |
| 1055 | 3300050509 | nmdc:mga0qj67_23200_c1 | nmdc:mga0qj67_23200_c1_3314_3613 | 99 |
| 1056 | 3300050509 | nmdc:mga0qj67_563773_c1 | nmdc:mga0qj67_563773_c1_500_799 | 99 |
| 1057 | 3300050509 | nmdc:mga0qj67_61432_c1 | nmdc:mga0qj67_61432_c1_852_1151 | 99 |
| 1058 | 3300050510 | nmdc:mga06r32_128077_c1 | nmdc:mga06r32_128077_c1_1493_1792 | 99 |
| 1059 | 3300050511 | nmdc:mga08y16_1172445_c1 | nmdc:mga08y16_1172445_c1_256_555 | 99 |
| 1060 | 3300050511 | nmdc:mga08y16_19984_c1 | nmdc:mga08y16_19984_c1_1897_2196 | 99 |
| 1061 | 3300050511 | nmdc:mga08y16_244307_c1 | nmdc:mga08y16_244307_c1_130_429 | 99 |
| 1062 | 3300050511 | nmdc:mga08y16_2979_c1 | nmdc:mga08y16_2979_c1_5052_5351 | 99 |
| 1063 | 3300050511 | nmdc:mga08y16_46458_c1 | nmdc:mga08y16_46458_c1_3564_3863 | 99 |
| 1064 | 3300050512 | nmdc:mga0n895_2047167_c1 | nmdc:mga0n895_2047167_c1_135_434 | 99 |
| 1065 | 3300050512 | nmdc:mga0n895_220970_c1 | nmdc:mga0n895_220970_c1_1585_1884 | 99 |
| 1066 | 3300050512 | nmdc:mga0n895_35411_c1 | nmdc:mga0n895_35411_c1_3630_3929 | 99 |
| 1067 | 3300050515 | nmdc:mga0a205_205039_c1 | nmdc:mga0a205_205039_c1_1334_1633 | 99 |
| 1068 | 3300050515 | nmdc:mga0a205_516667_c1 | nmdc:mga0a205_516667_c1_499_798 | 99 |
| 1069 | 3300050515 | nmdc:mga0a205_964118_c1 | nmdc:mga0a205_964118_c1_27_326 | 99 |
| 1070 | 3300050516 | nmdc:mga0sz30_200081_c1 | nmdc:mga0sz30_200081_c1_564_863 | 99 |
| 1071 | 3300054114 | Ga0501084_0028026 | Ga0501084_0028026_1729_2028 | 99 |
| 1072 | 3300054114 | Ga0501084_0221203 | Ga0501084_0221203_667_966 | 99 |
| 1073 | 3300054114 | Ga0501084_0617930 | Ga0501084_0617930_410_709 | 99 |
| 1074 | 3300054114 | Ga0501084_1046619 | Ga0501084_1046619_243_542 | 99 |
| 1075 | 3300059423 | Ga0590074_115496 | Ga0590074_115496_34_333 | 99 |
| 1076 | 3300059426 | Ga0590077_000518 | Ga0590077_000518_4445_4744 | 99 |
| 1077 | 3300060353 | Ga0501082_0037262 | Ga0501082_0037262_3458_3757 | 99 |
| 1078 | 3300060353 | Ga0501082_0258610 | Ga0501082_0258610_750_1049 | 99 |
| 1079 | 3300060353 | Ga0501082_0340092 | Ga0501082_0340092_988_1287 | 99 |
| 1080 | 3300060353 | Ga0501082_0449738 | Ga0501082_0449738_659_958 | 99 |
| 1081 | 3300060353 | Ga0501082_1486509 | Ga0501082_1486509_11_310 | 99 |
| 1082 | 3300060353 | Ga0501082_1712595 | Ga0501082_1712595_82_381 | 99 |
| 1083 | 3300061734 | Ga0530510_0011089 | Ga0530510_0011089_5738_6037 | 99 |
| 1084 | 3300061734 | Ga0530510_0942225 | Ga0530510_0942225_195_494 | 99 |
| 1085 | 3300061734 | Ga0530510_0987283 | Ga0530510_0987283_226_525 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5yrx-assembly1.cif.gz_A-2 | crystal structure of a hypothetical protein rv3716c from mycobacterium tuberculosis | 0.8784 | 16 | 81 |
| 1pug-assembly2.cif.gz_D | structure of e. coli ybab | 0.877 | 15 | 88 |
| 7bid-assembly1.cif.gz_A | crystal structure of v31wrap-t, a 7-bladed designer protein | 0.8769 | 24 | 51 |
| 1pug-assembly2.cif.gz_C | structure of e. coli ybab | 0.8587 | 11 | 88 |
| 1pug-assembly1.cif.gz_B | structure of e. coli ybab | 0.8546 | 14 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A644_499_658_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9196 | 34 | 50 | 3.20.19.10 |
| 5yrxA00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8784 | 16 | 81 | 3.30.1310.10 |
| 1pugB00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8546 | 14 | 84 | 3.30.1310.10 |
| 1pugA00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8387 | 8 | 97 | 3.30.1310.10 |
| af_Q4CUP9_587_746_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8133 | 25 | 38 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383AGM3-F1-model_v4 | YbaB/EbfC family nucleoid-associated protein | 0.9584 | 3 | 80 |
GO:0003677
GO:0005829 |
| AF-I4BAU4-F1-model_v4 | Nucleoid-associated protein Turpa_3767 | 0.9304 | 2 | 93 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-A0A2N1W9T3-F1-model_v4 | Nucleoid-associated protein | 0.9275 | 8 | 80 |
GO:0003677
|
| AF-A0A6B2DJQ5-F1-model_v4 | YbaB/EbfC family nucleoid-associated protein | 0.9162 | 2 | 84 |
GO:0003677
|
| AF-A0A2V7WSV0-F1-model_v4 | Nucleoid-associated protein DMF54_06745 | 0.9047 | 4 | 99 |
GO:0003677
GO:0005829 GO:0043590 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar