F489758

General Info

Members Datasets Scaffolds Average Seq Length
1085 348 1085 97

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100410868|Ga0068859_1004108682
Length 110
Sequence MPGLKARPTGIMNIQKMMQQAQEMQXRLQKQMADMRVDATAGGGMVTVVVSGHKQLMKITIDPEVVSKDDVPMLQDLILAAINDAHRKVDQALAQQMSGLMGGMQNSGLV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
211 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
212 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
218 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
221 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
222 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
223 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
224 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
225 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
226 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
227 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
228 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
229 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
230 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
235 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
236 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
237 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
262 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
274 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
288 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
316 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
325 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
326 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
327 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
346 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 2.58
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10083124 3300003203 Bacteria 978
2 JGI25406J46586_10092444 3300003203 Bacteria 911
3 JGI25406J46586_10213409 3300003203 Unclassified 564
4 Ga0065714_10106583 3300005288 Bacteria 1546
5 Ga0065712_10025310 3300005290 Bacteria 1411
6 Ga0065712_10153694 3300005290 Bacteria 1350
7 Ga0065715_10138994 3300005293 Bacteria 1883
8 Ga0065715_10149341 3300005293 Bacteria 1748
9 Ga0065707_10086703 3300005295 Bacteria 5336
10 Ga0065707_10149428 3300005295 Bacteria 1675
11 Ga0065707_10170689 3300005295 Bacteria 1487
12 Ga0065707_10591340 3300005295 Bacteria 695
13 Ga0065707_10707279 3300005295 Unclassified 636
14 Ga0065707_11046822 3300005295 Bacteria 528
15 Ga0065707_11122576 3300005295 Unclassified 511
16 Ga0065707_11136378 3300005295 Bacteria 507
17 Ga0070676_10028956 3300005328 Bacteria 3147
18 Ga0070683_100007552 3300005329 Bacteria 9189
19 Ga0070690_100027789 3300005330 Bacteria 3500
20 Ga0070690_100149010 3300005330 Bacteria 1594
21 Ga0070690_100170683 3300005330 Bacteria 1497
22 Ga0070690_100257315 3300005330 Bacteria 1237
23 Ga0070670_100004413 3300005331 Bacteria 11779
24 Ga0070670_100007462 3300005331 Bacteria 9285
25 Ga0070670_100464699 3300005331 Unclassified 1122
26 Ga0070677_10762496 3300005333 Bacteria 550
27 Ga0068869_100058451 3300005334 Bacteria 2820
28 Ga0068869_100084729 3300005334 Bacteria 2373
29 Ga0068869_100823931 3300005334 Bacteria 799
30 Ga0070666_10045960 3300005335 Bacteria 2927
31 Ga0070666_10063575 3300005335 Bacteria 2502
32 Ga0070666_10859068 3300005335 Bacteria 670
33 Ga0070666_10908227 3300005335 Bacteria 651
34 Ga0070680_100111780 3300005336 Bacteria 2275
35 Ga0070680_100415668 3300005336 Bacteria 1147
36 Ga0070680_100778601 3300005336 Bacteria 824
37 Ga0070680_101163650 3300005336 Bacteria 667
38 Ga0070682_100493593 3300005337 Bacteria 947
39 Ga0070682_101400767 3300005337 Bacteria 598
40 Ga0070682_101904942 3300005337 Bacteria 521
41 Ga0068868_100315931 3300005338 Unclassified 1330
42 Ga0068868_100389144 3300005338 Bacteria 1201
43 Ga0070660_101496559 3300005339 Bacteria 574
44 Ga0070689_100030548 3300005340 Bacteria 4090
45 Ga0070689_100176159 3300005340 Bacteria 1735
46 Ga0070689_100256727 3300005340 Bacteria 1444
47 Ga0070689_100275519 3300005340 Bacteria 1394
48 Ga0070689_100725728 3300005340 Bacteria 869
49 Ga0070689_102143232 3300005340 Bacteria 512
50 Ga0070691_10017904 3300005341 Bacteria 3261
51 Ga0070691_10182267 3300005341 Bacteria 1094
52 Ga0070687_100008463 3300005343 Bacteria 4361
53 Ga0070687_100023052 3300005343 Bacteria 2954
54 Ga0070687_100051971 3300005343 Bacteria 2125
55 Ga0070661_100012520 3300005344 Bacteria 5935
56 Ga0070661_100098211 3300005344 Bacteria 2175
57 Ga0070692_10028201 3300005345 Bacteria 2789
58 Ga0070692_10314983 3300005345 Bacteria 960
59 Ga0070668_100269987 3300005347 Unclassified 1417
60 Ga0070668_100636083 3300005347 Bacteria 936
61 Ga0070668_100763258 3300005347 Bacteria 857
62 Ga0070668_101644322 3300005347 Bacteria 589
63 Ga0070669_100051895 3300005353 Bacteria 2998
64 Ga0070669_100102174 3300005353 Bacteria 2164
65 Ga0070669_100155395 3300005353 Bacteria 1773
66 Ga0070669_100156483 3300005353 Bacteria 1768
67 Ga0070669_100336184 3300005353 Bacteria 1223
68 Ga0070669_100350581 3300005353 Bacteria 1198
69 Ga0070669_100960175 3300005353 Bacteria 732
70 Ga0070669_101158658 3300005353 Bacteria 667
71 Ga0070675_100016827 3300005354 Bacteria 5806
72 Ga0070675_100179773 3300005354 Bacteria 1828
73 Ga0070675_100197845 3300005354 Bacteria 1744
74 Ga0070675_100253317 3300005354 Bacteria 1541
75 Ga0070675_100597189 3300005354 Bacteria 1001
76 Ga0070675_100702999 3300005354 Bacteria 921
77 Ga0070675_102161713 3300005354 Bacteria 513
78 Ga0070671_100037051 3300005355 Bacteria 4044
79 Ga0070671_100409430 3300005355 Bacteria 1161
80 Ga0070671_101165111 3300005355 Bacteria 678
81 Ga0070674_100168717 3300005356 Bacteria 1667
82 Ga0070674_100724991 3300005356 Bacteria 852
83 Ga0070674_101939626 3300005356 Bacteria 536
84 Ga0070673_100011151 3300005364 Bacteria 6127
85 Ga0070673_100016210 3300005364 Bacteria 5261
86 Ga0070673_100409025 3300005364 Bacteria 1214
87 Ga0070688_100025746 3300005365 Bacteria 3488
88 Ga0070688_100095705 3300005365 Bacteria 1949
89 Ga0070688_100112936 3300005365 Bacteria 1809
90 Ga0070688_100217497 3300005365 Unclassified 1345
91 Ga0070688_100428286 3300005365 Bacteria 985
92 Ga0070688_100526803 3300005365 Bacteria 895
93 Ga0070688_100631478 3300005365 Bacteria 823
94 Ga0070688_100854438 3300005365 Bacteria 715
95 Ga0070688_101624904 3300005365 Bacteria 528
96 Ga0070659_100100205 3300005366 Bacteria 2331
97 Ga0070659_100976545 3300005366 Bacteria 743
98 Ga0070667_100102344 3300005367 Bacteria 2475
99 Ga0070667_100105118 3300005367 Bacteria 2443
100 Ga0070667_100166117 3300005367 Bacteria 1947
101 Ga0070667_100579633 3300005367 Bacteria 1033
102 Ga0070667_102254858 3300005367 Bacteria 513
103 Ga0070709_10429129 3300005434 Bacteria 992
104 Ga0070714_100012428 3300005435 Bacteria 6798
105 Ga0070713_100371955 3300005436 Bacteria 1330
106 Ga0070701_10019829 3300005438 Bacteria 3182
107 Ga0070701_10043041 3300005438 Bacteria 2308
108 Ga0070701_10325118 3300005438 Bacteria 953
109 Ga0070701_10332515 3300005438 Bacteria 943
110 Ga0070701_10890246 3300005438 Unclassified 614
111 Ga0070701_11346115 3300005438 Bacteria 512
112 Ga0070705_100010925 3300005440 Bacteria 4562
113 Ga0070705_100077195 3300005440 Bacteria 2034
114 Ga0070705_100383867 3300005440 Bacteria 1035
115 Ga0070700_100044430 3300005441 Bacteria 2736
116 Ga0070700_100067920 3300005441 Bacteria 2265
117 Ga0070700_100111792 3300005441 Bacteria 1817
118 Ga0070700_100229740 3300005441 Bacteria 1320
119 Ga0070700_100288007 3300005441 Bacteria 1194
120 Ga0070700_101225102 3300005441 Bacteria 628
121 Ga0070700_101391223 3300005441 Bacteria 593
122 Ga0070700_101766357 3300005441 Bacteria 532
123 Ga0070694_100002811 3300005444 Bacteria 10330
124 Ga0070694_100006907 3300005444 Bacteria 6898
125 Ga0070694_100097721 3300005444 Bacteria 2072
126 Ga0070694_100420609 3300005444 Bacteria 1050
127 Ga0070694_100673681 3300005444 Bacteria 839
128 Ga0070694_100952934 3300005444 Bacteria 711
129 Ga0070663_100219852 3300005455 Bacteria 1491
130 Ga0070678_100505484 3300005456 Bacteria 1067
131 Ga0070678_100676007 3300005456 Bacteria 928
132 Ga0070662_101702549 3300005457 Bacteria 544
133 Ga0070681_10570750 3300005458 Bacteria 1045
134 Ga0068867_100087743 3300005459 Bacteria 2356
135 Ga0068867_100203840 3300005459 Bacteria 1585
136 Ga0068867_100256849 3300005459 Bacteria 1423
137 Ga0068867_100286403 3300005459 Unclassified 1353
138 Ga0068867_100470492 3300005459 Bacteria 1075
139 Ga0068867_100648207 3300005459 Bacteria 926
140 Ga0070685_10038256 3300005466 Bacteria 2720
141 Ga0070685_10263185 3300005466 Unclassified 1148
142 Ga0070685_10267026 3300005466 Bacteria 1140
143 Ga0070685_11021502 3300005466 Bacteria 621
144 Ga0070685_11391578 3300005466 Bacteria 538
145 Ga0070706_100059841 3300005467 Bacteria 3516
146 Ga0070706_101859534 3300005467 Bacteria 547
147 Ga0070707_100328591 3300005468 Bacteria 1486
148 Ga0070707_100550545 3300005468 Bacteria 1116
149 Ga0070707_100964469 3300005468 Unclassified 818
150 Ga0070707_101543588 3300005468 Bacteria 631
151 Ga0070698_100001914 3300005471 Bacteria 23193
152 Ga0070698_100008781 3300005471 Bacteria 10875
153 Ga0070698_100367484 3300005471 Bacteria 1371
154 Ga0070698_100734923 3300005471 Bacteria 930
155 Ga0070698_101784181 3300005471 Bacteria 568
156 Ga0070699_100005726 3300005518 Bacteria 10873
157 Ga0070699_100005918 3300005518 Bacteria 10685
158 Ga0070699_100021870 3300005518 Bacteria 5512
159 Ga0070699_100927027 3300005518 Bacteria 798
160 Ga0070679_100677308 3300005530 Bacteria 974
161 Ga0070684_100005231 3300005535 Bacteria 9925
162 Ga0070684_100245419 3300005535 Bacteria 1636
163 Ga0070684_100578208 3300005535 Bacteria 1044
164 Ga0070697_100597651 3300005536 Bacteria 970
165 Ga0070697_100864185 3300005536 Bacteria 802
166 Ga0068853_101811238 3300005539 Bacteria 592
167 Ga0070672_100041632 3300005543 Bacteria 3533
168 Ga0070672_100471306 3300005543 Bacteria 1083
169 Ga0070672_101492071 3300005543 Bacteria 606
170 Ga0070672_101977229 3300005543 Bacteria 525
171 Ga0070686_100031148 3300005544 Bacteria 3259
172 Ga0070686_100190371 3300005544 Bacteria 1464
173 Ga0070686_100611433 3300005544 Bacteria 860
174 Ga0070686_101393912 3300005544 Unclassified 588
175 Ga0070695_100110617 3300005545 Bacteria 1863
176 Ga0070695_100496908 3300005545 Unclassified 943
177 Ga0070695_100980094 3300005545 Bacteria 686
178 Ga0070695_100998378 3300005545 Bacteria 681
179 Ga0070696_100005487 3300005546 Bacteria 8462
180 Ga0070696_100050068 3300005546 Bacteria 2903
181 Ga0070693_100185296 3300005547 Bacteria 1343
182 Ga0070693_100469191 3300005547 Bacteria 887
183 Ga0070693_100699894 3300005547 Archaea 742
184 Ga0070665_100033864 3300005548 Bacteria 5139
185 Ga0070665_101164879 3300005548 Bacteria 782
186 Ga0070704_100031294 3300005549 Bacteria 3577
187 Ga0070704_100057843 3300005549 Bacteria 2759
188 Ga0070704_100464129 3300005549 Bacteria 1093
189 Ga0070704_100466830 3300005549 Bacteria 1090
190 Ga0070704_100736766 3300005549 Bacteria 877
191 Ga0070704_100739832 3300005549 Unclassified 875
192 Ga0070704_100985458 3300005549 Bacteria 762
193 Ga0070704_101122451 3300005549 Bacteria 715
194 Ga0070664_100001608 3300005564 Bacteria 18074
195 Ga0070664_100026140 3300005564 Bacteria 4841
196 Ga0070664_100095017 3300005564 Bacteria 2585
197 Ga0070664_100257859 3300005564 Unclassified 1568
198 Ga0068857_100021160 3300005577 Bacteria 5724
199 Ga0068857_100417081 3300005577 Bacteria 1251
200 Ga0068854_100015949 3300005578 Bacteria 4995
201 Ga0070702_100111378 3300005615 Bacteria 1697
202 Ga0070702_100152589 3300005615 Unclassified 1485
203 Ga0070702_100677648 3300005615 Bacteria 783
204 Ga0068852_101063555 3300005616 Bacteria 829
205 Ga0068859_100027743 3300005617 Bacteria 5679
206 Ga0068859_100197425 3300005617 Bacteria 2096
207 Ga0068859_100244855 3300005617 Bacteria 1882
208 Ga0068859_100379594 3300005617 Bacteria 1509
209 Ga0068859_100410868 3300005617 Bacteria 1449
210 Ga0068859_100505474 3300005617 Unclassified 1304
211 Ga0068859_102508717 3300005617 Unclassified 568
212 Ga0068859_102628729 3300005617 Bacteria 554
213 Ga0068864_100016044 3300005618 Bacteria 6232
214 Ga0068864_100593820 3300005618 Bacteria 1074
215 Ga0068864_101179039 3300005618 Bacteria 764
216 Ga0068864_102118915 3300005618 Bacteria 569
217 Ga0068866_10108018 3300005718 Bacteria 1547
218 Ga0068866_11236171 3300005718 Bacteria 540
219 Ga0068861_100030884 3300005719 Bacteria 3930
220 Ga0068861_100137258 3300005719 Bacteria 1991
221 Ga0068861_100429375 3300005719 Bacteria 1179
222 Ga0068861_101097131 3300005719 Bacteria 765
223 Ga0068851_10041209 3300005834 Bacteria 2321
224 Ga0068870_10154775 3300005840 Bacteria 1354
225 Ga0068870_10458441 3300005840 Bacteria 842
226 Ga0068863_100429611 3300005841 Bacteria 1295
227 Ga0068863_101602832 3300005841 Bacteria 660
228 Ga0068858_100014560 3300005842 Bacteria 7411
229 Ga0068858_100119501 3300005842 Bacteria 2464
230 Ga0068858_100221343 3300005842 Bacteria 1792
231 Ga0068858_100298054 3300005842 Unclassified 1538
232 Ga0068858_100405010 3300005842 Bacteria 1311
233 Ga0068858_100700445 3300005842 Bacteria 986
234 Ga0068858_100991570 3300005842 Bacteria 823
235 Ga0068858_101841938 3300005842 Bacteria 598
236 Ga0068860_100288994 3300005843 Bacteria 1604
237 Ga0068860_100382474 3300005843 Unclassified 1390
238 Ga0068860_100430620 3300005843 Bacteria 1309
239 Ga0068860_101142187 3300005843 Bacteria 799
240 Ga0068860_102243004 3300005843 Bacteria 567
241 Ga0068862_100023246 3300005844 Bacteria 5192
242 Ga0068862_100479185 3300005844 Unclassified 1177
243 Ga0068862_100577193 3300005844 Bacteria 1077
244 Ga0068862_100772970 3300005844 Bacteria 936
245 Ga0068862_100842579 3300005844 Bacteria 898
246 Ga0068862_100966043 3300005844 Bacteria 841
247 Ga0068862_101822497 3300005844 Unclassified 618
248 Ga0068862_102209706 3300005844 Bacteria 562
249 Ga0081539_10001702 3300005985 Bacteria 35478
250 Ga0081539_10038590 3300005985 Bacteria 2828
251 Ga0081539_10040663 3300005985 Bacteria 2727
252 Ga0081539_10075209 3300005985 Bacteria 1795
253 Ga0070717_11791795 3300006028 Bacteria 555
254 Ga0075365_10022822 3300006038 Bacteria 3926
255 Ga0075368_10107148 3300006042 Bacteria 1150
256 Ga0075363_100266427 3300006048 Archaea 989
257 Ga0075364_10021212 3300006051 Bacteria 4093
258 Ga0075364_10087665 3300006051 Bacteria 2063
259 Ga0075364_10288778 3300006051 Bacteria 1116
260 Ga0075432_10210689 3300006058 Bacteria 773
261 Ga0075432_10474815 3300006058 Bacteria 553
262 Ga0070716_101529411 3300006173 Bacteria 546
263 Ga0070712_100295073 3300006175 Bacteria 1310
264 Ga0075362_10006980 3300006177 Bacteria 4240
265 Ga0075367_10055938 3300006178 Bacteria 2343
266 Ga0075369_10335085 3300006186 Archaea 709
267 Ga0075366_10009667 3300006195 Bacteria 5390
268 Ga0097621_100073548 3300006237 Bacteria 2829
269 Ga0097621_100183506 3300006237 Unclassified 1809
270 Ga0097621_102434840 3300006237 Unclassified 501
271 Ga0075370_10033251 3300006353 Bacteria 2887
272 Ga0068871_100064962 3300006358 Bacteria 2988
273 Ga0068871_100297997 3300006358 Bacteria 1415
274 Ga0068871_100402308 3300006358 Bacteria 1219
275 Ga0068871_100927422 3300006358 Bacteria 808
276 Ga0068871_100996510 3300006358 Bacteria 780
277 Ga0068871_101599655 3300006358 Bacteria 617
278 Ga0068871_101686193 3300006358 Bacteria 601
279 Ga0075428_100010724 3300006844 Bacteria 10187
280 Ga0075428_100071091 3300006844 Bacteria 3803
281 Ga0075428_100132288 3300006844 Bacteria 2713
282 Ga0075428_100336039 3300006844 Bacteria 1622
283 Ga0075428_100941311 3300006844 Bacteria 915
284 Ga0075428_101148545 3300006844 Bacteria 819
285 Ga0075428_102631023 3300006844 Bacteria 514
286 Ga0075430_100017805 3300006846 Bacteria 6048
287 Ga0075430_100019061 3300006846 Bacteria 5837
288 Ga0075430_100061518 3300006846 Bacteria 3155
289 Ga0075430_100202398 3300006846 Unclassified 1648
290 Ga0075430_100382920 3300006846 Unclassified 1161
291 Ga0075430_100708444 3300006846 Bacteria 830
292 Ga0075430_100866753 3300006846 Bacteria 744
293 Ga0075430_101112134 3300006846 Bacteria 651
294 Ga0075430_101263071 3300006846 Bacteria 608
295 Ga0075431_100595588 3300006847 Bacteria 1090
296 Ga0075431_101231372 3300006847 Archaea 711
297 Ga0075431_101264756 3300006847 Unclassified 699
298 Ga0075431_101418004 3300006847 Unclassified 654
299 Ga0075433_10026046 3300006852 Bacteria 4947
300 Ga0075433_10028333 3300006852 Bacteria 4760
301 Ga0075433_10104570 3300006852 Bacteria 2508
302 Ga0075433_10500118 3300006852 Bacteria 1070
303 Ga0075433_10895592 3300006852 Bacteria 774
304 Ga0075434_100002784 3300006871 Bacteria 15480
305 Ga0075434_100027981 3300006871 Bacteria 5535
306 Ga0075434_100031212 3300006871 Bacteria 5252
307 Ga0075434_100116835 3300006871 Unclassified 2681
308 Ga0075434_100295964 3300006871 Bacteria 1638
309 Ga0075434_100419277 3300006871 Bacteria 1360
310 Ga0075434_100848793 3300006871 Bacteria 929
311 Ga0075434_101276311 3300006871 Unclassified 745
312 Ga0075429_100031024 3300006880 Bacteria 4645
313 Ga0075429_100031059 3300006880 Bacteria 4643
314 Ga0075429_100131023 3300006880 Bacteria 2193
315 Ga0075429_100131370 3300006880 Bacteria 2190
316 Ga0075429_100152347 3300006880 Bacteria 2024
317 Ga0075429_100235486 3300006880 Unclassified 1604
318 Ga0075429_100310362 3300006880 Bacteria 1381
319 Ga0075429_100633518 3300006880 Bacteria 937
320 Ga0075429_101413257 3300006880 Bacteria 606
321 Ga0068865_100121111 3300006881 Bacteria 1946
322 Ga0068865_100187815 3300006881 Bacteria 1596
323 Ga0068865_100415698 3300006881 Bacteria 1105
324 Ga0068865_101291166 3300006881 Bacteria 649
325 Ga0075436_100015139 3300006914 Bacteria 5286
326 Ga0075436_100090650 3300006914 Bacteria 2125
327 Ga0097620_100027741 3300006931 Bacteria 5679
328 Ga0097620_100197407 3300006931 Bacteria 2096
329 Ga0097620_100244853 3300006931 Bacteria 1882
330 Ga0097620_100379593 3300006931 Bacteria 1509
331 Ga0097620_100410879 3300006931 Bacteria 1449
332 Ga0097620_100505469 3300006931 Unclassified 1304
333 Ga0097620_101849231 3300006931 Bacteria 667
334 Ga0097620_102508684 3300006931 Unclassified 568
335 Ga0097620_102628332 3300006931 Bacteria 554
336 Ga0075435_100102968 3300007076 Bacteria 2367
337 Ga0075435_101178059 3300007076 Unclassified 670
338 Ga0105250_10262023 3300009092 Bacteria 740
339 Ga0105240_10635565 3300009093 Bacteria 1171
340 Ga0111539_10000002 3300009094 Bacteria 983359
341 Ga0111539_10000494 3300009094 Bacteria 50039
342 Ga0111539_10000981 3300009094 Bacteria 37479
343 Ga0111539_10004818 3300009094 Bacteria 17588
344 Ga0111539_10009303 3300009094 Bacteria 12406
345 Ga0111539_10014610 3300009094 Bacteria 9799
346 Ga0111539_10031561 3300009094 Bacteria 6435
347 Ga0111539_10031711 3300009094 Bacteria 6420
348 Ga0111539_10088335 3300009094 Bacteria 3642
349 Ga0111539_10211131 3300009094 Bacteria 2262
350 Ga0111539_10375909 3300009094 Bacteria 1654
351 Ga0111539_10718218 3300009094 Unclassified 1163
352 Ga0111539_10729901 3300009094 Bacteria 1153
353 Ga0111539_11166340 3300009094 Unclassified 895
354 Ga0111539_11225417 3300009094 Bacteria 871
355 Ga0111539_11775921 3300009094 Bacteria 715
356 Ga0111539_12396531 3300009094 Bacteria 612
357 Ga0111539_12407837 3300009094 Bacteria 611
358 Ga0111539_12423775 3300009094 Bacteria 609
359 Ga0111539_13278058 3300009094 Bacteria 521
360 Ga0105245_10362090 3300009098 Unclassified 1440
361 Ga0105245_11009328 3300009098 Bacteria 877
362 Ga0105245_11092064 3300009098 Bacteria 844
363 Ga0105247_10766862 3300009101 Bacteria 733
364 Ga0114129_10000410 3300009147 Bacteria 50569
365 Ga0114129_10010375 3300009147 Bacteria 13286
366 Ga0114129_10021226 3300009147 Bacteria 9221
367 Ga0114129_10103495 3300009147 Bacteria 3936
368 Ga0114129_10131662 3300009147 Bacteria 3434
369 Ga0114129_10448604 3300009147 Bacteria 1692
370 Ga0114129_10491555 3300009147 Bacteria 1604
371 Ga0114129_10491991 3300009147 Bacteria 1603
372 Ga0114129_11290882 3300009147 Bacteria 905
373 Ga0114129_11439070 3300009147 Bacteria 849
374 Ga0114129_11785621 3300009147 Bacteria 748
375 Ga0114129_12031475 3300009147 Bacteria 695
376 Ga0114129_12975644 3300009147 Bacteria 558
377 Ga0105243_10214883 3300009148 Bacteria 1696
378 Ga0105243_10499044 3300009148 Unclassified 1153
379 Ga0105243_10540476 3300009148 Bacteria 1111
380 Ga0105243_11355771 3300009148 Bacteria 730
381 Ga0105243_12573886 3300009148 Bacteria 548
382 Ga0105241_10227160 3300009174 Bacteria 1572
383 Ga0105241_11718821 3300009174 Bacteria 610
384 Ga0105242_10027112 3300009176 Bacteria 4546
385 Ga0105242_10148153 3300009176 Bacteria 2044
386 Ga0105242_10704730 3300009176 Bacteria 988
387 Ga0105242_11123983 3300009176 Bacteria 801
388 Ga0105242_11429965 3300009176 Bacteria 720
389 Ga0105242_12066370 3300009176 Bacteria 613
390 Ga0105242_12556086 3300009176 Bacteria 559
391 Ga0105242_12829305 3300009176 Bacteria 536
392 Ga0105248_10056208 3300009177 Bacteria 4415
393 Ga0105248_10078834 3300009177 Bacteria 3702
394 Ga0105248_10185719 3300009177 Bacteria 2343
395 Ga0105248_10200924 3300009177 Bacteria 2246
396 Ga0105248_10268822 3300009177 Bacteria 1920
397 Ga0105248_10588409 3300009177 Bacteria 1256
398 Ga0105248_10639528 3300009177 Bacteria 1200
399 Ga0105237_10789770 3300009545 Bacteria 956
400 Ga0105249_10193204 3300009553 Unclassified 1988
401 Ga0105249_10288108 3300009553 Unclassified 1643
402 Ga0105249_10334000 3300009553 Bacteria 1530
403 Ga0105249_10536530 3300009553 Bacteria 1219
404 Ga0105249_11500721 3300009553 Bacteria 746
405 Ga0105249_12119870 3300009553 Bacteria 635
406 Ga0105249_12177084 3300009553 Bacteria 627
407 Ga0105249_13359684 3300009553 Bacteria 515
408 Ga0105239_13254207 3300010375 Bacteria 529
409 Ga0105246_10072654 3300011119 Bacteria 2426
410 Ga0105246_10655482 3300011119 Bacteria 914
411 Ga0105246_11465365 3300011119 Bacteria 640
412 Ga0157370_10473771 3300013104 Bacteria 1151
413 Ga0157370_11605225 3300013104 Bacteria 584
414 Ga0157374_10091418 3300013296 Bacteria 2902
415 Ga0157374_10392762 3300013296 Bacteria 1383
416 Ga0157378_10493590 3300013297 Bacteria 1222
417 Ga0157378_10701691 3300013297 Bacteria 1031
418 Ga0157378_10705802 3300013297 Bacteria 1028
419 Ga0157378_10816167 3300013297 Bacteria 959
420 Ga0157378_11217201 3300013297 Unclassified 793
421 Ga0157378_11424839 3300013297 Bacteria 736
422 Ga0163162_10081557 3300013306 Bacteria 3305
423 Ga0163162_10916219 3300013306 Bacteria 989
424 Ga0163162_12960292 3300013306 Bacteria 546
425 Ga0157375_10122515 3300013308 Bacteria 2712
426 Ga0157375_10748925 3300013308 Bacteria 1128
427 Ga0157375_10922867 3300013308 Bacteria 1016
428 Ga0157375_12004728 3300013308 Bacteria 688
429 Ga0163163_10000663 3300014325 Bacteria 29504
430 Ga0163163_10051186 3300014325 Bacteria 4072
431 Ga0163163_10051300 3300014325 Bacteria 4067
432 Ga0163163_12535584 3300014325 Bacteria 571
433 Ga0157380_10019060 3300014326 Bacteria 5107
434 Ga0157380_10147873 3300014326 Bacteria 2027
435 Ga0157380_10159384 3300014326 Bacteria 1960
436 Ga0157380_10244769 3300014326 Bacteria 1619
437 Ga0157380_10377514 3300014326 Unclassified 1337
438 Ga0157380_11045784 3300014326 Bacteria 852
439 Ga0157380_11440155 3300014326 Unclassified 740
440 Ga0157380_11467623 3300014326 Bacteria 734
441 Ga0157380_11483884 3300014326 Unclassified 731
442 Ga0157380_13327703 3300014326 Unclassified 514
443 Ga0157377_10168058 3300014745 Bacteria 1369
444 Ga0157377_10182204 3300014745 Bacteria 1322
445 Ga0157377_10409306 3300014745 Bacteria 926
446 Ga0157379_10018789 3300014968 Bacteria 6095
447 Ga0157379_10362481 3300014968 Unclassified 1328
448 Ga0157379_10739262 3300014968 Bacteria 926
449 Ga0157379_10961823 3300014968 Bacteria 813
450 Ga0157379_11628553 3300014968 Bacteria 631
451 Ga0157376_10102217 3300014969 Bacteria 2507
452 Ga0157376_10932279 3300014969 Bacteria 888
453 Ga0157376_10947980 3300014969 Bacteria 881
454 Ga0157376_11326572 3300014969 Bacteria 750
455 Ga0157376_12532350 3300014969 Bacteria 553
456 Ga0163161_10344775 3300017792 Bacteria 1183
457 Ga0163161_10598561 3300017792 Bacteria 909
458 Ga0207697_10028355 3300025315 Bacteria 2290
459 Ga0207697_10104649 3300025315 Bacteria 1209
460 Ga0207656_10114764 3300025321 Bacteria 1248
461 Ga0207682_10141899 3300025893 Bacteria 1078
462 Ga0207642_10361294 3300025899 Bacteria 859
463 Ga0207642_10390764 3300025899 Bacteria 830
464 Ga0207642_10564474 3300025899 Bacteria 704
465 Ga0207710_10728913 3300025900 Bacteria 520
466 Ga0207688_10411373 3300025901 Bacteria 840
467 Ga0207688_10641101 3300025901 Bacteria 670
468 Ga0207680_10012973 3300025903 Bacteria 4261
469 Ga0207680_10175344 3300025903 Bacteria 1446
470 Ga0207680_10802893 3300025903 Bacteria 675
471 Ga0207680_11198531 3300025903 Bacteria 541
472 Ga0207647_10353135 3300025904 Bacteria 832
473 Ga0207699_10369831 3300025906 Bacteria 1016
474 Ga0207645_10006858 3300025907 Bacteria 8126
475 Ga0207645_10092758 3300025907 Bacteria 1942
476 Ga0207645_10139529 3300025907 Bacteria 1579
477 Ga0207643_10160496 3300025908 Bacteria 1352
478 Ga0207643_10468671 3300025908 Bacteria 803
479 Ga0207684_10050119 3300025910 Bacteria 3542
480 Ga0207707_10755878 3300025912 Bacteria 813
481 Ga0207693_10404735 3300025915 Bacteria 1067
482 Ga0207660_10126900 3300025917 Bacteria 1938
483 Ga0207660_10489262 3300025917 Bacteria 997
484 Ga0207662_10000724 3300025918 Bacteria 15073
485 Ga0207662_10036889 3300025918 Bacteria 2859
486 Ga0207662_10079506 3300025918 Bacteria 1998
487 Ga0207662_10213307 3300025918 Bacteria 1254
488 Ga0207649_10014442 3300025920 Bacteria 4422
489 Ga0207649_10074085 3300025920 Bacteria 2184
490 Ga0207652_10753920 3300025921 Bacteria 866
491 Ga0207646_10119235 3300025922 Bacteria 2370
492 Ga0207646_10452790 3300025922 Bacteria 1158
493 Ga0207646_10683837 3300025922 Unclassified 918
494 Ga0207646_11431012 3300025922 Bacteria 600
495 Ga0207681_10108834 3300025923 Bacteria 2012
496 Ga0207681_10170620 3300025923 Bacteria 1649
497 Ga0207681_10242915 3300025923 Bacteria 1402
498 Ga0207681_10849591 3300025923 Bacteria 763
499 Ga0207681_11180808 3300025923 Bacteria 643
500 Ga0207650_10005949 3300025925 Bacteria 8327
501 Ga0207650_10212934 3300025925 Bacteria 1552
502 Ga0207650_10862600 3300025925 Bacteria 768
503 Ga0207659_10070657 3300025926 Bacteria 2546
504 Ga0207659_10218667 3300025926 Bacteria 1530
505 Ga0207659_10245933 3300025926 Bacteria 1449
506 Ga0207659_10860743 3300025926 Bacteria 779
507 Ga0207659_11157736 3300025926 Bacteria 665
508 Ga0207687_10424821 3300025927 Unclassified 1097
509 Ga0207687_10455804 3300025927 Bacteria 1061
510 Ga0207687_10735457 3300025927 Bacteria 839
511 Ga0207700_10407357 3300025928 Bacteria 1192
512 Ga0207664_10019126 3300025929 Bacteria 5057
513 Ga0207644_10025621 3300025931 Bacteria 4056
514 Ga0207644_11804282 3300025931 Bacteria 512
515 Ga0207690_10090510 3300025932 Bacteria 2160
516 Ga0207706_10255567 3300025933 Bacteria 1530
517 Ga0207706_11009822 3300025933 Unclassified 699
518 Ga0207686_10586134 3300025934 Bacteria 876
519 Ga0207686_10829244 3300025934 Unclassified 743
520 Ga0207709_10218683 3300025935 Bacteria 1372
521 Ga0207709_11603613 3300025935 Archaea 541
522 Ga0207670_10009947 3300025936 Bacteria 5451
523 Ga0207670_10055982 3300025936 Bacteria 2668
524 Ga0207670_10154626 3300025936 Bacteria 1706
525 Ga0207670_10213452 3300025936 Bacteria 1473
526 Ga0207670_10856524 3300025936 Bacteria 759
527 Ga0207670_10882285 3300025936 Bacteria 748
528 Ga0207670_11124515 3300025936 Bacteria 664
529 Ga0207669_10163951 3300025937 Bacteria 1574
530 Ga0207669_10513240 3300025937 Bacteria 961
531 Ga0207669_10577353 3300025937 Bacteria 911
532 Ga0207669_10949103 3300025937 Bacteria 721
533 Ga0207704_10293654 3300025938 Bacteria 1242
534 Ga0207665_10708488 3300025939 Bacteria 792
535 Ga0207691_10035117 3300025940 Bacteria 4658
536 Ga0207691_10589775 3300025940 Bacteria 941
537 Ga0207711_10052374 3300025941 Bacteria 3498
538 Ga0207711_10059255 3300025941 Bacteria 3296
539 Ga0207711_10231968 3300025941 Bacteria 1691
540 Ga0207711_10449608 3300025941 Bacteria 1199
541 Ga0207711_11147549 3300025941 Bacteria 718
542 Ga0207711_11383338 3300025941 Bacteria 646
543 Ga0207689_10006797 3300025942 Bacteria 10066
544 Ga0207689_10089587 3300025942 Bacteria 2527
545 Ga0207689_10155386 3300025942 Bacteria 1886
546 Ga0207689_10276070 3300025942 Bacteria 1391
547 Ga0207661_10003359 3300025944 Bacteria 11114
548 Ga0207679_10003327 3300025945 Bacteria 9926
549 Ga0207679_10099569 3300025945 Bacteria 2270
550 Ga0207679_10743898 3300025945 Unclassified 892
551 Ga0207679_10775176 3300025945 Bacteria 873
552 Ga0207651_10063293 3300025960 Bacteria 2583
553 Ga0207651_10113967 3300025960 Bacteria 2035
554 Ga0207651_10146104 3300025960 Bacteria 1834
555 Ga0207651_10284456 3300025960 Bacteria 1368
556 Ga0207712_10684787 3300025961 Bacteria 894
557 Ga0207712_11565837 3300025961 Bacteria 591
558 Ga0207712_11928752 3300025961 Unclassified 529
559 Ga0207668_10241305 3300025972 Unclassified 1462
560 Ga0207668_10388884 3300025972 Bacteria 1176
561 Ga0207668_10566262 3300025972 Bacteria 986
562 Ga0207640_10136137 3300025981 Bacteria 1783
563 Ga0207640_10425090 3300025981 Unclassified 1088
564 Ga0207658_10177662 3300025986 Bacteria 1759
565 Ga0207658_10219745 3300025986 Bacteria 1598
566 Ga0207658_10233156 3300025986 Bacteria 1555
567 Ga0207658_10471730 3300025986 Bacteria 1114
568 Ga0207658_10571006 3300025986 Bacteria 1014
569 Ga0207677_11892456 3300026023 Bacteria 554
570 Ga0207677_11922384 3300026023 Unclassified 550
571 Ga0207703_10028166 3300026035 Bacteria 4426
572 Ga0207703_10277807 3300026035 Bacteria 1520
573 Ga0207703_10481808 3300026035 Bacteria 1162
574 Ga0207703_11466846 3300026035 Bacteria 656
575 Ga0207639_10948082 3300026041 Bacteria 805
576 Ga0207678_10003414 3300026067 Bacteria 14300
577 Ga0207678_10036078 3300026067 Bacteria 4303
578 Ga0207678_11021343 3300026067 Bacteria 732
579 Ga0207678_11704107 3300026067 Bacteria 553
580 Ga0207708_10008073 3300026075 Bacteria 7802
581 Ga0207708_10035538 3300026075 Bacteria 3791
582 Ga0207708_10050949 3300026075 Bacteria 3152
583 Ga0207708_10097773 3300026075 Bacteria 2269
584 Ga0207708_10383685 3300026075 Bacteria 1159
585 Ga0207708_11271275 3300026075 Bacteria 644
586 Ga0207641_10190676 3300026088 Bacteria 1884
587 Ga0207641_10491030 3300026088 Bacteria 1191
588 Ga0207641_10689032 3300026088 Bacteria 1006
589 Ga0207641_10753911 3300026088 Bacteria 961
590 Ga0207648_10034858 3300026089 Bacteria 4437
591 Ga0207648_10049704 3300026089 Bacteria 3668
592 Ga0207648_10138059 3300026089 Bacteria 2148
593 Ga0207648_10484744 3300026089 Bacteria 1130
594 Ga0207648_10878959 3300026089 Bacteria 836
595 Ga0207676_10057882 3300026095 Bacteria 3054
596 Ga0207676_10232121 3300026095 Bacteria 1650
597 Ga0207676_10764784 3300026095 Bacteria 940
598 Ga0207674_10029870 3300026116 Bacteria 5735
599 Ga0207674_10284441 3300026116 Bacteria 1602
600 Ga0207674_10509282 3300026116 Bacteria 1163
601 Ga0207674_10775663 3300026116 Unclassified 925
602 Ga0207674_11322739 3300026116 Bacteria 690
603 Ga0207675_100056601 3300026118 Bacteria 3658
604 Ga0207675_100125191 3300026118 Bacteria 2434
605 Ga0207675_100152156 3300026118 Bacteria 2202
606 Ga0207675_100224347 3300026118 Bacteria 1811
607 Ga0207675_100252953 3300026118 Bacteria 1706
608 Ga0207675_100278724 3300026118 Bacteria 1624
609 Ga0207675_100927920 3300026118 Bacteria 887
610 Ga0207675_100972704 3300026118 Bacteria 867
611 Ga0207675_101036903 3300026118 Bacteria 839
612 Ga0207675_102309182 3300026118 Bacteria 552
613 Ga0207683_11075672 3300026121 Bacteria 746
614 Ga0207683_11153016 3300026121 Bacteria 719
615 Ga0209969_1023274 3300027360 Bacteria 928
616 Ga0209967_1062605 3300027364 Unclassified 578
617 Ga0209974_10469283 3300027876 Bacteria 501
618 Ga0207428_10000004 3300027907 Bacteria 727800
619 Ga0207428_10000066 3300027907 Bacteria 150622
620 Ga0207428_10001093 3300027907 Bacteria 29501
621 Ga0207428_10005537 3300027907 Bacteria 11764
622 Ga0207428_10055858 3300027907 Bacteria 3138
623 Ga0207428_10066960 3300027907 Bacteria 2829
624 Ga0207428_10071304 3300027907 Bacteria 2729
625 Ga0207428_10092199 3300027907 Bacteria 2351
626 Ga0207428_10384192 3300027907 Bacteria 1030
627 Ga0207428_11004282 3300027907 Bacteria 586
628 Ga0268266_10212024 3300028379 Bacteria 1776
629 Ga0268266_11470027 3300028379 Bacteria 657
630 Ga0268265_11107770 3300028380 Bacteria 786
631 Ga0268265_11319233 3300028380 Bacteria 722
632 Ga0268265_11349863 3300028380 Bacteria 714
633 Ga0268265_12339696 3300028380 Bacteria 541
634 Ga0268264_10115035 3300028381 Bacteria 2363
635 Ga0268264_10192729 3300028381 Bacteria 1859
636 Ga0268264_10527165 3300028381 Unclassified 1155
637 Ga0268264_10594671 3300028381 Bacteria 1090
638 Ga0268264_11086496 3300028381 Bacteria 808
639 Ga0268264_11789745 3300028381 Bacteria 624
640 Ga0268264_12631312 3300028381 Bacteria 507
641 Ga0307408_100023632 3300031548 Bacteria 4190
642 Ga0307408_100261771 3300031548 Bacteria 1432
643 Ga0307408_100402624 3300031548 Bacteria 1175
644 Ga0307405_10006893 3300031731 Bacteria 5637
645 Ga0307405_10221650 3300031731 Bacteria 1388
646 Ga0307413_10239745 3300031824 Bacteria 1338
647 Ga0307413_10331048 3300031824 Bacteria 1167
648 Ga0307413_10364976 3300031824 Bacteria 1119
649 Ga0307413_10382255 3300031824 Unclassified 1097
650 Ga0307413_10417206 3300031824 Bacteria 1056
651 Ga0307413_10519559 3300031824 Bacteria 960
652 Ga0307413_10626788 3300031824 Bacteria 884
653 Ga0307410_10002658 3300031852 Bacteria 8714
654 Ga0307410_10042686 3300031852 Bacteria 3000
655 Ga0307410_10147912 3300031852 Bacteria 1745
656 Ga0307410_10508726 3300031852 Bacteria 992
657 Ga0307410_10782691 3300031852 Bacteria 810
658 Ga0307406_10030254 3300031901 Bacteria 3286
659 Ga0307406_10098326 3300031901 Bacteria 1987
660 Ga0307406_10736648 3300031901 Bacteria 826
661 Ga0307407_10033690 3300031903 Bacteria 2797
662 Ga0307407_10051437 3300031903 Bacteria 2362
663 Ga0307407_10090709 3300031903 Bacteria 1872
664 Ga0307407_10331626 3300031903 Bacteria 1071
665 Ga0307407_10411242 3300031903 Bacteria 973
666 Ga0307412_10002780 3300031911 Bacteria 9729
667 Ga0307412_10281513 3300031911 Bacteria 1306
668 Ga0307412_10367850 3300031911 Unclassified 1160
669 Ga0307412_10941510 3300031911 Bacteria 760
670 Ga0307412_11208239 3300031911 Bacteria 677
671 Ga0307409_100026062 3300031995 Bacteria 4116
672 Ga0307409_100027404 3300031995 Bacteria 4037
673 Ga0307409_100061598 3300031995 Bacteria 2933
674 Ga0307409_100067913 3300031995 Bacteria 2817
675 Ga0307409_100110777 3300031995 Bacteria 2301
676 Ga0307409_100188142 3300031995 Bacteria 1835
677 Ga0307416_100064487 3300032002 Bacteria 3005
678 Ga0307416_100084872 3300032002 Bacteria 2693
679 Ga0307416_100163096 3300032002 Bacteria 2063
680 Ga0307416_100374872 3300032002 Bacteria 1450
681 Ga0307416_100634802 3300032002 Bacteria 1151
682 Ga0307416_100812870 3300032002 Bacteria 1031
683 Ga0307416_102169404 3300032002 Unclassified 657
684 Ga0307414_10188975 3300032004 Bacteria 1665
685 Ga0307414_10235540 3300032004 Bacteria 1512
686 Ga0307414_10371664 3300032004 Bacteria 1233
687 Ga0307414_10400370 3300032004 Bacteria 1192
688 Ga0307414_11165783 3300032004 Bacteria 713
689 Ga0307411_10111433 3300032005 Bacteria 1959
690 Ga0307411_10219441 3300032005 Bacteria 1474
691 Ga0307411_10267673 3300032005 Bacteria 1353
692 Ga0307411_10301332 3300032005 Bacteria 1285
693 Ga0307411_10329942 3300032005 Bacteria 1236
694 Ga0307411_10469000 3300032005 Unclassified 1057
695 Ga0307411_10469203 3300032005 Bacteria 1057
696 Ga0307411_11645149 3300032005 Unclassified 593
697 Ga0307415_100043485 3300032126 Bacteria 2997
698 Ga0307415_100179480 3300032126 Bacteria 1660
699 Ga0307415_100347555 3300032126 Bacteria 1247
700 Ga0307415_100829886 3300032126 Unclassified 846
701 Ga0307415_101304893 3300032126 Bacteria 688
702 Ga0373938_0188269 3300034957 Archaea 567
703 Ga0373936_0400656 3300035113 Bacteria 630
704 Ga0373936_0611281 3300035113 Bacteria 512
705 Ga0373954_0047240 3300035118 Bacteria 2014
706 Ga0373957_0007399 3300035120 Bacteria 3513
707 Ga0373960_0190300 3300035121 Bacteria 721
708 Ga0373955_0012700 3300035172 Bacteria 4055
709 Ga0373955_0499374 3300035172 Bacteria 743
710 Ga0373955_0865220 3300035172 Bacteria 556
711 Ga0373961_0445509 3300035241 Bacteria 504
712 Ga0373933_0003937 3300035724 Bacteria 8198
713 Ga0373937_0002473 3300036401 Bacteria 15364
714 Ga0373937_0185689 3300036401 Bacteria 1953
715 Ga0373937_1732953 3300036401 Bacteria 571
716 Ga0395898_1768798 3300037466 Bacteria 540
717 Ga0436362_0045085 3300039453 Bacteria 801
718 Ga0439453_0185251 3300041408 Bacteria 510
719 Ga0451795_0189527 3300041456 Bacteria 621
720 Ga0451800_0575700 3300041459 Bacteria 1231
721 Ga0451807_0021731 3300041486 Bacteria 520
722 Ga0451807_0526429 3300041486 Bacteria 721
723 Ga0451807_0793962 3300041486 Bacteria 618
724 Ga0451839_0563425 3300041496 Bacteria 702
725 Ga0451849_1226666 3300041505 Bacteria 548
726 Ga0451853_2084722 3300041512 Bacteria 759
727 Ga0451853_2545316 3300041512 Bacteria 1419
728 Ga0451853_3669051 3300041512 Bacteria 859
729 Ga0451853_3745927 3300041512 Bacteria 1019
730 Ga0439433_0083770 3300041999 Bacteria 778
731 Ga0439443_055794 3300042003 Bacteria 699
732 Ga0439454_099419 3300042011 Bacteria 545
733 Ga0439456_161775 3300042013 Bacteria 524
734 Ga0450923_018237 3300042125 Bacteria 1341
735 Ga0450923_021563 3300042125 Bacteria 1257
736 Ga0450923_040523 3300042125 Bacteria 977
737 Ga0450890_041317 3300042127 Bacteria 683
738 Ga0450897_038392 3300042128 Bacteria 558
739 Ga0450892_010298 3300042130 Bacteria 818
740 Ga0450894_003529 3300042131 Bacteria 2044
741 Ga0450895_024623 3300042132 Bacteria 570
742 Ga0450896_024701 3300042133 Bacteria 891
743 Ga0450899_021474 3300042135 Unclassified 756
744 Ga0450906_021096 3300042145 Bacteria 1165
745 Ga0450909_009430 3300042185 Bacteria 1425
746 Ga0439434_0245718 3300042435 Bacteria 611
747 Ga0439435_0072151 3300042436 Bacteria 1024
748 Ga0439464_0033332 3300042439 Bacteria 1450
749 Ga0439460_0181914 3300042461 Unclassified 711
750 Ga0450916_008974 3300042530 Bacteria 1228
751 Ga0450916_096513 3300042530 Bacteria 520
752 Ga0450918_034014 3300042531 Bacteria 905
753 Ga0450893_0098999 3300042532 Bacteria 592
754 Ga0451577_0132777 3300042876 Bacteria 2234
755 Ga0453683_0623424 3300044673 Bacteria 704
756 Ga0453683_0726699 3300044673 Bacteria 651
757 Ga0453684_0107756 3300044712 Bacteria 3392
758 Ga0466960_0876213 3300044901 Bacteria 547
759 Ga0451576_0023050 3300045051 Bacteria 6747
760 Ga0451576_2085483 3300045051 Bacteria 583
761 Ga0451576_2247038 3300045051 Unclassified 560
762 Ga0466967_0877877 3300045976 Bacteria 892
763 Ga0466967_1607584 3300045976 Bacteria 647
764 Ga0495592_0475807 3300046454 Bacteria 779
765 Ga0495603_0209070 3300046455 Bacteria 1127
766 Ga0495651_0076455 3300046462 Bacteria 2536
767 Ga0495653_0708482 3300046463 Bacteria 611
768 Ga0495582_0361365 3300046473 Bacteria 836
769 Ga0495664_0707613 3300046477 Bacteria 595
770 Ga0495584_0031669 3300046491 Bacteria 2676
771 Ga0495594_0669086 3300046499 Bacteria 587
772 Ga0495628_0940909 3300046516 Bacteria 597
773 Ga0495630_0715786 3300046517 Bacteria 766
774 Ga0495637_0207938 3300046520 Bacteria 717
775 Ga0495643_0001941 3300046522 Bacteria 17402
776 Ga0495663_0134012 3300046525 Bacteria 837
777 Ga0495587_0098139 3300046536 Bacteria 1689
778 Ga0495598_0009390 3300046537 Bacteria 2311
779 Ga0495598_0015886 3300046537 Bacteria 1910
780 Ga0495598_0134260 3300046537 Bacteria 851
781 Ga0495609_0079851 3300046538 Bacteria 1431
782 Ga0495621_0094454 3300046539 Bacteria 1131
783 Ga0495621_0167157 3300046539 Bacteria 872
784 Ga0495597_0351223 3300046542 Unclassified 566
785 Ga0495633_0193656 3300046558 Bacteria 934
786 Ga0495656_0107445 3300046615 Bacteria 1300
787 Ga0495659_0102391 3300046664 Bacteria 1110
788 Ga0495647_0003465 3300046681 Bacteria 5047
789 Ga0495647_0275437 3300046681 Bacteria 754
790 Ga0495647_0324119 3300046681 Bacteria 698
791 Ga0495669_0114625 3300046684 Bacteria 1261
792 Ga0495669_0338223 3300046684 Bacteria 727
793 Ga0495649_0409512 3300046694 Bacteria 680
794 Ga0495604_0347158 3300047317 Unclassified 987
795 Ga0495672_0320193 3300047320 Bacteria 729
796 Ga0495680_0380536 3300047322 Bacteria 978
797 Ga0495675_0755088 3300047444 Bacteria 541
798 Ga0495685_080951 3300047447 Bacteria 1081
799 Ga0495614_0230281 3300048089 Bacteria 844
800 Ga0495615_0145672 3300048090 Bacteria 702
801 Ga0496101_0614809 3300048904 Bacteria 859
802 Ga0496104_0003082 3300048907 Bacteria 14367
803 Ga0496104_1271719 3300048907 Bacteria 639
804 Ga0496105_0019761 3300048908 Bacteria 5435
805 Ga0496105_0343643 3300048908 Bacteria 1193
806 Ga0496106_0249197 3300048909 Bacteria 1420
807 Ga0496106_0500743 3300048909 Bacteria 976
808 Ga0496107_0318703 3300048910 Bacteria 1157
809 Ga0496108_0003036 3300048911 Bacteria 13496
810 Ga0496108_1012114 3300048911 Bacteria 709
811 Ga0496109_0004537 3300048912 Bacteria 11602
812 Ga0496109_0818684 3300048912 Bacteria 869
813 Ga0496110_0004868 3300048913 Bacteria 10477
814 Ga0496110_0215709 3300048913 Bacteria 1745
815 Ga0496110_0891015 3300048913 Bacteria 796
816 Ga0496111_0005731 3300048914 Bacteria 8009
817 Ga0496111_0127638 3300048914 Bacteria 1881
818 Ga0496112_0001468 3300048915 Bacteria 18097
819 Ga0496113_0167493 3300048916 Bacteria 1739
820 Ga0496113_0994574 3300048916 Bacteria 661
821 Ga0496114_0053394 3300048917 Bacteria 3369
822 Ga0496114_0171724 3300048917 Bacteria 1890
823 Ga0496114_1337213 3300048917 Bacteria 603
824 Ga0501300_021039 3300049523 Bacteria 953
825 Ga0501311_082027 3300049527 Bacteria 550
826 Ga0501031_0046471 3300049568 Bacteria 2831
827 Ga0501031_0511735 3300049568 Bacteria 774
828 Ga0501032_0520296 3300049569 Bacteria 759
829 Ga0501033_0037295 3300049570 Bacteria 3639
830 Ga0501034_0115513 3300049571 Bacteria 2672
831 Ga0501034_0705034 3300049571 Bacteria 907
832 Ga0501036_0104742 3300049572 Unclassified 2392
833 Ga0501036_0273501 3300049572 Bacteria 1414
834 Ga0501036_0521110 3300049572 Bacteria 989
835 Ga0501036_0591953 3300049572 Bacteria 920
836 Ga0501036_0652360 3300049572 Bacteria 871
837 Ga0501036_0865534 3300049572 Bacteria 742
838 Ga0501036_1015335 3300049572 Bacteria 679
839 Ga0501037_0098874 3300049573 Bacteria 2107
840 Ga0501037_0557127 3300049573 Bacteria 773
841 Ga0501037_0728156 3300049573 Bacteria 658
842 Ga0501038_0135132 3300049574 Bacteria 2021
843 Ga0501038_0399459 3300049574 Bacteria 1063
844 Ga0501038_0589329 3300049574 Bacteria 842
845 Ga0501038_0834415 3300049574 Bacteria 683
846 Ga0501039_0089734 3300049575 Bacteria 2395
847 Ga0501039_0258539 3300049575 Bacteria 1369
848 Ga0501039_0368660 3300049575 Bacteria 1128
849 Ga0501039_0497179 3300049575 Bacteria 958
850 Ga0501039_0504529 3300049575 Bacteria 950
851 Ga0501040_0068905 3300049576 Bacteria 2440
852 Ga0501040_0286680 3300049576 Bacteria 1176
853 Ga0501040_0511750 3300049576 Bacteria 865
854 Ga0501040_1230390 3300049576 Bacteria 543
855 Ga0501041_0144688 3300049577 Bacteria 1483
856 Ga0501041_0235132 3300049577 Bacteria 1151
857 Ga0501041_0427339 3300049577 Bacteria 840
858 Ga0501041_0530679 3300049577 Bacteria 750
859 Ga0501042_0075928 3300049578 Bacteria 2405
860 Ga0501042_0085131 3300049578 Bacteria 2267
861 Ga0501042_0210948 3300049578 Bacteria 1401
862 Ga0501042_0233859 3300049578 Bacteria 1326
863 Ga0501042_0874338 3300049578 Bacteria 654
864 Ga0501042_1258217 3300049578 Bacteria 540
865 Ga0501042_1373781 3300049578 Bacteria 515
866 Ga0501043_0106136 3300049579 Bacteria 2206
867 Ga0501046_0015798 3300049580 Bacteria 6334
868 Ga0501046_0046528 3300049580 Bacteria 3443
869 Ga0501046_0285268 3300049580 Bacteria 1209
870 Ga0501046_0536254 3300049580 Bacteria 835
871 Ga0501046_0610915 3300049580 Bacteria 773
872 Ga0501046_1168724 3300049580 Bacteria 530
873 Ga0501047_0006623 3300049581 Bacteria 10895
874 Ga0501047_0071383 3300049581 Bacteria 3342
875 Ga0501047_0988841 3300049581 Bacteria 654
876 Ga0501048_0200008 3300049582 Bacteria 1416
877 Ga0501067_0144682 3300049583 Bacteria 1324
878 Ga0501067_0544826 3300049583 Bacteria 650
879 Ga0501067_0588831 3300049583 Bacteria 623
880 Ga0501068_0058634 3300049584 Bacteria 2336
881 Ga0501068_0075221 3300049584 Bacteria 2066
882 Ga0501068_0211500 3300049584 Bacteria 1231
883 Ga0501069_0006243 3300049585 Bacteria 6228
884 Ga0501070_0343688 3300049586 Bacteria 1212
885 Ga0501070_0661706 3300049586 Bacteria 828
886 Ga0501070_1497282 3300049586 Bacteria 511
887 Ga0501071_0149591 3300049587 Bacteria 1741
888 Ga0501071_0159629 3300049587 Bacteria 1685
889 Ga0501071_0166359 3300049587 Bacteria 1650
890 Ga0501071_0189283 3300049587 Bacteria 1543
891 Ga0501071_0239367 3300049587 Bacteria 1368
892 Ga0501071_0435316 3300049587 Bacteria 1003
893 Ga0501071_0484897 3300049587 Bacteria 948
894 Ga0501071_0672350 3300049587 Bacteria 797
895 Ga0501071_1099832 3300049587 Bacteria 614
896 Ga0501072_0075990 3300049588 Bacteria 2657
897 Ga0501072_0109368 3300049588 Bacteria 2200
898 Ga0501072_0127443 3300049588 Bacteria 2028
899 Ga0501072_0210167 3300049588 Bacteria 1551
900 Ga0501072_0220493 3300049588 Bacteria 1512
901 Ga0501072_0254797 3300049588 Bacteria 1397
902 Ga0501073_0347179 3300049589 Bacteria 1024
903 Ga0501073_0454940 3300049589 Bacteria 885
904 Ga0501073_0580333 3300049589 Bacteria 774
905 Ga0501073_1058910 3300049589 Bacteria 558
906 Ga0501074_0017869 3300049590 Bacteria 5153
907 Ga0501074_0162295 3300049590 Bacteria 1596
908 Ga0501074_0194780 3300049590 Bacteria 1445
909 Ga0501074_0314169 3300049590 Bacteria 1113
910 Ga0501074_0929107 3300049590 Bacteria 612
911 Ga0501075_0121589 3300049591 Bacteria 1987
912 Ga0501075_0144066 3300049591 Bacteria 1816
913 Ga0501075_0165360 3300049591 Bacteria 1688
914 Ga0501075_0423995 3300049591 Bacteria 1014
915 Ga0501075_0606554 3300049591 Bacteria 835
916 Ga0501075_1375790 3300049591 Bacteria 535
917 Ga0501075_1442648 3300049591 Bacteria 521
918 Ga0501075_1530664 3300049591 Bacteria 505
919 Ga0501076_0085979 3300049592 Bacteria 2527
920 Ga0501076_0159376 3300049592 Bacteria 1838
921 Ga0501076_0185119 3300049592 Bacteria 1698
922 Ga0501076_0347888 3300049592 Bacteria 1217
923 Ga0501076_0404539 3300049592 Bacteria 1122
924 Ga0501076_0454774 3300049592 Bacteria 1054
925 Ga0501076_0472907 3300049592 Bacteria 1032
926 Ga0501076_0517199 3300049592 Bacteria 984
927 Ga0501076_0546117 3300049592 Bacteria 955
928 Ga0501076_0979298 3300049592 Bacteria 697
929 Ga0501076_1557296 3300049592 Bacteria 542
930 Ga0501077_0102406 3300049593 Bacteria 1814
931 Ga0501077_0253061 3300049593 Bacteria 1120
932 Ga0501077_0384601 3300049593 Bacteria 897
933 Ga0501077_0454925 3300049593 Bacteria 820
934 Ga0501077_0488621 3300049593 Unclassified 789
935 Ga0501077_0747206 3300049593 Unclassified 629
936 Ga0501077_0835607 3300049593 Bacteria 592
937 Ga0501211_043925 3300049658 Bacteria 539
938 Ga0501243_130230 3300049675 Unclassified 525
939 Ga0501079_0027969 3300049741 Bacteria 4325
940 Ga0501079_0332455 3300049741 Bacteria 1190
941 Ga0501079_0832907 3300049741 Unclassified 726
942 Ga0501080_0019050 3300049742 Bacteria 6354
943 Ga0501080_0102787 3300049742 Bacteria 2651
944 Ga0501080_0393028 3300049742 Bacteria 1248
945 Ga0501080_1833734 3300049742 Bacteria 509
946 Ga0501081_0046801 3300049743 Bacteria 2975
947 Ga0501081_0354441 3300049743 Bacteria 1082
948 Ga0501081_0398270 3300049743 Bacteria 1019
949 Ga0501083_0009096 3300049744 Bacteria 7015
950 Ga0501083_0139058 3300049744 Bacteria 1590
951 Ga0501083_0180486 3300049744 Bacteria 1378
952 Ga0501083_1035306 3300049744 Bacteria 534
953 Ga0501035_0128300 3300049822 Bacteria 2212
954 Ga0501035_0250609 3300049822 Bacteria 1504
955 Ga0501035_0296453 3300049822 Bacteria 1363
956 Ga0501035_0812271 3300049822 Bacteria 746
957 Ga0501044_0116255 3300049823 Bacteria 2680
958 Ga0501044_0144191 3300049823 Bacteria 2368
959 Ga0501044_0723691 3300049823 Bacteria 879
960 Ga0501045_0013621 3300049824 Bacteria 5748
961 Ga0501045_0026599 3300049824 Bacteria 4164
962 Ga0501045_0044615 3300049824 Bacteria 3230
963 Ga0501045_0091558 3300049824 Bacteria 2248
964 Ga0501045_0984409 3300049824 Bacteria 619
965 nmdc:mga03683_152060_c1 3300050489 Bacteria 1045
966 nmdc:mga03n38_328724_c1 3300050490 Archaea 827
967 nmdc:mga00v17_169127_c1 3300050491 Bacteria 1409
968 nmdc:mga00v17_373533_c1 3300050491 Bacteria 927
969 nmdc:mga0yw44_16488_c1 3300050492 Unclassified 1930
970 nmdc:mga0k408_11298_c1 3300050493 Bacteria 4858
971 nmdc:mga0k408_601469_c1 3300050493 Bacteria 648
972 nmdc:mga0k408_842942_c1 3300050493 Bacteria 533
973 nmdc:mga06z11_128855_c1 3300050494 Bacteria 1419
974 nmdc:mga06z11_640735_c1 3300050494 Bacteria 647
975 nmdc:mga04h51_80670_c1 3300050495 Bacteria 1154
976 nmdc:mga07m45_99236_c1 3300050496 Bacteria 1249
977 nmdc:mga05p37_1102340_c1 3300050507 Bacteria 831
978 nmdc:mga05p37_11849_c1 3300050507 Bacteria 10393
979 nmdc:mga05p37_1408827_c1 3300050507 Bacteria 701
980 nmdc:mga05p37_1775674_c1 3300050507 Bacteria 597
981 nmdc:mga05p37_2244117_c1 3300050507 Bacteria 505
982 nmdc:mga05p37_288705_c1 3300050507 Bacteria 1953
983 nmdc:mga05p37_359328_c1 3300050507 Bacteria 1712
984 nmdc:mga05p37_39335_c1 3300050507 Bacteria 5806
985 nmdc:mga05p37_54_c2 3300050507 Bacteria 73831
986 nmdc:mga05p37_554256_c1 3300050507 Bacteria 1308
987 nmdc:mga05p37_59208_c1 3300050507 Bacteria 4717
988 nmdc:mga05p37_62626_c1 3300050507 Bacteria 4578
989 nmdc:mga05p37_69250_c1 3300050507 Bacteria 4340
990 nmdc:mga05p37_979152_c1 3300050507 Bacteria 901
991 nmdc:mga09592_1053806_c1 3300050508 Bacteria 678
992 nmdc:mga09592_1101508_c1 3300050508 Bacteria 660
993 nmdc:mga09592_1258644_c1 3300050508 Unclassified 610
994 nmdc:mga09592_1521423_c1 3300050508 Bacteria 544
995 nmdc:mga09592_1709847_c1 3300050508 Unclassified 507
996 nmdc:mga09592_27877_c1 3300050508 Bacteria 4688
997 nmdc:mga09592_475652_c1 3300050508 Bacteria 1077
998 nmdc:mga09592_553605_c1 3300050508 Bacteria 988
999 nmdc:mga09592_624290_c1 3300050508 Bacteria 922
1000 nmdc:mga09592_686212_c1 3300050508 Bacteria 872
1001 nmdc:mga09592_848199_c1 3300050508 Bacteria 771
1002 nmdc:mga0qj67_146515_c1 3300050509 Bacteria 1914
1003 nmdc:mga0qj67_23200_c1 3300050509 Unclassified 4771
1004 nmdc:mga0qj67_325561_c1 3300050509 Bacteria 1244
1005 nmdc:mga0qj67_398643_c1 3300050509 Bacteria 1110
1006 nmdc:mga0qj67_496222_c1 3300050509 Bacteria 982
1007 nmdc:mga0qj67_563773_c1 3300050509 Bacteria 913
1008 nmdc:mga0qj67_566669_c1 3300050509 Bacteria 910
1009 nmdc:mga0qj67_61432_c1 3300050509 Bacteria 2983
1010 nmdc:mga0qj67_915933_c1 3300050509 Bacteria 690
1011 nmdc:mga06r32_128077_c1 3300050510 Bacteria 2509
1012 nmdc:mga06r32_672116_c1 3300050510 Unclassified 1003
1013 nmdc:mga06r32_71740_c1 3300050510 Bacteria 3352
1014 nmdc:mga08y16_1015049_c1 3300050511 Bacteria 809
1015 nmdc:mga08y16_1141985_c1 3300050511 Bacteria 752
1016 nmdc:mga08y16_1172445_c1 3300050511 Unclassified 740
1017 nmdc:mga08y16_1409804_c1 3300050511 Bacteria 660
1018 nmdc:mga08y16_1947641_c1 3300050511 Bacteria 538
1019 nmdc:mga08y16_19906_c1 3300050511 Bacteria 7079
1020 nmdc:mga08y16_19984_c1 3300050511 Bacteria 7066
1021 nmdc:mga08y16_244307_c1 3300050511 Bacteria 1855
1022 nmdc:mga08y16_2979_c1 3300050511 Bacteria 17456
1023 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
1024 nmdc:mga08y16_46458_c1 3300050511 Bacteria 4546
1025 nmdc:mga08y16_53015_c1 3300050511 Bacteria 4242
1026 nmdc:mga08y16_53496_c1 3300050511 Bacteria 4222
1027 nmdc:mga08y16_634696_c1 3300050511 Bacteria 1074
1028 nmdc:mga08y16_67967_c1 3300050511 Bacteria 3717
1029 nmdc:mga08y16_87982_c1 3300050511 Bacteria 3237
1030 nmdc:mga0n895_1424093_c1 3300050512 Bacteria 661
1031 nmdc:mga0n895_1576179_c1 3300050512 Unclassified 622
1032 nmdc:mga0n895_2047167_c1 3300050512 Bacteria 530
1033 nmdc:mga0n895_220970_c1 3300050512 Bacteria 1923
1034 nmdc:mga0n895_281_c1 3300050512 Bacteria 33522
1035 nmdc:mga0n895_285856_c1 3300050512 Unclassified 1672
1036 nmdc:mga0n895_31613_c1 3300050512 Bacteria 5071
1037 nmdc:mga0n895_35411_c1 3300050512 Bacteria 4813
1038 nmdc:mga0n895_627410_c1 3300050512 Bacteria 1075
1039 nmdc:mga0n895_73517_c1 3300050512 Bacteria 3394
1040 nmdc:mga0rr50_12769_c1 3300050513 Bacteria 5443
1041 nmdc:mga0rr50_597653_c1 3300050513 Bacteria 941
1042 nmdc:mga0rr50_99442_c1 3300050513 Bacteria 2282
1043 nmdc:mga08x19_1442_c1 3300050514 Bacteria 14702
1044 nmdc:mga08x19_15948_c1 3300050514 Bacteria 4578
1045 nmdc:mga0a205_1430760_c1 3300050515 Bacteria 539
1046 nmdc:mga0a205_205039_c1 3300050515 Bacteria 1861
1047 nmdc:mga0a205_249539_c1 3300050515 Bacteria 1655
1048 nmdc:mga0a205_34105_c1 3300050515 Bacteria 4883
1049 nmdc:mga0a205_469_c1 3300050515 Bacteria 31359
1050 nmdc:mga0a205_495605_c1 3300050515 Bacteria 1079
1051 nmdc:mga0a205_509325_c1 3300050515 Bacteria 1060
1052 nmdc:mga0a205_516667_c1 3300050515 Bacteria 1051
1053 nmdc:mga0a205_56533_c1 3300050515 Bacteria 3788
1054 nmdc:mga0a205_964118_c1 3300050515 Bacteria 700
1055 nmdc:mga0sz30_200081_c1 3300050516 Unclassified 887
1056 Ga0495619_0465123 3300053085 Bacteria 871
1057 Ga0501084_0028026 3300054114 Bacteria 4706
1058 Ga0501084_0087693 3300054114 Bacteria 2613
1059 Ga0501084_0221203 3300054114 Bacteria 1598
1060 Ga0501084_0516083 3300054114 Bacteria 1010
1061 Ga0501084_0617930 3300054114 Bacteria 915
1062 Ga0501084_1046619 3300054114 Bacteria 685
1063 Ga0501084_1642936 3300054114 Bacteria 537
1064 Ga0590071_056342 3300059421 Bacteria 956
1065 Ga0590074_115496 3300059423 Bacteria 532
1066 Ga0590077_000518 3300059426 Bacteria 10686
1067 Ga0590077_030411 3300059426 Bacteria 1177
1068 Ga0501082_0037262 3300060353 Bacteria 4191
1069 Ga0501082_0164047 3300060353 Bacteria 1931
1070 Ga0501082_0198840 3300060353 Bacteria 1744
1071 Ga0501082_0258610 3300060353 Bacteria 1514
1072 Ga0501082_0340092 3300060353 Bacteria 1308
1073 Ga0501082_0342075 3300060353 Bacteria 1304
1074 Ga0501082_0449738 3300060353 Bacteria 1125
1075 Ga0501082_0558647 3300060353 Bacteria 1001
1076 Ga0501082_1486509 3300060353 Bacteria 592
1077 Ga0501082_1712595 3300060353 Bacteria 548
1078 Ga0501082_1850452 3300060353 Bacteria 526
1079 Ga0530510_0011089 3300061734 Bacteria 6323
1080 Ga0530510_0247570 3300061734 Bacteria 1328
1081 Ga0530510_0332525 3300061734 Bacteria 1140
1082 Ga0530510_0439828 3300061734 Bacteria 985
1083 Ga0530510_0564265 3300061734 Bacteria 865
1084 Ga0530510_0942225 3300061734 Bacteria 660
1085 Ga0530510_0987283 3300061734 Unclassified 644

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10493590 Ga0157378_104935901 82
2 3300014968 Ga0157379_10739262 Ga0157379_107392622 85
3 3300031911 Ga0307412_11208239 Ga0307412_112082391 86
4 3300049523 Ga0501300_021039 Ga0501300_021039_215_526 86
5 3300014969 Ga0157376_12532350 Ga0157376_125323502 87
6 3300005295 Ga0065707_10149428 Ga0065707_101494282 88
7 3300005295 Ga0065707_11122576 Ga0065707_111225761 88
8 3300005335 Ga0070666_10908227 Ga0070666_109082272 88
9 3300005339 Ga0070660_101496559 Ga0070660_1014965592 88
10 3300005353 Ga0070669_100350581 Ga0070669_1003505812 88
11 3300005441 Ga0070700_100229740 Ga0070700_1002297402 88
12 3300005459 Ga0068867_100256849 Ga0068867_1002568492 88
13 3300005617 Ga0068859_102628729 Ga0068859_1026287292 88
14 3300005842 Ga0068858_100119501 Ga0068858_1001195014 88
15 3300005844 Ga0068862_100023246 Ga0068862_1000232462 88
16 3300006846 Ga0075430_101112134 Ga0075430_1011121342 88
17 3300006931 Ga0097620_102628332 Ga0097620_1026283322 88
18 3300009094 Ga0111539_13278058 Ga0111539_132780582 88
19 3300009101 Ga0105247_10766862 Ga0105247_107668622 88
20 3300009176 Ga0105242_11123983 Ga0105242_111239832 88
21 3300009177 Ga0105248_10639528 Ga0105248_106395282 88
22 3300009553 Ga0105249_13359684 Ga0105249_133596842 88
23 3300013104 Ga0157370_11605225 Ga0157370_116052252 88
24 3300013297 Ga0157378_10705802 Ga0157378_107058022 88
25 3300014326 Ga0157380_10159384 Ga0157380_101593842 88
26 3300014968 Ga0157379_11628553 Ga0157379_116285532 88
27 3300025922 Ga0207646_11431012 Ga0207646_114310122 88
28 3300025923 Ga0207681_10108834 Ga0207681_101088344 88
29 3300025960 Ga0207651_10284456 Ga0207651_102844562 88
30 3300005295 Ga0065707_10086703 Ga0065707_100867036 89
31 3300005545 Ga0070695_100998378 Ga0070695_1009983781 89
32 3300006871 Ga0075434_100116835 Ga0075434_1001168354 89
33 3300009094 Ga0111539_10000002 Ga0111539_10000002138 89
34 3300009094 Ga0111539_10014610 Ga0111539_1001461013 89
35 3300009147 Ga0114129_11785621 Ga0114129_117856211 89
36 3300027907 Ga0207428_10000004 Ga0207428_10000004519 89
37 3300027907 Ga0207428_10092199 Ga0207428_100921992 89
38 3300049586 Ga0501070_1497282 Ga0501070_1497282_64_360 89
39 3300049589 Ga0501073_1058910 Ga0501073_1058910_248_544 89
40 3300049591 Ga0501075_1375790 Ga0501075_1375790_77_373 89
41 3300050509 nmdc:mga0qj67_325561_c1 nmdc:mga0qj67_325561_c1_875_1174 89
42 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_808795_809094 89
43 3300050511 nmdc:mga08y16_53015_c1 nmdc:mga08y16_53015_c1_2120_2419 89
44 3300050512 nmdc:mga0n895_285856_c1 nmdc:mga0n895_285856_c1_994_1293 89
45 3300005336 Ga0070680_100415668 Ga0070680_1004156682 90
46 3300025918 Ga0207662_10213307 Ga0207662_102133072 90
47 3300035113 Ga0373936_0611281 Ga0373936_0611281_183_455 90
48 3300037466 Ga0395898_1768798 Ga0395898_1768798_94_366 90
49 3300039453 Ga0436362_0045085 Ga0436362_0045085_410_685 90
50 3300041456 Ga0451795_0189527 Ga0451795_0189527_181_480 90
51 3300046477 Ga0495664_0707613 Ga0495664_0707613_190_462 90
52 3300050507 nmdc:mga05p37_1102340_c1 nmdc:mga05p37_1102340_c1_414_686 90
53 3300050512 nmdc:mga0n895_627410_c1 nmdc:mga0n895_627410_c1_711_998 90
54 3300050515 nmdc:mga0a205_495605_c1 nmdc:mga0a205_495605_c1_431_718 90
55 3300005468 Ga0070707_100550545 Ga0070707_1005505452 91
56 3300005535 Ga0070684_100578208 Ga0070684_1005782081 91
57 3300005842 Ga0068858_100405010 Ga0068858_1004050101 91
58 3300006358 Ga0068871_100402308 Ga0068871_1004023082 91
59 3300006847 Ga0075431_101418004 Ga0075431_1014180042 91
60 3300006914 Ga0075436_100015139 Ga0075436_1000151397 91
61 3300014325 Ga0163163_10000663 Ga0163163_1000066317 91
62 3300014969 Ga0157376_10932279 Ga0157376_109322792 91
63 3300025922 Ga0207646_10452790 Ga0207646_104527902 91
64 3300026035 Ga0207703_10481808 Ga0207703_104818082 91
65 3300035118 Ga0373954_0047240 Ga0373954_0047240_1541_1840 91
66 3300035120 Ga0373957_0007399 Ga0373957_0007399_1053_1352 91
67 3300035172 Ga0373955_0012700 Ga0373955_0012700_467_766 91
68 3300035724 Ga0373933_0003937 Ga0373933_0003937_2733_3032 91
69 3300036401 Ga0373937_0002473 Ga0373937_0002473_6505_6804 91
70 3300036401 Ga0373937_0185689 Ga0373937_0185689_577_876 91
71 3300044673 Ga0453683_0726699 Ga0453683_0726699_84_383 91
72 3300045051 Ga0451576_0023050 Ga0451576_0023050_366_665 91
73 3300046462 Ga0495651_0076455 Ga0495651_0076455_503_802 91
74 3300046516 Ga0495628_0940909 Ga0495628_0940909_32_334 91
75 3300046517 Ga0495630_0715786 Ga0495630_0715786_401_700 91
76 3300048913 Ga0496110_0215709 Ga0496110_0215709_745_1044 91
77 3300048914 Ga0496111_0127638 Ga0496111_0127638_43_342 91
78 3300048916 Ga0496113_0994574 Ga0496113_0994574_290_589 91
79 3300048917 Ga0496114_0171724 Ga0496114_0171724_784_1083 91
80 3300050508 nmdc:mga09592_1709847_c1 nmdc:mga09592_1709847_c1_39_335 91
81 3300050509 nmdc:mga0qj67_398643_c1 nmdc:mga0qj67_398643_c1_316_612 91
82 3300050510 nmdc:mga06r32_672116_c1 nmdc:mga06r32_672116_c1_333_629 91
83 3300050514 nmdc:mga08x19_1442_c1 nmdc:mga08x19_1442_c1_1867_2166 91
84 3300053085 Ga0495619_0465123 Ga0495619_0465123_246_545 91
85 3300005328 Ga0070676_10028956 Ga0070676_100289562 92
86 3300005333 Ga0070677_10762496 Ga0070677_107624961 92
87 3300005335 Ga0070666_10045960 Ga0070666_100459602 92
88 3300005338 Ga0068868_100389144 Ga0068868_1003891442 92
89 3300005341 Ga0070691_10017904 Ga0070691_100179042 92
90 3300005343 Ga0070687_100051971 Ga0070687_1000519713 92
91 3300005347 Ga0070668_101644322 Ga0070668_1016443222 92
92 3300005353 Ga0070669_100155395 Ga0070669_1001553951 92
93 3300005354 Ga0070675_100197845 Ga0070675_1001978452 92
94 3300005364 Ga0070673_100409025 Ga0070673_1004090252 92
95 3300005367 Ga0070667_100166117 Ga0070667_1001661173 92
96 3300005367 Ga0070667_100579633 Ga0070667_1005796332 92
97 3300005440 Ga0070705_100077195 Ga0070705_1000771951 92
98 3300005441 Ga0070700_100067920 Ga0070700_1000679202 92
99 3300005459 Ga0068867_100087743 Ga0068867_1000877431 92
100 3300005544 Ga0070686_101393912 Ga0070686_1013939122 92
101 3300005545 Ga0070695_100110617 Ga0070695_1001106172 92
102 3300005548 Ga0070665_100033864 Ga0070665_1000338648 92
103 3300005615 Ga0070702_100111378 Ga0070702_1001113782 92
104 3300005618 Ga0068864_100593820 Ga0068864_1005938202 92
105 3300005842 Ga0068858_100014560 Ga0068858_1000145603 92
106 3300005842 Ga0068858_100700445 Ga0068858_1007004452 92
107 3300006237 Ga0097621_100073548 Ga0097621_1000735482 92
108 3300009094 Ga0111539_12423775 Ga0111539_124237751 92
109 3300025901 Ga0207688_10411373 Ga0207688_104113731 92
110 3300025917 Ga0207660_10489262 Ga0207660_104892622 92
111 3300025941 Ga0207711_10052374 Ga0207711_100523743 92
112 3300026035 Ga0207703_10028166 Ga0207703_100281664 92
113 3300027907 Ga0207428_10066960 Ga0207428_100669603 92
114 3300028379 Ga0268266_10212024 Ga0268266_102120242 92
115 3300046558 Ga0495633_0193656 Ga0495633_0193656_629_907 92
116 3300049593 Ga0501077_0454925 Ga0501077_0454925_358_636 92
117 3300005438 Ga0070701_11346115 Ga0070701_113461151 93
118 3300005440 Ga0070705_100010925 Ga0070705_1000109252 93
119 3300005444 Ga0070694_100002811 Ga0070694_1000028117 93
120 3300005444 Ga0070694_100006907 Ga0070694_1000069072 93
121 3300005468 Ga0070707_100328591 Ga0070707_1003285912 93
122 3300005518 Ga0070699_100005918 Ga0070699_10000591813 93
123 3300005535 Ga0070684_100245419 Ga0070684_1002454192 93
124 3300005539 Ga0068853_101811238 Ga0068853_1018112381 93
125 3300005543 Ga0070672_101492071 Ga0070672_1014920711 93
126 3300005543 Ga0070672_101977229 Ga0070672_1019772292 93
127 3300005549 Ga0070704_100031294 Ga0070704_1000312945 93
128 3300005549 Ga0070704_100464129 Ga0070704_1004641292 93
129 3300005564 Ga0070664_100095017 Ga0070664_1000950172 93
130 3300005578 Ga0068854_100015949 Ga0068854_1000159495 93
131 3300005719 Ga0068861_100137258 Ga0068861_1001372582 93
132 3300005843 Ga0068860_100430620 Ga0068860_1004306202 93
133 3300006051 Ga0075364_10288778 Ga0075364_102887782 93
134 3300006358 Ga0068871_100297997 Ga0068871_1002979972 93
135 3300006852 Ga0075433_10026046 Ga0075433_100260465 93
136 3300006871 Ga0075434_100031212 Ga0075434_1000312126 93
137 3300006871 Ga0075434_101276311 Ga0075434_1012763112 93
138 3300006881 Ga0068865_100187815 Ga0068865_1001878153 93
139 3300006914 Ga0075436_100090650 Ga0075436_1000906502 93
140 3300007076 Ga0075435_100102968 Ga0075435_1001029682 93
141 3300014325 Ga0163163_12535584 Ga0163163_125355842 93
142 3300014326 Ga0157380_10147873 Ga0157380_101478732 93
143 3300025321 Ga0207656_10114764 Ga0207656_101147642 93
144 3300025899 Ga0207642_10390764 Ga0207642_103907642 93
145 3300025907 Ga0207645_10006858 Ga0207645_100068587 93
146 3300025921 Ga0207652_10753920 Ga0207652_107539201 93
147 3300025922 Ga0207646_10119235 Ga0207646_101192353 93
148 3300025926 Ga0207659_10070657 Ga0207659_100706574 93
149 3300025927 Ga0207687_10455804 Ga0207687_104558042 93
150 3300025932 Ga0207690_10090510 Ga0207690_100905102 93
151 3300025935 Ga0207709_10218683 Ga0207709_102186832 93
152 3300025936 Ga0207670_11124515 Ga0207670_111245152 93
153 3300025940 Ga0207691_10589775 Ga0207691_105897752 93
154 3300025945 Ga0207679_10099569 Ga0207679_100995694 93
155 3300025960 Ga0207651_10146104 Ga0207651_101461043 93
156 3300025981 Ga0207640_10136137 Ga0207640_101361373 93
157 3300025986 Ga0207658_10219745 Ga0207658_102197453 93
158 3300025986 Ga0207658_10471730 Ga0207658_104717302 93
159 3300026075 Ga0207708_10097773 Ga0207708_100977732 93
160 3300026088 Ga0207641_10190676 Ga0207641_101906763 93
161 3300026089 Ga0207648_10034858 Ga0207648_100348582 93
162 3300026089 Ga0207648_10878959 Ga0207648_108789592 93
163 3300026118 Ga0207675_100056601 Ga0207675_1000566013 93
164 3300027364 Ga0209967_1062605 Ga0209967_10626052 93
165 3300028380 Ga0268265_11319233 Ga0268265_113192332 93
166 3300028381 Ga0268264_10115035 Ga0268264_101150352 93
167 3300041408 Ga0439453_0185251 Ga0439453_0185251_65_346 93
168 3300042011 Ga0439454_099419 Ga0439454_099419_218_499 93
169 3300042436 Ga0439435_0072151 Ga0439435_0072151_419_700 93
170 3300044673 Ga0453683_0623424 Ga0453683_0623424_160_441 93
171 3300045051 Ga0451576_2085483 Ga0451576_2085483_92_373 93
172 3300045051 Ga0451576_2247038 Ga0451576_2247038_218_502 93
173 3300048910 Ga0496107_0318703 Ga0496107_0318703_209_493 93
174 3300049574 Ga0501038_0589329 Ga0501038_0589329_287_568 93
175 3300049578 Ga0501042_0874338 Ga0501042_0874338_13_294 93
176 3300050491 nmdc:mga00v17_169127_c1 nmdc:mga00v17_169127_c1_707_991 93
177 3300050507 nmdc:mga05p37_288705_c1 nmdc:mga05p37_288705_c1_44_328 93
178 3300050511 nmdc:mga08y16_1947641_c1 nmdc:mga08y16_1947641_c1_80_364 93
179 3300005366 Ga0070659_100100205 Ga0070659_1001002052 94
180 3300005456 Ga0070678_100505484 Ga0070678_1005054842 94
181 3300005458 Ga0070681_10570750 Ga0070681_105707502 94
182 3300005466 Ga0070685_11021502 Ga0070685_110215021 94
183 3300005530 Ga0070679_100677308 Ga0070679_1006773082 94
184 3300006844 Ga0075428_100010724 Ga0075428_1000107243 94
185 3300006846 Ga0075430_100019061 Ga0075430_1000190612 94
186 3300006847 Ga0075431_100595588 Ga0075431_1005955882 94
187 3300006880 Ga0075429_100031059 Ga0075429_1000310593 94
188 3300009147 Ga0114129_10010375 Ga0114129_100103754 94
189 3300009148 Ga0105243_10214883 Ga0105243_102148833 94
190 3300009176 Ga0105242_10704730 Ga0105242_107047302 94
191 3300025899 Ga0207642_10361294 Ga0207642_103612942 94
192 3300025912 Ga0207707_10755878 Ga0207707_107558781 94
193 3300026116 Ga0207674_11322739 Ga0207674_113227392 94
194 3300032002 Ga0307416_102169404 Ga0307416_1021694042 94
195 3300035172 Ga0373955_0499374 Ga0373955_0499374_142_426 94
196 3300036401 Ga0373937_1732953 Ga0373937_1732953_152_436 94
197 3300042127 Ga0450890_041317 Ga0450890_041317_277_561 94
198 3300042435 Ga0439434_0245718 Ga0439434_0245718_13_297 94
199 3300047444 Ga0495675_0755088 Ga0495675_0755088_119_403 94
200 3300048907 Ga0496104_1271719 Ga0496104_1271719_210_494 94
201 3300048913 Ga0496110_0891015 Ga0496110_0891015_16_300 94
202 3300048917 Ga0496114_1337213 Ga0496114_1337213_146_430 94
203 3300049587 Ga0501071_0189283 Ga0501071_0189283_119_403 94
204 3300049588 Ga0501072_0210167 Ga0501072_0210167_1120_1404 94
205 3300049592 Ga0501076_0347888 Ga0501076_0347888_787_1071 94
206 3300050507 nmdc:mga05p37_39335_c1 nmdc:mga05p37_39335_c1_4867_5151 94
207 3300050508 nmdc:mga09592_1101508_c1 nmdc:mga09592_1101508_c1_195_479 94
208 3300050508 nmdc:mga09592_27877_c1 nmdc:mga09592_27877_c1_1922_2206 94
209 3300050509 nmdc:mga0qj67_566669_c1 nmdc:mga0qj67_566669_c1_371_655 94
210 3300050511 nmdc:mga08y16_634696_c1 nmdc:mga08y16_634696_c1_538_822 94
211 3300050512 nmdc:mga0n895_1424093_c1 nmdc:mga0n895_1424093_c1_299_583 94
212 3300050515 nmdc:mga0a205_1430760_c1 nmdc:mga0a205_1430760_c1_68_352 94
213 3300060353 Ga0501082_0558647 Ga0501082_0558647_107_391 94
214 3300061734 Ga0530510_0247570 Ga0530510_0247570_771_1055 94
215 3300025937 Ga0207669_10949103 Ga0207669_109491032 95
216 3300025941 Ga0207711_11383338 Ga0207711_113833381 95
217 3300042130 Ga0450892_010298 Ga0450892_010298_87_374 95
218 3300042530 Ga0450916_008974 Ga0450916_008974_327_614 95
219 3300049577 Ga0501041_0427339 Ga0501041_0427339_305_592 95
220 3300049591 Ga0501075_0606554 Ga0501075_0606554_266_553 95
221 3300049592 Ga0501076_1557296 Ga0501076_1557296_207_494 95
222 3300005471 Ga0070698_100734923 Ga0070698_1007349232 96
223 3300006844 Ga0075428_100071091 Ga0075428_1000710915 96
224 3300006846 Ga0075430_100017805 Ga0075430_1000178053 96
225 3300006852 Ga0075433_10028333 Ga0075433_100283336 96
226 3300006871 Ga0075434_100002784 Ga0075434_10000278413 96
227 3300006871 Ga0075434_100848793 Ga0075434_1008487932 96
228 3300006880 Ga0075429_100131370 Ga0075429_1001313702 96
229 3300009094 Ga0111539_10000494 Ga0111539_100004948 96
230 3300009147 Ga0114129_10131662 Ga0114129_101316625 96
231 3300009147 Ga0114129_10491555 Ga0114129_104915552 96
232 3300025939 Ga0207665_10708488 Ga0207665_107084881 96
233 3300027907 Ga0207428_10001093 Ga0207428_100010933 96
234 3300042132 Ga0450895_024623 Ga0450895_024623_63_353 96
235 3300050507 nmdc:mga05p37_2244117_c1 nmdc:mga05p37_2244117_c1_58_348 96
236 3300050507 nmdc:mga05p37_62626_c1 nmdc:mga05p37_62626_c1_2417_2707 96
237 3300050508 nmdc:mga09592_848199_c1 nmdc:mga09592_848199_c1_237_527 96
238 3300050509 nmdc:mga0qj67_496222_c1 nmdc:mga0qj67_496222_c1_629_919 96
239 3300050510 nmdc:mga06r32_71740_c1 nmdc:mga06r32_71740_c1_1460_1750 96
240 3300050511 nmdc:mga08y16_53496_c1 nmdc:mga08y16_53496_c1_3695_3985 96
241 3300050512 nmdc:mga0n895_281_c1 nmdc:mga0n895_281_c1_2641_2931 96
242 3300050512 nmdc:mga0n895_73517_c1 nmdc:mga0n895_73517_c1_1823_2113 96
243 3300050513 nmdc:mga0rr50_12769_c1 nmdc:mga0rr50_12769_c1_1821_2111 96
244 3300050515 nmdc:mga0a205_34105_c1 nmdc:mga0a205_34105_c1_2062_2352 96
245 3300050515 nmdc:mga0a205_469_c1 nmdc:mga0a205_469_c1_28517_28807 96
246 3300005331 Ga0070670_100464699 Ga0070670_1004646993 97
247 3300005354 Ga0070675_100253317 Ga0070675_1002533172 97
248 3300005365 Ga0070688_100217497 Ga0070688_1002174972 97
249 3300005365 Ga0070688_100526803 Ga0070688_1005268031 97
250 3300005549 Ga0070704_100466830 Ga0070704_1004668301 97
251 3300005549 Ga0070704_101122451 Ga0070704_1011224512 97
252 3300005617 Ga0068859_100505474 Ga0068859_1005054742 97
253 3300005719 Ga0068861_100429375 Ga0068861_1004293752 97
254 3300005844 Ga0068862_100842579 Ga0068862_1008425792 97
255 3300005844 Ga0068862_101822497 Ga0068862_1018224971 97
256 3300006051 Ga0075364_10087665 Ga0075364_100876652 97
257 3300006931 Ga0097620_100505469 Ga0097620_1005054692 97
258 3300009094 Ga0111539_10031561 Ga0111539_100315612 97
259 3300009094 Ga0111539_10375909 Ga0111539_103759092 97
260 3300009553 Ga0105249_10193204 Ga0105249_101932042 97
261 3300009553 Ga0105249_10536530 Ga0105249_105365302 97
262 3300014326 Ga0157380_11440155 Ga0157380_114401552 97
263 3300014326 Ga0157380_11483884 Ga0157380_114838842 97
264 3300025923 Ga0207681_11180808 Ga0207681_111808082 97
265 3300025925 Ga0207650_10862600 Ga0207650_108626002 97
266 3300025926 Ga0207659_10860743 Ga0207659_108607432 97
267 3300025937 Ga0207669_10577353 Ga0207669_105773532 97
268 3300025961 Ga0207712_10684787 Ga0207712_106847871 97
269 3300025961 Ga0207712_11928752 Ga0207712_119287521 97
270 3300026118 Ga0207675_100152156 Ga0207675_1001521563 97
271 3300028380 Ga0268265_11349863 Ga0268265_113498632 97
272 3300042125 Ga0450923_021563 Ga0450923_021563_469_762 97
273 3300042125 Ga0450923_040523 Ga0450923_040523_572_865 97
274 3300042128 Ga0450897_038392 Ga0450897_038392_20_313 97
275 3300042131 Ga0450894_003529 Ga0450894_003529_1706_1999 97
276 3300042133 Ga0450896_024701 Ga0450896_024701_11_304 97
277 3300042135 Ga0450899_021474 Ga0450899_021474_403_696 97
278 3300042145 Ga0450906_021096 Ga0450906_021096_100_393 97
279 3300042185 Ga0450909_009430 Ga0450909_009430_311_604 97
280 3300049580 Ga0501046_1168724 Ga0501046_1168724_84_377 97
281 3300050511 nmdc:mga08y16_1409804_c1 nmdc:mga08y16_1409804_c1_52_345 97
282 3300005288 Ga0065714_10106583 Ga0065714_101065833 98
283 3300005290 Ga0065712_10025310 Ga0065712_100253103 98
284 3300005293 Ga0065715_10138994 Ga0065715_101389942 98
285 3300005295 Ga0065707_10591340 Ga0065707_105913402 98
286 3300005295 Ga0065707_10707279 Ga0065707_107072792 98
287 3300005295 Ga0065707_11046822 Ga0065707_110468221 98
288 3300005330 Ga0070690_100027789 Ga0070690_1000277892 98
289 3300005331 Ga0070670_100007462 Ga0070670_1000074627 98
290 3300005336 Ga0070680_100111780 Ga0070680_1001117803 98
291 3300005340 Ga0070689_100176159 Ga0070689_1001761592 98
292 3300005340 Ga0070689_102143232 Ga0070689_1021432322 98
293 3300005343 Ga0070687_100023052 Ga0070687_1000230522 98
294 3300005344 Ga0070661_100098211 Ga0070661_1000982112 98
295 3300005345 Ga0070692_10028201 Ga0070692_100282012 98
296 3300005345 Ga0070692_10314983 Ga0070692_103149832 98
297 3300005347 Ga0070668_100763258 Ga0070668_1007632582 98
298 3300005353 Ga0070669_100051895 Ga0070669_1000518953 98
299 3300005353 Ga0070669_101158658 Ga0070669_1011586581 98
300 3300005354 Ga0070675_100016827 Ga0070675_1000168272 98
301 3300005354 Ga0070675_100597189 Ga0070675_1005971891 98
302 3300005355 Ga0070671_100409430 Ga0070671_1004094302 98
303 3300005356 Ga0070674_100168717 Ga0070674_1001687172 98
304 3300005356 Ga0070674_100724991 Ga0070674_1007249912 98
305 3300005356 Ga0070674_101939626 Ga0070674_1019396261 98
306 3300005364 Ga0070673_100011151 Ga0070673_1000111512 98
307 3300005365 Ga0070688_100025746 Ga0070688_1000257462 98
308 3300005365 Ga0070688_100095705 Ga0070688_1000957052 98
309 3300005365 Ga0070688_100112936 Ga0070688_1001129362 98
310 3300005365 Ga0070688_100631478 Ga0070688_1006314782 98
311 3300005434 Ga0070709_10429129 Ga0070709_104291292 98
312 3300005435 Ga0070714_100012428 Ga0070714_1000124283 98
313 3300005436 Ga0070713_100371955 Ga0070713_1003719552 98
314 3300005438 Ga0070701_10019829 Ga0070701_100198294 98
315 3300005438 Ga0070701_10325118 Ga0070701_103251182 98
316 3300005438 Ga0070701_10332515 Ga0070701_103325152 98
317 3300005440 Ga0070705_100383867 Ga0070705_1003838672 98
318 3300005441 Ga0070700_100044430 Ga0070700_1000444302 98
319 3300005441 Ga0070700_100288007 Ga0070700_1002880072 98
320 3300005441 Ga0070700_101225102 Ga0070700_1012251022 98
321 3300005441 Ga0070700_101391223 Ga0070700_1013912232 98
322 3300005444 Ga0070694_100097721 Ga0070694_1000977212 98
323 3300005444 Ga0070694_100420609 Ga0070694_1004206092 98
324 3300005444 Ga0070694_100673681 Ga0070694_1006736811 98
325 3300005444 Ga0070694_100952934 Ga0070694_1009529342 98
326 3300005459 Ga0068867_100203840 Ga0068867_1002038402 98
327 3300005466 Ga0070685_10038256 Ga0070685_100382562 98
328 3300005467 Ga0070706_100059841 Ga0070706_1000598412 98
329 3300005468 Ga0070707_100964469 Ga0070707_1009644691 98
330 3300005471 Ga0070698_100001914 Ga0070698_10000191414 98
331 3300005471 Ga0070698_100008781 Ga0070698_1000087813 98
332 3300005471 Ga0070698_100367484 Ga0070698_1003674842 98
333 3300005471 Ga0070698_101784181 Ga0070698_1017841812 98
334 3300005518 Ga0070699_100005726 Ga0070699_1000057265 98
335 3300005518 Ga0070699_100927027 Ga0070699_1009270272 98
336 3300005536 Ga0070697_100597651 Ga0070697_1005976512 98
337 3300005536 Ga0070697_100864185 Ga0070697_1008641851 98
338 3300005543 Ga0070672_100041632 Ga0070672_1000416322 98
339 3300005544 Ga0070686_100190371 Ga0070686_1001903712 98
340 3300005545 Ga0070695_100980094 Ga0070695_1009800942 98
341 3300005546 Ga0070696_100005487 Ga0070696_1000054875 98
342 3300005549 Ga0070704_100057843 Ga0070704_1000578433 98
343 3300005549 Ga0070704_100736766 Ga0070704_1007367662 98
344 3300005549 Ga0070704_100985458 Ga0070704_1009854582 98
345 3300005564 Ga0070664_100026140 Ga0070664_1000261402 98
346 3300005577 Ga0068857_100417081 Ga0068857_1004170813 98
347 3300005616 Ga0068852_101063555 Ga0068852_1010635552 98
348 3300005617 Ga0068859_100027743 Ga0068859_1000277433 98
349 3300005617 Ga0068859_100379594 Ga0068859_1003795942 98
350 3300005618 Ga0068864_100016044 Ga0068864_1000160443 98
351 3300005840 Ga0068870_10154775 Ga0068870_101547752 98
352 3300005840 Ga0068870_10458441 Ga0068870_104584412 98
353 3300005842 Ga0068858_100991570 Ga0068858_1009915702 98
354 3300005843 Ga0068860_102243004 Ga0068860_1022430042 98
355 3300005844 Ga0068862_100577193 Ga0068862_1005771932 98
356 3300006028 Ga0070717_11791795 Ga0070717_117917952 98
357 3300006058 Ga0075432_10210689 Ga0075432_102106892 98
358 3300006173 Ga0070716_101529411 Ga0070716_1015294111 98
359 3300006175 Ga0070712_100295073 Ga0070712_1002950732 98
360 3300006237 Ga0097621_102434840 Ga0097621_1024348402 98
361 3300006358 Ga0068871_100996510 Ga0068871_1009965102 98
362 3300006844 Ga0075428_100941311 Ga0075428_1009413112 98
363 3300006844 Ga0075428_101148545 Ga0075428_1011485452 98
364 3300006844 Ga0075428_102631023 Ga0075428_1026310232 98
365 3300006846 Ga0075430_100866753 Ga0075430_1008667532 98
366 3300006846 Ga0075430_101263071 Ga0075430_1012630712 98
367 3300006852 Ga0075433_10104570 Ga0075433_101045704 98
368 3300006871 Ga0075434_100419277 Ga0075434_1004192772 98
369 3300006880 Ga0075429_100131023 Ga0075429_1001310232 98
370 3300006880 Ga0075429_100152347 Ga0075429_1001523472 98
371 3300006880 Ga0075429_100310362 Ga0075429_1003103622 98
372 3300006880 Ga0075429_100633518 Ga0075429_1006335181 98
373 3300006931 Ga0097620_100027741 Ga0097620_1000277413 98
374 3300006931 Ga0097620_100379593 Ga0097620_1003795932 98
375 3300006931 Ga0097620_101849231 Ga0097620_1018492312 98
376 3300009092 Ga0105250_10262023 Ga0105250_102620231 98
377 3300009093 Ga0105240_10635565 Ga0105240_106355652 98
378 3300009094 Ga0111539_10031711 Ga0111539_100317117 98
379 3300009094 Ga0111539_10088335 Ga0111539_100883352 98
380 3300009094 Ga0111539_10729901 Ga0111539_107299011 98
381 3300009094 Ga0111539_11166340 Ga0111539_111663402 98
382 3300009094 Ga0111539_11225417 Ga0111539_112254172 98
383 3300009094 Ga0111539_11775921 Ga0111539_117759212 98
384 3300009094 Ga0111539_12396531 Ga0111539_123965311 98
385 3300009094 Ga0111539_12407837 Ga0111539_124078371 98
386 3300009147 Ga0114129_10103495 Ga0114129_101034953 98
387 3300009147 Ga0114129_10448604 Ga0114129_104486042 98
388 3300009147 Ga0114129_10491991 Ga0114129_104919912 98
389 3300009147 Ga0114129_11439070 Ga0114129_114390702 98
390 3300009147 Ga0114129_12031475 Ga0114129_120314752 98
391 3300009148 Ga0105243_12573886 Ga0105243_125738862 98
392 3300009174 Ga0105241_10227160 Ga0105241_102271603 98
393 3300009176 Ga0105242_10027112 Ga0105242_100271122 98
394 3300009177 Ga0105248_10078834 Ga0105248_100788343 98
395 3300009177 Ga0105248_10588409 Ga0105248_105884092 98
396 3300009545 Ga0105237_10789770 Ga0105237_107897702 98
397 3300011119 Ga0105246_10655482 Ga0105246_106554822 98
398 3300011119 Ga0105246_11465365 Ga0105246_114653652 98
399 3300013308 Ga0157375_10122515 Ga0157375_101225152 98
400 3300013308 Ga0157375_10748925 Ga0157375_107489252 98
401 3300013308 Ga0157375_10922867 Ga0157375_109228673 98
402 3300013308 Ga0157375_12004728 Ga0157375_120047282 98
403 3300014325 Ga0163163_10051300 Ga0163163_100513003 98
404 3300014326 Ga0157380_10019060 Ga0157380_100190603 98
405 3300014326 Ga0157380_10244769 Ga0157380_102447693 98
406 3300014326 Ga0157380_11045784 Ga0157380_110457842 98
407 3300014326 Ga0157380_11467623 Ga0157380_114676232 98
408 3300014326 Ga0157380_13327703 Ga0157380_133277032 98
409 3300014745 Ga0157377_10168058 Ga0157377_101680582 98
410 3300014745 Ga0157377_10409306 Ga0157377_104093062 98
411 3300014968 Ga0157379_10018789 Ga0157379_100187897 98
412 3300014969 Ga0157376_10102217 Ga0157376_101022172 98
413 3300025893 Ga0207682_10141899 Ga0207682_101418991 98
414 3300025903 Ga0207680_10175344 Ga0207680_101753442 98
415 3300025903 Ga0207680_11198531 Ga0207680_111985312 98
416 3300025906 Ga0207699_10369831 Ga0207699_103698312 98
417 3300025907 Ga0207645_10139529 Ga0207645_101395293 98
418 3300025908 Ga0207643_10468671 Ga0207643_104686712 98
419 3300025910 Ga0207684_10050119 Ga0207684_100501194 98
420 3300025915 Ga0207693_10404735 Ga0207693_104047352 98
421 3300025917 Ga0207660_10126900 Ga0207660_101269002 98
422 3300025918 Ga0207662_10036889 Ga0207662_100368895 98
423 3300025918 Ga0207662_10079506 Ga0207662_100795062 98
424 3300025920 Ga0207649_10074085 Ga0207649_100740852 98
425 3300025922 Ga0207646_10683837 Ga0207646_106838372 98
426 3300025923 Ga0207681_10242915 Ga0207681_102429152 98
427 3300025925 Ga0207650_10212934 Ga0207650_102129342 98
428 3300025926 Ga0207659_10245933 Ga0207659_102459332 98
429 3300025926 Ga0207659_11157736 Ga0207659_111577361 98
430 3300025928 Ga0207700_10407357 Ga0207700_104073572 98
431 3300025929 Ga0207664_10019126 Ga0207664_100191265 98
432 3300025933 Ga0207706_10255567 Ga0207706_102555672 98
433 3300025936 Ga0207670_10856524 Ga0207670_108565242 98
434 3300025936 Ga0207670_10882285 Ga0207670_108822852 98
435 3300025937 Ga0207669_10163951 Ga0207669_101639512 98
436 3300025937 Ga0207669_10513240 Ga0207669_105132402 98
437 3300025960 Ga0207651_10113967 Ga0207651_101139673 98
438 3300025972 Ga0207668_10388884 Ga0207668_103888842 98
439 3300026023 Ga0207677_11892456 Ga0207677_118924561 98
440 3300026023 Ga0207677_11922384 Ga0207677_119223842 98
441 3300026035 Ga0207703_11466846 Ga0207703_114668462 98
442 3300026041 Ga0207639_10948082 Ga0207639_109480821 98
443 3300026067 Ga0207678_11021343 Ga0207678_110213431 98
444 3300026075 Ga0207708_10035538 Ga0207708_100355382 98
445 3300026075 Ga0207708_10050949 Ga0207708_100509493 98
446 3300026075 Ga0207708_10383685 Ga0207708_103836851 98
447 3300026075 Ga0207708_11271275 Ga0207708_112712752 98
448 3300026088 Ga0207641_10491030 Ga0207641_104910303 98
449 3300026088 Ga0207641_10689032 Ga0207641_106890322 98
450 3300026089 Ga0207648_10138059 Ga0207648_101380593 98
451 3300026095 Ga0207676_10057882 Ga0207676_100578822 98
452 3300026095 Ga0207676_10764784 Ga0207676_107647842 98
453 3300026116 Ga0207674_10284441 Ga0207674_102844411 98
454 3300026118 Ga0207675_100224347 Ga0207675_1002243473 98
455 3300026118 Ga0207675_100927920 Ga0207675_1009279202 98
456 3300027360 Ga0209969_1023274 Ga0209969_10232741 98
457 3300027876 Ga0209974_10469283 Ga0209974_104692832 98
458 3300027907 Ga0207428_10055858 Ga0207428_100558582 98
459 3300027907 Ga0207428_10071304 Ga0207428_100713042 98
460 3300027907 Ga0207428_10384192 Ga0207428_103841922 98
461 3300027907 Ga0207428_11004282 Ga0207428_110042822 98
462 3300028381 Ga0268264_10594671 Ga0268264_105946712 98
463 3300028381 Ga0268264_12631312 Ga0268264_126313122 98
464 3300031548 Ga0307408_100023632 Ga0307408_1000236322 98
465 3300031548 Ga0307408_100261771 Ga0307408_1002617712 98
466 3300031731 Ga0307405_10006893 Ga0307405_100068933 98
467 3300031824 Ga0307413_10239745 Ga0307413_102397453 98
468 3300031824 Ga0307413_10331048 Ga0307413_103310482 98
469 3300031824 Ga0307413_10382255 Ga0307413_103822552 98
470 3300031824 Ga0307413_10417206 Ga0307413_104172062 98
471 3300031824 Ga0307413_10626788 Ga0307413_106267882 98
472 3300031852 Ga0307410_10002658 Ga0307410_100026587 98
473 3300031852 Ga0307410_10042686 Ga0307410_100426864 98
474 3300031852 Ga0307410_10508726 Ga0307410_105087262 98
475 3300031852 Ga0307410_10782691 Ga0307410_107826912 98
476 3300031901 Ga0307406_10030254 Ga0307406_100302544 98
477 3300031901 Ga0307406_10098326 Ga0307406_100983264 98
478 3300031903 Ga0307407_10051437 Ga0307407_100514372 98
479 3300031903 Ga0307407_10090709 Ga0307407_100907092 98
480 3300031903 Ga0307407_10331626 Ga0307407_103316262 98
481 3300031903 Ga0307407_10411242 Ga0307407_104112422 98
482 3300031911 Ga0307412_10002780 Ga0307412_100027804 98
483 3300031911 Ga0307412_10281513 Ga0307412_102815132 98
484 3300031911 Ga0307412_10367850 Ga0307412_103678502 98
485 3300031911 Ga0307412_10941510 Ga0307412_109415102 98
486 3300031995 Ga0307409_100026062 Ga0307409_1000260622 98
487 3300031995 Ga0307409_100061598 Ga0307409_1000615982 98
488 3300031995 Ga0307409_100067913 Ga0307409_1000679132 98
489 3300031995 Ga0307409_100110777 Ga0307409_1001107774 98
490 3300031995 Ga0307409_100188142 Ga0307409_1001881423 98
491 3300032002 Ga0307416_100064487 Ga0307416_1000644874 98
492 3300032002 Ga0307416_100084872 Ga0307416_1000848722 98
493 3300032002 Ga0307416_100163096 Ga0307416_1001630963 98
494 3300032002 Ga0307416_100634802 Ga0307416_1006348022 98
495 3300032002 Ga0307416_100812870 Ga0307416_1008128702 98
496 3300032004 Ga0307414_10188975 Ga0307414_101889751 98
497 3300032004 Ga0307414_10235540 Ga0307414_102355402 98
498 3300032004 Ga0307414_10400370 Ga0307414_104003702 98
499 3300032004 Ga0307414_11165783 Ga0307414_111657832 98
500 3300032005 Ga0307411_10111433 Ga0307411_101114332 98
501 3300032005 Ga0307411_10219441 Ga0307411_102194412 98
502 3300032005 Ga0307411_10301332 Ga0307411_103013322 98
503 3300032005 Ga0307411_10329942 Ga0307411_103299422 98
504 3300032005 Ga0307411_10469203 Ga0307411_104692032 98
505 3300032005 Ga0307411_11645149 Ga0307411_116451492 98
506 3300032126 Ga0307415_100043485 Ga0307415_1000434854 98
507 3300032126 Ga0307415_100179480 Ga0307415_1001794803 98
508 3300032126 Ga0307415_100347555 Ga0307415_1003475552 98
509 3300032126 Ga0307415_101304893 Ga0307415_1013048932 98
510 3300035121 Ga0373960_0190300 Ga0373960_0190300_14_310 98
511 3300041459 Ga0451800_0575700 Ga0451800_0575700_432_728 98
512 3300041486 Ga0451807_0526429 Ga0451807_0526429_326_622 98
513 3300041486 Ga0451807_0793962 Ga0451807_0793962_282_578 98
514 3300041496 Ga0451839_0563425 Ga0451839_0563425_193_489 98
515 3300041505 Ga0451849_1226666 Ga0451849_1226666_175_471 98
516 3300041512 Ga0451853_2084722 Ga0451853_2084722_297_593 98
517 3300041512 Ga0451853_2545316 Ga0451853_2545316_796_1092 98
518 3300041512 Ga0451853_3745927 Ga0451853_3745927_39_335 98
519 3300041999 Ga0439433_0083770 Ga0439433_0083770_38_334 98
520 3300042125 Ga0450923_018237 Ga0450923_018237_866_1162 98
521 3300042439 Ga0439464_0033332 Ga0439464_0033332_836_1132 98
522 3300042461 Ga0439460_0181914 Ga0439460_0181914_122_418 98
523 3300042531 Ga0450918_034014 Ga0450918_034014_487_783 98
524 3300044901 Ga0466960_0876213 Ga0466960_0876213_116_424 98
525 3300045976 Ga0466967_1607584 Ga0466967_1607584_315_611 98
526 3300046491 Ga0495584_0031669 Ga0495584_0031669_408_704 98
527 3300046520 Ga0495637_0207938 Ga0495637_0207938_74_370 98
528 3300046522 Ga0495643_0001941 Ga0495643_0001941_8957_9253 98
529 3300046525 Ga0495663_0134012 Ga0495663_0134012_478_774 98
530 3300046537 Ga0495598_0009390 Ga0495598_0009390_127_423 98
531 3300046537 Ga0495598_0015886 Ga0495598_0015886_1212_1508 98
532 3300046537 Ga0495598_0134260 Ga0495598_0134260_18_314 98
533 3300046538 Ga0495609_0079851 Ga0495609_0079851_463_759 98
534 3300046539 Ga0495621_0094454 Ga0495621_0094454_337_633 98
535 3300046539 Ga0495621_0167157 Ga0495621_0167157_79_375 98
536 3300046542 Ga0495597_0351223 Ga0495597_0351223_94_390 98
537 3300046615 Ga0495656_0107445 Ga0495656_0107445_812_1108 98
538 3300046664 Ga0495659_0102391 Ga0495659_0102391_723_1019 98
539 3300046681 Ga0495647_0003465 Ga0495647_0003465_1319_1618 98
540 3300046684 Ga0495669_0114625 Ga0495669_0114625_844_1140 98
541 3300046684 Ga0495669_0338223 Ga0495669_0338223_45_341 98
542 3300047447 Ga0495685_080951 Ga0495685_080951_100_396 98
543 3300048090 Ga0495615_0145672 Ga0495615_0145672_92_388 98
544 3300048908 Ga0496105_0343643 Ga0496105_0343643_71_370 98
545 3300048917 Ga0496114_0053394 Ga0496114_0053394_1670_1969 98
546 3300049572 Ga0501036_0273501 Ga0501036_0273501_590_886 98
547 3300049572 Ga0501036_0591953 Ga0501036_0591953_55_351 98
548 3300049572 Ga0501036_0652360 Ga0501036_0652360_471_767 98
549 3300049572 Ga0501036_1015335 Ga0501036_1015335_311_607 98
550 3300049574 Ga0501038_0834415 Ga0501038_0834415_201_497 98
551 3300049575 Ga0501039_0258539 Ga0501039_0258539_1054_1350 98
552 3300049576 Ga0501040_0286680 Ga0501040_0286680_764_1060 98
553 3300049576 Ga0501040_1230390 Ga0501040_1230390_229_525 98
554 3300049577 Ga0501041_0235132 Ga0501041_0235132_140_436 98
555 3300049577 Ga0501041_0530679 Ga0501041_0530679_226_522 98
556 3300049578 Ga0501042_0075928 Ga0501042_0075928_2003_2299 98
557 3300049578 Ga0501042_0085131 Ga0501042_0085131_1299_1595 98
558 3300049578 Ga0501042_0210948 Ga0501042_0210948_891_1187 98
559 3300049578 Ga0501042_1258217 Ga0501042_1258217_101_397 98
560 3300049578 Ga0501042_1373781 Ga0501042_1373781_192_488 98
561 3300049580 Ga0501046_0610915 Ga0501046_0610915_296_592 98
562 3300049583 Ga0501067_0544826 Ga0501067_0544826_268_567 98
563 3300049584 Ga0501068_0075221 Ga0501068_0075221_1269_1565 98
564 3300049587 Ga0501071_0159629 Ga0501071_0159629_334_630 98
565 3300049587 Ga0501071_0239367 Ga0501071_0239367_35_331 98
566 3300049587 Ga0501071_0435316 Ga0501071_0435316_513_809 98
567 3300049587 Ga0501071_0672350 Ga0501071_0672350_61_357 98
568 3300049587 Ga0501071_1099832 Ga0501071_1099832_190_486 98
569 3300049588 Ga0501072_0109368 Ga0501072_0109368_59_355 98
570 3300049590 Ga0501074_0194780 Ga0501074_0194780_330_626 98
571 3300049590 Ga0501074_0314169 Ga0501074_0314169_622_918 98
572 3300049591 Ga0501075_0121589 Ga0501075_0121589_1188_1484 98
573 3300049592 Ga0501076_0085979 Ga0501076_0085979_177_473 98
574 3300049592 Ga0501076_0159376 Ga0501076_0159376_803_1099 98
575 3300049592 Ga0501076_0185119 Ga0501076_0185119_535_831 98
576 3300049592 Ga0501076_0546117 Ga0501076_0546117_452_748 98
577 3300049593 Ga0501077_0253061 Ga0501077_0253061_731_1027 98
578 3300049593 Ga0501077_0488621 Ga0501077_0488621_97_393 98
579 3300049593 Ga0501077_0835607 Ga0501077_0835607_56_352 98
580 3300049658 Ga0501211_043925 Ga0501211_043925_40_336 98
581 3300049742 Ga0501080_0393028 Ga0501080_0393028_347_643 98
582 3300049743 Ga0501081_0354441 Ga0501081_0354441_31_327 98
583 3300049744 Ga0501083_1035306 Ga0501083_1035306_120_416 98
584 3300049824 Ga0501045_0091558 Ga0501045_0091558_726_1022 98
585 3300050491 nmdc:mga00v17_373533_c1 nmdc:mga00v17_373533_c1_185_481 98
586 3300050493 nmdc:mga0k408_601469_c1 nmdc:mga0k408_601469_c1_99_395 98
587 3300050493 nmdc:mga0k408_842942_c1 nmdc:mga0k408_842942_c1_94_390 98
588 3300050494 nmdc:mga06z11_640735_c1 nmdc:mga06z11_640735_c1_80_376 98
589 3300050507 nmdc:mga05p37_554256_c1 nmdc:mga05p37_554256_c1_234_530 98
590 3300050507 nmdc:mga05p37_59208_c1 nmdc:mga05p37_59208_c1_3153_3449 98
591 3300050507 nmdc:mga05p37_979152_c1 nmdc:mga05p37_979152_c1_152_451 98
592 3300050508 nmdc:mga09592_1053806_c1 nmdc:mga09592_1053806_c1_353_652 98
593 3300050508 nmdc:mga09592_1521423_c1 nmdc:mga09592_1521423_c1_56_352 98
594 3300050508 nmdc:mga09592_553605_c1 nmdc:mga09592_553605_c1_642_938 98
595 3300050509 nmdc:mga0qj67_915933_c1 nmdc:mga0qj67_915933_c1_152_451 98
596 3300050511 nmdc:mga08y16_1015049_c1 nmdc:mga08y16_1015049_c1_63_359 98
597 3300050511 nmdc:mga08y16_1141985_c1 nmdc:mga08y16_1141985_c1_396_692 98
598 3300050511 nmdc:mga08y16_19906_c1 nmdc:mga08y16_19906_c1_999_1295 98
599 3300050511 nmdc:mga08y16_67967_c1 nmdc:mga08y16_67967_c1_1945_2241 98
600 3300050511 nmdc:mga08y16_87982_c1 nmdc:mga08y16_87982_c1_125_421 98
601 3300050512 nmdc:mga0n895_1576179_c1 nmdc:mga0n895_1576179_c1_249_545 98
602 3300050512 nmdc:mga0n895_31613_c1 nmdc:mga0n895_31613_c1_2028_2327 98
603 3300050513 nmdc:mga0rr50_597653_c1 nmdc:mga0rr50_597653_c1_161_460 98
604 3300050513 nmdc:mga0rr50_99442_c1 nmdc:mga0rr50_99442_c1_1929_2225 98
605 3300050514 nmdc:mga08x19_15948_c1 nmdc:mga08x19_15948_c1_3347_3646 98
606 3300050515 nmdc:mga0a205_249539_c1 nmdc:mga0a205_249539_c1_444_740 98
607 3300050515 nmdc:mga0a205_509325_c1 nmdc:mga0a205_509325_c1_262_561 98
608 3300050515 nmdc:mga0a205_56533_c1 nmdc:mga0a205_56533_c1_1881_2180 98
609 3300054114 Ga0501084_0087693 Ga0501084_0087693_2288_2584 98
610 3300054114 Ga0501084_0516083 Ga0501084_0516083_344_640 98
611 3300054114 Ga0501084_1642936 Ga0501084_1642936_215_511 98
612 3300059421 Ga0590071_056342 Ga0590071_056342_45_341 98
613 3300059426 Ga0590077_030411 Ga0590077_030411_158_454 98
614 3300060353 Ga0501082_0164047 Ga0501082_0164047_565_861 98
615 3300060353 Ga0501082_0198840 Ga0501082_0198840_417_713 98
616 3300060353 Ga0501082_0342075 Ga0501082_0342075_62_358 98
617 3300060353 Ga0501082_1850452 Ga0501082_1850452_161_457 98
618 3300061734 Ga0530510_0332525 Ga0530510_0332525_405_701 98
619 3300061734 Ga0530510_0439828 Ga0530510_0439828_287_583 98
620 3300061734 Ga0530510_0564265 Ga0530510_0564265_199_495 98
621 3300003203 JGI25406J46586_10083124 JGI25406J46586_100831241 99
622 3300003203 JGI25406J46586_10092444 JGI25406J46586_100924441 99
623 3300003203 JGI25406J46586_10213409 JGI25406J46586_102134091 99
624 3300005290 Ga0065712_10153694 Ga0065712_101536943 99
625 3300005293 Ga0065715_10149341 Ga0065715_101493412 99
626 3300005295 Ga0065707_10170689 Ga0065707_101706892 99
627 3300005295 Ga0065707_11136378 Ga0065707_111363782 99
628 3300005329 Ga0070683_100007552 Ga0070683_1000075526 99
629 3300005330 Ga0070690_100149010 Ga0070690_1001490101 99
630 3300005330 Ga0070690_100170683 Ga0070690_1001706832 99
631 3300005330 Ga0070690_100257315 Ga0070690_1002573152 99
632 3300005331 Ga0070670_100004413 Ga0070670_1000044137 99
633 3300005334 Ga0068869_100058451 Ga0068869_1000584513 99
634 3300005334 Ga0068869_100084729 Ga0068869_1000847292 99
635 3300005334 Ga0068869_100823931 Ga0068869_1008239312 99
636 3300005335 Ga0070666_10063575 Ga0070666_100635752 99
637 3300005335 Ga0070666_10859068 Ga0070666_108590682 99
638 3300005336 Ga0070680_100778601 Ga0070680_1007786012 99
639 3300005336 Ga0070680_101163650 Ga0070680_1011636501 99
640 3300005337 Ga0070682_100493593 Ga0070682_1004935932 99
641 3300005337 Ga0070682_101400767 Ga0070682_1014007672 99
642 3300005337 Ga0070682_101904942 Ga0070682_1019049421 99
643 3300005338 Ga0068868_100315931 Ga0068868_1003159312 99
644 3300005340 Ga0070689_100030548 Ga0070689_1000305483 99
645 3300005340 Ga0070689_100256727 Ga0070689_1002567271 99
646 3300005340 Ga0070689_100275519 Ga0070689_1002755192 99
647 3300005340 Ga0070689_100725728 Ga0070689_1007257282 99
648 3300005341 Ga0070691_10182267 Ga0070691_101822673 99
649 3300005343 Ga0070687_100008463 Ga0070687_1000084633 99
650 3300005344 Ga0070661_100012520 Ga0070661_1000125203 99
651 3300005347 Ga0070668_100269987 Ga0070668_1002699872 99
652 3300005347 Ga0070668_100636083 Ga0070668_1006360832 99
653 3300005353 Ga0070669_100102174 Ga0070669_1001021742 99
654 3300005353 Ga0070669_100156483 Ga0070669_1001564833 99
655 3300005353 Ga0070669_100336184 Ga0070669_1003361843 99
656 3300005353 Ga0070669_100960175 Ga0070669_1009601752 99
657 3300005354 Ga0070675_100179773 Ga0070675_1001797733 99
658 3300005354 Ga0070675_100702999 Ga0070675_1007029993 99
659 3300005354 Ga0070675_102161713 Ga0070675_1021617131 99
660 3300005355 Ga0070671_100037051 Ga0070671_1000370513 99
661 3300005355 Ga0070671_101165111 Ga0070671_1011651111 99
662 3300005364 Ga0070673_100016210 Ga0070673_1000162105 99
663 3300005365 Ga0070688_100428286 Ga0070688_1004282862 99
664 3300005365 Ga0070688_100854438 Ga0070688_1008544382 99
665 3300005365 Ga0070688_101624904 Ga0070688_1016249041 99
666 3300005366 Ga0070659_100976545 Ga0070659_1009765452 99
667 3300005367 Ga0070667_100102344 Ga0070667_1001023443 99
668 3300005367 Ga0070667_100105118 Ga0070667_1001051182 99
669 3300005367 Ga0070667_102254858 Ga0070667_1022548581 99
670 3300005438 Ga0070701_10043041 Ga0070701_100430411 99
671 3300005438 Ga0070701_10890246 Ga0070701_108902461 99
672 3300005441 Ga0070700_100111792 Ga0070700_1001117922 99
673 3300005441 Ga0070700_101766357 Ga0070700_1017663571 99
674 3300005455 Ga0070663_100219852 Ga0070663_1002198522 99
675 3300005456 Ga0070678_100676007 Ga0070678_1006760072 99
676 3300005457 Ga0070662_101702549 Ga0070662_1017025491 99
677 3300005459 Ga0068867_100286403 Ga0068867_1002864033 99
678 3300005459 Ga0068867_100470492 Ga0068867_1004704922 99
679 3300005459 Ga0068867_100648207 Ga0068867_1006482072 99
680 3300005466 Ga0070685_10263185 Ga0070685_102631851 99
681 3300005466 Ga0070685_10267026 Ga0070685_102670262 99
682 3300005466 Ga0070685_11391578 Ga0070685_113915781 99
683 3300005467 Ga0070706_101859534 Ga0070706_1018595341 99
684 3300005468 Ga0070707_101543588 Ga0070707_1015435881 99
685 3300005518 Ga0070699_100021870 Ga0070699_1000218703 99
686 3300005535 Ga0070684_100005231 Ga0070684_1000052313 99
687 3300005543 Ga0070672_100471306 Ga0070672_1004713062 99
688 3300005544 Ga0070686_100031148 Ga0070686_1000311483 99
689 3300005544 Ga0070686_100611433 Ga0070686_1006114332 99
690 3300005545 Ga0070695_100496908 Ga0070695_1004969083 99
691 3300005546 Ga0070696_100050068 Ga0070696_1000500682 99
692 3300005547 Ga0070693_100185296 Ga0070693_1001852963 99
693 3300005547 Ga0070693_100469191 Ga0070693_1004691912 99
694 3300005547 Ga0070693_100699894 Ga0070693_1006998941 99
695 3300005548 Ga0070665_101164879 Ga0070665_1011648792 99
696 3300005549 Ga0070704_100739832 Ga0070704_1007398321 99
697 3300005564 Ga0070664_100001608 Ga0070664_1000016089 99
698 3300005564 Ga0070664_100257859 Ga0070664_1002578593 99
699 3300005577 Ga0068857_100021160 Ga0068857_1000211603 99
700 3300005615 Ga0070702_100152589 Ga0070702_1001525893 99
701 3300005615 Ga0070702_100677648 Ga0070702_1006776482 99
702 3300005617 Ga0068859_100197425 Ga0068859_1001974252 99
703 3300005617 Ga0068859_100244855 Ga0068859_1002448551 99
704 3300005617 Ga0068859_100410868 Ga0068859_1004108682 99
705 3300005617 Ga0068859_102508717 Ga0068859_1025087171 99
706 3300005618 Ga0068864_101179039 Ga0068864_1011790391 99
707 3300005618 Ga0068864_102118915 Ga0068864_1021189151 99
708 3300005718 Ga0068866_10108018 Ga0068866_101080183 99
709 3300005718 Ga0068866_11236171 Ga0068866_112361711 99
710 3300005719 Ga0068861_100030884 Ga0068861_1000308844 99
711 3300005719 Ga0068861_101097131 Ga0068861_1010971312 99
712 3300005834 Ga0068851_10041209 Ga0068851_100412092 99
713 3300005841 Ga0068863_100429611 Ga0068863_1004296113 99
714 3300005841 Ga0068863_101602832 Ga0068863_1016028322 99
715 3300005842 Ga0068858_100221343 Ga0068858_1002213433 99
716 3300005842 Ga0068858_100298054 Ga0068858_1002980542 99
717 3300005842 Ga0068858_101841938 Ga0068858_1018419382 99
718 3300005843 Ga0068860_100288994 Ga0068860_1002889942 99
719 3300005843 Ga0068860_100382474 Ga0068860_1003824743 99
720 3300005843 Ga0068860_101142187 Ga0068860_1011421871 99
721 3300005844 Ga0068862_100479185 Ga0068862_1004791851 99
722 3300005844 Ga0068862_100772970 Ga0068862_1007729702 99
723 3300005844 Ga0068862_100966043 Ga0068862_1009660432 99
724 3300005844 Ga0068862_102209706 Ga0068862_1022097062 99
725 3300005985 Ga0081539_10001702 Ga0081539_1000170225 99
726 3300005985 Ga0081539_10038590 Ga0081539_100385902 99
727 3300005985 Ga0081539_10040663 Ga0081539_100406632 99
728 3300005985 Ga0081539_10075209 Ga0081539_100752092 99
729 3300006038 Ga0075365_10022822 Ga0075365_100228223 99
730 3300006042 Ga0075368_10107148 Ga0075368_101071482 99
731 3300006048 Ga0075363_100266427 Ga0075363_1002664272 99
732 3300006051 Ga0075364_10021212 Ga0075364_100212123 99
733 3300006058 Ga0075432_10474815 Ga0075432_104748152 99
734 3300006177 Ga0075362_10006980 Ga0075362_100069804 99
735 3300006178 Ga0075367_10055938 Ga0075367_100559381 99
736 3300006186 Ga0075369_10335085 Ga0075369_103350852 99
737 3300006195 Ga0075366_10009667 Ga0075366_100096672 99
738 3300006237 Ga0097621_100183506 Ga0097621_1001835063 99
739 3300006353 Ga0075370_10033251 Ga0075370_100332512 99
740 3300006358 Ga0068871_100064962 Ga0068871_1000649622 99
741 3300006358 Ga0068871_100927422 Ga0068871_1009274222 99
742 3300006358 Ga0068871_101599655 Ga0068871_1015996552 99
743 3300006358 Ga0068871_101686193 Ga0068871_1016861932 99
744 3300006844 Ga0075428_100132288 Ga0075428_1001322882 99
745 3300006844 Ga0075428_100336039 Ga0075428_1003360392 99
746 3300006846 Ga0075430_100061518 Ga0075430_1000615182 99
747 3300006846 Ga0075430_100202398 Ga0075430_1002023982 99
748 3300006846 Ga0075430_100382920 Ga0075430_1003829202 99
749 3300006846 Ga0075430_100708444 Ga0075430_1007084442 99
750 3300006847 Ga0075431_101231372 Ga0075431_1012313721 99
751 3300006847 Ga0075431_101264756 Ga0075431_1012647562 99
752 3300006852 Ga0075433_10500118 Ga0075433_105001182 99
753 3300006852 Ga0075433_10895592 Ga0075433_108955921 99
754 3300006871 Ga0075434_100027981 Ga0075434_1000279813 99
755 3300006871 Ga0075434_100295964 Ga0075434_1002959642 99
756 3300006880 Ga0075429_100031024 Ga0075429_1000310243 99
757 3300006880 Ga0075429_100235486 Ga0075429_1002354863 99
758 3300006880 Ga0075429_101413257 Ga0075429_1014132571 99
759 3300006881 Ga0068865_100121111 Ga0068865_1001211111 99
760 3300006881 Ga0068865_100415698 Ga0068865_1004156982 99
761 3300006881 Ga0068865_101291166 Ga0068865_1012911662 99
762 3300006931 Ga0097620_100197407 Ga0097620_1001974072 99
763 3300006931 Ga0097620_100244853 Ga0097620_1002448531 99
764 3300006931 Ga0097620_100410879 Ga0097620_1004108792 99
765 3300006931 Ga0097620_102508684 Ga0097620_1025086841 99
766 3300007076 Ga0075435_101178059 Ga0075435_1011780592 99
767 3300009094 Ga0111539_10000981 Ga0111539_1000098120 99
768 3300009094 Ga0111539_10004818 Ga0111539_1000481816 99
769 3300009094 Ga0111539_10009303 Ga0111539_100093034 99
770 3300009094 Ga0111539_10211131 Ga0111539_102111312 99
771 3300009094 Ga0111539_10718218 Ga0111539_107182182 99
772 3300009098 Ga0105245_10362090 Ga0105245_103620902 99
773 3300009098 Ga0105245_11009328 Ga0105245_110093281 99
774 3300009098 Ga0105245_11092064 Ga0105245_110920642 99
775 3300009147 Ga0114129_10000410 Ga0114129_100004107 99
776 3300009147 Ga0114129_10021226 Ga0114129_100212262 99
777 3300009147 Ga0114129_11290882 Ga0114129_112908822 99
778 3300009147 Ga0114129_12975644 Ga0114129_129756442 99
779 3300009148 Ga0105243_10499044 Ga0105243_104990442 99
780 3300009148 Ga0105243_10540476 Ga0105243_105404761 99
781 3300009148 Ga0105243_11355771 Ga0105243_113557712 99
782 3300009174 Ga0105241_11718821 Ga0105241_117188212 99
783 3300009176 Ga0105242_10148153 Ga0105242_101481532 99
784 3300009176 Ga0105242_11429965 Ga0105242_114299652 99
785 3300009176 Ga0105242_12066370 Ga0105242_120663702 99
786 3300009176 Ga0105242_12556086 Ga0105242_125560861 99
787 3300009176 Ga0105242_12829305 Ga0105242_128293052 99
788 3300009177 Ga0105248_10056208 Ga0105248_100562085 99
789 3300009177 Ga0105248_10185719 Ga0105248_101857192 99
790 3300009177 Ga0105248_10200924 Ga0105248_102009242 99
791 3300009177 Ga0105248_10268822 Ga0105248_102688223 99
792 3300009553 Ga0105249_10288108 Ga0105249_102881083 99
793 3300009553 Ga0105249_10334000 Ga0105249_103340002 99
794 3300009553 Ga0105249_11500721 Ga0105249_115007212 99
795 3300009553 Ga0105249_12119870 Ga0105249_121198701 99
796 3300009553 Ga0105249_12177084 Ga0105249_121770841 99
797 3300010375 Ga0105239_13254207 Ga0105239_132542072 99
798 3300011119 Ga0105246_10072654 Ga0105246_100726543 99
799 3300013104 Ga0157370_10473771 Ga0157370_104737712 99
800 3300013296 Ga0157374_10091418 Ga0157374_100914182 99
801 3300013296 Ga0157374_10392762 Ga0157374_103927622 99
802 3300013297 Ga0157378_10701691 Ga0157378_107016911 99
803 3300013297 Ga0157378_10816167 Ga0157378_108161672 99
804 3300013297 Ga0157378_11217201 Ga0157378_112172012 99
805 3300013297 Ga0157378_11424839 Ga0157378_114248392 99
806 3300013306 Ga0163162_10081557 Ga0163162_100815573 99
807 3300013306 Ga0163162_10916219 Ga0163162_109162192 99
808 3300013306 Ga0163162_12960292 Ga0163162_129602922 99
809 3300014325 Ga0163163_10051186 Ga0163163_100511862 99
810 3300014326 Ga0157380_10377514 Ga0157380_103775143 99
811 3300014745 Ga0157377_10182204 Ga0157377_101822042 99
812 3300014968 Ga0157379_10362481 Ga0157379_103624811 99
813 3300014968 Ga0157379_10961823 Ga0157379_109618232 99
814 3300014969 Ga0157376_10947980 Ga0157376_109479802 99
815 3300014969 Ga0157376_11326572 Ga0157376_113265722 99
816 3300017792 Ga0163161_10344775 Ga0163161_103447752 99
817 3300017792 Ga0163161_10598561 Ga0163161_105985612 99
818 3300025315 Ga0207697_10028355 Ga0207697_100283553 99
819 3300025315 Ga0207697_10104649 Ga0207697_101046492 99
820 3300025899 Ga0207642_10564474 Ga0207642_105644741 99
821 3300025900 Ga0207710_10728913 Ga0207710_107289132 99
822 3300025901 Ga0207688_10641101 Ga0207688_106411011 99
823 3300025903 Ga0207680_10012973 Ga0207680_100129733 99
824 3300025903 Ga0207680_10802893 Ga0207680_108028932 99
825 3300025904 Ga0207647_10353135 Ga0207647_103531352 99
826 3300025907 Ga0207645_10092758 Ga0207645_100927583 99
827 3300025908 Ga0207643_10160496 Ga0207643_101604962 99
828 3300025918 Ga0207662_10000724 Ga0207662_100007242 99
829 3300025920 Ga0207649_10014442 Ga0207649_100144421 99
830 3300025923 Ga0207681_10170620 Ga0207681_101706203 99
831 3300025923 Ga0207681_10849591 Ga0207681_108495912 99
832 3300025925 Ga0207650_10005949 Ga0207650_100059496 99
833 3300025926 Ga0207659_10218667 Ga0207659_102186671 99
834 3300025927 Ga0207687_10424821 Ga0207687_104248212 99
835 3300025927 Ga0207687_10735457 Ga0207687_107354572 99
836 3300025931 Ga0207644_10025621 Ga0207644_100256214 99
837 3300025931 Ga0207644_11804282 Ga0207644_118042822 99
838 3300025933 Ga0207706_11009822 Ga0207706_110098221 99
839 3300025934 Ga0207686_10586134 Ga0207686_105861342 99
840 3300025934 Ga0207686_10829244 Ga0207686_108292441 99
841 3300025935 Ga0207709_11603613 Ga0207709_116036131 99
842 3300025936 Ga0207670_10009947 Ga0207670_100099473 99
843 3300025936 Ga0207670_10055982 Ga0207670_100559822 99
844 3300025936 Ga0207670_10154626 Ga0207670_101546262 99
845 3300025936 Ga0207670_10213452 Ga0207670_102134522 99
846 3300025938 Ga0207704_10293654 Ga0207704_102936542 99
847 3300025940 Ga0207691_10035117 Ga0207691_100351173 99
848 3300025941 Ga0207711_10059255 Ga0207711_100592554 99
849 3300025941 Ga0207711_10231968 Ga0207711_102319682 99
850 3300025941 Ga0207711_10449608 Ga0207711_104496082 99
851 3300025941 Ga0207711_11147549 Ga0207711_111475491 99
852 3300025942 Ga0207689_10006797 Ga0207689_100067972 99
853 3300025942 Ga0207689_10089587 Ga0207689_100895872 99
854 3300025942 Ga0207689_10155386 Ga0207689_101553863 99
855 3300025942 Ga0207689_10276070 Ga0207689_102760702 99
856 3300025944 Ga0207661_10003359 Ga0207661_100033593 99
857 3300025945 Ga0207679_10003327 Ga0207679_100033273 99
858 3300025945 Ga0207679_10743898 Ga0207679_107438982 99
859 3300025945 Ga0207679_10775176 Ga0207679_107751762 99
860 3300025960 Ga0207651_10063293 Ga0207651_100632933 99
861 3300025961 Ga0207712_11565837 Ga0207712_115658372 99
862 3300025972 Ga0207668_10241305 Ga0207668_102413052 99
863 3300025972 Ga0207668_10566262 Ga0207668_105662622 99
864 3300025981 Ga0207640_10425090 Ga0207640_104250901 99
865 3300025986 Ga0207658_10177662 Ga0207658_101776622 99
866 3300025986 Ga0207658_10233156 Ga0207658_102331561 99
867 3300025986 Ga0207658_10571006 Ga0207658_105710062 99
868 3300026035 Ga0207703_10277807 Ga0207703_102778073 99
869 3300026067 Ga0207678_10003414 Ga0207678_100034149 99
870 3300026067 Ga0207678_10036078 Ga0207678_100360783 99
871 3300026067 Ga0207678_11704107 Ga0207678_117041071 99
872 3300026075 Ga0207708_10008073 Ga0207708_100080738 99
873 3300026088 Ga0207641_10753911 Ga0207641_107539112 99
874 3300026089 Ga0207648_10049704 Ga0207648_100497043 99
875 3300026089 Ga0207648_10484744 Ga0207648_104847442 99
876 3300026095 Ga0207676_10232121 Ga0207676_102321212 99
877 3300026116 Ga0207674_10029870 Ga0207674_100298703 99
878 3300026116 Ga0207674_10509282 Ga0207674_105092822 99
879 3300026116 Ga0207674_10775663 Ga0207674_107756631 99
880 3300026118 Ga0207675_100125191 Ga0207675_1001251912 99
881 3300026118 Ga0207675_100252953 Ga0207675_1002529532 99
882 3300026118 Ga0207675_100278724 Ga0207675_1002787242 99
883 3300026118 Ga0207675_100972704 Ga0207675_1009727042 99
884 3300026118 Ga0207675_101036903 Ga0207675_1010369032 99
885 3300026118 Ga0207675_102309182 Ga0207675_1023091822 99
886 3300026121 Ga0207683_11075672 Ga0207683_110756722 99
887 3300026121 Ga0207683_11153016 Ga0207683_111530162 99
888 3300027907 Ga0207428_10000066 Ga0207428_1000006684 99
889 3300027907 Ga0207428_10005537 Ga0207428_100055376 99
890 3300028379 Ga0268266_11470027 Ga0268266_114700272 99
891 3300028380 Ga0268265_11107770 Ga0268265_111077702 99
892 3300028380 Ga0268265_12339696 Ga0268265_123396962 99
893 3300028381 Ga0268264_10192729 Ga0268264_101927292 99
894 3300028381 Ga0268264_10527165 Ga0268264_105271653 99
895 3300028381 Ga0268264_11086496 Ga0268264_110864962 99
896 3300028381 Ga0268264_11789745 Ga0268264_117897452 99
897 3300031548 Ga0307408_100402624 Ga0307408_1004026242 99
898 3300031731 Ga0307405_10221650 Ga0307405_102216503 99
899 3300031824 Ga0307413_10364976 Ga0307413_103649762 99
900 3300031824 Ga0307413_10519559 Ga0307413_105195592 99
901 3300031852 Ga0307410_10147912 Ga0307410_101479123 99
902 3300031901 Ga0307406_10736648 Ga0307406_107366482 99
903 3300031903 Ga0307407_10033690 Ga0307407_100336903 99
904 3300031995 Ga0307409_100027404 Ga0307409_1000274043 99
905 3300032002 Ga0307416_100374872 Ga0307416_1003748723 99
906 3300032004 Ga0307414_10371664 Ga0307414_103716643 99
907 3300032005 Ga0307411_10267673 Ga0307411_102676732 99
908 3300032005 Ga0307411_10469000 Ga0307411_104690002 99
909 3300032126 Ga0307415_100829886 Ga0307415_1008298862 99
910 3300034957 Ga0373938_0188269 Ga0373938_0188269_31_330 99
911 3300035113 Ga0373936_0400656 Ga0373936_0400656_25_324 99
912 3300035172 Ga0373955_0865220 Ga0373955_0865220_59_358 99
913 3300035241 Ga0373961_0445509 Ga0373961_0445509_20_319 99
914 3300041486 Ga0451807_0021731 Ga0451807_0021731_26_325 99
915 3300041512 Ga0451853_3669051 Ga0451853_3669051_168_467 99
916 3300042003 Ga0439443_055794 Ga0439443_055794_13_312 99
917 3300042013 Ga0439456_161775 Ga0439456_161775_38_337 99
918 3300042530 Ga0450916_096513 Ga0450916_096513_115_414 99
919 3300042532 Ga0450893_0098999 Ga0450893_0098999_154_453 99
920 3300042876 Ga0451577_0132777 Ga0451577_0132777_1281_1580 99
921 3300044712 Ga0453684_0107756 Ga0453684_0107756_2877_3176 99
922 3300045976 Ga0466967_0877877 Ga0466967_0877877_235_534 99
923 3300046454 Ga0495592_0475807 Ga0495592_0475807_180_479 99
924 3300046455 Ga0495603_0209070 Ga0495603_0209070_150_449 99
925 3300046463 Ga0495653_0708482 Ga0495653_0708482_221_520 99
926 3300046473 Ga0495582_0361365 Ga0495582_0361365_207_506 99
927 3300046499 Ga0495594_0669086 Ga0495594_0669086_252_551 99
928 3300046536 Ga0495587_0098139 Ga0495587_0098139_1035_1334 99
929 3300046681 Ga0495647_0275437 Ga0495647_0275437_198_497 99
930 3300046681 Ga0495647_0324119 Ga0495647_0324119_321_620 99
931 3300046694 Ga0495649_0409512 Ga0495649_0409512_20_319 99
932 3300047317 Ga0495604_0347158 Ga0495604_0347158_621_920 99
933 3300047320 Ga0495672_0320193 Ga0495672_0320193_64_363 99
934 3300047322 Ga0495680_0380536 Ga0495680_0380536_239_538 99
935 3300048089 Ga0495614_0230281 Ga0495614_0230281_511_810 99
936 3300048904 Ga0496101_0614809 Ga0496101_0614809_83_382 99
937 3300048907 Ga0496104_0003082 Ga0496104_0003082_5759_6058 99
938 3300048908 Ga0496105_0019761 Ga0496105_0019761_138_437 99
939 3300048909 Ga0496106_0249197 Ga0496106_0249197_149_448 99
940 3300048909 Ga0496106_0500743 Ga0496106_0500743_331_630 99
941 3300048911 Ga0496108_0003036 Ga0496108_0003036_8549_8848 99
942 3300048911 Ga0496108_1012114 Ga0496108_1012114_111_410 99
943 3300048912 Ga0496109_0004537 Ga0496109_0004537_9439_9738 99
944 3300048912 Ga0496109_0818684 Ga0496109_0818684_66_365 99
945 3300048913 Ga0496110_0004868 Ga0496110_0004868_7206_7505 99
946 3300048914 Ga0496111_0005731 Ga0496111_0005731_345_644 99
947 3300048915 Ga0496112_0001468 Ga0496112_0001468_5802_6101 99
948 3300048916 Ga0496113_0167493 Ga0496113_0167493_777_1076 99
949 3300049527 Ga0501311_082027 Ga0501311_082027_32_331 99
950 3300049568 Ga0501031_0046471 Ga0501031_0046471_1211_1510 99
951 3300049568 Ga0501031_0511735 Ga0501031_0511735_164_463 99
952 3300049569 Ga0501032_0520296 Ga0501032_0520296_287_586 99
953 3300049570 Ga0501033_0037295 Ga0501033_0037295_1115_1414 99
954 3300049571 Ga0501034_0115513 Ga0501034_0115513_2333_2632 99
955 3300049571 Ga0501034_0705034 Ga0501034_0705034_318_617 99
956 3300049572 Ga0501036_0104742 Ga0501036_0104742_1264_1563 99
957 3300049572 Ga0501036_0521110 Ga0501036_0521110_492_791 99
958 3300049572 Ga0501036_0865534 Ga0501036_0865534_288_587 99
959 3300049573 Ga0501037_0098874 Ga0501037_0098874_1752_2051 99
960 3300049573 Ga0501037_0557127 Ga0501037_0557127_442_741 99
961 3300049573 Ga0501037_0728156 Ga0501037_0728156_318_617 99
962 3300049574 Ga0501038_0135132 Ga0501038_0135132_271_570 99
963 3300049574 Ga0501038_0399459 Ga0501038_0399459_609_908 99
964 3300049575 Ga0501039_0089734 Ga0501039_0089734_1294_1593 99
965 3300049575 Ga0501039_0368660 Ga0501039_0368660_524_823 99
966 3300049575 Ga0501039_0497179 Ga0501039_0497179_13_312 99
967 3300049575 Ga0501039_0504529 Ga0501039_0504529_24_323 99
968 3300049576 Ga0501040_0068905 Ga0501040_0068905_140_439 99
969 3300049576 Ga0501040_0511750 Ga0501040_0511750_310_609 99
970 3300049577 Ga0501041_0144688 Ga0501041_0144688_733_1032 99
971 3300049578 Ga0501042_0233859 Ga0501042_0233859_296_595 99
972 3300049579 Ga0501043_0106136 Ga0501043_0106136_1670_1969 99
973 3300049580 Ga0501046_0015798 Ga0501046_0015798_734_1033 99
974 3300049580 Ga0501046_0046528 Ga0501046_0046528_302_601 99
975 3300049580 Ga0501046_0285268 Ga0501046_0285268_170_469 99
976 3300049580 Ga0501046_0536254 Ga0501046_0536254_526_825 99
977 3300049581 Ga0501047_0006623 Ga0501047_0006623_10579_10878 99
978 3300049581 Ga0501047_0071383 Ga0501047_0071383_3003_3302 99
979 3300049581 Ga0501047_0988841 Ga0501047_0988841_173_472 99
980 3300049582 Ga0501048_0200008 Ga0501048_0200008_568_867 99
981 3300049583 Ga0501067_0144682 Ga0501067_0144682_328_627 99
982 3300049583 Ga0501067_0588831 Ga0501067_0588831_177_476 99
983 3300049584 Ga0501068_0058634 Ga0501068_0058634_1234_1533 99
984 3300049584 Ga0501068_0211500 Ga0501068_0211500_198_497 99
985 3300049585 Ga0501069_0006243 Ga0501069_0006243_441_740 99
986 3300049586 Ga0501070_0343688 Ga0501070_0343688_414_713 99
987 3300049586 Ga0501070_0661706 Ga0501070_0661706_323_622 99
988 3300049587 Ga0501071_0149591 Ga0501071_0149591_367_666 99
989 3300049587 Ga0501071_0166359 Ga0501071_0166359_1323_1622 99
990 3300049587 Ga0501071_0484897 Ga0501071_0484897_527_826 99
991 3300049588 Ga0501072_0075990 Ga0501072_0075990_239_538 99
992 3300049588 Ga0501072_0127443 Ga0501072_0127443_599_898 99
993 3300049588 Ga0501072_0220493 Ga0501072_0220493_642_941 99
994 3300049588 Ga0501072_0254797 Ga0501072_0254797_202_501 99
995 3300049589 Ga0501073_0347179 Ga0501073_0347179_392_691 99
996 3300049589 Ga0501073_0454940 Ga0501073_0454940_211_510 99
997 3300049589 Ga0501073_0580333 Ga0501073_0580333_359_658 99
998 3300049590 Ga0501074_0017869 Ga0501074_0017869_1144_1443 99
999 3300049590 Ga0501074_0162295 Ga0501074_0162295_427_726 99
1000 3300049590 Ga0501074_0929107 Ga0501074_0929107_153_455 99
1001 3300049591 Ga0501075_0144066 Ga0501075_0144066_887_1186 99
1002 3300049591 Ga0501075_0165360 Ga0501075_0165360_332_631 99
1003 3300049591 Ga0501075_0423995 Ga0501075_0423995_85_384 99
1004 3300049591 Ga0501075_1442648 Ga0501075_1442648_14_313 99
1005 3300049591 Ga0501075_1530664 Ga0501075_1530664_66_365 99
1006 3300049592 Ga0501076_0404539 Ga0501076_0404539_800_1099 99
1007 3300049592 Ga0501076_0454774 Ga0501076_0454774_132_431 99
1008 3300049592 Ga0501076_0472907 Ga0501076_0472907_477_776 99
1009 3300049592 Ga0501076_0517199 Ga0501076_0517199_310_609 99
1010 3300049592 Ga0501076_0979298 Ga0501076_0979298_292_594 99
1011 3300049593 Ga0501077_0102406 Ga0501077_0102406_79_378 99
1012 3300049593 Ga0501077_0384601 Ga0501077_0384601_398_697 99
1013 3300049593 Ga0501077_0747206 Ga0501077_0747206_55_354 99
1014 3300049675 Ga0501243_130230 Ga0501243_130230_33_332 99
1015 3300049741 Ga0501079_0027969 Ga0501079_0027969_758_1057 99
1016 3300049741 Ga0501079_0332455 Ga0501079_0332455_136_435 99
1017 3300049741 Ga0501079_0832907 Ga0501079_0832907_35_334 99
1018 3300049742 Ga0501080_0019050 Ga0501080_0019050_4503_4802 99
1019 3300049742 Ga0501080_0102787 Ga0501080_0102787_228_527 99
1020 3300049742 Ga0501080_1833734 Ga0501080_1833734_151_450 99
1021 3300049743 Ga0501081_0046801 Ga0501081_0046801_1706_2005 99
1022 3300049743 Ga0501081_0398270 Ga0501081_0398270_94_393 99
1023 3300049744 Ga0501083_0009096 Ga0501083_0009096_6609_6908 99
1024 3300049744 Ga0501083_0139058 Ga0501083_0139058_999_1298 99
1025 3300049744 Ga0501083_0180486 Ga0501083_0180486_336_635 99
1026 3300049822 Ga0501035_0128300 Ga0501035_0128300_1222_1521 99
1027 3300049822 Ga0501035_0250609 Ga0501035_0250609_560_859 99
1028 3300049822 Ga0501035_0296453 Ga0501035_0296453_765_1064 99
1029 3300049822 Ga0501035_0812271 Ga0501035_0812271_35_334 99
1030 3300049823 Ga0501044_0116255 Ga0501044_0116255_168_467 99
1031 3300049823 Ga0501044_0144191 Ga0501044_0144191_174_473 99
1032 3300049823 Ga0501044_0723691 Ga0501044_0723691_453_752 99
1033 3300049824 Ga0501045_0013621 Ga0501045_0013621_1286_1585 99
1034 3300049824 Ga0501045_0026599 Ga0501045_0026599_1508_1807 99
1035 3300049824 Ga0501045_0044615 Ga0501045_0044615_1114_1413 99
1036 3300049824 Ga0501045_0984409 Ga0501045_0984409_156_455 99
1037 3300050489 nmdc:mga03683_152060_c1 nmdc:mga03683_152060_c1_281_580 99
1038 3300050490 nmdc:mga03n38_328724_c1 nmdc:mga03n38_328724_c1_59_358 99
1039 3300050492 nmdc:mga0yw44_16488_c1 nmdc:mga0yw44_16488_c1_869_1168 99
1040 3300050493 nmdc:mga0k408_11298_c1 nmdc:mga0k408_11298_c1_1723_2022 99
1041 3300050494 nmdc:mga06z11_128855_c1 nmdc:mga06z11_128855_c1_1069_1368 99
1042 3300050495 nmdc:mga04h51_80670_c1 nmdc:mga04h51_80670_c1_249_548 99
1043 3300050496 nmdc:mga07m45_99236_c1 nmdc:mga07m45_99236_c1_319_618 99
1044 3300050507 nmdc:mga05p37_11849_c1 nmdc:mga05p37_11849_c1_4876_5175 99
1045 3300050507 nmdc:mga05p37_1408827_c1 nmdc:mga05p37_1408827_c1_280_579 99
1046 3300050507 nmdc:mga05p37_1775674_c1 nmdc:mga05p37_1775674_c1_69_368 99
1047 3300050507 nmdc:mga05p37_359328_c1 nmdc:mga05p37_359328_c1_73_372 99
1048 3300050507 nmdc:mga05p37_54_c2 nmdc:mga05p37_54_c2_20261_20560 99
1049 3300050507 nmdc:mga05p37_69250_c1 nmdc:mga05p37_69250_c1_3876_4175 99
1050 3300050508 nmdc:mga09592_1258644_c1 nmdc:mga09592_1258644_c1_155_454 99
1051 3300050508 nmdc:mga09592_475652_c1 nmdc:mga09592_475652_c1_717_1016 99
1052 3300050508 nmdc:mga09592_624290_c1 nmdc:mga09592_624290_c1_21_320 99
1053 3300050508 nmdc:mga09592_686212_c1 nmdc:mga09592_686212_c1_152_451 99
1054 3300050509 nmdc:mga0qj67_146515_c1 nmdc:mga0qj67_146515_c1_253_552 99
1055 3300050509 nmdc:mga0qj67_23200_c1 nmdc:mga0qj67_23200_c1_3314_3613 99
1056 3300050509 nmdc:mga0qj67_563773_c1 nmdc:mga0qj67_563773_c1_500_799 99
1057 3300050509 nmdc:mga0qj67_61432_c1 nmdc:mga0qj67_61432_c1_852_1151 99
1058 3300050510 nmdc:mga06r32_128077_c1 nmdc:mga06r32_128077_c1_1493_1792 99
1059 3300050511 nmdc:mga08y16_1172445_c1 nmdc:mga08y16_1172445_c1_256_555 99
1060 3300050511 nmdc:mga08y16_19984_c1 nmdc:mga08y16_19984_c1_1897_2196 99
1061 3300050511 nmdc:mga08y16_244307_c1 nmdc:mga08y16_244307_c1_130_429 99
1062 3300050511 nmdc:mga08y16_2979_c1 nmdc:mga08y16_2979_c1_5052_5351 99
1063 3300050511 nmdc:mga08y16_46458_c1 nmdc:mga08y16_46458_c1_3564_3863 99
1064 3300050512 nmdc:mga0n895_2047167_c1 nmdc:mga0n895_2047167_c1_135_434 99
1065 3300050512 nmdc:mga0n895_220970_c1 nmdc:mga0n895_220970_c1_1585_1884 99
1066 3300050512 nmdc:mga0n895_35411_c1 nmdc:mga0n895_35411_c1_3630_3929 99
1067 3300050515 nmdc:mga0a205_205039_c1 nmdc:mga0a205_205039_c1_1334_1633 99
1068 3300050515 nmdc:mga0a205_516667_c1 nmdc:mga0a205_516667_c1_499_798 99
1069 3300050515 nmdc:mga0a205_964118_c1 nmdc:mga0a205_964118_c1_27_326 99
1070 3300050516 nmdc:mga0sz30_200081_c1 nmdc:mga0sz30_200081_c1_564_863 99
1071 3300054114 Ga0501084_0028026 Ga0501084_0028026_1729_2028 99
1072 3300054114 Ga0501084_0221203 Ga0501084_0221203_667_966 99
1073 3300054114 Ga0501084_0617930 Ga0501084_0617930_410_709 99
1074 3300054114 Ga0501084_1046619 Ga0501084_1046619_243_542 99
1075 3300059423 Ga0590074_115496 Ga0590074_115496_34_333 99
1076 3300059426 Ga0590077_000518 Ga0590077_000518_4445_4744 99
1077 3300060353 Ga0501082_0037262 Ga0501082_0037262_3458_3757 99
1078 3300060353 Ga0501082_0258610 Ga0501082_0258610_750_1049 99
1079 3300060353 Ga0501082_0340092 Ga0501082_0340092_988_1287 99
1080 3300060353 Ga0501082_0449738 Ga0501082_0449738_659_958 99
1081 3300060353 Ga0501082_1486509 Ga0501082_1486509_11_310 99
1082 3300060353 Ga0501082_1712595 Ga0501082_1712595_82_381 99
1083 3300061734 Ga0530510_0011089 Ga0530510_0011089_5738_6037 99
1084 3300061734 Ga0530510_0942225 Ga0530510_0942225_195_494 99
1085 3300061734 Ga0530510_0987283 Ga0530510_0987283_226_525 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

14

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yrx-assembly1.cif.gz_A-2 crystal structure of a hypothetical protein rv3716c from mycobacterium tuberculosis 0.8784 16 81
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.877 15 88
7bid-assembly1.cif.gz_A crystal structure of v31wrap-t, a 7-bladed designer protein 0.8769 24 51
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.8587 11 88
1pug-assembly1.cif.gz_B structure of e. coli ybab 0.8546 14 84
ID Description Score Start End Superfamily
af_Q5A644_499_658_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9196 34 50 3.20.19.10
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8784 16 81 3.30.1310.10
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8546 14 84 3.30.1310.10
1pugA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8387 8 97 3.30.1310.10
af_Q4CUP9_587_746_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8133 25 38 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A383AGM3-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.9584 3 80 GO:0003677
GO:0005829
AF-I4BAU4-F1-model_v4 Nucleoid-associated protein Turpa_3767 0.9304 2 93 GO:0003677
GO:0005829
GO:0043590
AF-A0A2N1W9T3-F1-model_v4 Nucleoid-associated protein 0.9275 8 80 GO:0003677
AF-A0A6B2DJQ5-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.9162 2 84 GO:0003677
AF-A0A2V7WSV0-F1-model_v4 Nucleoid-associated protein DMF54_06745 0.9047 4 99 GO:0003677
GO:0005829
GO:0043590

Feature Viewer

pLDDT pTM Quality
86.63 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map