F489772
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1085 | 807 | 2168 | 331 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221599|2644006518 |
| Length | 348 |
| Sequence | CMMPIGLGREVGLDMSVNEETREIRRRPWRDIDLRAVAPFAALFLLLIVGALVNPNFIGITNLANVATRCAFIAIIAVGATFVISAGDLDLSVGSMVAFVASLMILLMNSGVIADPTLMLVAAVVFTLIAGALCGLANGLITTVGKIEPFIATLGTMGIYRGLTTWLSQGGAITLRSADIQTLYRPAYFGSILGVPVPIVVILAVTAVAAFILYRTRYGRHVVAVGSNSDVARYSGIAVNRVRTIAFVIQGLCVAIAVLLYVPRLGSTSATTGILWELQAITAVVVGGTALKGGAGRVWGTICGAFILELVGNIMLLSNFISEYLIGAIQGAIIIIAMLVQRSLVRKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 22 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 35 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 39 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 42 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 43 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 49 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 56 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 60 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 61 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 62 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 63 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 95 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 100 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 101 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 105 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 106 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 108 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 121 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 122 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 123 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 131 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 132 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 133 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 136 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 137 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 138 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 139 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 181 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 182 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 204 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 210 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 211 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 212 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 213 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 214 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 215 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 217 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 218 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 219 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 220 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 221 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 222 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 223 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 224 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 225 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 226 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 227 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 228 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 229 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 230 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 231 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 232 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 233 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 234 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 235 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 236 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 237 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 238 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 240 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 241 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 242 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 243 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 244 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 245 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 246 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 248 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 249 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 250 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 251 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 252 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 253 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 254 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 255 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 256 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 257 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 258 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 259 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 260 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 261 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 262 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 263 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 264 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 265 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 266 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 267 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 268 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 269 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 270 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 271 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 272 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 273 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 274 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 275 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 276 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 277 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 278 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 279 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 280 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 281 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 282 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 283 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 284 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 285 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 286 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 287 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 288 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 289 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 290 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 291 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 292 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 293 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 294 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 295 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 296 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 297 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 298 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 299 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 300 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 301 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 302 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 303 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 304 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 305 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 306 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 307 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 308 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 309 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 310 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 311 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 312 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 313 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 314 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 315 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 316 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 317 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 318 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 319 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 320 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 321 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 322 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 323 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 324 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 325 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 326 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 327 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 328 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 329 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 330 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 331 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 332 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 333 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 334 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 335 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 336 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 337 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 338 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 339 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 340 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 341 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 342 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 343 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 344 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 345 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 346 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 347 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 348 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 349 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 350 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 351 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 352 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 353 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 354 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 355 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 356 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 357 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 358 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 359 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 360 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 361 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 362 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 363 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 364 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 365 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 366 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 367 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 368 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 369 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 370 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 371 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 372 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 373 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 374 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 375 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 376 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 377 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 378 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 379 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 380 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 381 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 382 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 383 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 384 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 385 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 386 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 387 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 388 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 389 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 390 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 391 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 392 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 393 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 394 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 395 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 396 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 397 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 398 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 399 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 400 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 401 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 402 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 403 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 404 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 405 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 406 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 407 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 408 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 409 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 410 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 411 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 412 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 413 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 414 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 415 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 416 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 417 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 418 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 419 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 420 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 421 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 422 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 423 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 424 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 425 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 426 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 427 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 428 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 429 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 430 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 431 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 432 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 433 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 434 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 435 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 436 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 437 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 438 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 439 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 440 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 441 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 442 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 443 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 444 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 445 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 446 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 447 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 448 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 449 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 450 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 451 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 452 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 453 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 454 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 455 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 456 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 457 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 458 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 459 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 460 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 461 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 462 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 463 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 464 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 465 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 466 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 467 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 468 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 469 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 470 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 471 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 472 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 473 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 474 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 475 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 476 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 477 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 478 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 479 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 480 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 481 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 482 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 483 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 484 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 485 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 486 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 487 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 488 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 489 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 490 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 491 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 492 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 493 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 494 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 495 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 496 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 497 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 498 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 499 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 500 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 501 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 502 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 503 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 504 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 505 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 506 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 507 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 508 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 509 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 510 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 511 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 512 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 513 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 514 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 515 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 516 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 517 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 518 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 519 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 520 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 521 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 522 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 523 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 524 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 525 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 526 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 527 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 528 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 529 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 530 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 531 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 532 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 533 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 534 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 535 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 536 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 537 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 538 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 539 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 540 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 541 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 542 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 543 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 544 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 545 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 546 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 547 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 548 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 549 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 550 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 551 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 552 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 553 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 554 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 555 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 556 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 557 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 558 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 559 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 560 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 561 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 562 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 563 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 564 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 565 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 566 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 567 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 568 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 569 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 570 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 571 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 572 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 573 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 574 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 575 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 576 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 577 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 578 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 579 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 580 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 581 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 582 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 583 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 584 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 585 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 586 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 587 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 588 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 589 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 590 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 591 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 592 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 593 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 594 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 595 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 596 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 597 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 598 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 599 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 600 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 601 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 602 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 603 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 604 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 605 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 606 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 607 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 608 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 609 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 610 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 611 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 612 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 613 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 614 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 615 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 616 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 617 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 618 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 619 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 620 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 621 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 622 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 623 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 624 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 625 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 626 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 627 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 628 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 629 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 630 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 631 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 632 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 633 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 634 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 635 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 636 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 637 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 638 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 639 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 640 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 641 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 642 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 643 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 644 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 645 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 646 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 647 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 648 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 649 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 650 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 651 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 652 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 653 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 654 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 655 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 656 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 657 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 658 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 659 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 660 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 661 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 662 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 663 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 664 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 665 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 666 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 667 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 668 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 669 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 670 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 671 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 672 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 673 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 674 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 675 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 676 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 677 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 678 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 679 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 680 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 681 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 682 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 683 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 684 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 685 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 686 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 687 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 688 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 689 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 690 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 691 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 692 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 693 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 694 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 695 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 696 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 697 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 698 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 699 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 700 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 701 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 702 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 703 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 704 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 705 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 706 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 707 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 708 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 709 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 710 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 711 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 712 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 713 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 714 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 715 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 716 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 717 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 718 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 719 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 720 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 721 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 722 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 723 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 724 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 725 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 726 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 727 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 728 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 729 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 730 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 731 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 732 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 733 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 734 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 735 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 736 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 737 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 738 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 739 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 740 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 741 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 742 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 743 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 744 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 745 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 746 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 747 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 748 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 749 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 750 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 751 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 752 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 753 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 754 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 755 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 756 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 757 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 758 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 759 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 760 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 761 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 762 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 763 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 764 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 765 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 766 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 767 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 768 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 769 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 770 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 771 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 772 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 773 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 774 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 775 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 776 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 777 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 778 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 779 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 780 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 781 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 782 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 783 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 784 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 785 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 786 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 787 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 788 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 789 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 790 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 791 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 792 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 793 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 794 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 795 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 796 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 797 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 798 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 799 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 800 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 801 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 802 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 803 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 804 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 805 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 806 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 807 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 47.93 |
| Metatranscriptomes | 0 |
| Isolates | 52.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.46 |
| Bulb | 0 |
| Endosphere | 16.68 |
| Nodule | 39.72 |
| Rhizoplane | 1.66 |
| Rhizosphere | 23.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001156 | 3300001979 | Bacteria | 11909 |
| 2 | JGI24740J21852_10036884 | 3300001979 | Bacteria | 1514 |
| 3 | JGI25155J39150_1000012 | 3300002704 | Bacteria | 199435 |
| 4 | JGI25156J39149_1000036 | 3300002705 | Bacteria | 110527 |
| 5 | JGI25162J39368_1000674 | 3300002737 | Bacteria | 23983 |
| 6 | JGI25154J39366_1000033 | 3300002738 | Bacteria | 184379 |
| 7 | JGI25157J39369_1000457 | 3300002741 | Bacteria | 25863 |
| 8 | JGI25152J39213_1001181 | 3300002773 | Bacteria | 12068 |
| 9 | JGI25152J39213_1001905 | 3300002773 | Bacteria | 8354 |
| 10 | JGI25152J39213_1002964 | 3300002773 | Bacteria | 6041 |
| 11 | JGI25152J39213_1007241 | 3300002773 | Bacteria | 2899 |
| 12 | JGI25152J39213_1016687 | 3300002773 | Bacteria | 1409 |
| 13 | JGI25150J39212_1000063 | 3300002774 | Bacteria | 64558 |
| 14 | JGI25150J39212_1005441 | 3300002774 | Bacteria | 2717 |
| 15 | JGI25150J39212_1006207 | 3300002774 | Bacteria | 2488 |
| 16 | JGI25150J39212_1014882 | 3300002774 | Bacteria | 1309 |
| 17 | JGI25159J45721_1000626 | 3300002987 | Bacteria | 15678 |
| 18 | JGI25151J46595_10000140 | 3300003187 | Bacteria | 95958 |
| 19 | JGI25151J46595_10001756 | 3300003187 | Bacteria | 14041 |
| 20 | JGI25151J46595_10013176 | 3300003187 | Bacteria | 3730 |
| 21 | JGI25165J46597_1000653 | 3300003214 | Bacteria | 28392 |
| 22 | JGI25165J46597_1000719 | 3300003214 | Bacteria | 25974 |
| 23 | JGI25153J46596_10019404 | 3300003215 | Bacteria | 2607 |
| 24 | JGI25153J46596_10041665 | 3300003215 | Bacteria | 1409 |
| 25 | JGI25160J50197_1001017 | 3300003354 | Bacteria | 14523 |
| 26 | JGI25160J50197_1001914 | 3300003354 | Bacteria | 9964 |
| 27 | JGI25160J50197_1017789 | 3300003354 | Bacteria | 2239 |
| 28 | JGI25161J50226_1001626 | 3300003374 | Bacteria | 6515 |
| 29 | JGI25161J50226_1001837 | 3300003374 | Bacteria | 5942 |
| 30 | Ga0055526_1001694 | 3300003771 | Bacteria | 15400 |
| 31 | Ga0055526_1008634 | 3300003771 | Bacteria | 5040 |
| 32 | Ga0055526_1009413 | 3300003771 | Bacteria | 4701 |
| 33 | Ga0055526_1016484 | 3300003771 | Bacteria | 2886 |
| 34 | Ga0055526_1025675 | 3300003771 | Bacteria | 1883 |
| 35 | Ga0055524_1000790 | 3300003775 | Bacteria | 21100 |
| 36 | Ga0055524_1001796 | 3300003775 | Bacteria | 11760 |
| 37 | Ga0055524_1005331 | 3300003775 | Bacteria | 5763 |
| 38 | Ga0055536_1004141 | 3300003781 | Bacteria | 7519 |
| 39 | Ga0055536_1007318 | 3300003781 | Bacteria | 4963 |
| 40 | Ga0055528_1000548 | 3300003790 | Bacteria | 28660 |
| 41 | Ga0055528_1000886 | 3300003790 | Bacteria | 20225 |
| 42 | Ga0055528_1005173 | 3300003790 | Bacteria | 6133 |
| 43 | Ga0055540_1000548 | 3300003792 | Bacteria | 28000 |
| 44 | Ga0055540_1018076 | 3300003792 | Bacteria | 1943 |
| 45 | Ga0055531_10004650 | 3300003794 | Bacteria | 8241 |
| 46 | Ga0055531_10007450 | 3300003794 | Bacteria | 5971 |
| 47 | Ga0058692_1001450 | 3300003856 | Bacteria | 8748 |
| 48 | Ga0055543_1000892 | 3300004625 | Bacteria | 14160 |
| 49 | Ga0055543_1001407 | 3300004625 | Bacteria | 9571 |
| 50 | Ga0065165_1002701 | 3300005262 | Bacteria | 14246 |
| 51 | Ga0065165_1005489 | 3300005262 | Bacteria | 7096 |
| 52 | Ga0065165_1009147 | 3300005262 | Bacteria | 4490 |
| 53 | Ga0065704_10033657 | 3300005289 | Bacteria | 1294 |
| 54 | Ga0070670_100002696 | 3300005331 | Bacteria | 14664 |
| 55 | Ga0070668_100038532 | 3300005347 | Bacteria | 3653 |
| 56 | Ga0070668_100325906 | 3300005347 | Bacteria | 1294 |
| 57 | Ga0070669_100279631 | 3300005353 | Bacteria | 1337 |
| 58 | Ga0070671_100042038 | 3300005355 | Bacteria | 3799 |
| 59 | Ga0070685_10104509 | 3300005466 | Bacteria | 1734 |
| 60 | Ga0070665_100057236 | 3300005548 | Bacteria | 3909 |
| 61 | Ga0070665_100313075 | 3300005548 | Bacteria | 1574 |
| 62 | Ga0068852_100083709 | 3300005616 | Bacteria | 2837 |
| 63 | Ga0081540_1007912 | 3300005983 | Bacteria | 7503 |
| 64 | Ga0075365_10000600 | 3300006038 | Bacteria | 14128 |
| 65 | Ga0075365_10007867 | 3300006038 | Bacteria | 6007 |
| 66 | Ga0075365_10087883 | 3300006038 | Bacteria | 2114 |
| 67 | Ga0075368_10006634 | 3300006042 | Bacteria | 4057 |
| 68 | Ga0075368_10023539 | 3300006042 | Bacteria | 2353 |
| 69 | Ga0075363_100095763 | 3300006048 | Bacteria | 1638 |
| 70 | Ga0075362_10002533 | 3300006177 | Bacteria | 6160 |
| 71 | Ga0075367_10008288 | 3300006178 | Bacteria | 5381 |
| 72 | Ga0075367_10019332 | 3300006178 | Bacteria | 3776 |
| 73 | Ga0075369_10006833 | 3300006186 | Bacteria | 4332 |
| 74 | Ga0075369_10009672 | 3300006186 | Bacteria | 3752 |
| 75 | Ga0075366_10017993 | 3300006195 | Bacteria | 4077 |
| 76 | Ga0075370_10000839 | 3300006353 | Bacteria | 12435 |
| 77 | Ga0079104_1000042 | 3300006946 | Bacteria | 185991 |
| 78 | Ga0079104_1003298 | 3300006946 | Bacteria | 7678 |
| 79 | Ga0099826_10000123 | 3300006948 | Bacteria | 34864 |
| 80 | Ga0099826_10003580 | 3300006948 | Bacteria | 10608 |
| 81 | Ga0105251_10027023 | 3300009011 | Bacteria | 2915 |
| 82 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 83 | Ga0105243_10006354 | 3300009148 | Bacteria | 9126 |
| 84 | Ga0105248_10052789 | 3300009177 | Bacteria | 4562 |
| 85 | Ga0105237_10004254 | 3300009545 | Bacteria | 16661 |
| 86 | Ga0123341_1000015 | 3300009765 | Bacteria | 86184 |
| 87 | Ga0123341_1043929 | 3300009765 | Bacteria | 2775 |
| 88 | Ga0123342_1003064 | 3300009766 | Bacteria | 27242 |
| 89 | Ga0123342_1008248 | 3300009766 | Bacteria | 13251 |
| 90 | Ga0105239_10018520 | 3300010375 | Bacteria | 7691 |
| 91 | Ga0105239_10241070 | 3300010375 | Bacteria | 2029 |
| 92 | Ga0157373_10003853 | 3300013100 | Bacteria | 11337 |
| 93 | Ga0157373_10033005 | 3300013100 | Bacteria | 3726 |
| 94 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 95 | Ga0157371_10021215 | 3300013102 | Bacteria | 4771 |
| 96 | Ga0157370_10002915 | 3300013104 | Bacteria | 20380 |
| 97 | Ga0157369_10106762 | 3300013105 | Bacteria | 2980 |
| 98 | Ga0157369_10155347 | 3300013105 | Bacteria | 2417 |
| 99 | Ga0171463_1022 | 3300013249 | Bacteria | 15552 |
| 100 | Ga0182005_1007319 | 3300015265 | Bacteria | 3318 |
| 101 | Ga0183363_1124 | 3300015690 | Bacteria | 20069 |
| 102 | Ga0163161_10295066 | 3300017792 | Bacteria | 1275 |
| 103 | Ga0214543_1000025 | 3300021327 | Bacteria | 225351 |
| 104 | Ga0213872_10014331 | 3300021361 | Bacteria | 3700 |
| 105 | Ga0228711_1000020 | 3300022739 | Bacteria | 108422 |
| 106 | Ga0228710_1000012 | 3300022740 | Bacteria | 148650 |
| 107 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 108 | Ga0209436_103526 | 3300025208 | Bacteria | 4124 |
| 109 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 110 | Ga0207425_1000080 | 3300025245 | Bacteria | 100578 |
| 111 | Ga0207425_1002325 | 3300025245 | Bacteria | 6803 |
| 112 | Ga0207425_1009181 | 3300025245 | Bacteria | 2475 |
| 113 | Ga0207425_1022926 | 3300025245 | Bacteria | 1311 |
| 114 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 115 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 116 | Ga0209677_101144 | 3300025253 | Bacteria | 12360 |
| 117 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 118 | Ga0209129_1000195 | 3300025258 | Bacteria | 80791 |
| 119 | Ga0209129_1000199 | 3300025258 | Bacteria | 77091 |
| 120 | Ga0209129_1002007 | 3300025258 | Bacteria | 10555 |
| 121 | Ga0209129_1003568 | 3300025258 | Bacteria | 6680 |
| 122 | Ga0209129_1003611 | 3300025258 | Bacteria | 6609 |
| 123 | Ga0209129_1005580 | 3300025258 | Bacteria | 4388 |
| 124 | Ga0209233_1000163 | 3300025261 | Bacteria | 152912 |
| 125 | Ga0209233_1000299 | 3300025261 | Bacteria | 60375 |
| 126 | Ga0209673_1000037 | 3300025273 | Bacteria | 313804 |
| 127 | Ga0209673_1000320 | 3300025273 | Bacteria | 88073 |
| 128 | Ga0209673_1000880 | 3300025273 | Bacteria | 38918 |
| 129 | Ga0209673_1000924 | 3300025273 | Bacteria | 37119 |
| 130 | Ga0209673_1004391 | 3300025273 | Bacteria | 7580 |
| 131 | Ga0209673_1011468 | 3300025273 | Bacteria | 3651 |
| 132 | Ga0209130_1000079 | 3300025284 | Bacteria | 167669 |
| 133 | Ga0209130_1011944 | 3300025284 | Bacteria | 2299 |
| 134 | Ga0209130_1013537 | 3300025284 | Bacteria | 2084 |
| 135 | Ga0209675_1015513 | 3300025291 | Bacteria | 2257 |
| 136 | Ga0209676_1000093 | 3300025292 | Bacteria | 250231 |
| 137 | Ga0209676_1005216 | 3300025292 | Bacteria | 6886 |
| 138 | Ga0209676_1015915 | 3300025292 | Bacteria | 2744 |
| 139 | Ga0209025_1000052 | 3300025294 | Bacteria | 324648 |
| 140 | Ga0209025_1000332 | 3300025294 | Bacteria | 104326 |
| 141 | Ga0209025_1000354 | 3300025294 | Bacteria | 98665 |
| 142 | Ga0209025_1000566 | 3300025294 | Bacteria | 67702 |
| 143 | Ga0209025_1000666 | 3300025294 | Bacteria | 59408 |
| 144 | Ga0209025_1003632 | 3300025294 | Bacteria | 14340 |
| 145 | Ga0209025_1007212 | 3300025294 | Bacteria | 8372 |
| 146 | Ga0209025_1017809 | 3300025294 | Bacteria | 4073 |
| 147 | Ga0209025_1051272 | 3300025294 | Bacteria | 1641 |
| 148 | Ga0209025_1059426 | 3300025294 | Bacteria | 1443 |
| 149 | Ga0209025_1070635 | 3300025294 | Bacteria | 1242 |
| 150 | Ga0209564_1000345 | 3300025295 | Bacteria | 88073 |
| 151 | Ga0209564_1000869 | 3300025295 | Bacteria | 40151 |
| 152 | Ga0209564_1001903 | 3300025295 | Bacteria | 18682 |
| 153 | Ga0209564_1009432 | 3300025295 | Bacteria | 4646 |
| 154 | Ga0209758_1000105 | 3300025297 | Bacteria | 221415 |
| 155 | Ga0209758_1000263 | 3300025297 | Bacteria | 104297 |
| 156 | Ga0209758_1001323 | 3300025297 | Bacteria | 30082 |
| 157 | Ga0209758_1001789 | 3300025297 | Bacteria | 23722 |
| 158 | Ga0209758_1002280 | 3300025297 | Bacteria | 19856 |
| 159 | Ga0209758_1002342 | 3300025297 | Bacteria | 19520 |
| 160 | Ga0209758_1008256 | 3300025297 | Bacteria | 6816 |
| 161 | Ga0209050_1003774 | 3300025298 | Bacteria | 10824 |
| 162 | Ga0209050_1011010 | 3300025298 | Bacteria | 4361 |
| 163 | Ga0209256_1000310 | 3300025299 | Bacteria | 85227 |
| 164 | Ga0209256_1000343 | 3300025299 | Bacteria | 75902 |
| 165 | Ga0209256_1000348 | 3300025299 | Bacteria | 75070 |
| 166 | Ga0209256_1001088 | 3300025299 | Bacteria | 31344 |
| 167 | Ga0209256_1003669 | 3300025299 | Bacteria | 10473 |
| 168 | Ga0209256_1012405 | 3300025299 | Bacteria | 3270 |
| 169 | Ga0207426_1000167 | 3300025302 | Bacteria | 167669 |
| 170 | Ga0207426_1000296 | 3300025302 | Bacteria | 98032 |
| 171 | Ga0207426_1002918 | 3300025302 | Bacteria | 10078 |
| 172 | Ga0209051_1000236 | 3300025303 | Bacteria | 92738 |
| 173 | Ga0209051_1000517 | 3300025303 | Bacteria | 48573 |
| 174 | Ga0209051_1009994 | 3300025303 | Bacteria | 4833 |
| 175 | Ga0209051_1010221 | 3300025303 | Bacteria | 4766 |
| 176 | Ga0209257_1004486 | 3300025304 | Bacteria | 10777 |
| 177 | Ga0209257_1006024 | 3300025304 | Bacteria | 8103 |
| 178 | Ga0209257_1008087 | 3300025304 | Bacteria | 6118 |
| 179 | Ga0209257_1030459 | 3300025304 | Bacteria | 1742 |
| 180 | Ga0207688_10034324 | 3300025901 | Bacteria | 2809 |
| 181 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 182 | Ga0207671_10000107 | 3300025914 | Bacteria | 128950 |
| 183 | Ga0207650_10001919 | 3300025925 | Bacteria | 14650 |
| 184 | Ga0207709_10106244 | 3300025935 | Bacteria | 1867 |
| 185 | Ga0207711_10105120 | 3300025941 | Bacteria | 2503 |
| 186 | Ga0207668_10020566 | 3300025972 | Bacteria | 4196 |
| 187 | Ga0207678_10110034 | 3300026067 | Bacteria | 2350 |
| 188 | Ga0207678_10186721 | 3300026067 | Bacteria | 1771 |
| 189 | Ga0207702_10082609 | 3300026078 | Bacteria | 2794 |
| 190 | Ga0209281_1000138 | 3300027111 | Bacteria | 180979 |
| 191 | Ga0209281_1000194 | 3300027111 | Bacteria | 139318 |
| 192 | Ga0209281_1000446 | 3300027111 | Bacteria | 59196 |
| 193 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 194 | Ga0209371_1002844 | 3300027312 | Bacteria | 9159 |
| 195 | Ga0209282_1000020 | 3300027666 | Bacteria | 180986 |
| 196 | Ga0209282_1000176 | 3300027666 | Bacteria | 35300 |
| 197 | Ga0209282_1015163 | 3300027666 | Bacteria | 4906 |
| 198 | Ga0209813_10009431 | 3300027866 | Bacteria | 2496 |
| 199 | Ga0268266_10033214 | 3300028379 | Bacteria | 4388 |
| 200 | Ga0268266_10086667 | 3300028379 | Bacteria | 2738 |
| 201 | Ga0268266_10313451 | 3300028379 | Bacteria | 1466 |
| 202 | Ga0268266_10412311 | 3300028379 | Bacteria | 1279 |
| 203 | Ga0265318_10030678 | 3300028577 | Bacteria | 2090 |
| 204 | Ga0307515_10000145 | 3300028794 | Bacteria | 170814 |
| 205 | Ga0307515_10000263 | 3300028794 | Bacteria | 130303 |
| 206 | Ga0307515_10093119 | 3300028794 | Bacteria | 3741 |
| 207 | Ga0307515_10151926 | 3300028794 | Bacteria | 2415 |
| 208 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 209 | Ga0265330_10034995 | 3300031235 | Bacteria | 2242 |
| 210 | Ga0265328_10004940 | 3300031239 | Bacteria | 5745 |
| 211 | Ga0265325_10004012 | 3300031241 | Bacteria | 9404 |
| 212 | Ga0265325_10006401 | 3300031241 | Bacteria | 7141 |
| 213 | Ga0265340_10000794 | 3300031247 | Bacteria | 17926 |
| 214 | Ga0265340_10018114 | 3300031247 | Bacteria | 3636 |
| 215 | Ga0265340_10034019 | 3300031247 | Bacteria | 2535 |
| 216 | Ga0265339_10002113 | 3300031249 | Bacteria | 14479 |
| 217 | Ga0265339_10011130 | 3300031249 | Bacteria | 5553 |
| 218 | Ga0265339_10033081 | 3300031249 | Bacteria | 2914 |
| 219 | Ga0265316_10016672 | 3300031344 | Bacteria | 6368 |
| 220 | Ga0265316_10044429 | 3300031344 | Bacteria | 3534 |
| 221 | Ga0265316_10187407 | 3300031344 | Bacteria | 1538 |
| 222 | Ga0307513_10003087 | 3300031456 | Bacteria | 22729 |
| 223 | Ga0307513_10003471 | 3300031456 | Bacteria | 21323 |
| 224 | Ga0307513_10053661 | 3300031456 | Bacteria | 4330 |
| 225 | Ga0307408_100016058 | 3300031548 | Bacteria | 4992 |
| 226 | Ga0265313_10000371 | 3300031595 | Bacteria | 48762 |
| 227 | Ga0265313_10008172 | 3300031595 | Bacteria | 6994 |
| 228 | Ga0265313_10070962 | 3300031595 | Bacteria | 1604 |
| 229 | Ga0265314_10025242 | 3300031711 | Bacteria | 4489 |
| 230 | Ga0265314_10030223 | 3300031711 | Bacteria | 4013 |
| 231 | Ga0265314_10062963 | 3300031711 | Bacteria | 2518 |
| 232 | Ga0265314_10123438 | 3300031711 | Bacteria | 1626 |
| 233 | Ga0265342_10014444 | 3300031712 | Bacteria | 5240 |
| 234 | Ga0265342_10015031 | 3300031712 | Bacteria | 5110 |
| 235 | Ga0307516_10016649 | 3300031730 | Bacteria | 7681 |
| 236 | Ga0307516_10022527 | 3300031730 | Bacteria | 6466 |
| 237 | Ga0307516_10138676 | 3300031730 | Bacteria | 2204 |
| 238 | Ga0307405_10001367 | 3300031731 | Bacteria | 10231 |
| 239 | Ga0307405_10018122 | 3300031731 | Bacteria | 3879 |
| 240 | Ga0307406_10023570 | 3300031901 | Bacteria | 3664 |
| 241 | Ga0307406_10249820 | 3300031901 | Bacteria | 1335 |
| 242 | Ga0307412_10004368 | 3300031911 | Bacteria | 7882 |
| 243 | Ga0307412_10014315 | 3300031911 | Bacteria | 4675 |
| 244 | Ga0315914_1000031 | 3300031967 | Bacteria | 101407 |
| 245 | Ga0307409_100179951 | 3300031995 | Bacteria | 1871 |
| 246 | Ga0307414_10128114 | 3300032004 | Bacteria | 1965 |
| 247 | Ga0307510_10083251 | 3300033180 | Bacteria | 3090 |
| 248 | Ga0315913_1000010 | 3300033430 | Bacteria | 140890 |
| 249 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 250 | Ga0373943_0133380 | 3300035170 | Bacteria | 1331 |
| 251 | Ga0373935_0024645 | 3300035692 | Bacteria | 3705 |
| 252 | Ga0373927_0000047 | 3300035695 | Bacteria | 87289 |
| 253 | Ga0373925_0001420 | 3300037068 | Bacteria | 20792 |
| 254 | Ga0395905_0001828 | 3300037471 | Bacteria | 24574 |
| 255 | Ga0395905_0006179 | 3300037471 | Bacteria | 12087 |
| 256 | Ga0395905_0049808 | 3300037471 | Bacteria | 3926 |
| 257 | Ga0436360_1304194 | 3300039438 | Bacteria | 1574 |
| 258 | Ga0436361_0563451 | 3300039447 | Bacteria | 2423 |
| 259 | Ga0439436_0025655 | 3300041404 | Bacteria | 1730 |
| 260 | Ga0439439_0012905 | 3300041406 | Bacteria | 2022 |
| 261 | Ga0439465_0008881 | 3300041413 | Bacteria | 3166 |
| 262 | Ga0439465_0015760 | 3300041413 | Bacteria | 2357 |
| 263 | Ga0451787_487060 | 3300041441 | Bacteria | 4301 |
| 264 | Ga0451798_0290064 | 3300041458 | Bacteria | 2243 |
| 265 | Ga0451839_1092244 | 3300041496 | Bacteria | 1790 |
| 266 | Ga0439449_0044724 | 3300042007 | Bacteria | 1642 |
| 267 | Ga0439434_0030723 | 3300042435 | Bacteria | 1631 |
| 268 | Ga0466972_0028935 | 3300044658 | Bacteria | 2730 |
| 269 | Ga0466965_0061260 | 3300044683 | Bacteria | 1881 |
| 270 | Ga0466970_0013042 | 3300044765 | Bacteria | 4259 |
| 271 | Ga0466960_0065776 | 3300044901 | Bacteria | 1791 |
| 272 | Ga0495638_0000591 | 3300046460 | Bacteria | 40915 |
| 273 | Ga0495638_0033311 | 3300046460 | Bacteria | 3295 |
| 274 | Ga0495638_0190347 | 3300046460 | Bacteria | 1164 |
| 275 | Ga0495651_0103046 | 3300046462 | Bacteria | 2121 |
| 276 | Ga0495605_0014574 | 3300046474 | Bacteria | 4300 |
| 277 | Ga0495605_0025162 | 3300046474 | Bacteria | 3103 |
| 278 | Ga0495662_0025297 | 3300046476 | Bacteria | 2866 |
| 279 | Ga0495585_0042765 | 3300046492 | Bacteria | 2536 |
| 280 | Ga0495585_0047769 | 3300046492 | Bacteria | 2382 |
| 281 | Ga0495585_0082527 | 3300046492 | Bacteria | 1740 |
| 282 | Ga0495583_0018919 | 3300046506 | Bacteria | 3611 |
| 283 | Ga0495583_0022293 | 3300046506 | Bacteria | 3234 |
| 284 | Ga0495606_0002219 | 3300046507 | Bacteria | 23170 |
| 285 | Ga0495606_0013151 | 3300046507 | Bacteria | 6568 |
| 286 | Ga0495606_0126417 | 3300046507 | Bacteria | 1524 |
| 287 | Ga0495610_0006787 | 3300046512 | Bacteria | 7765 |
| 288 | Ga0495610_0012381 | 3300046512 | Bacteria | 5138 |
| 289 | Ga0495610_0087136 | 3300046512 | Bacteria | 1421 |
| 290 | Ga0495620_0039077 | 3300046515 | Bacteria | 2100 |
| 291 | Ga0495631_0013351 | 3300046518 | Bacteria | 3988 |
| 292 | Ga0495632_0006479 | 3300046519 | Bacteria | 7520 |
| 293 | Ga0495632_0014663 | 3300046519 | Bacteria | 4425 |
| 294 | Ga0495632_0019658 | 3300046519 | Bacteria | 3674 |
| 295 | Ga0495643_0070462 | 3300046522 | Bacteria | 1836 |
| 296 | Ga0495648_0072972 | 3300046524 | Bacteria | 1984 |
| 297 | Ga0495648_0076014 | 3300046524 | Bacteria | 1929 |
| 298 | Ga0495654_0001861 | 3300046530 | Bacteria | 14052 |
| 299 | Ga0495609_0014234 | 3300046538 | Bacteria | 3744 |
| 300 | Ga0495609_0017098 | 3300046538 | Bacteria | 3372 |
| 301 | Ga0495597_0086343 | 3300046542 | Bacteria | 1336 |
| 302 | Ga0495633_0008943 | 3300046558 | Bacteria | 5581 |
| 303 | Ga0495633_0063371 | 3300046558 | Bacteria | 1730 |
| 304 | Ga0495656_0007577 | 3300046615 | Bacteria | 3843 |
| 305 | Ga0495668_0032402 | 3300046616 | Bacteria | 2941 |
| 306 | Ga0495668_0065935 | 3300046616 | Bacteria | 1993 |
| 307 | Ga0495611_0028580 | 3300046648 | Bacteria | 2443 |
| 308 | Ga0495625_0016371 | 3300046660 | Bacteria | 5838 |
| 309 | Ga0495625_0041947 | 3300046660 | Bacteria | 3327 |
| 310 | Ga0495625_0121150 | 3300046660 | Bacteria | 1780 |
| 311 | Ga0495625_0139187 | 3300046660 | Bacteria | 1639 |
| 312 | Ga0495588_0001719 | 3300046674 | Bacteria | 9324 |
| 313 | Ga0495624_0093949 | 3300046690 | Bacteria | 1849 |
| 314 | Ga0495649_0047454 | 3300046694 | Bacteria | 2336 |
| 315 | Ga0495660_0014687 | 3300046810 | Bacteria | 4529 |
| 316 | Ga0495660_0031536 | 3300046810 | Bacteria | 2980 |
| 317 | Ga0495604_0025551 | 3300047317 | Bacteria | 4705 |
| 318 | Ga0495686_0002643 | 3300047472 | Bacteria | 16544 |
| 319 | Ga0495686_0023395 | 3300047472 | Bacteria | 4075 |
| 320 | Ga0495686_0044801 | 3300047472 | Bacteria | 2800 |
| 321 | Ga0495686_0051091 | 3300047472 | Bacteria | 2595 |
| 322 | Ga0495626_0094034 | 3300048091 | Bacteria | 1315 |
| 323 | Ga0496101_0147835 | 3300048904 | Bacteria | 1795 |
| 324 | Ga0496102_0211453 | 3300048905 | Bacteria | 1828 |
| 325 | Ga0496104_0200868 | 3300048907 | Bacteria | 1906 |
| 326 | Ga0496105_0148638 | 3300048908 | Bacteria | 1926 |
| 327 | Ga0496106_0015899 | 3300048909 | Bacteria | 5567 |
| 328 | Ga0496110_0047664 | 3300048913 | Bacteria | 3754 |
| 329 | Ga0496110_0166737 | 3300048913 | Bacteria | 1997 |
| 330 | Ga0496111_0000570 | 3300048914 | Bacteria | 19247 |
| 331 | Ga0496116_0000026 | 3300048919 | Bacteria | 450803 |
| 332 | Ga0496116_0005540 | 3300048919 | Bacteria | 11645 |
| 333 | Ga0496116_0012007 | 3300048919 | Bacteria | 7109 |
| 334 | Ga0496116_0012328 | 3300048919 | Bacteria | 6990 |
| 335 | Ga0496116_0040317 | 3300048919 | Bacteria | 3216 |
| 336 | Ga0496116_0051820 | 3300048919 | Bacteria | 2723 |
| 337 | Ga0496117_0000016 | 3300048920 | Bacteria | 523642 |
| 338 | Ga0496117_0002458 | 3300048920 | Bacteria | 23348 |
| 339 | Ga0496117_0028194 | 3300048920 | Bacteria | 4352 |
| 340 | Ga0496117_0083821 | 3300048920 | Bacteria | 2082 |
| 341 | Ga0496117_0091385 | 3300048920 | Bacteria | 1958 |
| 342 | Ga0496117_0185452 | 3300048920 | Bacteria | 1191 |
| 343 | Ga0496118_0004029 | 3300048921 | Bacteria | 17860 |
| 344 | Ga0496118_0010916 | 3300048921 | Bacteria | 8933 |
| 345 | Ga0496118_0037836 | 3300048921 | Bacteria | 3876 |
| 346 | Ga0496118_0046435 | 3300048921 | Bacteria | 3379 |
| 347 | Ga0496118_0046573 | 3300048921 | Bacteria | 3371 |
| 348 | Ga0496118_0091661 | 3300048921 | Bacteria | 2089 |
| 349 | Ga0496119_0004065 | 3300048922 | Bacteria | 14759 |
| 350 | Ga0496119_0018854 | 3300048922 | Bacteria | 5112 |
| 351 | Ga0496119_0023424 | 3300048922 | Bacteria | 4378 |
| 352 | Ga0496119_0064058 | 3300048922 | Bacteria | 2184 |
| 353 | Ga0496119_0076320 | 3300048922 | Bacteria | 1944 |
| 354 | Ga0496120_0000056 | 3300048923 | Bacteria | 180367 |
| 355 | Ga0496120_0002742 | 3300048923 | Bacteria | 17205 |
| 356 | Ga0496120_0012085 | 3300048923 | Bacteria | 5896 |
| 357 | Ga0496120_0035007 | 3300048923 | Bacteria | 3004 |
| 358 | Ga0496120_0079917 | 3300048923 | Bacteria | 1774 |
| 359 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 360 | Ga0496121_0000180 | 3300048924 | Bacteria | 141128 |
| 361 | Ga0496121_0056708 | 3300048924 | Bacteria | 3251 |
| 362 | Ga0496121_0065712 | 3300048924 | Bacteria | 2949 |
| 363 | Ga0496121_0091542 | 3300048924 | Bacteria | 2374 |
| 364 | Ga0496121_0128317 | 3300048924 | Bacteria | 1903 |
| 365 | Ga0496121_0153971 | 3300048924 | Bacteria | 1688 |
| 366 | Ga0496121_0172481 | 3300048924 | Bacteria | 1569 |
| 367 | Ga0496121_0217723 | 3300048924 | Bacteria | 1347 |
| 368 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 369 | Ga0496122_0000024 | 3300048925 | Bacteria | 372400 |
| 370 | Ga0496122_0000107 | 3300048925 | Bacteria | 193163 |
| 371 | Ga0496122_0017729 | 3300048925 | Bacteria | 6629 |
| 372 | Ga0496122_0036472 | 3300048925 | Bacteria | 3974 |
| 373 | Ga0496122_0049824 | 3300048925 | Bacteria | 3200 |
| 374 | Ga0496122_0062614 | 3300048925 | Bacteria | 2722 |
| 375 | Ga0496122_0065454 | 3300048925 | Bacteria | 2635 |
| 376 | Ga0496122_0096660 | 3300048925 | Bacteria | 1991 |
| 377 | Ga0496122_0099727 | 3300048925 | Bacteria | 1946 |
| 378 | Ga0496122_0128951 | 3300048925 | Bacteria | 1612 |
| 379 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 380 | Ga0496123_0000063 | 3300048926 | Bacteria | 216072 |
| 381 | Ga0496123_0000086 | 3300048926 | Bacteria | 183266 |
| 382 | Ga0496123_0020993 | 3300048926 | Bacteria | 5089 |
| 383 | Ga0496123_0031131 | 3300048926 | Bacteria | 3887 |
| 384 | Ga0496123_0046162 | 3300048926 | Bacteria | 2957 |
| 385 | Ga0496123_0051434 | 3300048926 | Bacteria | 2743 |
| 386 | Ga0496123_0064470 | 3300048926 | Bacteria | 2334 |
| 387 | Ga0496123_0166873 | 3300048926 | Bacteria | 1166 |
| 388 | Ga0496124_0000091 | 3300048927 | Bacteria | 189706 |
| 389 | Ga0496124_0001850 | 3300048927 | Bacteria | 29217 |
| 390 | Ga0496124_0003986 | 3300048927 | Bacteria | 17602 |
| 391 | Ga0496124_0010962 | 3300048927 | Bacteria | 9114 |
| 392 | Ga0496124_0018448 | 3300048927 | Bacteria | 6534 |
| 393 | Ga0496124_0087766 | 3300048927 | Bacteria | 2543 |
| 394 | Ga0496124_0118612 | 3300048927 | Bacteria | 2118 |
| 395 | Ga0496124_0120742 | 3300048927 | Bacteria | 2094 |
| 396 | Ga0496124_0140989 | 3300048927 | Bacteria | 1902 |
| 397 | Ga0496124_0149069 | 3300048927 | Bacteria | 1837 |
| 398 | Ga0496124_0206491 | 3300048927 | Bacteria | 1489 |
| 399 | Ga0496124_0295217 | 3300048927 | Bacteria | 1174 |
| 400 | Ga0496125_0000262 | 3300048928 | Bacteria | 108389 |
| 401 | Ga0496125_0000323 | 3300048928 | Bacteria | 93243 |
| 402 | Ga0496125_0000477 | 3300048928 | Bacteria | 70913 |
| 403 | Ga0496125_0000833 | 3300048928 | Bacteria | 49770 |
| 404 | Ga0496125_0003888 | 3300048928 | Bacteria | 17657 |
| 405 | Ga0496125_0017666 | 3300048928 | Bacteria | 6790 |
| 406 | Ga0496125_0084817 | 3300048928 | Bacteria | 2403 |
| 407 | Ga0496125_0104148 | 3300048928 | Bacteria | 2079 |
| 408 | Ga0496126_0000059 | 3300048929 | Bacteria | 267449 |
| 409 | Ga0496126_0000434 | 3300048929 | Bacteria | 83949 |
| 410 | Ga0496126_0123891 | 3300048929 | Bacteria | 2238 |
| 411 | Ga0496126_0145353 | 3300048929 | Bacteria | 2037 |
| 412 | Ga0495678_022082 | 3300049459 | Bacteria | 2789 |
| 413 | Ga0495678_028523 | 3300049459 | Bacteria | 2354 |
| 414 | Ga0501031_0021483 | 3300049568 | Bacteria | 4207 |
| 415 | Ga0501031_0054122 | 3300049568 | Bacteria | 2615 |
| 416 | Ga0501031_0191332 | 3300049568 | Bacteria | 1336 |
| 417 | Ga0501032_0000013 | 3300049569 | Bacteria | 185070 |
| 418 | Ga0501032_0079944 | 3300049569 | Bacteria | 2176 |
| 419 | Ga0501032_0226446 | 3300049569 | Bacteria | 1216 |
| 420 | Ga0501033_0000361 | 3300049570 | Bacteria | 43373 |
| 421 | Ga0501033_0000522 | 3300049570 | Bacteria | 36025 |
| 422 | Ga0501033_0061697 | 3300049570 | Bacteria | 2762 |
| 423 | Ga0501033_0218368 | 3300049570 | Bacteria | 1358 |
| 424 | Ga0501034_0000054 | 3300049571 | Bacteria | 206373 |
| 425 | Ga0501034_0096196 | 3300049571 | Bacteria | 2957 |
| 426 | Ga0501034_0173063 | 3300049571 | Bacteria | 2125 |
| 427 | Ga0501036_0000828 | 3300049572 | Bacteria | 22938 |
| 428 | Ga0501037_0005064 | 3300049573 | Bacteria | 9586 |
| 429 | Ga0501037_0051215 | 3300049573 | Bacteria | 3020 |
| 430 | Ga0501037_0070049 | 3300049573 | Bacteria | 2552 |
| 431 | Ga0501037_0070716 | 3300049573 | Bacteria | 2539 |
| 432 | Ga0501037_0142774 | 3300049573 | Bacteria | 1713 |
| 433 | Ga0501038_0000018 | 3300049574 | Bacteria | 155191 |
| 434 | Ga0501039_0000152 | 3300049575 | Bacteria | 47363 |
| 435 | Ga0501039_0101641 | 3300049575 | Bacteria | 2244 |
| 436 | Ga0501043_0000014 | 3300049579 | Bacteria | 184687 |
| 437 | Ga0501043_0098352 | 3300049579 | Bacteria | 2300 |
| 438 | Ga0501043_0148584 | 3300049579 | Bacteria | 1834 |
| 439 | Ga0501043_0197794 | 3300049579 | Bacteria | 1561 |
| 440 | Ga0501047_0016929 | 3300049581 | Bacteria | 6969 |
| 441 | Ga0501047_0030248 | 3300049581 | Bacteria | 5221 |
| 442 | Ga0501047_0163998 | 3300049581 | Bacteria | 2093 |
| 443 | Ga0501047_0167105 | 3300049581 | Bacteria | 2070 |
| 444 | Ga0501047_0244511 | 3300049581 | Bacteria | 1644 |
| 445 | Ga0501067_0091524 | 3300049583 | Bacteria | 1688 |
| 446 | Ga0501069_0145120 | 3300049585 | Bacteria | 1362 |
| 447 | Ga0501070_0041228 | 3300049586 | Bacteria | 3846 |
| 448 | Ga0501070_0051047 | 3300049586 | Bacteria | 3433 |
| 449 | Ga0501070_0136494 | 3300049586 | Bacteria | 2025 |
| 450 | Ga0501070_0335479 | 3300049586 | Bacteria | 1228 |
| 451 | Ga0501074_0227283 | 3300049590 | Bacteria | 1328 |
| 452 | Ga0501074_0281648 | 3300049590 | Bacteria | 1182 |
| 453 | Ga0501261_006749 | 3300049690 | Bacteria | 1465 |
| 454 | Ga0501079_0199236 | 3300049741 | Bacteria | 1564 |
| 455 | Ga0501083_0055471 | 3300049744 | Bacteria | 2656 |
| 456 | Ga0501083_0174984 | 3300049744 | Bacteria | 1402 |
| 457 | Ga0501035_0000019 | 3300049822 | Bacteria | 241152 |
| 458 | Ga0501035_0008142 | 3300049822 | Bacteria | 9770 |
| 459 | Ga0501035_0021342 | 3300049822 | Bacteria | 5953 |
| 460 | Ga0501035_0078684 | 3300049822 | Bacteria | 2912 |
| 461 | Ga0501044_0092425 | 3300049823 | Bacteria | 3051 |
| 462 | Ga0501044_0125105 | 3300049823 | Bacteria | 2569 |
| 463 | Ga0501044_0212875 | 3300049823 | Bacteria | 1886 |
| 464 | Ga0501045_0190772 | 3300049824 | Bacteria | 1527 |
| 465 | nmdc:mga03n38_57874_c1 | 3300050490 | Bacteria | 1754 |
| 466 | nmdc:mga00v17_107176_c1 | 3300050491 | Bacteria | 1769 |
| 467 | nmdc:mga00v17_230_c1 | 3300050491 | Bacteria | 33351 |
| 468 | nmdc:mga00v17_337_c1 | 3300050491 | Bacteria | 26383 |
| 469 | nmdc:mga0yw44_9347_c2 | 3300050492 | Bacteria | 4070 |
| 470 | nmdc:mga0k408_7537_c1 | 3300050493 | Bacteria | 5813 |
| 471 | nmdc:mga06z11_66756_c1 | 3300050494 | Bacteria | 1892 |
| 472 | nmdc:mga04h51_24749_c1 | 3300050495 | Bacteria | 1842 |
| 473 | nmdc:mga0sz30_354_c1 | 3300050516 | Bacteria | 17427 |
| 474 | nmdc:mga0sz30_8054_c1 | 3300050516 | Bacteria | 3970 |
| 475 | Ga0500610_0085237 | 3300053079 | Bacteria | 1645 |
| 476 | Ga0500578_0032372 | 3300053086 | Bacteria | 3360 |
| 477 | Ga0500578_0085480 | 3300053086 | Bacteria | 2004 |
| 478 | Ga0500651_0124156 | 3300053093 | Bacteria | 1565 |
| 479 | Ga0500654_068947 | 3300053099 | Bacteria | 1740 |
| 480 | Ga0500557_000023 | 3300053105 | Bacteria | 87584 |
| 481 | Ga0500560_000252 | 3300053107 | Bacteria | 6600 |
| 482 | Ga0500569_001403 | 3300053109 | Bacteria | 4529 |
| 483 | Ga0500569_013694 | 3300053109 | Bacteria | 1992 |
| 484 | Ga0500572_016677 | 3300053111 | Bacteria | 1875 |
| 485 | Ga0500594_0004142 | 3300053118 | Bacteria | 3198 |
| 486 | Ga0500594_0023448 | 3300053118 | Bacteria | 1565 |
| 487 | Ga0500607_044592 | 3300053121 | Bacteria | 2384 |
| 488 | Ga0500614_029953 | 3300053123 | Bacteria | 1324 |
| 489 | Ga0500618_000109 | 3300053125 | Bacteria | 66318 |
| 490 | Ga0500618_001997 | 3300053125 | Bacteria | 8320 |
| 491 | Ga0500626_103833 | 3300053128 | Bacteria | 1236 |
| 492 | Ga0500642_0000059 | 3300053130 | Bacteria | 65182 |
| 493 | Ga0500652_077096 | 3300053131 | Bacteria | 1386 |
| 494 | Ga0500658_0001045 | 3300053134 | Bacteria | 11320 |
| 495 | Ga0500658_0047640 | 3300053134 | Bacteria | 1740 |
| 496 | Ga0500659_0099848 | 3300053135 | Bacteria | 1505 |
| 497 | Ga0500559_0004001 | 3300053136 | Bacteria | 7080 |
| 498 | Ga0500559_0073470 | 3300053136 | Bacteria | 1543 |
| 499 | Ga0500561_0000248 | 3300053137 | Bacteria | 9498 |
| 500 | Ga0500568_0005458 | 3300053139 | Bacteria | 6566 |
| 501 | Ga0500568_0020932 | 3300053139 | Bacteria | 2821 |
| 502 | Ga0500590_005965 | 3300053148 | Bacteria | 5905 |
| 503 | Ga0500590_018538 | 3300053148 | Bacteria | 3601 |
| 504 | Ga0500604_0034151 | 3300053151 | Bacteria | 1507 |
| 505 | Ga0500616_0002051 | 3300053153 | Bacteria | 17701 |
| 506 | Ga0500616_0035606 | 3300053153 | Bacteria | 2706 |
| 507 | Ga0500619_000785 | 3300053154 | Bacteria | 5430 |
| 508 | Ga0500622_0001743 | 3300053156 | Bacteria | 16801 |
| 509 | Ga0500622_0005319 | 3300053156 | Bacteria | 7761 |
| 510 | Ga0500627_0014296 | 3300053158 | Bacteria | 3037 |
| 511 | Ga0500634_0038398 | 3300053161 | Bacteria | 2603 |
| 512 | Ga0500634_0059534 | 3300053161 | Bacteria | 2031 |
| 513 | Ga0500636_0000001 | 3300053177 | Bacteria | 324086 |
| 514 | Ga0500636_0000014 | 3300053177 | Bacteria | 124740 |
| 515 | Ga0500636_0006275 | 3300053177 | Bacteria | 6818 |
| 516 | Ga0500637_0072703 | 3300053178 | Bacteria | 1979 |
| 517 | Ga0500625_001971 | 3300053729 | Bacteria | 7433 |
| 518 | Ga0501082_0090721 | 3300060353 | Bacteria | 2639 |
| 519 | Ga0501082_0134700 | 3300060353 | Bacteria | 2143 |
| 520 | 2644006518 | 2643221599 | Bacteria | 6292121 |
| 521 | 2508731439 | 2508501050 | Bacteria | 9633614 |
| 522 | 2509077049 | 2508501114 | Bacteria | 7082538 |
| 523 | 2509111012 | 2508501122 | Bacteria | 6292184 |
| 524 | 2509379344 | 2509276019 | Bacteria | 6802256 |
| 525 | 2509389784 | 2509276021 | Bacteria | 7634384 |
| 526 | 2509447962 | 2509276033 | Bacteria | 7180565 |
| 527 | 2510134900 | 2510065019 | Bacteria | 6903379 |
| 528 | 2510305736 | 2510065057 | Bacteria | 6649661 |
| 529 | 2510896311 | 2510461076 | Bacteria | 8618824 |
| 530 | 2511174162 | 2510917026 | Bacteria | 7046020 |
| 531 | 2511187238 | 2510917028 | Bacteria | 6185411 |
| 532 | 2511195941 | 2510917030 | Bacteria | 7460662 |
| 533 | 2511391285 | 2511231027 | Bacteria | 5013807 |
| 534 | 2511497510 | 2511231052 | Bacteria | 6974333 |
| 535 | 2512529958 | 2512047086 | Bacteria | 6850303 |
| 536 | 2512969812 | 2512875026 | Bacteria | 6861065 |
| 537 | 2513572663 | 2513237084 | Bacteria | 7231967 |
| 538 | 2513580105 | 2513237085 | Bacteria | 7695351 |
| 539 | 2513581887 | 2513237086 | Bacteria | 7265287 |
| 540 | 2513599858 | 2513237088 | Bacteria | 6927906 |
| 541 | 2513603030 | 2513237089 | Bacteria | 6553624 |
| 542 | 2513615301 | 2513237091 | Bacteria | 6900273 |
| 543 | 2513631261 | 2513237093 | Bacteria | 7545552 |
| 544 | 2513710844 | 2513237103 | Bacteria | 7647401 |
| 545 | 2513867013 | 2513237138 | Bacteria | 7368160 |
| 546 | 2513884616 | 2513237140 | Bacteria | 7076289 |
| 547 | 2513901386 | 2513237143 | Bacteria | 6664116 |
| 548 | 2513908127 | 2513237144 | Bacteria | 7530820 |
| 549 | 2513927003 | 2513237146 | Bacteria | 7166346 |
| 550 | 2513998140 | 2513237159 | Bacteria | 6810126 |
| 551 | 2514004599 | 2513237160 | Bacteria | 6650282 |
| 552 | 2514023201 | 2513237162 | Bacteria | 7468464 |
| 553 | 2515113983 | 2515075009 | Bacteria | 7288508 |
| 554 | 2515609787 | 2515154107 | Bacteria | 6795637 |
| 555 | 2515639182 | 2515154113 | Bacteria | 7807172 |
| 556 | 2515642970 | 2515154114 | Bacteria | 7848616 |
| 557 | 2515656716 | 2515154116 | Bacteria | 7552979 |
| 558 | 2515743659 | 2515154134 | Bacteria | 7220242 |
| 559 | 2516896836 | 2516653046 | Bacteria | 6989037 |
| 560 | 2517037615 | 2516653077 | Bacteria | 7555578 |
| 561 | 2517077902 | 2516653085 | Bacteria | 7346596 |
| 562 | 2517096698 | 2517093000 | Bacteria | 7412387 |
| 563 | 2517410413 | 2517287029 | Bacteria | 6905599 |
| 564 | 2517565308 | 2517487022 | Bacteria | 7227575 |
| 565 | 2520377970 | 2519899620 | Bacteria | 6499161 |
| 566 | 2524451380 | 2524023207 | Bacteria | 6813453 |
| 567 | 2530647011 | 2529292951 | Bacteria | 6916614 |
| 568 | 2535484300 | 2534681786 | Bacteria | 3308809 |
| 569 | 2535519366 | 2534681796 | Bacteria | 7146037 |
| 570 | 2537876531 | 2537561587 | Bacteria | 5425293 |
| 571 | 2551675489 | 2551306084 | Bacteria | 8942552 |
| 572 | 2551688438 | 2551306085 | Bacteria | 7347181 |
| 573 | 2551691905 | 2551306086 | Bacteria | 6843938 |
| 574 | 2551701818 | 2551306087 | Bacteria | 7351905 |
| 575 | 2551708395 | 2551306089 | Bacteria | 7162724 |
| 576 | 2551720333 | 2551306090 | Bacteria | 7953713 |
| 577 | 2551727215 | 2551306091 | Bacteria | 7086830 |
| 578 | 2551744856 | 2551306093 | Bacteria | 7064773 |
| 579 | 2554245699 | 2554235003 | Bacteria | 5877155 |
| 580 | 2558861528 | 2558860100 | Bacteria | 8458965 |
| 581 | 2559296472 | 2558860242 | Bacteria | 5568029 |
| 582 | 2585168088 | 2582581283 | Bacteria | 6030556 |
| 583 | 2585202407 | 2582581294 | Bacteria | 6626667 |
| 584 | 2585224722 | 2582581298 | Bacteria | 7315509 |
| 585 | 2585227889 | 2582581299 | Bacteria | 6518058 |
| 586 | 2585255536 | 2582581304 | Bacteria | 5831370 |
| 587 | 2585269705 | 2582581306 | Bacteria | 6450535 |
| 588 | 2585280256 | 2582581308 | Bacteria | 7413247 |
| 589 | 2585322533 | 2582581315 | Bacteria | 7318924 |
| 590 | 2585388633 | 2582581865 | Bacteria | 6644329 |
| 591 | 2585392482 | 2582581866 | Bacteria | 6859583 |
| 592 | 2585402285 | 2582581867 | Bacteria | 7184437 |
| 593 | 2585529020 | 2585427526 | Bacteria | 7258840 |
| 594 | 2585532485 | 2585427527 | Bacteria | 7273426 |
| 595 | 2585540961 | 2585427528 | Bacteria | 6842387 |
| 596 | 2585547278 | 2585427529 | Bacteria | 7395659 |
| 597 | 2585554498 | 2585427530 | Bacteria | 7383882 |
| 598 | 2585822415 | 2585427590 | Bacteria | 6824633 |
| 599 | 2585839723 | 2585427593 | Bacteria | 7141551 |
| 600 | 2585845447 | 2585427594 | Bacteria | 6180594 |
| 601 | 2585898981 | 2585427608 | Bacteria | 6544331 |
| 602 | 2585997220 | 2585427633 | Bacteria | 6413184 |
| 603 | 2586001821 | 2585427634 | Bacteria | 6455027 |
| 604 | 2599334701 | 2599185156 | Bacteria | 5403036 |
| 605 | 2599420503 | 2599185170 | Bacteria | 7295545 |
| 606 | 2599603039 | 2599185210 | Bacteria | 5624189 |
| 607 | 2599720056 | 2599185236 | Bacteria | 6875203 |
| 608 | 2600194423 | 2599185352 | Bacteria | 7228948 |
| 609 | 2600373591 | 2600254933 | Bacteria | 4750527 |
| 610 | 2601610656 | 2600255279 | Bacteria | 5605316 |
| 611 | 2601747014 | 2600255308 | Bacteria | 5611129 |
| 612 | 2616295618 | 2615840624 | Bacteria | 6557588 |
| 613 | 2616307444 | 2615840626 | Bacteria | 7921970 |
| 614 | 2617383443 | 2617270742 | Bacteria | 6808054 |
| 615 | 2643776171 | 2643221551 | Bacteria | 3750538 |
| 616 | 2643794618 | 2643221555 | Bacteria | 3749717 |
| 617 | 2643809471 | 2643221557 | Bacteria | 7184309 |
| 618 | 2643814620 | 2643221558 | Bacteria | 5460675 |
| 619 | 2643854223 | 2643221568 | Bacteria | 5187270 |
| 620 | 2643922222 | 2643221582 | Bacteria | 5804683 |
| 621 | 2644048363 | 2643221607 | Bacteria | 6314006 |
| 622 | 2644066867 | 2643221610 | Bacteria | 7480339 |
| 623 | 2644108420 | 2643221618 | Bacteria | 7717186 |
| 624 | 2644147609 | 2643221626 | Bacteria | 8069654 |
| 625 | 2644195962 | 2643221634 | Bacteria | 6705461 |
| 626 | 2644201725 | 2643221636 | Bacteria | 6583769 |
| 627 | 2644209831 | 2643221637 | Bacteria | 5345260 |
| 628 | 2644241934 | 2643221643 | Bacteria | 5749658 |
| 629 | 2644299297 | 2643221653 | Bacteria | 4569637 |
| 630 | 2644309472 | 2643221655 | Bacteria | 7722067 |
| 631 | 2644331769 | 2643221659 | Bacteria | 7890716 |
| 632 | 2644375812 | 2643221668 | Bacteria | 7306521 |
| 633 | 2644418070 | 2643221675 | Bacteria | 7473456 |
| 634 | 2644451325 | 2643221680 | Bacteria | 7473610 |
| 635 | 2644481165 | 2643221686 | Bacteria | 6310811 |
| 636 | 2644496421 | 2643221688 | Bacteria | 5260751 |
| 637 | 2644500142 | 2643221689 | Bacteria | 6042950 |
| 638 | 2644520599 | 2643221693 | Bacteria | 5513853 |
| 639 | 2644542150 | 2643221698 | Bacteria | 7756764 |
| 640 | 2644615975 | 2643221712 | Bacteria | 7729434 |
| 641 | 2644653382 | 2643221718 | Bacteria | 5345506 |
| 642 | 2644657525 | 2643221719 | Bacteria | 4568197 |
| 643 | 2644673275 | 2643221723 | Bacteria | 7095460 |
| 644 | 2644691670 | 2643221726 | Bacteria | 7455827 |
| 645 | 2671112236 | 2667528174 | Bacteria | 6435400 |
| 646 | 2719182652 | 2718217882 | Bacteria | 6556348 |
| 647 | 2719387323 | 2718217927 | Bacteria | 6972593 |
| 648 | 2719666968 | 2718217997 | Bacteria | 6740740 |
| 649 | 2719733370 | 2718218009 | Bacteria | 6478651 |
| 650 | 2720493388 | 2718218199 | Bacteria | 6740745 |
| 651 | 2720614859 | 2718218232 | Bacteria | 6720332 |
| 652 | 2720621632 | 2718218233 | Bacteria | 6662049 |
| 653 | 2720632960 | 2718218235 | Bacteria | 6630699 |
| 654 | 2720776684 | 2718218269 | Bacteria | 6906114 |
| 655 | 2721148765 | 2718218363 | Bacteria | 6524337 |
| 656 | 2721160149 | 2718218365 | Bacteria | 6274507 |
| 657 | 2721165578 | 2718218366 | Bacteria | 6425255 |
| 658 | 2721400958 | 2718218423 | Bacteria | 6438183 |
| 659 | 2722841748 | 2721755514 | Bacteria | 6424414 |
| 660 | 2723028272 | 2721755556 | Bacteria | 6745503 |
| 661 | 2723561900 | 2721755684 | Bacteria | 6859907 |
| 662 | 2723568532 | 2721755685 | Bacteria | 6704835 |
| 663 | 2724039771 | 2721755809 | Bacteria | 6438790 |
| 664 | 2724046126 | 2721755810 | Bacteria | 6479005 |
| 665 | 2724091291 | 2721755819 | Bacteria | 6906405 |
| 666 | 2724105797 | 2721755822 | Bacteria | 6726041 |
| 667 | 2724111623 | 2721755823 | Bacteria | 6752556 |
| 668 | 2725945409 | 2724679232 | Bacteria | 7646494 |
| 669 | 2730109208 | 2728369352 | Bacteria | 6745171 |
| 670 | 2730165887 | 2728369365 | Bacteria | 6555560 |
| 671 | 2730299781 | 2728369397 | Bacteria | 6274511 |
| 672 | 2738804787 | 2738541293 | Bacteria | 7065685 |
| 673 | 2738944557 | 2738541317 | Bacteria | 5340176 |
| 674 | 2739035518 | 2738541333 | Bacteria | 7106503 |
| 675 | 2753357622 | 2751185800 | Bacteria | 5467370 |
| 676 | 2757572462 | 2757320392 | Bacteria | 3737298 |
| 677 | 2758640119 | 2758568016 | Bacteria | 5645291 |
| 678 | 2766065265 | 2765235942 | Bacteria | 7445910 |
| 679 | 2774868389 | 2773857925 | Bacteria | 6472445 |
| 680 | 2776262585 | 2775506901 | Bacteria | 9631051 |
| 681 | 2776914621 | 2775507049 | Bacteria | 6284736 |
| 682 | 2778176055 | 2775507266 | Bacteria | 7392367 |
| 683 | 2792582062 | 2791355082 | Bacteria | 5973319 |
| 684 | 2792623398 | 2791355091 | Bacteria | 6135441 |
| 685 | 2792629286 | 2791355092 | Bacteria | 6248105 |
| 686 | 2793280643 | 2791355253 | Bacteria | 5171699 |
| 687 | 2793293567 | 2791355256 | Bacteria | 6798008 |
| 688 | 2793313020 | 2791355259 | Bacteria | 7254731 |
| 689 | 2793319667 | 2791355260 | Bacteria | 6598818 |
| 690 | 2793327834 | 2791355261 | Bacteria | 6661293 |
| 691 | 2793333448 | 2791355262 | Bacteria | 6774204 |
| 692 | 2793342031 | 2791355263 | Bacteria | 6872478 |
| 693 | 2793347426 | 2791355264 | Bacteria | 6429314 |
| 694 | 2793353757 | 2791355265 | Bacteria | 6539969 |
| 695 | 2793359643 | 2791355266 | Bacteria | 7116587 |
| 696 | 2793369393 | 2791355267 | Bacteria | 7222458 |
| 697 | 2802716240 | 2802428858 | Bacteria | 6636079 |
| 698 | 2802722722 | 2802428859 | Bacteria | 6667919 |
| 699 | 2802729135 | 2802428860 | Bacteria | 6525526 |
| 700 | 2802735527 | 2802428861 | Bacteria | 6534206 |
| 701 | 2802741897 | 2802428862 | Bacteria | 6633353 |
| 702 | 2802748348 | 2802428863 | Bacteria | 6410669 |
| 703 | 2805929462 | 2802429605 | Bacteria | 6875453 |
| 704 | 2805935357 | 2802429606 | Bacteria | 6346811 |
| 705 | 2806044504 | 2802429633 | Bacteria | 7341974 |
| 706 | 2806052705 | 2802429634 | Bacteria | 7083200 |
| 707 | 2806059005 | 2802429635 | Bacteria | 7650140 |
| 708 | 2806068332 | 2802429636 | Bacteria | 7597525 |
| 709 | 2806074452 | 2802429637 | Bacteria | 7067217 |
| 710 | 2808986923 | 2808606387 | Bacteria | 5697198 |
| 711 | 2819243865 | 2818991272 | Bacteria | 4622173 |
| 712 | 2819557750 | 2818991439 | Bacteria | 6907412 |
| 713 | 2819639655 | 2818991453 | Bacteria | 7181617 |
| 714 | 2819686492 | 2818991461 | Bacteria | 7026071 |
| 715 | 2821126219 | 2821123053 | Bacteria | 7836056 |
| 716 | 2835313051 | 2835312727 | Bacteria | 7413381 |
| 717 | 2838019164 | 2838016132 | Bacteria | 6577831 |
| 718 | 2838024245 | 2838022645 | Bacteria | 6494267 |
| 719 | 2838033176 | 2838029111 | Bacteria | 6603031 |
| 720 | 2838040825 | 2838035591 | Bacteria | 7166484 |
| 721 | 2838047415 | 2838042994 | Bacteria | 6046894 |
| 722 | 2838051117 | 2838048938 | Bacteria | 6044578 |
| 723 | 2838063904 | 2838061910 | Bacteria | 6794874 |
| 724 | 2838073389 | 2838068647 | Bacteria | 6208656 |
| 725 | 2838075740 | 2838074704 | Bacteria | 6785777 |
| 726 | 2838664784 | 2838661181 | Bacteria | 7385261 |
| 727 | 2838671078 | 2838668709 | Bacteria | 6671819 |
| 728 | 2838677728 | 2838675328 | Bacteria | 4909118 |
| 729 | 2838684899 | 2838680041 | Bacteria | 6545511 |
| 730 | 2838691262 | 2838686498 | Bacteria | 7807632 |
| 731 | 2838699264 | 2838694306 | Bacteria | 6853137 |
| 732 | 2838703743 | 2838701080 | Bacteria | 6669771 |
| 733 | 2838712745 | 2838707686 | Bacteria | 6619912 |
| 734 | 2838717367 | 2838714209 | Bacteria | 5525906 |
| 735 | 2838722023 | 2838719591 | Bacteria | 5523910 |
| 736 | 2838728116 | 2838724970 | Bacteria | 4908691 |
| 737 | 2838735745 | 2838729681 | Bacteria | 7400765 |
| 738 | 2838737306 | 2838736955 | Bacteria | 5760694 |
| 739 | 2838748647 | 2838742623 | Bacteria | 7396178 |
| 740 | 2841842325 | 2841840854 | Bacteria | 5761912 |
| 741 | 2841849777 | 2841846520 | Bacteria | 5345850 |
| 742 | 2841853918 | 2841851746 | Bacteria | 7532261 |
| 743 | 2841864211 | 2841859092 | Bacteria | 5436171 |
| 744 | 2841868114 | 2841864319 | Bacteria | 6742987 |
| 745 | 2842082222 | 2842077413 | Bacteria | 6508645 |
| 746 | 2842113377 | 2842110456 | Bacteria | 7656360 |
| 747 | 2842123147 | 2842118031 | Bacteria | 7033875 |
| 748 | 2842127475 | 2842124991 | Bacteria | 5346824 |
| 749 | 2842132621 | 2842130223 | Bacteria | 4909145 |
| 750 | 2842142104 | 2842140634 | Bacteria | 5759631 |
| 751 | 2842151252 | 2842146304 | Bacteria | 5957337 |
| 752 | 2842154615 | 2842152218 | Bacteria | 4908957 |
| 753 | 2842162564 | 2842156927 | Bacteria | 6894975 |
| 754 | 2842170008 | 2842163707 | Bacteria | 6916235 |
| 755 | 2842173112 | 2842170452 | Bacteria | 5525737 |
| 756 | 2842178235 | 2842175837 | Bacteria | 4908771 |
| 757 | 2842185001 | 2842180545 | Bacteria | 6888678 |
| 758 | 2842190474 | 2842187318 | Bacteria | 5524014 |
| 759 | 2842198204 | 2842192696 | Bacteria | 6147454 |
| 760 | 2842199787 | 2842198810 | Bacteria | 6608673 |
| 761 | 2842208373 | 2842205361 | Bacteria | 6340321 |
| 762 | 2842214788 | 2842211629 | Bacteria | 5523832 |
| 763 | 2842220019 | 2842217011 | Bacteria | 7497767 |
| 764 | 2842227509 | 2842224351 | Bacteria | 5524473 |
| 765 | 2842235626 | 2842229732 | Bacteria | 7475766 |
| 766 | 2842241953 | 2842237096 | Bacteria | 6620661 |
| 767 | 2842249340 | 2842243621 | Bacteria | 7421798 |
| 768 | 2842256308 | 2842250916 | Bacteria | 6579627 |
| 769 | 2842263523 | 2842257432 | Bacteria | 7401195 |
| 770 | 2842266664 | 2842264693 | Bacteria | 6472963 |
| 771 | 2842275737 | 2842271015 | Bacteria | 7807131 |
| 772 | 2842281618 | 2842278818 | Bacteria | 6340002 |
| 773 | 2842288741 | 2842285085 | Bacteria | 6011953 |
| 774 | 2842296223 | 2842291075 | Bacteria | 7076806 |
| 775 | 2842308279 | 2842304105 | Bacteria | 7023636 |
| 776 | 2842316440 | 2842311132 | Bacteria | 6616990 |
| 777 | 2842321328 | 2842317721 | Bacteria | 6793725 |
| 778 | 2842345066 | 2842341865 | Bacteria | 7003929 |
| 779 | 2842369182 | 2842363717 | Bacteria | 6844742 |
| 780 | 2842375575 | 2842370503 | Bacteria | 7038661 |
| 781 | 2842382623 | 2842377471 | Bacteria | 7140707 |
| 782 | 2842390024 | 2842384541 | Bacteria | 7057858 |
| 783 | 2842398452 | 2842395702 | Bacteria | 6780583 |
| 784 | 2842406592 | 2842402390 | Bacteria | 6681310 |
| 785 | 2842412981 | 2842409023 | Bacteria | 6687331 |
| 786 | 2842419624 | 2842415677 | Bacteria | 6596907 |
| 787 | 2842427024 | 2842422224 | Bacteria | 6239196 |
| 788 | 2842429983 | 2842428310 | Bacteria | 6767288 |
| 789 | 2842436357 | 2842434925 | Bacteria | 6502746 |
| 790 | 2842444060 | 2842441272 | Bacteria | 6769273 |
| 791 | 2842451087 | 2842447887 | Bacteria | 6754142 |
| 792 | 2842464404 | 2842462802 | Bacteria | 6588055 |
| 793 | 2842470686 | 2842469257 | Bacteria | 6752936 |
| 794 | 2842479909 | 2842475841 | Bacteria | 6603183 |
| 795 | 2842483344 | 2842482326 | Bacteria | 7212537 |
| 796 | 2842493335 | 2842489311 | Bacteria | 6620893 |
| 797 | 2842499094 | 2842495871 | Bacteria | 6820686 |
| 798 | 2842507085 | 2842502639 | Bacteria | 6604161 |
| 799 | 2842510782 | 2842509118 | Bacteria | 6850950 |
| 800 | 2842521042 | 2842515876 | Bacteria | 5436280 |
| 801 | 2842523245 | 2842521101 | Bacteria | 6569494 |
| 802 | 2842875722 | 2842871566 | Bacteria | 4827117 |
| 803 | 2842925825 | 2842922631 | Bacteria | 5824079 |
| 804 | 2844166094 | 2844163670 | Bacteria | 7266046 |
| 805 | 2844457436 | 2844454524 | Bacteria | 7952546 |
| 806 | 2850084504 | 2850079185 | Bacteria | 6848280 |
| 807 | 2852391269 | 2852387548 | Bacteria | 8025568 |
| 808 | 2854897337 | 2854896431 | Bacteria | 5869725 |
| 809 | 2854913436 | 2854911287 | Bacteria | 5582813 |
| 810 | 2854915535 | 2854911287 | Bacteria | 5582813 |
| 811 | 2854921529 | 2854916844 | Bacteria | 5725939 |
| 812 | 2855828342 | 2855825444 | Bacteria | 6785811 |
| 813 | 2855843454 | 2855839649 | Bacteria | 7135830 |
| 814 | 2857518845 | 2857516855 | Bacteria | 7787325 |
| 815 | 2857532780 | 2857531043 | Bacteria | 6754041 |
| 816 | 2858806278 | 2858800743 | Bacteria | 6603254 |
| 817 | 2882459181 | 2882456835 | Bacteria | 6863978 |
| 818 | 2891375627 | 2891373044 | Bacteria | 5202277 |
| 819 | 2891377471 | 2891373044 | Bacteria | 5202277 |
| 820 | 2894233218 | 2894232714 | Bacteria | 8834183 |
| 821 | 2896388193 | 2896384573 | Bacteria | 7700774 |
| 822 | 2899793470 | 2899792073 | Bacteria | 4926588 |
| 823 | 2899805190 | 2899803654 | Bacteria | 5577784 |
| 824 | 2899847671 | 2899845264 | Bacteria | 5672268 |
| 825 | 2913309177 | 2913308742 | Bacteria | 5350706 |
| 826 | 2915984168 | 2915980308 | Bacteria | 6624279 |
| 827 | 2915987826 | 2915986958 | Bacteria | 6739310 |
| 828 | 2916000083 | 2915993759 | Bacteria | 7016183 |
| 829 | 2916006018 | 2916000859 | Bacteria | 6865702 |
| 830 | 2916013074 | 2916007675 | Bacteria | 6898660 |
| 831 | 2916018938 | 2916014648 | Bacteria | 6946486 |
| 832 | 2916024811 | 2916021584 | Bacteria | 6854472 |
| 833 | 2916029380 | 2916028427 | Bacteria | 6748433 |
| 834 | 2916037160 | 2916035215 | Bacteria | 6755766 |
| 835 | 2916046056 | 2916041962 | Bacteria | 6820487 |
| 836 | 2916050144 | 2916048683 | Bacteria | 6543552 |
| 837 | 2916058855 | 2916055098 | Bacteria | 6758838 |
| 838 | 2916068587 | 2916061851 | Bacteria | 6737736 |
| 839 | 2916072128 | 2916068649 | Bacteria | 6943657 |
| 840 | 2916082781 | 2916076590 | Bacteria | 6596108 |
| 841 | 2919104625 | 2919100787 | Bacteria | 7710546 |
| 842 | 2919117633 | 2919114240 | Bacteria | 5700270 |
| 843 | 2919168610 | 2919166419 | Bacteria | 4952238 |
| 844 | 2919173513 | 2919171160 | Bacteria | 6499771 |
| 845 | 2920764303 | 2920760137 | Bacteria | 7427611 |
| 846 | 2920826293 | 2920822456 | Bacteria | 6897201 |
| 847 | 2921202277 | 2921201388 | Bacteria | 6926299 |
| 848 | 2921214742 | 2921208531 | Bacteria | 6745326 |
| 849 | 2921237829 | 2921237296 | Bacteria | 6876710 |
| 850 | 2921247380 | 2921244191 | Bacteria | 6568419 |
| 851 | 2921253400 | 2921250672 | Bacteria | 6677771 |
| 852 | 2921259842 | 2921257292 | Bacteria | 6808382 |
| 853 | 2921265323 | 2921263974 | Bacteria | 6864552 |
| 854 | 2921282610 | 2921282425 | Bacteria | 6826397 |
| 855 | 2921291329 | 2921289301 | Bacteria | 7316391 |
| 856 | 2921301338 | 2921296804 | Bacteria | 7176999 |
| 857 | 2923558718 | 2923556063 | Bacteria | 6793593 |
| 858 | 2924150169 | 2924144063 | Bacteria | 6883928 |
| 859 | 2924155331 | 2924150972 | Bacteria | 7169444 |
| 860 | 2924158582 | 2924158325 | Bacteria | 7188855 |
| 861 | 2924168893 | 2924165586 | Bacteria | 7260590 |
| 862 | 2924176347 | 2924172951 | Bacteria | 6749356 |
| 863 | 2924186038 | 2924179722 | Bacteria | 6843264 |
| 864 | 2924188333 | 2924186466 | Bacteria | 6876637 |
| 865 | 2924198463 | 2924193448 | Bacteria | 6955718 |
| 866 | 2924206075 | 2924200457 | Bacteria | 6757188 |
| 867 | 2924210099 | 2924207177 | Bacteria | 6917007 |
| 868 | 2924215718 | 2924214083 | Bacteria | 7080103 |
| 869 | 2924226056 | 2924221636 | Bacteria | 7113495 |
| 870 | 2924230684 | 2924228884 | Bacteria | 6633132 |
| 871 | 2926759070 | 2926754445 | Bacteria | 5964435 |
| 872 | 2926763420 | 2926760298 | Bacteria | 5505990 |
| 873 | 2928524844 | 2928521798 | Bacteria | 4960112 |
| 874 | 2929141115 | 2929138655 | Bacteria | 5810547 |
| 875 | 2933010002 | 2933006813 | Bacteria | 4912075 |
| 876 | 2933011546 | 2933011516 | Bacteria | 5439334 |
| 877 | 2933019917 | 2933016740 | Bacteria | 6355406 |
| 878 | 2933574728 | 2933570622 | Bacteria | 7023390 |
| 879 | 2933589333 | 2933586486 | Bacteria | 7667493 |
| 880 | 2933595966 | 2933594066 | Bacteria | 5594265 |
| 881 | 2933603481 | 2933599457 | Bacteria | 5858799 |
| 882 | 2935901224 | 2935894831 | Bacteria | 6620579 |
| 883 | 2935907497 | 2935901341 | Bacteria | 7341747 |
| 884 | 2936374813 | 2936367885 | Bacteria | 7324495 |
| 885 | 2936380505 | 2936375103 | Bacteria | 6652732 |
| 886 | 2936382327 | 2936381700 | Bacteria | 7006523 |
| 887 | 2936996748 | 2936996657 | Bacteria | 6298727 |
| 888 | 2937004758 | 2937002841 | Bacteria | 6934057 |
| 889 | 2937013489 | 2937009748 | Bacteria | 6746052 |
| 890 | 2937016732 | 2937016420 | Bacteria | 6782579 |
| 891 | 2937026592 | 2937023124 | Bacteria | 6815156 |
| 892 | 2937032303 | 2937029754 | Bacteria | 6424026 |
| 893 | 2937038289 | 2937036028 | Bacteria | 6846469 |
| 894 | 2937043899 | 2937042894 | Bacteria | 6741576 |
| 895 | 2937052571 | 2937049772 | Bacteria | 6757901 |
| 896 | 2937060135 | 2937056579 | Bacteria | 7107896 |
| 897 | 2937067982 | 2937063883 | Bacteria | 7199456 |
| 898 | 2937074262 | 2937071275 | Bacteria | 6984483 |
| 899 | 2937081766 | 2937078374 | Bacteria | 6610289 |
| 900 | 2937090359 | 2937084907 | Bacteria | 6618516 |
| 901 | 2937098375 | 2937091812 | Bacteria | 6979387 |
| 902 | 2937099102 | 2937098957 | Bacteria | 7249374 |
| 903 | 2937108928 | 2937106411 | Bacteria | 6947143 |
| 904 | 2937117336 | 2937113482 | Bacteria | 6505872 |
| 905 | 2937122464 | 2937119839 | Bacteria | 6597547 |
| 906 | 2937127314 | 2937126314 | Bacteria | 6771275 |
| 907 | 2939670112 | 2939669807 | Bacteria | 5028511 |
| 908 | 2941502646 | 2941499720 | Bacteria | 7599444 |
| 909 | 2954011534 | 2954011201 | Bacteria | 4762601 |
| 910 | 2957377433 | 2957375807 | Bacteria | 6425588 |
| 911 | 2957388275 | 2957382221 | Bacteria | 6737050 |
| 912 | 2957392203 | 2957388812 | Bacteria | 6778072 |
| 913 | 2957395820 | 2957395598 | Bacteria | 6822399 |
| 914 | 2957402618 | 2957402308 | Bacteria | 6741770 |
| 915 | 2957411098 | 2957408893 | Bacteria | 6558585 |
| 916 | 2957417826 | 2957415311 | Bacteria | 6991633 |
| 917 | 2957425185 | 2957422303 | Bacteria | 7172205 |
| 918 | 2957434154 | 2957430029 | Bacteria | 7022557 |
| 919 | 2957441051 | 2957437181 | Bacteria | 6568994 |
| 920 | 2957444136 | 2957443900 | Bacteria | 6869977 |
| 921 | 2957456728 | 2957450854 | Bacteria | 6765715 |
| 922 | 2957458933 | 2957457609 | Bacteria | 6967680 |
| 923 | 2957466962 | 2957464669 | Bacteria | 6568877 |
| 924 | 2957472869 | 2957471148 | Bacteria | 6797643 |
| 925 | 2957479223 | 2957478035 | Bacteria | 6756658 |
| 926 | 2957486512 | 2957484790 | Bacteria | 6703082 |
| 927 | 2957494951 | 2957491536 | Bacteria | 6695180 |
| 928 | 2957502810 | 2957498199 | Bacteria | 7126688 |
| 929 | 2957510048 | 2957505466 | Bacteria | 7253085 |
| 930 | 2960588149 | 2960584000 | Bacteria | 6864594 |
| 931 | 2960596727 | 2960591022 | Bacteria | 6622873 |
| 932 | 2960599602 | 2960597568 | Bacteria | 6550735 |
| 933 | 2960606959 | 2960603979 | Bacteria | 6898737 |
| 934 | 2960614447 | 2960610863 | Bacteria | 6691244 |
| 935 | 2960619301 | 2960617483 | Bacteria | 6727748 |
| 936 | 2960628261 | 2960624210 | Bacteria | 6875384 |
| 937 | 2960637681 | 2960631154 | Bacteria | 6732508 |
| 938 | 2960645397 | 2960637947 | Bacteria | 7296468 |
| 939 | 2960648857 | 2960645483 | Bacteria | 7211087 |
| 940 | 2960652894 | 2960652885 | Bacteria | 7083688 |
| 941 | 2960662543 | 2960660292 | Bacteria | 7041660 |
| 942 | 2960669272 | 2960667422 | Bacteria | 6763020 |
| 943 | 2960678753 | 2960674078 | Bacteria | 6609048 |
| 944 | 2960684801 | 2960680706 | Bacteria | 6624464 |
| 945 | 2960688967 | 2960687367 | Bacteria | 6535474 |
| 946 | 2964608445 | 2964607997 | Bacteria | 7101408 |
| 947 | 2964617274 | 2964615318 | Bacteria | 6809089 |
| 948 | 2964622191 | 2964621998 | Bacteria | 6834995 |
| 949 | 2964630757 | 2964628898 | Bacteria | 7083044 |
| 950 | 2964640350 | 2964636051 | Bacteria | 7091832 |
| 951 | 2964647543 | 2964643177 | Bacteria | 6820887 |
| 952 | 2964652017 | 2964649959 | Bacteria | 6675118 |
| 953 | 2964658511 | 2964656573 | Bacteria | 7100150 |
| 954 | 2964668697 | 2964663802 | Bacteria | 7019362 |
| 955 | 2964673814 | 2964670856 | Bacteria | 6851364 |
| 956 | 2964680119 | 2964678106 | Bacteria | 6792020 |
| 957 | 2964687518 | 2964685014 | Bacteria | 6839111 |
| 958 | 2964693421 | 2964691889 | Bacteria | 6802758 |
| 959 | 2964703842 | 2964698721 | Bacteria | 6765331 |
| 960 | 2964707298 | 2964705432 | Bacteria | 7114648 |
| 961 | 2964716002 | 2964712639 | Bacteria | 6695970 |
| 962 | 2964720110 | 2964719344 | Bacteria | 7286602 |
| 963 | 2967669129 | 2967664464 | Bacteria | 6948836 |
| 964 | 2967674183 | 2967671571 | Bacteria | 7021409 |
| 965 | 2967682327 | 2967678726 | Bacteria | 7264382 |
| 966 | 2967689009 | 2967686174 | Bacteria | 6678622 |
| 967 | 2967694736 | 2967693043 | Bacteria | 6804451 |
| 968 | 2967706366 | 2967699805 | Bacteria | 6854538 |
| 969 | 2967710834 | 2967706974 | Bacteria | 7186053 |
| 970 | 2967718101 | 2967714385 | Bacteria | 7000047 |
| 971 | 2967723947 | 2967721400 | Bacteria | 7073753 |
| 972 | 2967734524 | 2967728569 | Bacteria | 6641507 |
| 973 | 2967738596 | 2967735183 | Bacteria | 6827012 |
| 974 | 2967746565 | 2967742019 | Bacteria | 6794534 |
| 975 | 2967753371 | 2967748971 | Bacteria | 6733771 |
| 976 | 2967761440 | 2967755722 | Bacteria | 6814706 |
| 977 | 2967766177 | 2967762386 | Bacteria | 6923502 |
| 978 | 2967774888 | 2967769361 | Bacteria | 6587838 |
| 979 | 2967779397 | 2967775926 | Bacteria | 6738189 |
| 980 | 2970023194 | 2970019648 | Bacteria | 7072033 |
| 981 | 2970028427 | 2970026789 | Bacteria | 6785236 |
| 982 | 2970034846 | 2970033650 | Bacteria | 7118744 |
| 983 | 2970043882 | 2970040964 | Bacteria | 6731123 |
| 984 | 2970048065 | 2970047711 | Bacteria | 7088379 |
| 985 | 2970055211 | 2970054988 | Bacteria | 6611507 |
| 986 | 2970064124 | 2970061556 | Bacteria | 7099761 |
| 987 | 2970070133 | 2970068827 | Bacteria | 7123112 |
| 988 | 2970079868 | 2970076120 | Bacteria | 6697332 |
| 989 | 2970083037 | 2970082768 | Bacteria | 6183754 |
| 990 | 2970094948 | 2970088815 | Bacteria | 6933825 |
| 991 | 2970102468 | 2970095765 | Bacteria | 6936963 |
| 992 | 2970104945 | 2970102677 | Bacteria | 6812532 |
| 993 | 2970109582 | 2970109326 | Bacteria | 6863976 |
| 994 | 2970118762 | 2970116247 | Bacteria | 6501857 |
| 995 | 2970124928 | 2970122695 | Bacteria | 6625855 |
| 996 | 2970132583 | 2970129317 | Bacteria | 6806560 |
| 997 | 2970140190 | 2970136068 | Bacteria | 7207982 |
| 998 | 2970148335 | 2970143518 | Bacteria | 6446480 |
| 999 | 2970150029 | 2970149975 | Bacteria | 6779706 |
| 1000 | 2970161005 | 2970156795 | Bacteria | 7168044 |
| 1001 | 2970166203 | 2970164137 | Bacteria | 6861252 |
| 1002 | 2970172820 | 2970170962 | Bacteria | 6876229 |
| 1003 | 2970184028 | 2970177841 | Bacteria | 6768001 |
| 1004 | 2970184864 | 2970184632 | Bacteria | 7054431 |
| 1005 | 2970195157 | 2970191845 | Bacteria | 7032787 |
| 1006 | 2977522076 | 2977516862 | Bacteria | 6940108 |
| 1007 | 2977526899 | 2977523885 | Bacteria | 6960446 |
| 1008 | 2977533099 | 2977530762 | Bacteria | 6951399 |
| 1009 | 2977538279 | 2977537788 | Bacteria | 6929320 |
| 1010 | 2977546171 | 2977544691 | Bacteria | 6875412 |
| 1011 | 2977554069 | 2977551784 | Bacteria | 7125765 |
| 1012 | 2977565259 | 2977558990 | Bacteria | 6863948 |
| 1013 | 2977568002 | 2977565890 | Bacteria | 6901543 |
| 1014 | 2977572893 | 2977572785 | Bacteria | 6763888 |
| 1015 | 2977581791 | 2977579622 | Bacteria | 6772100 |
| 1016 | 2978971297 | 2978969890 | Bacteria | 5400756 |
| 1017 | 2979091547 | 2979089926 | Bacteria | 5670289 |
| 1018 | 2979097068 | 2979095461 | Bacteria | 5669583 |
| 1019 | 2979102790 | 2979100975 | Bacteria | 5423623 |
| 1020 | 2984509321 | 2984509177 | Bacteria | 5274802 |
| 1021 | 2984519979 | 2984518228 | Bacteria | 5277463 |
| 1022 | 2984537651 | 2984537506 | Bacteria | 5277481 |
| 1023 | 2984588442 | 2984587000 | Bacteria | 5263363 |
| 1024 | 2984604399 | 2984601300 | Bacteria | 5455244 |
| 1025 | 2989350382 | 2989349275 | Bacteria | 6349068 |
| 1026 | 2989354591 | 2989349275 | Bacteria | 6349068 |
| 1027 | 2989775196 | 2989771324 | Bacteria | 5605128 |
| 1028 | 2989780402 | 2989776772 | Bacteria | 4843317 |
| 1029 | 2996889265 | 2996887358 | Bacteria | 5795980 |
| 1030 | 2996894676 | 2996893221 | Bacteria | 5823108 |
| 1031 | 3005415428 | 3005409236 | Bacteria | 7188837 |
| 1032 | 3005449332 | 3005445848 | Bacteria | 6906074 |
| 1033 | 3005455636 | 3005452660 | Bacteria | 5889319 |
| 1034 | 3005457942 | 3005452660 | Bacteria | 5889319 |
| 1035 | 639650052 | 639633055 | Bacteria | 7751309 |
| 1036 | 643823356 | 643692032 | Bacteria | 6891900 |
| 1037 | 648739772 | 648276728 | Bacteria | 6968865 |
| 1038 | 650842889 | 650716007 | Bacteria | 5573770 |
| 1039 | 8003574411 | 8003570095 | Bacteria | 5747666 |
| 1040 | 8003996031 | 8003992118 | Bacteria | 7266902 |
| 1041 | 8004003790 | 8003999396 | Bacteria | 7063185 |
| 1042 | 8005249509 | 8005246636 | Bacteria | 4933972 |
| 1043 | 8005264157 | 8005258706 | Bacteria | 6184835 |
| 1044 | 8005282070 | 8005275841 | Bacteria | 6929066 |
| 1045 | 8005285114 | 8005282627 | Bacteria | 6675747 |
| 1046 | 8005294209 | 8005289223 | Bacteria | 6634003 |
| 1047 | 8005306622 | 8005301065 | Bacteria | 6614431 |
| 1048 | 8005309444 | 8005307578 | Bacteria | 7395396 |
| 1049 | 8005318668 | 8005314921 | Bacteria | 7072929 |
| 1050 | 8005323792 | 8005321885 | Bacteria | 5795980 |
| 1051 | 8005382730 | 8005376324 | Bacteria | 6590079 |
| 1052 | 8005383787 | 8005382845 | Bacteria | 6732062 |
| 1053 | 8005401113 | 8005395548 | Bacteria | 6806915 |
| 1054 | 8005434067 | 8005430974 | Bacteria | 6689030 |
| 1055 | 8005464671 | 8005460587 | Bacteria | 7157962 |
| 1056 | 8005488448 | 8005484373 | Bacteria | 6297373 |
| 1057 | 8005501720 | 8005497431 | Bacteria | 6477605 |
| 1058 | 8005547054 | 8005542996 | Bacteria | 7077758 |
| 1059 | 8005559109 | 8005556819 | Bacteria | 6908598 |
| 1060 | 8005566832 | 8005563573 | Bacteria | 7153261 |
| 1061 | 8005574890 | 8005570704 | Bacteria | 6957481 |
| 1062 | 8005623074 | 8005619151 | Bacteria | 7030230 |
| 1063 | 8005631618 | 8005626139 | Bacteria | 6534237 |
| 1064 | 8005673142 | 8005668836 | Bacteria | 6953162 |
| 1065 | 8005682156 | 8005682033 | Bacteria | 6726518 |
| 1066 | 8005693682 | 8005688590 | Bacteria | 6610080 |
| 1067 | 8005700922 | 8005695170 | Bacteria | 6912330 |
| 1068 | 8018133561 | 8018127388 | Bacteria | 7351159 |
| 1069 | 8018152089 | 8018150411 | Bacteria | 5549903 |
| 1070 | 8018170275 | 8018163183 | Bacteria | 7277977 |
| 1071 | 8018178410 | 8018176218 | Bacteria | 6896178 |
| 1072 | 8023687491 | 8023680758 | Bacteria | 7729763 |
| 1073 | 8024482007 | 8024479707 | Bacteria | 6954785 |
| 1074 | 8024486967 | 8024486573 | Bacteria | 6540512 |
| 1075 | 8024505881 | 8024501048 | Bacteria | 6427847 |
| 1076 | 8046773175 | 8046767195 | Bacteria | 7547379 |
| 1077 | 8049296090 | 8049293176 | Bacteria | 6128433 |
| 1078 | 8054465265 | 8054460903 | Bacteria | 4872905 |
| 1079 | 8054559365 | 8054558443 | Bacteria | 5204801 |
| 1080 | 8056381643 | 8056375014 | Bacteria | 7006639 |
| 1081 | 8056387080 | 8056382006 | Bacteria | 6408074 |
| 1082 | 8056876222 | 8056875544 | Bacteria | 4355797 |
| 1083 | 8057581088 | 8057575449 | Bacteria | 7367519 |
| 1084 | 8057877047 | 8057874678 | Bacteria | 7494653 |
| 1085 | JGI24740J21852_10001156 | |||
| 1086 | JGI24740J21852_10036884 | |||
| 1087 | JGI25155J39150_1000012 | |||
| 1088 | JGI25156J39149_1000036 | |||
| 1089 | JGI25162J39368_1000674 | |||
| 1090 | JGI25154J39366_1000033 | |||
| 1091 | JGI25157J39369_1000457 | |||
| 1092 | JGI25152J39213_1001181 | |||
| 1093 | JGI25152J39213_1001905 | |||
| 1094 | JGI25152J39213_1002964 | |||
| 1095 | JGI25152J39213_1007241 | |||
| 1096 | JGI25152J39213_1016687 | |||
| 1097 | JGI25150J39212_1000063 | |||
| 1098 | JGI25150J39212_1005441 | |||
| 1099 | JGI25150J39212_1006207 | |||
| 1100 | JGI25150J39212_1014882 | |||
| 1101 | JGI25159J45721_1000626 | |||
| 1102 | JGI25151J46595_10000140 | |||
| 1103 | JGI25151J46595_10001756 | |||
| 1104 | JGI25151J46595_10013176 | |||
| 1105 | JGI25165J46597_1000653 | |||
| 1106 | JGI25165J46597_1000719 | |||
| 1107 | JGI25153J46596_10019404 | |||
| 1108 | JGI25153J46596_10041665 | |||
| 1109 | JGI25160J50197_1001017 | |||
| 1110 | JGI25160J50197_1001914 | |||
| 1111 | JGI25160J50197_1017789 | |||
| 1112 | JGI25161J50226_1001626 | |||
| 1113 | JGI25161J50226_1001837 | |||
| 1114 | Ga0055526_1001694 | |||
| 1115 | Ga0055526_1008634 | |||
| 1116 | Ga0055526_1009413 | |||
| 1117 | Ga0055526_1016484 | |||
| 1118 | Ga0055526_1025675 | |||
| 1119 | Ga0055524_1000790 | |||
| 1120 | Ga0055524_1001796 | |||
| 1121 | Ga0055524_1005331 | |||
| 1122 | Ga0055536_1004141 | |||
| 1123 | Ga0055536_1007318 | |||
| 1124 | Ga0055528_1000548 | |||
| 1125 | Ga0055528_1000886 | |||
| 1126 | Ga0055528_1005173 | |||
| 1127 | Ga0055540_1000548 | |||
| 1128 | Ga0055540_1018076 | |||
| 1129 | Ga0055531_10004650 | |||
| 1130 | Ga0055531_10007450 | |||
| 1131 | Ga0058692_1001450 | |||
| 1132 | Ga0055543_1000892 | |||
| 1133 | Ga0055543_1001407 | |||
| 1134 | Ga0065165_1002701 | |||
| 1135 | Ga0065165_1005489 | |||
| 1136 | Ga0065165_1009147 | |||
| 1137 | Ga0065704_10033657 | |||
| 1138 | Ga0070670_100002696 | |||
| 1139 | Ga0070668_100038532 | |||
| 1140 | Ga0070668_100325906 | |||
| 1141 | Ga0070669_100279631 | |||
| 1142 | Ga0070671_100042038 | |||
| 1143 | Ga0070685_10104509 | |||
| 1144 | Ga0070665_100057236 | |||
| 1145 | Ga0070665_100313075 | |||
| 1146 | Ga0068852_100083709 | |||
| 1147 | Ga0081540_1007912 | |||
| 1148 | Ga0075365_10000600 | |||
| 1149 | Ga0075365_10007867 | |||
| 1150 | Ga0075365_10087883 | |||
| 1151 | Ga0075368_10006634 | |||
| 1152 | Ga0075368_10023539 | |||
| 1153 | Ga0075363_100095763 | |||
| 1154 | Ga0075362_10002533 | |||
| 1155 | Ga0075367_10008288 | |||
| 1156 | Ga0075367_10019332 | |||
| 1157 | Ga0075369_10006833 | |||
| 1158 | Ga0075369_10009672 | |||
| 1159 | Ga0075366_10017993 | |||
| 1160 | Ga0075370_10000839 | |||
| 1161 | Ga0079104_1000042 | |||
| 1162 | Ga0079104_1003298 | |||
| 1163 | Ga0099826_10000123 | |||
| 1164 | Ga0099826_10003580 | |||
| 1165 | Ga0105251_10027023 | |||
| 1166 | Ga0105240_10000019 | |||
| 1167 | Ga0105243_10006354 | |||
| 1168 | Ga0105248_10052789 | |||
| 1169 | Ga0105237_10004254 | |||
| 1170 | Ga0123341_1000015 | |||
| 1171 | Ga0123341_1043929 | |||
| 1172 | Ga0123342_1003064 | |||
| 1173 | Ga0123342_1008248 | |||
| 1174 | Ga0105239_10018520 | |||
| 1175 | Ga0105239_10241070 | |||
| 1176 | Ga0157373_10003853 | |||
| 1177 | Ga0157373_10033005 | |||
| 1178 | Ga0157371_10000002 | |||
| 1179 | Ga0157371_10021215 | |||
| 1180 | Ga0157370_10002915 | |||
| 1181 | Ga0157369_10106762 | |||
| 1182 | Ga0157369_10155347 | |||
| 1183 | Ga0171463_1022 | |||
| 1184 | Ga0182005_1007319 | |||
| 1185 | Ga0183363_1124 | |||
| 1186 | Ga0163161_10295066 | |||
| 1187 | Ga0214543_1000025 | |||
| 1188 | Ga0213872_10014331 | |||
| 1189 | Ga0228711_1000020 | |||
| 1190 | Ga0228710_1000012 | |||
| 1191 | Ga0209435_100005 | |||
| 1192 | Ga0209436_103526 | |||
| 1193 | Ga0209437_100078 | |||
| 1194 | Ga0207425_1000080 | |||
| 1195 | Ga0207425_1002325 | |||
| 1196 | Ga0207425_1009181 | |||
| 1197 | Ga0207425_1022926 | |||
| 1198 | Ga0209646_1000011 | |||
| 1199 | Ga0209026_1000008 | |||
| 1200 | Ga0209677_101144 | |||
| 1201 | Ga0209759_1000004 | |||
| 1202 | Ga0209129_1000195 | |||
| 1203 | Ga0209129_1000199 | |||
| 1204 | Ga0209129_1002007 | |||
| 1205 | Ga0209129_1003568 | |||
| 1206 | Ga0209129_1003611 | |||
| 1207 | Ga0209129_1005580 | |||
| 1208 | Ga0209233_1000163 | |||
| 1209 | Ga0209233_1000299 | |||
| 1210 | Ga0209673_1000037 | |||
| 1211 | Ga0209673_1000320 | |||
| 1212 | Ga0209673_1000880 | |||
| 1213 | Ga0209673_1000924 | |||
| 1214 | Ga0209673_1004391 | |||
| 1215 | Ga0209673_1011468 | |||
| 1216 | Ga0209130_1000079 | |||
| 1217 | Ga0209130_1011944 | |||
| 1218 | Ga0209130_1013537 | |||
| 1219 | Ga0209675_1015513 | |||
| 1220 | Ga0209676_1000093 | |||
| 1221 | Ga0209676_1005216 | |||
| 1222 | Ga0209676_1015915 | |||
| 1223 | Ga0209025_1000052 | |||
| 1224 | Ga0209025_1000332 | |||
| 1225 | Ga0209025_1000354 | |||
| 1226 | Ga0209025_1000566 | |||
| 1227 | Ga0209025_1000666 | |||
| 1228 | Ga0209025_1003632 | |||
| 1229 | Ga0209025_1007212 | |||
| 1230 | Ga0209025_1017809 | |||
| 1231 | Ga0209025_1051272 | |||
| 1232 | Ga0209025_1059426 | |||
| 1233 | Ga0209025_1070635 | |||
| 1234 | Ga0209564_1000345 | |||
| 1235 | Ga0209564_1000869 | |||
| 1236 | Ga0209564_1001903 | |||
| 1237 | Ga0209564_1009432 | |||
| 1238 | Ga0209758_1000105 | |||
| 1239 | Ga0209758_1000263 | |||
| 1240 | Ga0209758_1001323 | |||
| 1241 | Ga0209758_1001789 | |||
| 1242 | Ga0209758_1002280 | |||
| 1243 | Ga0209758_1002342 | |||
| 1244 | Ga0209758_1008256 | |||
| 1245 | Ga0209050_1003774 | |||
| 1246 | Ga0209050_1011010 | |||
| 1247 | Ga0209256_1000310 | |||
| 1248 | Ga0209256_1000343 | |||
| 1249 | Ga0209256_1000348 | |||
| 1250 | Ga0209256_1001088 | |||
| 1251 | Ga0209256_1003669 | |||
| 1252 | Ga0209256_1012405 | |||
| 1253 | Ga0207426_1000167 | |||
| 1254 | Ga0207426_1000296 | |||
| 1255 | Ga0207426_1002918 | |||
| 1256 | Ga0209051_1000236 | |||
| 1257 | Ga0209051_1000517 | |||
| 1258 | Ga0209051_1009994 | |||
| 1259 | Ga0209051_1010221 | |||
| 1260 | Ga0209257_1004486 | |||
| 1261 | Ga0209257_1006024 | |||
| 1262 | Ga0209257_1008087 | |||
| 1263 | Ga0209257_1030459 | |||
| 1264 | Ga0207688_10034324 | |||
| 1265 | Ga0207695_10000049 | |||
| 1266 | Ga0207671_10000107 | |||
| 1267 | Ga0207650_10001919 | |||
| 1268 | Ga0207709_10106244 | |||
| 1269 | Ga0207711_10105120 | |||
| 1270 | Ga0207668_10020566 | |||
| 1271 | Ga0207678_10110034 | |||
| 1272 | Ga0207678_10186721 | |||
| 1273 | Ga0207702_10082609 | |||
| 1274 | Ga0209281_1000138 | |||
| 1275 | Ga0209281_1000194 | |||
| 1276 | Ga0209281_1000446 | |||
| 1277 | Ga0209371_1000003 | |||
| 1278 | Ga0209371_1002844 | |||
| 1279 | Ga0209282_1000020 | |||
| 1280 | Ga0209282_1000176 | |||
| 1281 | Ga0209282_1015163 | |||
| 1282 | Ga0209813_10009431 | |||
| 1283 | Ga0268266_10033214 | |||
| 1284 | Ga0268266_10086667 | |||
| 1285 | Ga0268266_10313451 | |||
| 1286 | Ga0268266_10412311 | |||
| 1287 | Ga0265318_10030678 | |||
| 1288 | Ga0307515_10000145 | |||
| 1289 | Ga0307515_10000263 | |||
| 1290 | Ga0307515_10093119 | |||
| 1291 | Ga0307515_10151926 | |||
| 1292 | Ga0268256_1000004 | |||
| 1293 | Ga0265330_10034995 | |||
| 1294 | Ga0265328_10004940 | |||
| 1295 | Ga0265325_10004012 | |||
| 1296 | Ga0265325_10006401 | |||
| 1297 | Ga0265340_10000794 | |||
| 1298 | Ga0265340_10018114 | |||
| 1299 | Ga0265340_10034019 | |||
| 1300 | Ga0265339_10002113 | |||
| 1301 | Ga0265339_10011130 | |||
| 1302 | Ga0265339_10033081 | |||
| 1303 | Ga0265316_10016672 | |||
| 1304 | Ga0265316_10044429 | |||
| 1305 | Ga0265316_10187407 | |||
| 1306 | Ga0307513_10003087 | |||
| 1307 | Ga0307513_10003471 | |||
| 1308 | Ga0307513_10053661 | |||
| 1309 | Ga0307408_100016058 | |||
| 1310 | Ga0265313_10000371 | |||
| 1311 | Ga0265313_10008172 | |||
| 1312 | Ga0265313_10070962 | |||
| 1313 | Ga0265314_10025242 | |||
| 1314 | Ga0265314_10030223 | |||
| 1315 | Ga0265314_10062963 | |||
| 1316 | Ga0265314_10123438 | |||
| 1317 | Ga0265342_10014444 | |||
| 1318 | Ga0265342_10015031 | |||
| 1319 | Ga0307516_10016649 | |||
| 1320 | Ga0307516_10022527 | |||
| 1321 | Ga0307516_10138676 | |||
| 1322 | Ga0307405_10001367 | |||
| 1323 | Ga0307405_10018122 | |||
| 1324 | Ga0307406_10023570 | |||
| 1325 | Ga0307406_10249820 | |||
| 1326 | Ga0307412_10004368 | |||
| 1327 | Ga0307412_10014315 | |||
| 1328 | Ga0315914_1000031 | |||
| 1329 | Ga0307409_100179951 | |||
| 1330 | Ga0307414_10128114 | |||
| 1331 | Ga0307510_10083251 | |||
| 1332 | Ga0315913_1000010 | |||
| 1333 | Ga0315915_1000007 | |||
| 1334 | Ga0373943_0133380 | |||
| 1335 | Ga0373935_0024645 | |||
| 1336 | Ga0373927_0000047 | |||
| 1337 | Ga0373925_0001420 | |||
| 1338 | Ga0395905_0001828 | |||
| 1339 | Ga0395905_0006179 | |||
| 1340 | Ga0395905_0049808 | |||
| 1341 | Ga0436360_1304194 | |||
| 1342 | Ga0436361_0563451 | |||
| 1343 | Ga0439436_0025655 | |||
| 1344 | Ga0439439_0012905 | |||
| 1345 | Ga0439465_0008881 | |||
| 1346 | Ga0439465_0015760 | |||
| 1347 | Ga0451787_487060 | |||
| 1348 | Ga0451798_0290064 | |||
| 1349 | Ga0451839_1092244 | |||
| 1350 | Ga0439449_0044724 | |||
| 1351 | Ga0439434_0030723 | |||
| 1352 | Ga0466972_0028935 | |||
| 1353 | Ga0466965_0061260 | |||
| 1354 | Ga0466970_0013042 | |||
| 1355 | Ga0466960_0065776 | |||
| 1356 | Ga0495638_0000591 | |||
| 1357 | Ga0495638_0033311 | |||
| 1358 | Ga0495638_0190347 | |||
| 1359 | Ga0495651_0103046 | |||
| 1360 | Ga0495605_0014574 | |||
| 1361 | Ga0495605_0025162 | |||
| 1362 | Ga0495662_0025297 | |||
| 1363 | Ga0495585_0042765 | |||
| 1364 | Ga0495585_0047769 | |||
| 1365 | Ga0495585_0082527 | |||
| 1366 | Ga0495583_0018919 | |||
| 1367 | Ga0495583_0022293 | |||
| 1368 | Ga0495606_0002219 | |||
| 1369 | Ga0495606_0013151 | |||
| 1370 | Ga0495606_0126417 | |||
| 1371 | Ga0495610_0006787 | |||
| 1372 | Ga0495610_0012381 | |||
| 1373 | Ga0495610_0087136 | |||
| 1374 | Ga0495620_0039077 | |||
| 1375 | Ga0495631_0013351 | |||
| 1376 | Ga0495632_0006479 | |||
| 1377 | Ga0495632_0014663 | |||
| 1378 | Ga0495632_0019658 | |||
| 1379 | Ga0495643_0070462 | |||
| 1380 | Ga0495648_0072972 | |||
| 1381 | Ga0495648_0076014 | |||
| 1382 | Ga0495654_0001861 | |||
| 1383 | Ga0495609_0014234 | |||
| 1384 | Ga0495609_0017098 | |||
| 1385 | Ga0495597_0086343 | |||
| 1386 | Ga0495633_0008943 | |||
| 1387 | Ga0495633_0063371 | |||
| 1388 | Ga0495656_0007577 | |||
| 1389 | Ga0495668_0032402 | |||
| 1390 | Ga0495668_0065935 | |||
| 1391 | Ga0495611_0028580 | |||
| 1392 | Ga0495625_0016371 | |||
| 1393 | Ga0495625_0041947 | |||
| 1394 | Ga0495625_0121150 | |||
| 1395 | Ga0495625_0139187 | |||
| 1396 | Ga0495588_0001719 | |||
| 1397 | Ga0495624_0093949 | |||
| 1398 | Ga0495649_0047454 | |||
| 1399 | Ga0495660_0014687 | |||
| 1400 | Ga0495660_0031536 | |||
| 1401 | Ga0495604_0025551 | |||
| 1402 | Ga0495686_0002643 | |||
| 1403 | Ga0495686_0023395 | |||
| 1404 | Ga0495686_0044801 | |||
| 1405 | Ga0495686_0051091 | |||
| 1406 | Ga0495626_0094034 | |||
| 1407 | Ga0496101_0147835 | |||
| 1408 | Ga0496102_0211453 | |||
| 1409 | Ga0496104_0200868 | |||
| 1410 | Ga0496105_0148638 | |||
| 1411 | Ga0496106_0015899 | |||
| 1412 | Ga0496110_0047664 | |||
| 1413 | Ga0496110_0166737 | |||
| 1414 | Ga0496111_0000570 | |||
| 1415 | Ga0496116_0000026 | |||
| 1416 | Ga0496116_0005540 | |||
| 1417 | Ga0496116_0012007 | |||
| 1418 | Ga0496116_0012328 | |||
| 1419 | Ga0496116_0040317 | |||
| 1420 | Ga0496116_0051820 | |||
| 1421 | Ga0496117_0000016 | |||
| 1422 | Ga0496117_0002458 | |||
| 1423 | Ga0496117_0028194 | |||
| 1424 | Ga0496117_0083821 | |||
| 1425 | Ga0496117_0091385 | |||
| 1426 | Ga0496117_0185452 | |||
| 1427 | Ga0496118_0004029 | |||
| 1428 | Ga0496118_0010916 | |||
| 1429 | Ga0496118_0037836 | |||
| 1430 | Ga0496118_0046435 | |||
| 1431 | Ga0496118_0046573 | |||
| 1432 | Ga0496118_0091661 | |||
| 1433 | Ga0496119_0004065 | |||
| 1434 | Ga0496119_0018854 | |||
| 1435 | Ga0496119_0023424 | |||
| 1436 | Ga0496119_0064058 | |||
| 1437 | Ga0496119_0076320 | |||
| 1438 | Ga0496120_0000056 | |||
| 1439 | Ga0496120_0002742 | |||
| 1440 | Ga0496120_0012085 | |||
| 1441 | Ga0496120_0035007 | |||
| 1442 | Ga0496120_0079917 | |||
| 1443 | Ga0496121_0000003 | |||
| 1444 | Ga0496121_0000180 | |||
| 1445 | Ga0496121_0056708 | |||
| 1446 | Ga0496121_0065712 | |||
| 1447 | Ga0496121_0091542 | |||
| 1448 | Ga0496121_0128317 | |||
| 1449 | Ga0496121_0153971 | |||
| 1450 | Ga0496121_0172481 | |||
| 1451 | Ga0496121_0217723 | |||
| 1452 | Ga0496122_0000002 | |||
| 1453 | Ga0496122_0000024 | |||
| 1454 | Ga0496122_0000107 | |||
| 1455 | Ga0496122_0017729 | |||
| 1456 | Ga0496122_0036472 | |||
| 1457 | Ga0496122_0049824 | |||
| 1458 | Ga0496122_0062614 | |||
| 1459 | Ga0496122_0065454 | |||
| 1460 | Ga0496122_0096660 | |||
| 1461 | Ga0496122_0099727 | |||
| 1462 | Ga0496122_0128951 | |||
| 1463 | Ga0496123_0000002 | |||
| 1464 | Ga0496123_0000063 | |||
| 1465 | Ga0496123_0000086 | |||
| 1466 | Ga0496123_0020993 | |||
| 1467 | Ga0496123_0031131 | |||
| 1468 | Ga0496123_0046162 | |||
| 1469 | Ga0496123_0051434 | |||
| 1470 | Ga0496123_0064470 | |||
| 1471 | Ga0496123_0166873 | |||
| 1472 | Ga0496124_0000091 | |||
| 1473 | Ga0496124_0001850 | |||
| 1474 | Ga0496124_0003986 | |||
| 1475 | Ga0496124_0010962 | |||
| 1476 | Ga0496124_0018448 | |||
| 1477 | Ga0496124_0087766 | |||
| 1478 | Ga0496124_0118612 | |||
| 1479 | Ga0496124_0120742 | |||
| 1480 | Ga0496124_0140989 | |||
| 1481 | Ga0496124_0149069 | |||
| 1482 | Ga0496124_0206491 | |||
| 1483 | Ga0496124_0295217 | |||
| 1484 | Ga0496125_0000262 | |||
| 1485 | Ga0496125_0000323 | |||
| 1486 | Ga0496125_0000477 | |||
| 1487 | Ga0496125_0000833 | |||
| 1488 | Ga0496125_0003888 | |||
| 1489 | Ga0496125_0017666 | |||
| 1490 | Ga0496125_0084817 | |||
| 1491 | Ga0496125_0104148 | |||
| 1492 | Ga0496126_0000059 | |||
| 1493 | Ga0496126_0000434 | |||
| 1494 | Ga0496126_0123891 | |||
| 1495 | Ga0496126_0145353 | |||
| 1496 | Ga0495678_022082 | |||
| 1497 | Ga0495678_028523 | |||
| 1498 | Ga0501031_0021483 | |||
| 1499 | Ga0501031_0054122 | |||
| 1500 | Ga0501031_0191332 | |||
| 1501 | Ga0501032_0000013 | |||
| 1502 | Ga0501032_0079944 | |||
| 1503 | Ga0501032_0226446 | |||
| 1504 | Ga0501033_0000361 | |||
| 1505 | Ga0501033_0000522 | |||
| 1506 | Ga0501033_0061697 | |||
| 1507 | Ga0501033_0218368 | |||
| 1508 | Ga0501034_0000054 | |||
| 1509 | Ga0501034_0096196 | |||
| 1510 | Ga0501034_0173063 | |||
| 1511 | Ga0501036_0000828 | |||
| 1512 | Ga0501037_0005064 | |||
| 1513 | Ga0501037_0051215 | |||
| 1514 | Ga0501037_0070049 | |||
| 1515 | Ga0501037_0070716 | |||
| 1516 | Ga0501037_0142774 | |||
| 1517 | Ga0501038_0000018 | |||
| 1518 | Ga0501039_0000152 | |||
| 1519 | Ga0501039_0101641 | |||
| 1520 | Ga0501043_0000014 | |||
| 1521 | Ga0501043_0098352 | |||
| 1522 | Ga0501043_0148584 | |||
| 1523 | Ga0501043_0197794 | |||
| 1524 | Ga0501047_0016929 | |||
| 1525 | Ga0501047_0030248 | |||
| 1526 | Ga0501047_0163998 | |||
| 1527 | Ga0501047_0167105 | |||
| 1528 | Ga0501047_0244511 | |||
| 1529 | Ga0501067_0091524 | |||
| 1530 | Ga0501069_0145120 | |||
| 1531 | Ga0501070_0041228 | |||
| 1532 | Ga0501070_0051047 | |||
| 1533 | Ga0501070_0136494 | |||
| 1534 | Ga0501070_0335479 | |||
| 1535 | Ga0501074_0227283 | |||
| 1536 | Ga0501074_0281648 | |||
| 1537 | Ga0501261_006749 | |||
| 1538 | Ga0501079_0199236 | |||
| 1539 | Ga0501083_0055471 | |||
| 1540 | Ga0501083_0174984 | |||
| 1541 | Ga0501035_0000019 | |||
| 1542 | Ga0501035_0008142 | |||
| 1543 | Ga0501035_0021342 | |||
| 1544 | Ga0501035_0078684 | |||
| 1545 | Ga0501044_0092425 | |||
| 1546 | Ga0501044_0125105 | |||
| 1547 | Ga0501044_0212875 | |||
| 1548 | Ga0501045_0190772 | |||
| 1549 | nmdc:mga03n38_57874_c1 | |||
| 1550 | nmdc:mga00v17_107176_c1 | |||
| 1551 | nmdc:mga00v17_230_c1 | |||
| 1552 | nmdc:mga00v17_337_c1 | |||
| 1553 | nmdc:mga0yw44_9347_c2 | |||
| 1554 | nmdc:mga0k408_7537_c1 | |||
| 1555 | nmdc:mga06z11_66756_c1 | |||
| 1556 | nmdc:mga04h51_24749_c1 | |||
| 1557 | nmdc:mga0sz30_354_c1 | |||
| 1558 | nmdc:mga0sz30_8054_c1 | |||
| 1559 | Ga0500610_0085237 | |||
| 1560 | Ga0500578_0032372 | |||
| 1561 | Ga0500578_0085480 | |||
| 1562 | Ga0500651_0124156 | |||
| 1563 | Ga0500654_068947 | |||
| 1564 | Ga0500557_000023 | |||
| 1565 | Ga0500560_000252 | |||
| 1566 | Ga0500569_001403 | |||
| 1567 | Ga0500569_013694 | |||
| 1568 | Ga0500572_016677 | |||
| 1569 | Ga0500594_0004142 | |||
| 1570 | Ga0500594_0023448 | |||
| 1571 | Ga0500607_044592 | |||
| 1572 | Ga0500614_029953 | |||
| 1573 | Ga0500618_000109 | |||
| 1574 | Ga0500618_001997 | |||
| 1575 | Ga0500626_103833 | |||
| 1576 | Ga0500642_0000059 | |||
| 1577 | Ga0500652_077096 | |||
| 1578 | Ga0500658_0001045 | |||
| 1579 | Ga0500658_0047640 | |||
| 1580 | Ga0500659_0099848 | |||
| 1581 | Ga0500559_0004001 | |||
| 1582 | Ga0500559_0073470 | |||
| 1583 | Ga0500561_0000248 | |||
| 1584 | Ga0500568_0005458 | |||
| 1585 | Ga0500568_0020932 | |||
| 1586 | Ga0500590_005965 | |||
| 1587 | Ga0500590_018538 | |||
| 1588 | Ga0500604_0034151 | |||
| 1589 | Ga0500616_0002051 | |||
| 1590 | Ga0500616_0035606 | |||
| 1591 | Ga0500619_000785 | |||
| 1592 | Ga0500622_0001743 | |||
| 1593 | Ga0500622_0005319 | |||
| 1594 | Ga0500627_0014296 | |||
| 1595 | Ga0500634_0038398 | |||
| 1596 | Ga0500634_0059534 | |||
| 1597 | Ga0500636_0000001 | |||
| 1598 | Ga0500636_0000014 | |||
| 1599 | Ga0500636_0006275 | |||
| 1600 | Ga0500637_0072703 | |||
| 1601 | Ga0500625_001971 | |||
| 1602 | Ga0501082_0090721 | |||
| 1603 | Ga0501082_0134700 | |||
| 1604 | 2644006518 | |||
| 1605 | 2508731439 | |||
| 1606 | 2509077049 | |||
| 1607 | 2509111012 | |||
| 1608 | 2509379344 | |||
| 1609 | 2509389784 | |||
| 1610 | 2509447962 | |||
| 1611 | 2510134900 | |||
| 1612 | 2510305736 | |||
| 1613 | 2510896311 | |||
| 1614 | 2511174162 | |||
| 1615 | 2511187238 | |||
| 1616 | 2511195941 | |||
| 1617 | 2511391285 | |||
| 1618 | 2511497510 | |||
| 1619 | 2512529958 | |||
| 1620 | 2512969812 | |||
| 1621 | 2513572663 | |||
| 1622 | 2513580105 | |||
| 1623 | 2513581887 | |||
| 1624 | 2513599858 | |||
| 1625 | 2513603030 | |||
| 1626 | 2513615301 | |||
| 1627 | 2513631261 | |||
| 1628 | 2513710844 | |||
| 1629 | 2513867013 | |||
| 1630 | 2513884616 | |||
| 1631 | 2513901386 | |||
| 1632 | 2513908127 | |||
| 1633 | 2513927003 | |||
| 1634 | 2513998140 | |||
| 1635 | 2514004599 | |||
| 1636 | 2514023201 | |||
| 1637 | 2515113983 | |||
| 1638 | 2515609787 | |||
| 1639 | 2515639182 | |||
| 1640 | 2515642970 | |||
| 1641 | 2515656716 | |||
| 1642 | 2515743659 | |||
| 1643 | 2516896836 | |||
| 1644 | 2517037615 | |||
| 1645 | 2517077902 | |||
| 1646 | 2517096698 | |||
| 1647 | 2517410413 | |||
| 1648 | 2517565308 | |||
| 1649 | 2520377970 | |||
| 1650 | 2524451380 | |||
| 1651 | 2530647011 | |||
| 1652 | 2535484300 | |||
| 1653 | 2535519366 | |||
| 1654 | 2537876531 | |||
| 1655 | 2551675489 | |||
| 1656 | 2551688438 | |||
| 1657 | 2551691905 | |||
| 1658 | 2551701818 | |||
| 1659 | 2551708395 | |||
| 1660 | 2551720333 | |||
| 1661 | 2551727215 | |||
| 1662 | 2551744856 | |||
| 1663 | 2554245699 | |||
| 1664 | 2558861528 | |||
| 1665 | 2559296472 | |||
| 1666 | 2585168088 | |||
| 1667 | 2585202407 | |||
| 1668 | 2585224722 | |||
| 1669 | 2585227889 | |||
| 1670 | 2585255536 | |||
| 1671 | 2585269705 | |||
| 1672 | 2585280256 | |||
| 1673 | 2585322533 | |||
| 1674 | 2585388633 | |||
| 1675 | 2585392482 | |||
| 1676 | 2585402285 | |||
| 1677 | 2585529020 | |||
| 1678 | 2585532485 | |||
| 1679 | 2585540961 | |||
| 1680 | 2585547278 | |||
| 1681 | 2585554498 | |||
| 1682 | 2585822415 | |||
| 1683 | 2585839723 | |||
| 1684 | 2585845447 | |||
| 1685 | 2585898981 | |||
| 1686 | 2585997220 | |||
| 1687 | 2586001821 | |||
| 1688 | 2599334701 | |||
| 1689 | 2599420503 | |||
| 1690 | 2599603039 | |||
| 1691 | 2599720056 | |||
| 1692 | 2600194423 | |||
| 1693 | 2600373591 | |||
| 1694 | 2601610656 | |||
| 1695 | 2601747014 | |||
| 1696 | 2616295618 | |||
| 1697 | 2616307444 | |||
| 1698 | 2617383443 | |||
| 1699 | 2643776171 | |||
| 1700 | 2643794618 | |||
| 1701 | 2643809471 | |||
| 1702 | 2643814620 | |||
| 1703 | 2643854223 | |||
| 1704 | 2643922222 | |||
| 1705 | 2644048363 | |||
| 1706 | 2644066867 | |||
| 1707 | 2644108420 | |||
| 1708 | 2644147609 | |||
| 1709 | 2644195962 | |||
| 1710 | 2644201725 | |||
| 1711 | 2644209831 | |||
| 1712 | 2644241934 | |||
| 1713 | 2644299297 | |||
| 1714 | 2644309472 | |||
| 1715 | 2644331769 | |||
| 1716 | 2644375812 | |||
| 1717 | 2644418070 | |||
| 1718 | 2644451325 | |||
| 1719 | 2644481165 | |||
| 1720 | 2644496421 | |||
| 1721 | 2644500142 | |||
| 1722 | 2644520599 | |||
| 1723 | 2644542150 | |||
| 1724 | 2644615975 | |||
| 1725 | 2644653382 | |||
| 1726 | 2644657525 | |||
| 1727 | 2644673275 | |||
| 1728 | 2644691670 | |||
| 1729 | 2671112236 | |||
| 1730 | 2719182652 | |||
| 1731 | 2719387323 | |||
| 1732 | 2719666968 | |||
| 1733 | 2719733370 | |||
| 1734 | 2720493388 | |||
| 1735 | 2720614859 | |||
| 1736 | 2720621632 | |||
| 1737 | 2720632960 | |||
| 1738 | 2720776684 | |||
| 1739 | 2721148765 | |||
| 1740 | 2721160149 | |||
| 1741 | 2721165578 | |||
| 1742 | 2721400958 | |||
| 1743 | 2722841748 | |||
| 1744 | 2723028272 | |||
| 1745 | 2723561900 | |||
| 1746 | 2723568532 | |||
| 1747 | 2724039771 | |||
| 1748 | 2724046126 | |||
| 1749 | 2724091291 | |||
| 1750 | 2724105797 | |||
| 1751 | 2724111623 | |||
| 1752 | 2725945409 | |||
| 1753 | 2730109208 | |||
| 1754 | 2730165887 | |||
| 1755 | 2730299781 | |||
| 1756 | 2738804787 | |||
| 1757 | 2738944557 | |||
| 1758 | 2739035518 | |||
| 1759 | 2753357622 | |||
| 1760 | 2757572462 | |||
| 1761 | 2758640119 | |||
| 1762 | 2766065265 | |||
| 1763 | 2774868389 | |||
| 1764 | 2776262585 | |||
| 1765 | 2776914621 | |||
| 1766 | 2778176055 | |||
| 1767 | 2792582062 | |||
| 1768 | 2792623398 | |||
| 1769 | 2792629286 | |||
| 1770 | 2793280643 | |||
| 1771 | 2793293567 | |||
| 1772 | 2793313020 | |||
| 1773 | 2793319667 | |||
| 1774 | 2793327834 | |||
| 1775 | 2793333448 | |||
| 1776 | 2793342031 | |||
| 1777 | 2793347426 | |||
| 1778 | 2793353757 | |||
| 1779 | 2793359643 | |||
| 1780 | 2793369393 | |||
| 1781 | 2802716240 | |||
| 1782 | 2802722722 | |||
| 1783 | 2802729135 | |||
| 1784 | 2802735527 | |||
| 1785 | 2802741897 | |||
| 1786 | 2802748348 | |||
| 1787 | 2805929462 | |||
| 1788 | 2805935357 | |||
| 1789 | 2806044504 | |||
| 1790 | 2806052705 | |||
| 1791 | 2806059005 | |||
| 1792 | 2806068332 | |||
| 1793 | 2806074452 | |||
| 1794 | 2808986923 | |||
| 1795 | 2819243865 | |||
| 1796 | 2819557750 | |||
| 1797 | 2819639655 | |||
| 1798 | 2819686492 | |||
| 1799 | 2821126219 | |||
| 1800 | 2835313051 | |||
| 1801 | 2838019164 | |||
| 1802 | 2838024245 | |||
| 1803 | 2838033176 | |||
| 1804 | 2838040825 | |||
| 1805 | 2838047415 | |||
| 1806 | 2838051117 | |||
| 1807 | 2838063904 | |||
| 1808 | 2838073389 | |||
| 1809 | 2838075740 | |||
| 1810 | 2838664784 | |||
| 1811 | 2838671078 | |||
| 1812 | 2838677728 | |||
| 1813 | 2838684899 | |||
| 1814 | 2838691262 | |||
| 1815 | 2838699264 | |||
| 1816 | 2838703743 | |||
| 1817 | 2838712745 | |||
| 1818 | 2838717367 | |||
| 1819 | 2838722023 | |||
| 1820 | 2838728116 | |||
| 1821 | 2838735745 | |||
| 1822 | 2838737306 | |||
| 1823 | 2838748647 | |||
| 1824 | 2841842325 | |||
| 1825 | 2841849777 | |||
| 1826 | 2841853918 | |||
| 1827 | 2841864211 | |||
| 1828 | 2841868114 | |||
| 1829 | 2842082222 | |||
| 1830 | 2842113377 | |||
| 1831 | 2842123147 | |||
| 1832 | 2842127475 | |||
| 1833 | 2842132621 | |||
| 1834 | 2842142104 | |||
| 1835 | 2842151252 | |||
| 1836 | 2842154615 | |||
| 1837 | 2842162564 | |||
| 1838 | 2842170008 | |||
| 1839 | 2842173112 | |||
| 1840 | 2842178235 | |||
| 1841 | 2842185001 | |||
| 1842 | 2842190474 | |||
| 1843 | 2842198204 | |||
| 1844 | 2842199787 | |||
| 1845 | 2842208373 | |||
| 1846 | 2842214788 | |||
| 1847 | 2842220019 | |||
| 1848 | 2842227509 | |||
| 1849 | 2842235626 | |||
| 1850 | 2842241953 | |||
| 1851 | 2842249340 | |||
| 1852 | 2842256308 | |||
| 1853 | 2842263523 | |||
| 1854 | 2842266664 | |||
| 1855 | 2842275737 | |||
| 1856 | 2842281618 | |||
| 1857 | 2842288741 | |||
| 1858 | 2842296223 | |||
| 1859 | 2842308279 | |||
| 1860 | 2842316440 | |||
| 1861 | 2842321328 | |||
| 1862 | 2842345066 | |||
| 1863 | 2842369182 | |||
| 1864 | 2842375575 | |||
| 1865 | 2842382623 | |||
| 1866 | 2842390024 | |||
| 1867 | 2842398452 | |||
| 1868 | 2842406592 | |||
| 1869 | 2842412981 | |||
| 1870 | 2842419624 | |||
| 1871 | 2842427024 | |||
| 1872 | 2842429983 | |||
| 1873 | 2842436357 | |||
| 1874 | 2842444060 | |||
| 1875 | 2842451087 | |||
| 1876 | 2842464404 | |||
| 1877 | 2842470686 | |||
| 1878 | 2842479909 | |||
| 1879 | 2842483344 | |||
| 1880 | 2842493335 | |||
| 1881 | 2842499094 | |||
| 1882 | 2842507085 | |||
| 1883 | 2842510782 | |||
| 1884 | 2842521042 | |||
| 1885 | 2842523245 | |||
| 1886 | 2842875722 | |||
| 1887 | 2842925825 | |||
| 1888 | 2844166094 | |||
| 1889 | 2844457436 | |||
| 1890 | 2850084504 | |||
| 1891 | 2852391269 | |||
| 1892 | 2854897337 | |||
| 1893 | 2854913436 | |||
| 1894 | 2854915535 | |||
| 1895 | 2854921529 | |||
| 1896 | 2855828342 | |||
| 1897 | 2855843454 | |||
| 1898 | 2857518845 | |||
| 1899 | 2857532780 | |||
| 1900 | 2858806278 | |||
| 1901 | 2882459181 | |||
| 1902 | 2891375627 | |||
| 1903 | 2891377471 | |||
| 1904 | 2894233218 | |||
| 1905 | 2896388193 | |||
| 1906 | 2899793470 | |||
| 1907 | 2899805190 | |||
| 1908 | 2899847671 | |||
| 1909 | 2913309177 | |||
| 1910 | 2915984168 | |||
| 1911 | 2915987826 | |||
| 1912 | 2916000083 | |||
| 1913 | 2916006018 | |||
| 1914 | 2916013074 | |||
| 1915 | 2916018938 | |||
| 1916 | 2916024811 | |||
| 1917 | 2916029380 | |||
| 1918 | 2916037160 | |||
| 1919 | 2916046056 | |||
| 1920 | 2916050144 | |||
| 1921 | 2916058855 | |||
| 1922 | 2916068587 | |||
| 1923 | 2916072128 | |||
| 1924 | 2916082781 | |||
| 1925 | 2919104625 | |||
| 1926 | 2919117633 | |||
| 1927 | 2919168610 | |||
| 1928 | 2919173513 | |||
| 1929 | 2920764303 | |||
| 1930 | 2920826293 | |||
| 1931 | 2921202277 | |||
| 1932 | 2921214742 | |||
| 1933 | 2921237829 | |||
| 1934 | 2921247380 | |||
| 1935 | 2921253400 | |||
| 1936 | 2921259842 | |||
| 1937 | 2921265323 | |||
| 1938 | 2921282610 | |||
| 1939 | 2921291329 | |||
| 1940 | 2921301338 | |||
| 1941 | 2923558718 | |||
| 1942 | 2924150169 | |||
| 1943 | 2924155331 | |||
| 1944 | 2924158582 | |||
| 1945 | 2924168893 | |||
| 1946 | 2924176347 | |||
| 1947 | 2924186038 | |||
| 1948 | 2924188333 | |||
| 1949 | 2924198463 | |||
| 1950 | 2924206075 | |||
| 1951 | 2924210099 | |||
| 1952 | 2924215718 | |||
| 1953 | 2924226056 | |||
| 1954 | 2924230684 | |||
| 1955 | 2926759070 | |||
| 1956 | 2926763420 | |||
| 1957 | 2928524844 | |||
| 1958 | 2929141115 | |||
| 1959 | 2933010002 | |||
| 1960 | 2933011546 | |||
| 1961 | 2933019917 | |||
| 1962 | 2933574728 | |||
| 1963 | 2933589333 | |||
| 1964 | 2933595966 | |||
| 1965 | 2933603481 | |||
| 1966 | 2935901224 | |||
| 1967 | 2935907497 | |||
| 1968 | 2936374813 | |||
| 1969 | 2936380505 | |||
| 1970 | 2936382327 | |||
| 1971 | 2936996748 | |||
| 1972 | 2937004758 | |||
| 1973 | 2937013489 | |||
| 1974 | 2937016732 | |||
| 1975 | 2937026592 | |||
| 1976 | 2937032303 | |||
| 1977 | 2937038289 | |||
| 1978 | 2937043899 | |||
| 1979 | 2937052571 | |||
| 1980 | 2937060135 | |||
| 1981 | 2937067982 | |||
| 1982 | 2937074262 | |||
| 1983 | 2937081766 | |||
| 1984 | 2937090359 | |||
| 1985 | 2937098375 | |||
| 1986 | 2937099102 | |||
| 1987 | 2937108928 | |||
| 1988 | 2937117336 | |||
| 1989 | 2937122464 | |||
| 1990 | 2937127314 | |||
| 1991 | 2939670112 | |||
| 1992 | 2941502646 | |||
| 1993 | 2954011534 | |||
| 1994 | 2957377433 | |||
| 1995 | 2957388275 | |||
| 1996 | 2957392203 | |||
| 1997 | 2957395820 | |||
| 1998 | 2957402618 | |||
| 1999 | 2957411098 | |||
| 2000 | 2957417826 | |||
| 2001 | 2957425185 | |||
| 2002 | 2957434154 | |||
| 2003 | 2957441051 | |||
| 2004 | 2957444136 | |||
| 2005 | 2957456728 | |||
| 2006 | 2957458933 | |||
| 2007 | 2957466962 | |||
| 2008 | 2957472869 | |||
| 2009 | 2957479223 | |||
| 2010 | 2957486512 | |||
| 2011 | 2957494951 | |||
| 2012 | 2957502810 | |||
| 2013 | 2957510048 | |||
| 2014 | 2960588149 | |||
| 2015 | 2960596727 | |||
| 2016 | 2960599602 | |||
| 2017 | 2960606959 | |||
| 2018 | 2960614447 | |||
| 2019 | 2960619301 | |||
| 2020 | 2960628261 | |||
| 2021 | 2960637681 | |||
| 2022 | 2960645397 | |||
| 2023 | 2960648857 | |||
| 2024 | 2960652894 | |||
| 2025 | 2960662543 | |||
| 2026 | 2960669272 | |||
| 2027 | 2960678753 | |||
| 2028 | 2960684801 | |||
| 2029 | 2960688967 | |||
| 2030 | 2964608445 | |||
| 2031 | 2964617274 | |||
| 2032 | 2964622191 | |||
| 2033 | 2964630757 | |||
| 2034 | 2964640350 | |||
| 2035 | 2964647543 | |||
| 2036 | 2964652017 | |||
| 2037 | 2964658511 | |||
| 2038 | 2964668697 | |||
| 2039 | 2964673814 | |||
| 2040 | 2964680119 | |||
| 2041 | 2964687518 | |||
| 2042 | 2964693421 | |||
| 2043 | 2964703842 | |||
| 2044 | 2964707298 | |||
| 2045 | 2964716002 | |||
| 2046 | 2964720110 | |||
| 2047 | 2967669129 | |||
| 2048 | 2967674183 | |||
| 2049 | 2967682327 | |||
| 2050 | 2967689009 | |||
| 2051 | 2967694736 | |||
| 2052 | 2967706366 | |||
| 2053 | 2967710834 | |||
| 2054 | 2967718101 | |||
| 2055 | 2967723947 | |||
| 2056 | 2967734524 | |||
| 2057 | 2967738596 | |||
| 2058 | 2967746565 | |||
| 2059 | 2967753371 | |||
| 2060 | 2967761440 | |||
| 2061 | 2967766177 | |||
| 2062 | 2967774888 | |||
| 2063 | 2967779397 | |||
| 2064 | 2970023194 | |||
| 2065 | 2970028427 | |||
| 2066 | 2970034846 | |||
| 2067 | 2970043882 | |||
| 2068 | 2970048065 | |||
| 2069 | 2970055211 | |||
| 2070 | 2970064124 | |||
| 2071 | 2970070133 | |||
| 2072 | 2970079868 | |||
| 2073 | 2970083037 | |||
| 2074 | 2970094948 | |||
| 2075 | 2970102468 | |||
| 2076 | 2970104945 | |||
| 2077 | 2970109582 | |||
| 2078 | 2970118762 | |||
| 2079 | 2970124928 | |||
| 2080 | 2970132583 | |||
| 2081 | 2970140190 | |||
| 2082 | 2970148335 | |||
| 2083 | 2970150029 | |||
| 2084 | 2970161005 | |||
| 2085 | 2970166203 | |||
| 2086 | 2970172820 | |||
| 2087 | 2970184028 | |||
| 2088 | 2970184864 | |||
| 2089 | 2970195157 | |||
| 2090 | 2977522076 | |||
| 2091 | 2977526899 | |||
| 2092 | 2977533099 | |||
| 2093 | 2977538279 | |||
| 2094 | 2977546171 | |||
| 2095 | 2977554069 | |||
| 2096 | 2977565259 | |||
| 2097 | 2977568002 | |||
| 2098 | 2977572893 | |||
| 2099 | 2977581791 | |||
| 2100 | 2978971297 | |||
| 2101 | 2979091547 | |||
| 2102 | 2979097068 | |||
| 2103 | 2979102790 | |||
| 2104 | 2984509321 | |||
| 2105 | 2984519979 | |||
| 2106 | 2984537651 | |||
| 2107 | 2984588442 | |||
| 2108 | 2984604399 | |||
| 2109 | 2989350382 | |||
| 2110 | 2989354591 | |||
| 2111 | 2989775196 | |||
| 2112 | 2989780402 | |||
| 2113 | 2996889265 | |||
| 2114 | 2996894676 | |||
| 2115 | 3005415428 | |||
| 2116 | 3005449332 | |||
| 2117 | 3005455636 | |||
| 2118 | 3005457942 | |||
| 2119 | 639650052 | |||
| 2120 | 643823356 | |||
| 2121 | 648739772 | |||
| 2122 | 650842889 | |||
| 2123 | 8003574411 | |||
| 2124 | 8003996031 | |||
| 2125 | 8004003790 | |||
| 2126 | 8005249509 | |||
| 2127 | 8005264157 | |||
| 2128 | 8005282070 | |||
| 2129 | 8005285114 | |||
| 2130 | 8005294209 | |||
| 2131 | 8005306622 | |||
| 2132 | 8005309444 | |||
| 2133 | 8005318668 | |||
| 2134 | 8005323792 | |||
| 2135 | 8005382730 | |||
| 2136 | 8005383787 | |||
| 2137 | 8005401113 | |||
| 2138 | 8005434067 | |||
| 2139 | 8005464671 | |||
| 2140 | 8005488448 | |||
| 2141 | 8005501720 | |||
| 2142 | 8005547054 | |||
| 2143 | 8005559109 | |||
| 2144 | 8005566832 | |||
| 2145 | 8005574890 | |||
| 2146 | 8005623074 | |||
| 2147 | 8005631618 | |||
| 2148 | 8005673142 | |||
| 2149 | 8005682156 | |||
| 2150 | 8005693682 | |||
| 2151 | 8005700922 | |||
| 2152 | 8018133561 | |||
| 2153 | 8018152089 | |||
| 2154 | 8018170275 | |||
| 2155 | 8018178410 | |||
| 2156 | 8023687491 | |||
| 2157 | 8024482007 | |||
| 2158 | 8024486967 | |||
| 2159 | 8024505881 | |||
| 2160 | 8046773175 | |||
| 2161 | 8049296090 | |||
| 2162 | 8054465265 | |||
| 2163 | 8054559365 | |||
| 2164 | 8056381643 | |||
| 2165 | 8056387080 | |||
| 2166 | 8056876222 | |||
| 2167 | 8057581088 | |||
| 2168 | 8057877047 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5755 | 25 | 329 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5693 | 25 | 329 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5673 | 53 | 327 |
| 4dbl-assembly2.cif.gz_F | crystal structure of e159q mutant of btucdf | 0.5651 | 19 | 329 |
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.5648 | 22 | 321 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9407 | 51 | 326 | 1.10.3470.10 |
| af_P0AE26_50_315_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9407 | 51 | 326 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.934 | 51 | 326 | 1.10.3470.10 |
| af_P0AE26_50_315_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9339 | 51 | 326 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9297 | 51 | 326 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S4JJN0-F1-model_v4 | Ribose ABC transporter permease | 0.9536 | 22 | 332 |
GO:0005886
GO:0022857 |
| AF-A0A6I4G7W6-F1-model_v4 | deleted | 0.9511 | 24 | 336 |
|
| AF-A0A202DX07-F1-model_v4 | Ribose ABC transporter permease | 0.9507 | 24 | 335 |
GO:0005886
GO:0022857 |
| AF-A0A0S8DNU2-F1-model_v4 | Sugar ABC transporter permease | 0.9466 | 22 | 335 |
GO:0005886
GO:0022857 |
| AF-A0A6I3Q8Z3-F1-model_v4 | Ribose ABC transporter permease | 0.9459 | 23 | 336 |
GO:0005886
GO:0022857 |