F489779
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1086 | 441 | 2172 | 549 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10000496|Ga0081539_1000049627 |
| Length | 540 |
| Sequence | MAGTIFDHNLDKNPANYAPLTPLSFLERAAYVYPQRTSVIHGAERYTWGETYARCRRLASALARRGIGVGHTVAAMLPNTPPMYECHFGVAMTGAVLNTLNTRLDPQAIAFMLEHGEAKIVITDREFSATIEAALKMVKRRIMVVDAEDAEFRGGRRLGELTYEELLAGGEPNFAWRWPQDEWEAIALNYTSGTTGNPKGVVYHHRGAYLNAVGNILVWGMPHHSVYLWTLPMFHCNGWCFPWTMAANAGTSVCLRKVEAGTIFQLIKEHRVTHYCGAPIVHQTLINAPDEMKRGIEHKVSALVAAAAPPASMIEGMSKMGFDLTHVYGPATVCAKHPEWAELPLAEQVRLNGRQGVRYHVEEGLSVMDPETMEPVPADGETMGEIMFRGNITMKGYLKNKQASEEAFRGGWFHSGDLAVMQSDGYVKIRDRSKDIIISGGENISSLEVEDVLYRHPAVLGAAVVAMPDAKWGETPCAFVELKSGAKVSEAELIEFCRGQLARFKAPRAVVFGELPKTSTGKIQKFVLRERAKSATAIDT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 238 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 239 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 248 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 255 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 265 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 268 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 269 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 270 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 274 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 333 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 334 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 337 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 338 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 339 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 388 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 389 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 390 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 394 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 395 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 396 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 397 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 398 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 399 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 400 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 401 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 402 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 403 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 404 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 405 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 406 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 407 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 408 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 409 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 410 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 411 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 412 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 413 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 414 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 415 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 416 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 417 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 418 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 419 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 420 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 421 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 422 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 423 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 424 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 425 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 426 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 427 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 428 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 429 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 430 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 431 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 432 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 433 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 434 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 435 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 436 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 437 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 438 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 439 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 440 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 441 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.4 |
| Metatranscriptomes | 0.09 |
| Isolates | 4.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.67 |
| Nodule | 1.2 |
| Rhizoplane | 4.14 |
| Rhizosphere | 88.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081539_10000496 | 3300005985 | Bacteria | 82338 |
| 2 | JGI24746J21847_1002939 | 3300001977 | Bacteria | 2682 |
| 3 | JGI24737J22298_10009297 | 3300001990 | Bacteria | 3274 |
| 4 | JGI24738J21930_10005230 | 3300002075 | Bacteria | 3131 |
| 5 | JGI25406J46586_10001412 | 3300003203 | Bacteria | 11350 |
| 6 | rootH2_10022601 | 3300003320 | Bacteria | 11824 |
| 7 | Ga0055532_1000772 | 3300003758 | Bacteria | 11327 |
| 8 | Ga0055542_1001051 | 3300003762 | Bacteria | 17158 |
| 9 | Ga0055529_1000131 | 3300003763 | Bacteria | 105530 |
| 10 | Ga0070658_10002727 | 3300005327 | Bacteria | 14698 |
| 11 | Ga0070658_10064981 | 3300005327 | Bacteria | 2977 |
| 12 | Ga0070658_10065792 | 3300005327 | Bacteria | 2960 |
| 13 | Ga0070676_10000349 | 3300005328 | Bacteria | 21146 |
| 14 | Ga0070676_10000987 | 3300005328 | Bacteria | 14130 |
| 15 | Ga0070676_10005202 | 3300005328 | Bacteria | 6914 |
| 16 | Ga0070676_10015434 | 3300005328 | Bacteria | 4215 |
| 17 | Ga0070683_100002745 | 3300005329 | Bacteria | 14063 |
| 18 | Ga0070683_100004485 | 3300005329 | Bacteria | 11511 |
| 19 | Ga0070683_100075858 | 3300005329 | Bacteria | 3142 |
| 20 | Ga0070683_100088458 | 3300005329 | Bacteria | 2906 |
| 21 | Ga0070690_100000506 | 3300005330 | Bacteria | 19537 |
| 22 | Ga0070690_100013601 | 3300005330 | Bacteria | 4814 |
| 23 | Ga0070670_100001013 | 3300005331 | Bacteria | 22166 |
| 24 | Ga0070670_100001094 | 3300005331 | Bacteria | 21528 |
| 25 | Ga0070670_100003011 | 3300005331 | Bacteria | 13943 |
| 26 | Ga0070670_100016870 | 3300005331 | Bacteria | 6268 |
| 27 | Ga0070670_100052172 | 3300005331 | Bacteria | 3512 |
| 28 | Ga0070670_100084487 | 3300005331 | Bacteria | 2727 |
| 29 | Ga0070677_10000462 | 3300005333 | Bacteria | 13924 |
| 30 | Ga0070677_10007080 | 3300005333 | Bacteria | 3735 |
| 31 | Ga0070677_10014455 | 3300005333 | Bacteria | 2778 |
| 32 | Ga0068869_100001630 | 3300005334 | Bacteria | 13374 |
| 33 | Ga0068869_100010248 | 3300005334 | Bacteria | 6106 |
| 34 | Ga0068869_100014001 | 3300005334 | Bacteria | 5350 |
| 35 | Ga0070666_10000887 | 3300005335 | Bacteria | 18198 |
| 36 | Ga0070666_10007044 | 3300005335 | Bacteria | 6930 |
| 37 | Ga0070666_10069523 | 3300005335 | Bacteria | 2394 |
| 38 | Ga0070680_100000080 | 3300005336 | Bacteria | 52683 |
| 39 | Ga0070680_100004773 | 3300005336 | Bacteria | 10204 |
| 40 | Ga0070680_100007360 | 3300005336 | Bacteria | 8401 |
| 41 | Ga0070680_100013393 | 3300005336 | Bacteria | 6387 |
| 42 | Ga0070682_100002558 | 3300005337 | Bacteria | 10047 |
| 43 | Ga0070682_100004488 | 3300005337 | Bacteria | 7752 |
| 44 | Ga0068868_100000392 | 3300005338 | Bacteria | 29751 |
| 45 | Ga0068868_100002888 | 3300005338 | Bacteria | 11927 |
| 46 | Ga0068868_100104538 | 3300005338 | Bacteria | 2295 |
| 47 | Ga0070660_100000062 | 3300005339 | Bacteria | 63522 |
| 48 | Ga0070660_100000397 | 3300005339 | Bacteria | 28926 |
| 49 | Ga0070660_100000724 | 3300005339 | Bacteria | 21893 |
| 50 | Ga0070660_100001178 | 3300005339 | Bacteria | 17696 |
| 51 | Ga0070660_100017996 | 3300005339 | Bacteria | 5156 |
| 52 | Ga0070660_100020072 | 3300005339 | Bacteria | 4906 |
| 53 | Ga0070660_100041186 | 3300005339 | Bacteria | 3520 |
| 54 | Ga0070660_100046347 | 3300005339 | Bacteria | 3332 |
| 55 | Ga0070660_100072692 | 3300005339 | Bacteria | 2688 |
| 56 | Ga0070660_100151033 | 3300005339 | Bacteria | 1867 |
| 57 | Ga0070689_100018917 | 3300005340 | Bacteria | 5085 |
| 58 | Ga0070689_100019225 | 3300005340 | Bacteria | 5048 |
| 59 | Ga0070689_100048868 | 3300005340 | Bacteria | 3264 |
| 60 | Ga0070689_100055169 | 3300005340 | Bacteria | 3078 |
| 61 | Ga0070689_100103624 | 3300005340 | Bacteria | 2255 |
| 62 | Ga0070691_10000155 | 3300005341 | Bacteria | 22187 |
| 63 | Ga0070691_10001017 | 3300005341 | Bacteria | 11516 |
| 64 | Ga0070691_10001118 | 3300005341 | Bacteria | 11132 |
| 65 | Ga0070687_100051538 | 3300005343 | Bacteria | 2131 |
| 66 | Ga0070661_100001464 | 3300005344 | Bacteria | 16401 |
| 67 | Ga0070661_100002343 | 3300005344 | Bacteria | 12994 |
| 68 | Ga0070661_100003355 | 3300005344 | Bacteria | 11040 |
| 69 | Ga0070661_100005661 | 3300005344 | Bacteria | 8611 |
| 70 | Ga0070661_100005900 | 3300005344 | Bacteria | 8428 |
| 71 | Ga0070661_100047359 | 3300005344 | Bacteria | 3146 |
| 72 | Ga0070692_10026817 | 3300005345 | Bacteria | 2851 |
| 73 | Ga0070668_100000692 | 3300005347 | Bacteria | 22968 |
| 74 | Ga0070668_100003532 | 3300005347 | Bacteria | 11531 |
| 75 | Ga0070668_100013464 | 3300005347 | Bacteria | 6105 |
| 76 | Ga0070668_100017674 | 3300005347 | Bacteria | 5348 |
| 77 | Ga0070668_100075436 | 3300005347 | Bacteria | 2633 |
| 78 | Ga0070668_100088029 | 3300005347 | Bacteria | 2444 |
| 79 | Ga0070669_100000807 | 3300005353 | Bacteria | 22765 |
| 80 | Ga0070675_100000476 | 3300005354 | Bacteria | 27409 |
| 81 | Ga0070675_100000513 | 3300005354 | Bacteria | 26418 |
| 82 | Ga0070675_100001608 | 3300005354 | Bacteria | 16654 |
| 83 | Ga0070675_100007518 | 3300005354 | Bacteria | 8421 |
| 84 | Ga0070675_100023055 | 3300005354 | Bacteria | 4974 |
| 85 | Ga0070671_100001074 | 3300005355 | Bacteria | 20205 |
| 86 | Ga0070671_100001121 | 3300005355 | Bacteria | 19883 |
| 87 | Ga0070671_100002250 | 3300005355 | Bacteria | 14903 |
| 88 | Ga0070671_100005680 | 3300005355 | Bacteria | 9930 |
| 89 | Ga0070671_100044183 | 3300005355 | Bacteria | 3702 |
| 90 | Ga0070671_100136290 | 3300005355 | Bacteria | 2070 |
| 91 | Ga0070671_100141938 | 3300005355 | Bacteria | 2027 |
| 92 | Ga0070674_100000409 | 3300005356 | Bacteria | 21616 |
| 93 | Ga0070674_100006863 | 3300005356 | Bacteria | 6672 |
| 94 | Ga0070674_100020582 | 3300005356 | Bacteria | 4219 |
| 95 | Ga0070674_100024604 | 3300005356 | Bacteria | 3911 |
| 96 | Ga0070673_100000626 | 3300005364 | Bacteria | 19353 |
| 97 | Ga0070673_100002929 | 3300005364 | Bacteria | 10518 |
| 98 | Ga0070673_100017319 | 3300005364 | Bacteria | 5119 |
| 99 | Ga0070673_100063487 | 3300005364 | Bacteria | 2939 |
| 100 | Ga0070688_100002617 | 3300005365 | Bacteria | 9134 |
| 101 | Ga0070688_100004271 | 3300005365 | Bacteria | 7426 |
| 102 | Ga0070688_100019031 | 3300005365 | Bacteria | 3974 |
| 103 | Ga0070659_100000064 | 3300005366 | Bacteria | 83862 |
| 104 | Ga0070659_100000714 | 3300005366 | Bacteria | 24143 |
| 105 | Ga0070659_100002581 | 3300005366 | Bacteria | 12874 |
| 106 | Ga0070659_100004099 | 3300005366 | Bacteria | 10385 |
| 107 | Ga0070659_100007825 | 3300005366 | Bacteria | 7777 |
| 108 | Ga0070659_100024084 | 3300005366 | Bacteria | 4664 |
| 109 | Ga0070659_100038264 | 3300005366 | Bacteria | 3741 |
| 110 | Ga0070667_100000550 | 3300005367 | Bacteria | 37298 |
| 111 | Ga0070667_100005155 | 3300005367 | Bacteria | 10931 |
| 112 | Ga0070667_100097648 | 3300005367 | Bacteria | 2534 |
| 113 | Ga0070667_100205788 | 3300005367 | Bacteria | 1747 |
| 114 | Ga0070709_10001303 | 3300005434 | Bacteria | 13593 |
| 115 | Ga0070709_10001983 | 3300005434 | Bacteria | 11155 |
| 116 | Ga0070714_100002022 | 3300005435 | Bacteria | 14858 |
| 117 | Ga0070714_100006596 | 3300005435 | Bacteria | 8980 |
| 118 | Ga0070714_100010152 | 3300005435 | Bacteria | 7432 |
| 119 | Ga0070714_100035311 | 3300005435 | Bacteria | 4190 |
| 120 | Ga0070714_100056654 | 3300005435 | Bacteria | 3353 |
| 121 | Ga0070713_100000016 | 3300005436 | Bacteria | 121229 |
| 122 | Ga0070713_100044333 | 3300005436 | Bacteria | 3641 |
| 123 | Ga0070710_10002492 | 3300005437 | Bacteria | 8722 |
| 124 | Ga0070701_10003768 | 3300005438 | Bacteria | 6058 |
| 125 | Ga0070711_100037867 | 3300005439 | Bacteria | 3238 |
| 126 | Ga0070711_100087535 | 3300005439 | Bacteria | 2236 |
| 127 | Ga0070705_100002627 | 3300005440 | Bacteria | 8988 |
| 128 | Ga0070700_100002580 | 3300005441 | Bacteria | 9260 |
| 129 | Ga0070700_100055510 | 3300005441 | Bacteria | 2479 |
| 130 | Ga0070700_100088860 | 3300005441 | Bacteria | 2012 |
| 131 | Ga0070694_100000874 | 3300005444 | Bacteria | 16965 |
| 132 | Ga0070663_100000667 | 3300005455 | Bacteria | 18469 |
| 133 | Ga0070663_100001067 | 3300005455 | Bacteria | 15014 |
| 134 | Ga0070663_100001570 | 3300005455 | Bacteria | 12563 |
| 135 | Ga0070663_100002231 | 3300005455 | Bacteria | 10840 |
| 136 | Ga0070663_100002517 | 3300005455 | Bacteria | 10345 |
| 137 | Ga0070663_100015336 | 3300005455 | Bacteria | 4944 |
| 138 | Ga0070663_100017401 | 3300005455 | Bacteria | 4691 |
| 139 | Ga0070678_100000416 | 3300005456 | Bacteria | 20146 |
| 140 | Ga0070678_100000560 | 3300005456 | Bacteria | 18164 |
| 141 | Ga0070678_100000734 | 3300005456 | Bacteria | 16335 |
| 142 | Ga0070678_100013100 | 3300005456 | Bacteria | 5185 |
| 143 | Ga0070678_100060889 | 3300005456 | Bacteria | 2781 |
| 144 | Ga0070662_100007856 | 3300005457 | Bacteria | 6930 |
| 145 | Ga0070662_100060569 | 3300005457 | Bacteria | 2761 |
| 146 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 147 | Ga0070681_10004430 | 3300005458 | Bacteria | 13378 |
| 148 | Ga0070681_10007824 | 3300005458 | Bacteria | 10454 |
| 149 | Ga0070681_10049694 | 3300005458 | Bacteria | 4187 |
| 150 | Ga0068867_100001865 | 3300005459 | Bacteria | 14641 |
| 151 | Ga0068867_100009128 | 3300005459 | Bacteria | 6996 |
| 152 | Ga0068867_100013640 | 3300005459 | Bacteria | 5754 |
| 153 | Ga0068867_100126063 | 3300005459 | Bacteria | 1984 |
| 154 | Ga0070685_10036953 | 3300005466 | Bacteria | 2763 |
| 155 | Ga0070707_100067464 | 3300005468 | Bacteria | 3441 |
| 156 | Ga0070698_100010987 | 3300005471 | Bacteria | 9631 |
| 157 | Ga0070679_100004878 | 3300005530 | Bacteria | 12370 |
| 158 | Ga0070684_100003381 | 3300005535 | Bacteria | 11958 |
| 159 | Ga0070684_100006377 | 3300005535 | Bacteria | 9124 |
| 160 | Ga0070684_100012282 | 3300005535 | Bacteria | 6859 |
| 161 | Ga0070684_100114230 | 3300005535 | Bacteria | 2424 |
| 162 | Ga0070697_100011811 | 3300005536 | Bacteria | 6835 |
| 163 | Ga0070697_100129474 | 3300005536 | Bacteria | 2116 |
| 164 | Ga0068853_100000609 | 3300005539 | Bacteria | 24568 |
| 165 | Ga0068853_100008978 | 3300005539 | Bacteria | 8053 |
| 166 | Ga0068853_100045702 | 3300005539 | Bacteria | 3752 |
| 167 | Ga0070672_100001311 | 3300005543 | Bacteria | 15343 |
| 168 | Ga0070672_100002443 | 3300005543 | Bacteria | 11791 |
| 169 | Ga0070672_100003001 | 3300005543 | Bacteria | 10877 |
| 170 | Ga0070672_100003082 | 3300005543 | Bacteria | 10756 |
| 171 | Ga0070672_100007374 | 3300005543 | Bacteria | 7455 |
| 172 | Ga0070672_100024424 | 3300005543 | Bacteria | 4467 |
| 173 | Ga0070686_100000266 | 3300005544 | Bacteria | 35675 |
| 174 | Ga0070695_100000864 | 3300005545 | Bacteria | 16329 |
| 175 | Ga0070695_100080823 | 3300005545 | Bacteria | 2149 |
| 176 | Ga0070696_100003955 | 3300005546 | Bacteria | 9892 |
| 177 | Ga0070696_100006127 | 3300005546 | Bacteria | 8031 |
| 178 | Ga0070696_100021721 | 3300005546 | Bacteria | 4353 |
| 179 | Ga0070693_100000326 | 3300005547 | Bacteria | 21830 |
| 180 | Ga0070693_100001609 | 3300005547 | Bacteria | 10194 |
| 181 | Ga0070665_100001447 | 3300005548 | Bacteria | 27820 |
| 182 | Ga0070665_100005172 | 3300005548 | Bacteria | 13499 |
| 183 | Ga0070665_100011369 | 3300005548 | Bacteria | 9000 |
| 184 | Ga0070665_100017719 | 3300005548 | Bacteria | 7152 |
| 185 | Ga0070665_100021535 | 3300005548 | Bacteria | 6480 |
| 186 | Ga0070665_100079422 | 3300005548 | Bacteria | 3286 |
| 187 | Ga0070704_100003256 | 3300005549 | Bacteria | 9278 |
| 188 | Ga0070704_100012951 | 3300005549 | Bacteria | 5160 |
| 189 | Ga0068855_100000114 | 3300005563 | Bacteria | 100372 |
| 190 | Ga0068855_100001160 | 3300005563 | Bacteria | 32655 |
| 191 | Ga0068855_100007887 | 3300005563 | Bacteria | 12857 |
| 192 | Ga0068855_100007921 | 3300005563 | Bacteria | 12838 |
| 193 | Ga0068855_100015359 | 3300005563 | Bacteria | 9218 |
| 194 | Ga0068855_100019573 | 3300005563 | Bacteria | 8129 |
| 195 | Ga0068855_100026872 | 3300005563 | Bacteria | 6887 |
| 196 | Ga0068855_100102249 | 3300005563 | Bacteria | 3298 |
| 197 | Ga0068855_100179313 | 3300005563 | Bacteria | 2396 |
| 198 | Ga0070664_100000955 | 3300005564 | Bacteria | 22600 |
| 199 | Ga0070664_100004911 | 3300005564 | Bacteria | 10708 |
| 200 | Ga0070664_100007192 | 3300005564 | Bacteria | 8975 |
| 201 | Ga0070664_100016653 | 3300005564 | Bacteria | 6028 |
| 202 | Ga0070664_100027537 | 3300005564 | Bacteria | 4724 |
| 203 | Ga0068857_100000070 | 3300005577 | Bacteria | 58624 |
| 204 | Ga0068857_100005150 | 3300005577 | Bacteria | 11119 |
| 205 | Ga0068857_100012116 | 3300005577 | Bacteria | 7498 |
| 206 | Ga0068857_100016007 | 3300005577 | Bacteria | 6569 |
| 207 | Ga0068857_100057359 | 3300005577 | Bacteria | 3456 |
| 208 | Ga0068857_100086309 | 3300005577 | Bacteria | 2806 |
| 209 | Ga0068854_100000885 | 3300005578 | Bacteria | 18009 |
| 210 | Ga0068854_100004422 | 3300005578 | Bacteria | 8868 |
| 211 | Ga0068854_100012083 | 3300005578 | Bacteria | 5647 |
| 212 | Ga0068854_100015536 | 3300005578 | Bacteria | 5046 |
| 213 | Ga0068856_100001185 | 3300005614 | Bacteria | 27475 |
| 214 | Ga0068856_100002298 | 3300005614 | Bacteria | 19709 |
| 215 | Ga0068856_100003266 | 3300005614 | Bacteria | 16489 |
| 216 | Ga0068856_100004519 | 3300005614 | Bacteria | 13832 |
| 217 | Ga0068856_100021495 | 3300005614 | Bacteria | 6271 |
| 218 | Ga0068856_100021658 | 3300005614 | Bacteria | 6247 |
| 219 | Ga0070702_100000139 | 3300005615 | Bacteria | 22443 |
| 220 | Ga0070702_100007234 | 3300005615 | Bacteria | 5305 |
| 221 | Ga0068852_100001471 | 3300005616 | Bacteria | 15936 |
| 222 | Ga0068852_100001765 | 3300005616 | Bacteria | 14713 |
| 223 | Ga0068852_100001969 | 3300005616 | Bacteria | 13992 |
| 224 | Ga0068852_100002890 | 3300005616 | Bacteria | 11920 |
| 225 | Ga0068852_100011333 | 3300005616 | Bacteria | 6707 |
| 226 | Ga0068852_100084368 | 3300005616 | Bacteria | 2827 |
| 227 | Ga0068859_100004507 | 3300005617 | Bacteria | 14210 |
| 228 | Ga0068859_100050585 | 3300005617 | Bacteria | 4174 |
| 229 | Ga0068859_100128179 | 3300005617 | Bacteria | 2608 |
| 230 | Ga0068859_100232957 | 3300005617 | Bacteria | 1930 |
| 231 | Ga0068864_100000938 | 3300005618 | Bacteria | 24407 |
| 232 | Ga0068864_100005453 | 3300005618 | Bacteria | 10427 |
| 233 | Ga0068864_100017766 | 3300005618 | Bacteria | 5933 |
| 234 | Ga0068864_100020235 | 3300005618 | Bacteria | 5567 |
| 235 | Ga0068864_100065978 | 3300005618 | Bacteria | 3140 |
| 236 | Ga0068866_10006898 | 3300005718 | Bacteria | 4743 |
| 237 | Ga0068866_10008849 | 3300005718 | Bacteria | 4257 |
| 238 | Ga0068861_100006586 | 3300005719 | Bacteria | 7927 |
| 239 | Ga0068851_10000301 | 3300005834 | Bacteria | 22575 |
| 240 | Ga0068851_10003091 | 3300005834 | Bacteria | 7370 |
| 241 | Ga0068851_10009069 | 3300005834 | Bacteria | 4616 |
| 242 | Ga0068870_10000931 | 3300005840 | Bacteria | 11482 |
| 243 | Ga0068870_10008311 | 3300005840 | Bacteria | 4664 |
| 244 | Ga0068870_10052742 | 3300005840 | Bacteria | 2157 |
| 245 | Ga0068863_100000834 | 3300005841 | Bacteria | 30888 |
| 246 | Ga0068863_100001021 | 3300005841 | Bacteria | 28037 |
| 247 | Ga0068863_100006710 | 3300005841 | Bacteria | 11287 |
| 248 | Ga0068863_100015180 | 3300005841 | Bacteria | 7400 |
| 249 | Ga0068863_100092203 | 3300005841 | Bacteria | 2874 |
| 250 | Ga0068863_100160711 | 3300005841 | Bacteria | 2152 |
| 251 | Ga0068858_100001979 | 3300005842 | Bacteria | 20923 |
| 252 | Ga0068858_100010430 | 3300005842 | Bacteria | 8802 |
| 253 | Ga0068858_100050949 | 3300005842 | Bacteria | 3831 |
| 254 | Ga0068858_100055125 | 3300005842 | Bacteria | 3674 |
| 255 | Ga0068860_100003430 | 3300005843 | Bacteria | 16298 |
| 256 | Ga0068860_100003845 | 3300005843 | Bacteria | 15430 |
| 257 | Ga0068860_100004777 | 3300005843 | Bacteria | 13804 |
| 258 | Ga0068862_100020990 | 3300005844 | Bacteria | 5457 |
| 259 | Ga0068862_100041607 | 3300005844 | Bacteria | 3911 |
| 260 | Ga0068862_100071289 | 3300005844 | Bacteria | 3000 |
| 261 | Ga0068862_100083555 | 3300005844 | Bacteria | 2773 |
| 262 | Ga0068862_100105942 | 3300005844 | Bacteria | 2464 |
| 263 | Ga0081455_10006353 | 3300005937 | Bacteria | 12684 |
| 264 | Ga0081455_10134449 | 3300005937 | Bacteria | 1929 |
| 265 | Ga0081540_1002279 | 3300005983 | Bacteria | 15773 |
| 266 | Ga0081539_10000152 | 3300005985 | Bacteria | 160005 |
| 267 | Ga0070717_10032271 | 3300006028 | Bacteria | 4220 |
| 268 | Ga0075432_10007087 | 3300006058 | Bacteria | 3817 |
| 269 | Ga0070715_10000935 | 3300006163 | Bacteria | 8136 |
| 270 | Ga0070716_100000665 | 3300006173 | Bacteria | 14606 |
| 271 | Ga0070712_100000203 | 3300006175 | Bacteria | 33465 |
| 272 | Ga0070712_100000828 | 3300006175 | Bacteria | 18403 |
| 273 | Ga0070712_100029785 | 3300006175 | Bacteria | 3662 |
| 274 | Ga0075366_10004742 | 3300006195 | Bacteria | 7325 |
| 275 | Ga0097621_100000425 | 3300006237 | Bacteria | 29404 |
| 276 | Ga0097621_100013349 | 3300006237 | Bacteria | 6120 |
| 277 | Ga0075370_10029497 | 3300006353 | Bacteria | 3056 |
| 278 | Ga0068871_100000155 | 3300006358 | Bacteria | 45123 |
| 279 | Ga0068871_100001041 | 3300006358 | Bacteria | 18568 |
| 280 | Ga0068871_100033726 | 3300006358 | Bacteria | 4056 |
| 281 | Ga0068871_100057388 | 3300006358 | Bacteria | 3167 |
| 282 | Ga0068871_100087054 | 3300006358 | Bacteria | 2596 |
| 283 | Ga0068871_100087404 | 3300006358 | Bacteria | 2592 |
| 284 | Ga0075428_100037443 | 3300006844 | Bacteria | 5340 |
| 285 | Ga0075431_100006419 | 3300006847 | Bacteria | 11673 |
| 286 | Ga0075431_100009537 | 3300006847 | Bacteria | 9748 |
| 287 | Ga0075433_10051734 | 3300006852 | Bacteria | 3578 |
| 288 | Ga0075433_10082845 | 3300006852 | Bacteria | 2830 |
| 289 | Ga0075434_100004596 | 3300006871 | Bacteria | 12465 |
| 290 | Ga0075434_100005367 | 3300006871 | Bacteria | 11662 |
| 291 | Ga0075434_100014949 | 3300006871 | Bacteria | 7427 |
| 292 | Ga0075429_100008726 | 3300006880 | Bacteria | 8816 |
| 293 | Ga0075429_100018004 | 3300006880 | Bacteria | 6109 |
| 294 | Ga0075429_100053031 | 3300006880 | Bacteria | 3529 |
| 295 | Ga0068865_100003538 | 3300006881 | Bacteria | 9370 |
| 296 | Ga0068865_100010088 | 3300006881 | Bacteria | 5877 |
| 297 | Ga0075436_100001015 | 3300006914 | Bacteria | 18903 |
| 298 | Ga0075436_100001230 | 3300006914 | Bacteria | 17423 |
| 299 | Ga0075436_100007319 | 3300006914 | Bacteria | 7548 |
| 300 | Ga0075436_100019434 | 3300006914 | Bacteria | 4655 |
| 301 | Ga0075436_100031963 | 3300006914 | Bacteria | 3626 |
| 302 | Ga0097620_100004507 | 3300006931 | Bacteria | 14210 |
| 303 | Ga0097620_100050580 | 3300006931 | Bacteria | 4174 |
| 304 | Ga0097620_100128183 | 3300006931 | Bacteria | 2608 |
| 305 | Ga0097620_100232962 | 3300006931 | Bacteria | 1930 |
| 306 | Ga0075435_100006316 | 3300007076 | Bacteria | 8371 |
| 307 | Ga0075435_100007635 | 3300007076 | Bacteria | 7723 |
| 308 | Ga0075435_100022936 | 3300007076 | Bacteria | 4818 |
| 309 | Ga0099795_10024506 | 3300007788 | Bacteria | 2014 |
| 310 | Ga0105240_10003616 | 3300009093 | Bacteria | 23943 |
| 311 | Ga0105240_10004119 | 3300009093 | Bacteria | 22318 |
| 312 | Ga0105240_10007123 | 3300009093 | Bacteria | 16293 |
| 313 | Ga0105240_10025822 | 3300009093 | Bacteria | 7714 |
| 314 | Ga0105240_10027464 | 3300009093 | Bacteria | 7449 |
| 315 | Ga0105240_10059391 | 3300009093 | Bacteria | 4773 |
| 316 | Ga0111539_10017597 | 3300009094 | Bacteria | 8846 |
| 317 | Ga0111539_10077658 | 3300009094 | Bacteria | 3907 |
| 318 | Ga0111539_10083672 | 3300009094 | Bacteria | 3751 |
| 319 | Ga0111539_10195350 | 3300009094 | Bacteria | 2360 |
| 320 | Ga0111539_10205954 | 3300009094 | Bacteria | 2293 |
| 321 | Ga0111539_10272648 | 3300009094 | Bacteria | 1969 |
| 322 | Ga0105245_10001777 | 3300009098 | Bacteria | 19632 |
| 323 | Ga0105245_10013654 | 3300009098 | Bacteria | 7075 |
| 324 | Ga0105247_10018101 | 3300009101 | Bacteria | 4226 |
| 325 | Ga0105247_10036957 | 3300009101 | Bacteria | 2978 |
| 326 | Ga0105247_10049696 | 3300009101 | Bacteria | 2579 |
| 327 | Ga0114129_10017581 | 3300009147 | Bacteria | 10179 |
| 328 | Ga0114129_10122974 | 3300009147 | Bacteria | 3570 |
| 329 | Ga0105243_10001724 | 3300009148 | Bacteria | 18831 |
| 330 | Ga0105243_10076903 | 3300009148 | Bacteria | 2713 |
| 331 | Ga0105243_10154504 | 3300009148 | Bacteria | 1972 |
| 332 | Ga0105241_10002591 | 3300009174 | Bacteria | 13559 |
| 333 | Ga0105241_10004583 | 3300009174 | Bacteria | 10227 |
| 334 | Ga0105242_10003894 | 3300009176 | Bacteria | 11599 |
| 335 | Ga0105248_10000015 | 3300009177 | Bacteria | 322959 |
| 336 | Ga0105248_10001701 | 3300009177 | Bacteria | 24486 |
| 337 | Ga0105248_10003894 | 3300009177 | Bacteria | 16498 |
| 338 | Ga0105248_10004961 | 3300009177 | Bacteria | 14704 |
| 339 | Ga0105248_10009860 | 3300009177 | Bacteria | 10522 |
| 340 | Ga0105248_10127995 | 3300009177 | Bacteria | 2865 |
| 341 | Ga0105237_10002479 | 3300009545 | Bacteria | 22904 |
| 342 | Ga0105237_10012413 | 3300009545 | Bacteria | 8980 |
| 343 | Ga0105238_10001172 | 3300009551 | Bacteria | 26345 |
| 344 | Ga0105238_10024166 | 3300009551 | Bacteria | 6196 |
| 345 | Ga0105238_10032470 | 3300009551 | Bacteria | 5313 |
| 346 | Ga0105238_10049039 | 3300009551 | Bacteria | 4254 |
| 347 | Ga0105238_10051580 | 3300009551 | Bacteria | 4138 |
| 348 | Ga0105238_10091203 | 3300009551 | Bacteria | 3035 |
| 349 | Ga0105249_10003900 | 3300009553 | Bacteria | 12892 |
| 350 | Ga0105249_10020234 | 3300009553 | Bacteria | 5948 |
| 351 | Ga0105249_10034762 | 3300009553 | Bacteria | 4568 |
| 352 | Ga0105249_10047033 | 3300009553 | Bacteria | 3930 |
| 353 | Ga0105239_10003755 | 3300010375 | Bacteria | 18488 |
| 354 | Ga0105239_10034702 | 3300010375 | Bacteria | 5541 |
| 355 | Ga0105239_10040693 | 3300010375 | Bacteria | 5092 |
| 356 | Ga0105246_10005520 | 3300011119 | Bacteria | 7715 |
| 357 | Ga0105246_10077382 | 3300011119 | Bacteria | 2360 |
| 358 | Ga0157373_10000447 | 3300013100 | Bacteria | 32642 |
| 359 | Ga0157373_10004559 | 3300013100 | Bacteria | 10419 |
| 360 | Ga0157373_10007091 | 3300013100 | Bacteria | 8357 |
| 361 | Ga0157373_10020254 | 3300013100 | Bacteria | 4838 |
| 362 | Ga0157371_10001482 | 3300013102 | Bacteria | 24271 |
| 363 | Ga0157371_10009450 | 3300013102 | Bacteria | 7672 |
| 364 | Ga0157370_10002190 | 3300013104 | Bacteria | 23830 |
| 365 | Ga0157370_10003331 | 3300013104 | Bacteria | 18930 |
| 366 | Ga0157370_10004082 | 3300013104 | Bacteria | 16932 |
| 367 | Ga0157370_10004142 | 3300013104 | Bacteria | 16786 |
| 368 | Ga0157370_10014877 | 3300013104 | Bacteria | 7938 |
| 369 | Ga0157370_10023307 | 3300013104 | Bacteria | 6146 |
| 370 | Ga0157369_10004134 | 3300013105 | Bacteria | 17188 |
| 371 | Ga0157369_10007459 | 3300013105 | Bacteria | 12596 |
| 372 | Ga0157369_10031570 | 3300013105 | Bacteria | 5831 |
| 373 | Ga0157369_10106207 | 3300013105 | Bacteria | 2988 |
| 374 | Ga0157374_10000963 | 3300013296 | Bacteria | 24970 |
| 375 | Ga0157374_10002201 | 3300013296 | Bacteria | 16439 |
| 376 | Ga0157374_10006364 | 3300013296 | Bacteria | 10018 |
| 377 | Ga0157374_10015242 | 3300013296 | Bacteria | 6741 |
| 378 | Ga0157374_10053772 | 3300013296 | Bacteria | 3754 |
| 379 | Ga0157374_10120295 | 3300013296 | Bacteria | 2534 |
| 380 | Ga0157378_10003370 | 3300013297 | Bacteria | 14208 |
| 381 | Ga0157378_10044606 | 3300013297 | Bacteria | 3938 |
| 382 | Ga0157378_10052541 | 3300013297 | Bacteria | 3626 |
| 383 | Ga0163162_10013236 | 3300013306 | Bacteria | 8057 |
| 384 | Ga0163162_10015912 | 3300013306 | Bacteria | 7353 |
| 385 | Ga0157372_10001631 | 3300013307 | Bacteria | 24355 |
| 386 | Ga0157372_10007900 | 3300013307 | Bacteria | 11306 |
| 387 | Ga0157372_10010743 | 3300013307 | Bacteria | 9746 |
| 388 | Ga0157372_10011713 | 3300013307 | Bacteria | 9340 |
| 389 | Ga0157372_10017421 | 3300013307 | Bacteria | 7710 |
| 390 | Ga0157372_10022848 | 3300013307 | Bacteria | 6772 |
| 391 | Ga0157372_10025657 | 3300013307 | Bacteria | 6410 |
| 392 | Ga0157372_10089942 | 3300013307 | Bacteria | 3489 |
| 393 | Ga0157375_10002885 | 3300013308 | Bacteria | 14912 |
| 394 | Ga0157375_10003643 | 3300013308 | Bacteria | 13367 |
| 395 | Ga0157375_10018541 | 3300013308 | Bacteria | 6313 |
| 396 | Ga0157375_10048478 | 3300013308 | Bacteria | 4156 |
| 397 | Ga0157375_10144027 | 3300013308 | Bacteria | 2512 |
| 398 | Ga0157375_10210752 | 3300013308 | Bacteria | 2100 |
| 399 | Ga0163163_10012637 | 3300014325 | Bacteria | 7696 |
| 400 | Ga0163163_10074587 | 3300014325 | Bacteria | 3385 |
| 401 | Ga0157380_10008877 | 3300014326 | Bacteria | 7182 |
| 402 | Ga0157379_10005861 | 3300014968 | Bacteria | 10570 |
| 403 | Ga0157379_10011241 | 3300014968 | Bacteria | 7798 |
| 404 | Ga0157376_10016098 | 3300014969 | Bacteria | 5668 |
| 405 | Ga0157376_10023142 | 3300014969 | Bacteria | 4858 |
| 406 | Ga0157376_10030720 | 3300014969 | Bacteria | 4293 |
| 407 | Ga0157376_10031347 | 3300014969 | Bacteria | 4255 |
| 408 | Ga0163161_10003681 | 3300017792 | Bacteria | 10749 |
| 409 | Ga0163161_10081970 | 3300017792 | Bacteria | 2376 |
| 410 | Ga0163161_10094042 | 3300017792 | Bacteria | 2222 |
| 411 | Ga0163161_10131346 | 3300017792 | Bacteria | 1889 |
| 412 | Ga0213874_10003627 | 3300021377 | Bacteria | 3448 |
| 413 | Ga0213876_10000198 | 3300021384 | Bacteria | 61717 |
| 414 | Ga0213876_10001343 | 3300021384 | Bacteria | 15388 |
| 415 | Ga0224712_10006834 | 3300022467 | Bacteria | 3284 |
| 416 | Ga0209566_100145 | 3300025225 | Bacteria | 83624 |
| 417 | Ga0209674_103149 | 3300025226 | Bacteria | 3132 |
| 418 | Ga0209672_100015 | 3300025228 | Bacteria | 529352 |
| 419 | Ga0209672_100031 | 3300025228 | Bacteria | 332889 |
| 420 | Ga0209147_100016 | 3300025229 | Bacteria | 527606 |
| 421 | Ga0209147_100034 | 3300025229 | Bacteria | 346646 |
| 422 | Ga0209147_100040 | 3300025229 | Bacteria | 307612 |
| 423 | Ga0209563_102361 | 3300025230 | Bacteria | 4312 |
| 424 | Ga0209258_100026 | 3300025242 | Bacteria | 527606 |
| 425 | Ga0209258_100061 | 3300025242 | Bacteria | 313501 |
| 426 | Ga0209148_1000070 | 3300025254 | Bacteria | 332889 |
| 427 | Ga0209148_1000510 | 3300025254 | Bacteria | 39093 |
| 428 | Ga0209759_1002328 | 3300025256 | Bacteria | 8522 |
| 429 | Ga0209455_1000069 | 3300025272 | Bacteria | 308247 |
| 430 | Ga0209455_1000580 | 3300025272 | Bacteria | 23806 |
| 431 | Ga0209673_1000026 | 3300025273 | Bacteria | 373739 |
| 432 | Ga0207673_1003370 | 3300025290 | Bacteria | 1867 |
| 433 | Ga0207697_10002483 | 3300025315 | Bacteria | 9539 |
| 434 | Ga0207697_10017943 | 3300025315 | Bacteria | 2905 |
| 435 | Ga0207682_10000233 | 3300025893 | Bacteria | 24983 |
| 436 | Ga0207682_10000416 | 3300025893 | Bacteria | 19579 |
| 437 | Ga0207682_10010231 | 3300025893 | Bacteria | 3680 |
| 438 | Ga0207682_10010504 | 3300025893 | Bacteria | 3628 |
| 439 | Ga0207642_10003017 | 3300025899 | Bacteria | 5277 |
| 440 | Ga0207710_10006289 | 3300025900 | Bacteria | 5078 |
| 441 | Ga0207710_10014857 | 3300025900 | Bacteria | 3288 |
| 442 | Ga0207688_10003088 | 3300025901 | Bacteria | 9090 |
| 443 | Ga0207688_10004305 | 3300025901 | Bacteria | 7765 |
| 444 | Ga0207688_10027382 | 3300025901 | Bacteria | 3136 |
| 445 | Ga0207680_10000750 | 3300025903 | Bacteria | 15300 |
| 446 | Ga0207680_10014171 | 3300025903 | Bacteria | 4117 |
| 447 | Ga0207680_10017832 | 3300025903 | Bacteria | 3759 |
| 448 | Ga0207647_10007812 | 3300025904 | Bacteria | 7699 |
| 449 | Ga0207685_10000329 | 3300025905 | Bacteria | 7680 |
| 450 | Ga0207699_10000088 | 3300025906 | Bacteria | 69491 |
| 451 | Ga0207699_10007672 | 3300025906 | Bacteria | 5282 |
| 452 | Ga0207699_10015342 | 3300025906 | Bacteria | 3977 |
| 453 | Ga0207645_10000807 | 3300025907 | Bacteria | 26198 |
| 454 | Ga0207645_10003909 | 3300025907 | Bacteria | 11135 |
| 455 | Ga0207645_10009032 | 3300025907 | Bacteria | 6919 |
| 456 | Ga0207645_10021969 | 3300025907 | Bacteria | 4156 |
| 457 | Ga0207645_10024971 | 3300025907 | Bacteria | 3871 |
| 458 | Ga0207645_10038835 | 3300025907 | Bacteria | 3051 |
| 459 | Ga0207643_10000238 | 3300025908 | Bacteria | 38484 |
| 460 | Ga0207643_10024322 | 3300025908 | Bacteria | 3342 |
| 461 | Ga0207705_10000158 | 3300025909 | Bacteria | 73213 |
| 462 | Ga0207705_10052101 | 3300025909 | Bacteria | 2945 |
| 463 | Ga0207705_10065637 | 3300025909 | Bacteria | 2624 |
| 464 | Ga0207705_10070050 | 3300025909 | Bacteria | 2541 |
| 465 | Ga0207654_10005989 | 3300025911 | Bacteria | 6119 |
| 466 | Ga0207654_10092077 | 3300025911 | Bacteria | 1851 |
| 467 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 468 | Ga0207707_10000903 | 3300025912 | Bacteria | 28970 |
| 469 | Ga0207707_10005142 | 3300025912 | Bacteria | 11467 |
| 470 | Ga0207707_10038111 | 3300025912 | Bacteria | 4200 |
| 471 | Ga0207707_10086757 | 3300025912 | Bacteria | 2735 |
| 472 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 473 | Ga0207695_10003068 | 3300025913 | Bacteria | 23948 |
| 474 | Ga0207695_10088822 | 3300025913 | Bacteria | 3110 |
| 475 | Ga0207671_10045754 | 3300025914 | Bacteria | 3237 |
| 476 | Ga0207671_10047017 | 3300025914 | Bacteria | 3193 |
| 477 | Ga0207693_10000107 | 3300025915 | Bacteria | 75324 |
| 478 | Ga0207693_10000607 | 3300025915 | Bacteria | 32076 |
| 479 | Ga0207693_10021441 | 3300025915 | Bacteria | 5133 |
| 480 | Ga0207660_10000254 | 3300025917 | Bacteria | 34713 |
| 481 | Ga0207660_10000565 | 3300025917 | Bacteria | 24898 |
| 482 | Ga0207660_10010861 | 3300025917 | Bacteria | 5920 |
| 483 | Ga0207660_10011496 | 3300025917 | Bacteria | 5766 |
| 484 | Ga0207660_10101148 | 3300025917 | Bacteria | 2153 |
| 485 | Ga0207662_10005247 | 3300025918 | Bacteria | 6879 |
| 486 | Ga0207662_10016212 | 3300025918 | Bacteria | 4202 |
| 487 | Ga0207662_10025676 | 3300025918 | Bacteria | 3393 |
| 488 | Ga0207657_10000086 | 3300025919 | Bacteria | 88712 |
| 489 | Ga0207657_10000097 | 3300025919 | Bacteria | 83815 |
| 490 | Ga0207657_10000371 | 3300025919 | Bacteria | 47425 |
| 491 | Ga0207657_10001198 | 3300025919 | Bacteria | 27571 |
| 492 | Ga0207657_10002755 | 3300025919 | Bacteria | 18918 |
| 493 | Ga0207657_10006206 | 3300025919 | Bacteria | 12426 |
| 494 | Ga0207657_10015145 | 3300025919 | Bacteria | 7489 |
| 495 | Ga0207657_10021092 | 3300025919 | Bacteria | 6139 |
| 496 | Ga0207657_10027014 | 3300025919 | Bacteria | 5262 |
| 497 | Ga0207649_10034385 | 3300025920 | Bacteria | 3036 |
| 498 | Ga0207649_10035073 | 3300025920 | Bacteria | 3012 |
| 499 | Ga0207652_10000352 | 3300025921 | Bacteria | 47618 |
| 500 | Ga0207652_10000876 | 3300025921 | Bacteria | 28496 |
| 501 | Ga0207652_10004130 | 3300025921 | Bacteria | 11850 |
| 502 | Ga0207652_10015362 | 3300025921 | Bacteria | 6218 |
| 503 | Ga0207652_10049214 | 3300025921 | Bacteria | 3607 |
| 504 | Ga0207652_10064533 | 3300025921 | Bacteria | 3169 |
| 505 | Ga0207652_10071243 | 3300025921 | Bacteria | 3020 |
| 506 | Ga0207646_10024826 | 3300025922 | Bacteria | 5486 |
| 507 | Ga0207681_10009676 | 3300025923 | Bacteria | 5898 |
| 508 | Ga0207681_10019083 | 3300025923 | Bacteria | 4329 |
| 509 | Ga0207681_10088797 | 3300025923 | Bacteria | 2202 |
| 510 | Ga0207694_10000015 | 3300025924 | Bacteria | 363898 |
| 511 | Ga0207694_10012104 | 3300025924 | Bacteria | 6506 |
| 512 | Ga0207694_10040795 | 3300025924 | Bacteria | 3576 |
| 513 | Ga0207650_10001788 | 3300025925 | Bacteria | 15209 |
| 514 | Ga0207650_10001967 | 3300025925 | Bacteria | 14420 |
| 515 | Ga0207650_10005860 | 3300025925 | Bacteria | 8389 |
| 516 | Ga0207650_10009208 | 3300025925 | Bacteria | 6748 |
| 517 | Ga0207650_10016423 | 3300025925 | Bacteria | 5173 |
| 518 | Ga0207650_10021796 | 3300025925 | Bacteria | 4531 |
| 519 | Ga0207650_10037928 | 3300025925 | Bacteria | 3514 |
| 520 | Ga0207650_10044650 | 3300025925 | Bacteria | 3257 |
| 521 | Ga0207650_10121830 | 3300025925 | Bacteria | 2031 |
| 522 | Ga0207650_10143206 | 3300025925 | Bacteria | 1881 |
| 523 | Ga0207659_10000297 | 3300025926 | Bacteria | 30004 |
| 524 | Ga0207659_10005747 | 3300025926 | Bacteria | 7556 |
| 525 | Ga0207659_10015152 | 3300025926 | Bacteria | 4988 |
| 526 | Ga0207659_10023237 | 3300025926 | Bacteria | 4135 |
| 527 | Ga0207687_10003118 | 3300025927 | Bacteria | 11238 |
| 528 | Ga0207687_10090375 | 3300025927 | Bacteria | 2231 |
| 529 | Ga0207687_10155171 | 3300025927 | Bacteria | 1751 |
| 530 | Ga0207700_10000005 | 3300025928 | Bacteria | 394836 |
| 531 | Ga0207664_10016848 | 3300025929 | Bacteria | 5342 |
| 532 | Ga0207664_10057771 | 3300025929 | Bacteria | 3085 |
| 533 | Ga0207644_10000693 | 3300025931 | Bacteria | 21342 |
| 534 | Ga0207644_10002936 | 3300025931 | Bacteria | 10982 |
| 535 | Ga0207644_10007417 | 3300025931 | Bacteria | 7149 |
| 536 | Ga0207644_10012810 | 3300025931 | Bacteria | 5576 |
| 537 | Ga0207644_10023554 | 3300025931 | Bacteria | 4219 |
| 538 | Ga0207644_10031342 | 3300025931 | Bacteria | 3703 |
| 539 | Ga0207690_10000079 | 3300025932 | Bacteria | 83880 |
| 540 | Ga0207690_10001921 | 3300025932 | Bacteria | 12738 |
| 541 | Ga0207690_10010672 | 3300025932 | Bacteria | 5473 |
| 542 | Ga0207690_10021823 | 3300025932 | Bacteria | 3976 |
| 543 | Ga0207690_10028587 | 3300025932 | Bacteria | 3535 |
| 544 | Ga0207706_10000179 | 3300025933 | Bacteria | 70768 |
| 545 | Ga0207706_10000234 | 3300025933 | Bacteria | 60759 |
| 546 | Ga0207706_10008198 | 3300025933 | Bacteria | 9637 |
| 547 | Ga0207706_10020705 | 3300025933 | Bacteria | 5910 |
| 548 | Ga0207686_10003910 | 3300025934 | Bacteria | 7987 |
| 549 | Ga0207686_10022388 | 3300025934 | Bacteria | 3639 |
| 550 | Ga0207709_10006524 | 3300025935 | Bacteria | 6552 |
| 551 | Ga0207670_10001825 | 3300025936 | Bacteria | 11111 |
| 552 | Ga0207670_10004194 | 3300025936 | Bacteria | 7729 |
| 553 | Ga0207670_10013492 | 3300025936 | Bacteria | 4821 |
| 554 | Ga0207670_10141865 | 3300025936 | Bacteria | 1772 |
| 555 | Ga0207669_10003123 | 3300025937 | Bacteria | 7140 |
| 556 | Ga0207669_10004848 | 3300025937 | Bacteria | 5971 |
| 557 | Ga0207669_10013107 | 3300025937 | Bacteria | 4104 |
| 558 | Ga0207669_10020741 | 3300025937 | Bacteria | 3453 |
| 559 | Ga0207669_10028999 | 3300025937 | Bacteria | 3054 |
| 560 | Ga0207669_10090304 | 3300025937 | Bacteria | 1992 |
| 561 | Ga0207665_10003143 | 3300025939 | Bacteria | 11070 |
| 562 | Ga0207665_10010392 | 3300025939 | Bacteria | 6114 |
| 563 | Ga0207691_10000006 | 3300025940 | Bacteria | 161922 |
| 564 | Ga0207691_10000041 | 3300025940 | Bacteria | 106275 |
| 565 | Ga0207691_10002140 | 3300025940 | Bacteria | 19336 |
| 566 | Ga0207691_10003579 | 3300025940 | Bacteria | 15124 |
| 567 | Ga0207691_10007242 | 3300025940 | Bacteria | 10702 |
| 568 | Ga0207691_10023488 | 3300025940 | Bacteria | 5805 |
| 569 | Ga0207691_10051142 | 3300025940 | Bacteria | 3779 |
| 570 | Ga0207711_10000003 | 3300025941 | Bacteria | 1042791 |
| 571 | Ga0207711_10000005 | 3300025941 | Bacteria | 822972 |
| 572 | Ga0207711_10000009 | 3300025941 | Bacteria | 580864 |
| 573 | Ga0207711_10005744 | 3300025941 | Bacteria | 10469 |
| 574 | Ga0207711_10052212 | 3300025941 | Bacteria | 3503 |
| 575 | Ga0207711_10105987 | 3300025941 | Bacteria | 2493 |
| 576 | Ga0207711_10167938 | 3300025941 | Bacteria | 1989 |
| 577 | Ga0207689_10002625 | 3300025942 | Bacteria | 16644 |
| 578 | Ga0207689_10013046 | 3300025942 | Bacteria | 7096 |
| 579 | Ga0207689_10026766 | 3300025942 | Bacteria | 4830 |
| 580 | Ga0207689_10040323 | 3300025942 | Bacteria | 3865 |
| 581 | Ga0207689_10062096 | 3300025942 | Bacteria | 3073 |
| 582 | Ga0207689_10091084 | 3300025942 | Bacteria | 2506 |
| 583 | Ga0207661_10001297 | 3300025944 | Bacteria | 16724 |
| 584 | Ga0207661_10043906 | 3300025944 | Bacteria | 3529 |
| 585 | Ga0207679_10000854 | 3300025945 | Bacteria | 19571 |
| 586 | Ga0207679_10008751 | 3300025945 | Bacteria | 6458 |
| 587 | Ga0207667_10000012 | 3300025949 | Bacteria | 445492 |
| 588 | Ga0207667_10010041 | 3300025949 | Bacteria | 11097 |
| 589 | Ga0207667_10012475 | 3300025949 | Bacteria | 9787 |
| 590 | Ga0207667_10016595 | 3300025949 | Bacteria | 8312 |
| 591 | Ga0207667_10030042 | 3300025949 | Bacteria | 5883 |
| 592 | Ga0207667_10033189 | 3300025949 | Bacteria | 5553 |
| 593 | Ga0207651_10000821 | 3300025960 | Bacteria | 13431 |
| 594 | Ga0207651_10013513 | 3300025960 | Bacteria | 4675 |
| 595 | Ga0207651_10018012 | 3300025960 | Bacteria | 4191 |
| 596 | Ga0207651_10026671 | 3300025960 | Bacteria | 3614 |
| 597 | Ga0207712_10008168 | 3300025961 | Bacteria | 6615 |
| 598 | Ga0207712_10030965 | 3300025961 | Bacteria | 3600 |
| 599 | Ga0207712_10054342 | 3300025961 | Bacteria | 2813 |
| 600 | Ga0207668_10012351 | 3300025972 | Bacteria | 5226 |
| 601 | Ga0207668_10015304 | 3300025972 | Bacteria | 4762 |
| 602 | Ga0207668_10041851 | 3300025972 | Bacteria | 3098 |
| 603 | Ga0207668_10070945 | 3300025972 | Bacteria | 2486 |
| 604 | Ga0207640_10001916 | 3300025981 | Bacteria | 11183 |
| 605 | Ga0207640_10024196 | 3300025981 | Bacteria | 3661 |
| 606 | Ga0207658_10000919 | 3300025986 | Bacteria | 24357 |
| 607 | Ga0207658_10003069 | 3300025986 | Bacteria | 11943 |
| 608 | Ga0207658_10044901 | 3300025986 | Bacteria | 3218 |
| 609 | Ga0207658_10053095 | 3300025986 | Bacteria | 2993 |
| 610 | Ga0207658_10100828 | 3300025986 | Bacteria | 2261 |
| 611 | Ga0207677_10001381 | 3300026023 | Bacteria | 12956 |
| 612 | Ga0207677_10008881 | 3300026023 | Bacteria | 5634 |
| 613 | Ga0207677_10054070 | 3300026023 | Bacteria | 2737 |
| 614 | Ga0207677_10102872 | 3300026023 | Bacteria | 2107 |
| 615 | Ga0207703_10005123 | 3300026035 | Bacteria | 10606 |
| 616 | Ga0207703_10021199 | 3300026035 | Bacteria | 5086 |
| 617 | Ga0207703_10025888 | 3300026035 | Bacteria | 4616 |
| 618 | Ga0207703_10047168 | 3300026035 | Bacteria | 3473 |
| 619 | Ga0207703_10076878 | 3300026035 | Bacteria | 2770 |
| 620 | Ga0207639_10000490 | 3300026041 | Bacteria | 27373 |
| 621 | Ga0207639_10008869 | 3300026041 | Bacteria | 6918 |
| 622 | Ga0207639_10021277 | 3300026041 | Bacteria | 4657 |
| 623 | Ga0207639_10022263 | 3300026041 | Bacteria | 4563 |
| 624 | Ga0207639_10113055 | 3300026041 | Bacteria | 2217 |
| 625 | Ga0207678_10000048 | 3300026067 | Bacteria | 90920 |
| 626 | Ga0207678_10000571 | 3300026067 | Bacteria | 33712 |
| 627 | Ga0207678_10002945 | 3300026067 | Bacteria | 15420 |
| 628 | Ga0207678_10004770 | 3300026067 | Bacteria | 12167 |
| 629 | Ga0207678_10007754 | 3300026067 | Bacteria | 9485 |
| 630 | Ga0207678_10009779 | 3300026067 | Bacteria | 8433 |
| 631 | Ga0207678_10036581 | 3300026067 | Bacteria | 4273 |
| 632 | Ga0207678_10047822 | 3300026067 | Bacteria | 3699 |
| 633 | Ga0207708_10000443 | 3300026075 | Bacteria | 32270 |
| 634 | Ga0207708_10025813 | 3300026075 | Bacteria | 4446 |
| 635 | Ga0207702_10000159 | 3300026078 | Bacteria | 79906 |
| 636 | Ga0207702_10002232 | 3300026078 | Bacteria | 18580 |
| 637 | Ga0207702_10004049 | 3300026078 | Bacteria | 13157 |
| 638 | Ga0207702_10009325 | 3300026078 | Bacteria | 8245 |
| 639 | Ga0207702_10012569 | 3300026078 | Bacteria | 7042 |
| 640 | Ga0207702_10102796 | 3300026078 | Bacteria | 2526 |
| 641 | Ga0207702_10119111 | 3300026078 | Bacteria | 2360 |
| 642 | Ga0207641_10005890 | 3300026088 | Bacteria | 10401 |
| 643 | Ga0207641_10014561 | 3300026088 | Bacteria | 6447 |
| 644 | Ga0207641_10029258 | 3300026088 | Bacteria | 4554 |
| 645 | Ga0207641_10080992 | 3300026088 | Bacteria | 2818 |
| 646 | Ga0207648_10000601 | 3300026089 | Bacteria | 40481 |
| 647 | Ga0207648_10005057 | 3300026089 | Bacteria | 13371 |
| 648 | Ga0207648_10005567 | 3300026089 | Bacteria | 12673 |
| 649 | Ga0207648_10007647 | 3300026089 | Bacteria | 10579 |
| 650 | Ga0207648_10028309 | 3300026089 | Bacteria | 4969 |
| 651 | Ga0207648_10043296 | 3300026089 | Bacteria | 3952 |
| 652 | Ga0207648_10046711 | 3300026089 | Bacteria | 3796 |
| 653 | Ga0207648_10101206 | 3300026089 | Bacteria | 2525 |
| 654 | Ga0207676_10013122 | 3300026095 | Bacteria | 5948 |
| 655 | Ga0207676_10025294 | 3300026095 | Bacteria | 4405 |
| 656 | Ga0207676_10025391 | 3300026095 | Bacteria | 4396 |
| 657 | Ga0207676_10026337 | 3300026095 | Bacteria | 4325 |
| 658 | Ga0207674_10000049 | 3300026116 | Bacteria | 118784 |
| 659 | Ga0207674_10000370 | 3300026116 | Bacteria | 58547 |
| 660 | Ga0207674_10001773 | 3300026116 | Bacteria | 27553 |
| 661 | Ga0207674_10003550 | 3300026116 | Bacteria | 19032 |
| 662 | Ga0207674_10015035 | 3300026116 | Bacteria | 8525 |
| 663 | Ga0207675_100000155 | 3300026118 | Bacteria | 60380 |
| 664 | Ga0207675_100009455 | 3300026118 | Bacteria | 9124 |
| 665 | Ga0207675_100015985 | 3300026118 | Bacteria | 7005 |
| 666 | Ga0207675_100017259 | 3300026118 | Bacteria | 6739 |
| 667 | Ga0207683_10000011 | 3300026121 | Bacteria | 140261 |
| 668 | Ga0207683_10000189 | 3300026121 | Bacteria | 52818 |
| 669 | Ga0207683_10001926 | 3300026121 | Bacteria | 18374 |
| 670 | Ga0207683_10002787 | 3300026121 | Bacteria | 15262 |
| 671 | Ga0207683_10110301 | 3300026121 | Bacteria | 2463 |
| 672 | Ga0207698_10001338 | 3300026142 | Bacteria | 14348 |
| 673 | Ga0207698_10002962 | 3300026142 | Bacteria | 10167 |
| 674 | Ga0207698_10003392 | 3300026142 | Bacteria | 9590 |
| 675 | Ga0207698_10004499 | 3300026142 | Bacteria | 8507 |
| 676 | Ga0207698_10005795 | 3300026142 | Bacteria | 7668 |
| 677 | Ga0207698_10006260 | 3300026142 | Bacteria | 7407 |
| 678 | Ga0207698_10030846 | 3300026142 | Bacteria | 3862 |
| 679 | Ga0207698_10102178 | 3300026142 | Bacteria | 2379 |
| 680 | Ga0209371_1000751 | 3300027312 | Bacteria | 27079 |
| 681 | Ga0209179_1000384 | 3300027512 | Bacteria | 4355 |
| 682 | Ga0209983_1006882 | 3300027665 | Bacteria | 2332 |
| 683 | Ga0209588_1000210 | 3300027671 | Bacteria | 15783 |
| 684 | Ga0209971_1002340 | 3300027682 | Bacteria | 4577 |
| 685 | Ga0209966_1002324 | 3300027695 | Bacteria | 3174 |
| 686 | Ga0209974_10000323 | 3300027876 | Bacteria | 15625 |
| 687 | Ga0209974_10006470 | 3300027876 | Bacteria | 4089 |
| 688 | Ga0207428_10008390 | 3300027907 | Bacteria | 9332 |
| 689 | Ga0207428_10012418 | 3300027907 | Bacteria | 7484 |
| 690 | Ga0207428_10068766 | 3300027907 | Bacteria | 2785 |
| 691 | Ga0268266_10002385 | 3300028379 | Bacteria | 20297 |
| 692 | Ga0268266_10047097 | 3300028379 | Bacteria | 3692 |
| 693 | Ga0268266_10065304 | 3300028379 | Bacteria | 3146 |
| 694 | Ga0268266_10070942 | 3300028379 | Bacteria | 3019 |
| 695 | Ga0268265_10052141 | 3300028380 | Bacteria | 3092 |
| 696 | Ga0268265_10083584 | 3300028380 | Bacteria | 2528 |
| 697 | Ga0268264_10001396 | 3300028381 | Bacteria | 22573 |
| 698 | Ga0268264_10006175 | 3300028381 | Bacteria | 10119 |
| 699 | Ga0268264_10057327 | 3300028381 | Bacteria | 3258 |
| 700 | Ga0265334_10002110 | 3300028573 | Bacteria | 9395 |
| 701 | Ga0265318_10000592 | 3300028577 | Bacteria | 25373 |
| 702 | Ga0265323_10004666 | 3300028653 | Bacteria | 5881 |
| 703 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 704 | Ga0307515_10090731 | 3300028794 | Bacteria | 3828 |
| 705 | Ga0307515_10150586 | 3300028794 | Bacteria | 2434 |
| 706 | Ga0265338_10004492 | 3300028800 | Bacteria | 18812 |
| 707 | Ga0265338_10063820 | 3300028800 | Bacteria | 3209 |
| 708 | Ga0268256_1002905 | 3300030500 | Bacteria | 8213 |
| 709 | Ga0307512_10038108 | 3300030522 | Bacteria | 4050 |
| 710 | Ga0265332_10000924 | 3300031238 | Bacteria | 17584 |
| 711 | Ga0265328_10006776 | 3300031239 | Bacteria | 4822 |
| 712 | Ga0265320_10000625 | 3300031240 | Bacteria | 27084 |
| 713 | Ga0265320_10012670 | 3300031240 | Bacteria | 4892 |
| 714 | Ga0265325_10000001 | 3300031241 | Bacteria | 726814 |
| 715 | Ga0265325_10000673 | 3300031241 | Bacteria | 24901 |
| 716 | Ga0265325_10005019 | 3300031241 | Bacteria | 8234 |
| 717 | Ga0265325_10015283 | 3300031241 | Bacteria | 4320 |
| 718 | Ga0265325_10017095 | 3300031241 | Bacteria | 4037 |
| 719 | Ga0265329_10005832 | 3300031242 | Bacteria | 4943 |
| 720 | Ga0265340_10003875 | 3300031247 | Bacteria | 8426 |
| 721 | Ga0265340_10004765 | 3300031247 | Bacteria | 7543 |
| 722 | Ga0265340_10030063 | 3300031247 | Bacteria | 2725 |
| 723 | Ga0265339_10000178 | 3300031249 | Bacteria | 53982 |
| 724 | Ga0265339_10005168 | 3300031249 | Bacteria | 8750 |
| 725 | Ga0265331_10000009 | 3300031250 | Bacteria | 314950 |
| 726 | Ga0265331_10000212 | 3300031250 | Bacteria | 70202 |
| 727 | Ga0265331_10000310 | 3300031250 | Bacteria | 53265 |
| 728 | Ga0265331_10001575 | 3300031250 | Bacteria | 16682 |
| 729 | Ga0265331_10026759 | 3300031250 | Bacteria | 2896 |
| 730 | Ga0265327_10000007 | 3300031251 | Bacteria | 678515 |
| 731 | Ga0265327_10000158 | 3300031251 | Bacteria | 145905 |
| 732 | Ga0265327_10009438 | 3300031251 | Bacteria | 7041 |
| 733 | Ga0265316_10000026 | 3300031344 | Bacteria | 165508 |
| 734 | Ga0265316_10009154 | 3300031344 | Bacteria | 9125 |
| 735 | Ga0265316_10009219 | 3300031344 | Bacteria | 9090 |
| 736 | Ga0265316_10021563 | 3300031344 | Bacteria | 5452 |
| 737 | Ga0265316_10043664 | 3300031344 | Bacteria | 3570 |
| 738 | Ga0307509_10000120 | 3300031507 | Bacteria | 114238 |
| 739 | Ga0307408_100010986 | 3300031548 | Bacteria | 5974 |
| 740 | Ga0265313_10000671 | 3300031595 | Bacteria | 35201 |
| 741 | Ga0307508_10001852 | 3300031616 | Bacteria | 23364 |
| 742 | Ga0307508_10025621 | 3300031616 | Bacteria | 5345 |
| 743 | Ga0316575_10010304 | 3300031665 | Bacteria | 3431 |
| 744 | Ga0316579_10008169 | 3300031691 | Bacteria | 4354 |
| 745 | Ga0265314_10002254 | 3300031711 | Bacteria | 19953 |
| 746 | Ga0265314_10003180 | 3300031711 | Bacteria | 16087 |
| 747 | Ga0265314_10005106 | 3300031711 | Bacteria | 11950 |
| 748 | Ga0265314_10012749 | 3300031711 | Bacteria | 6832 |
| 749 | Ga0265314_10015735 | 3300031711 | Bacteria | 5993 |
| 750 | Ga0265314_10023623 | 3300031711 | Bacteria | 4682 |
| 751 | Ga0265314_10046915 | 3300031711 | Bacteria | 3044 |
| 752 | Ga0265342_10021084 | 3300031712 | Bacteria | 4168 |
| 753 | Ga0265342_10024917 | 3300031712 | Bacteria | 3769 |
| 754 | Ga0316578_10016636 | 3300031728 | Bacteria | 3985 |
| 755 | Ga0307407_10015656 | 3300031903 | Bacteria | 3757 |
| 756 | Ga0307409_100014286 | 3300031995 | Bacteria | 5156 |
| 757 | Ga0307409_100027306 | 3300031995 | Bacteria | 4043 |
| 758 | Ga0307409_100039025 | 3300031995 | Bacteria | 3520 |
| 759 | Ga0307411_10013561 | 3300032005 | Bacteria | 4501 |
| 760 | Ga0307415_100013127 | 3300032126 | Bacteria | 4823 |
| 761 | Ga0307510_10009222 | 3300033180 | Bacteria | 11755 |
| 762 | Ga0373929_0004474 | 3300035085 | Bacteria | 2503 |
| 763 | Ga0373934_0000354 | 3300035086 | Bacteria | 16098 |
| 764 | Ga0373934_0001011 | 3300035086 | Bacteria | 10172 |
| 765 | Ga0373923_0017531 | 3300035111 | Bacteria | 2740 |
| 766 | Ga0373953_0022004 | 3300035117 | Bacteria | 2399 |
| 767 | Ga0373954_0001117 | 3300035118 | Bacteria | 10746 |
| 768 | Ga0373954_0008727 | 3300035118 | Bacteria | 4456 |
| 769 | Ga0373956_0000015 | 3300035119 | Bacteria | 52635 |
| 770 | Ga0373957_0001021 | 3300035120 | Bacteria | 7349 |
| 771 | Ga0373957_0003087 | 3300035120 | Bacteria | 4855 |
| 772 | Ga0373960_0005659 | 3300035121 | Bacteria | 2904 |
| 773 | Ga0373946_0006343 | 3300035171 | Bacteria | 4288 |
| 774 | Ga0373955_0001876 | 3300035172 | Bacteria | 9055 |
| 775 | Ga0373955_0006100 | 3300035172 | Bacteria | 5474 |
| 776 | Ga0373924_0005581 | 3300035410 | Bacteria | 4462 |
| 777 | Ga0373931_0002837 | 3300035691 | Bacteria | 7727 |
| 778 | Ga0373931_0003952 | 3300035691 | Bacteria | 6710 |
| 779 | Ga0373931_0029355 | 3300035691 | Bacteria | 2822 |
| 780 | Ga0373935_0021323 | 3300035692 | Bacteria | 3966 |
| 781 | Ga0373927_0000105 | 3300035695 | Bacteria | 63459 |
| 782 | Ga0373933_0015225 | 3300035724 | Bacteria | 4287 |
| 783 | Ga0373933_0102922 | 3300035724 | Bacteria | 1773 |
| 784 | Ga0373937_0000182 | 3300036401 | Bacteria | 61628 |
| 785 | Ga0373937_0008540 | 3300036401 | Bacteria | 8897 |
| 786 | Ga0373937_0041024 | 3300036401 | Bacteria | 4221 |
| 787 | Ga0373937_0047865 | 3300036401 | Bacteria | 3913 |
| 788 | Ga0316582_0039982 | 3300036647 | Bacteria | 2923 |
| 789 | Ga0316584_0044557 | 3300036712 | Bacteria | 3308 |
| 790 | Ga0316584_0135245 | 3300036712 | Bacteria | 1840 |
| 791 | Ga0373925_0015839 | 3300037068 | Bacteria | 5454 |
| 792 | Ga0373925_0042583 | 3300037068 | Bacteria | 3368 |
| 793 | Ga0395900_0107137 | 3300037418 | Bacteria | 2871 |
| 794 | Ga0395900_0129653 | 3300037418 | Bacteria | 2585 |
| 795 | Ga0395898_0002100 | 3300037466 | Bacteria | 24723 |
| 796 | Ga0395898_0019233 | 3300037466 | Bacteria | 6953 |
| 797 | Ga0395898_0034834 | 3300037466 | Bacteria | 5012 |
| 798 | Ga0395905_0016763 | 3300037471 | Bacteria | 6962 |
| 799 | Ga0395905_0131121 | 3300037471 | Bacteria | 2357 |
| 800 | Ga0316581_0002069 | 3300037588 | Bacteria | 4715 |
| 801 | Ga0395901_0000012 | 3300038443 | Bacteria | 381361 |
| 802 | Ga0436365_0943727 | 3300039437 | Bacteria | 72096 |
| 803 | Ga0436365_1866721 | 3300039437 | Bacteria | 30114 |
| 804 | Ga0436363_0556201 | 3300039450 | Bacteria | 6913 |
| 805 | Ga0436363_1015978 | 3300039450 | Bacteria | 6242 |
| 806 | Ga0451577_0008079 | 3300042876 | Bacteria | 10267 |
| 807 | Ga0466966_0000358 | 3300044684 | Bacteria | 29554 |
| 808 | Ga0466961_0050276 | 3300044693 | Bacteria | 2662 |
| 809 | Ga0466971_0008411 | 3300044719 | Bacteria | 4501 |
| 810 | Ga0451576_0010126 | 3300045051 | Bacteria | 10855 |
| 811 | Ga0451576_0025520 | 3300045051 | Bacteria | 6366 |
| 812 | Ga0466958_0050054 | 3300045836 | Bacteria | 2529 |
| 813 | Ga0495592_0000222 | 3300046454 | Bacteria | 48902 |
| 814 | Ga0495592_0001331 | 3300046454 | Bacteria | 17151 |
| 815 | Ga0495592_0004668 | 3300046454 | Bacteria | 10040 |
| 816 | Ga0495592_0009287 | 3300046454 | Bacteria | 7397 |
| 817 | Ga0495592_0071067 | 3300046454 | Bacteria | 2534 |
| 818 | Ga0495603_0041644 | 3300046455 | Bacteria | 2746 |
| 819 | Ga0495590_0017656 | 3300046457 | Bacteria | 2565 |
| 820 | Ga0495590_0017900 | 3300046457 | Bacteria | 2542 |
| 821 | Ga0495629_0029934 | 3300046459 | Bacteria | 3860 |
| 822 | Ga0495641_0007909 | 3300046461 | Bacteria | 6565 |
| 823 | Ga0495651_0000027 | 3300046462 | Bacteria | 107496 |
| 824 | Ga0495653_0005972 | 3300046463 | Bacteria | 9967 |
| 825 | Ga0495580_0013264 | 3300046472 | Bacteria | 6297 |
| 826 | Ga0495580_0065734 | 3300046472 | Bacteria | 2540 |
| 827 | Ga0495605_0054297 | 3300046474 | Bacteria | 1941 |
| 828 | Ga0495639_0002186 | 3300046475 | Bacteria | 8613 |
| 829 | Ga0495664_0013806 | 3300046477 | Bacteria | 4580 |
| 830 | Ga0495584_0032900 | 3300046491 | Bacteria | 2623 |
| 831 | Ga0495594_0011392 | 3300046499 | Bacteria | 4619 |
| 832 | Ga0495583_0000157 | 3300046506 | Bacteria | 113758 |
| 833 | Ga0495618_0027905 | 3300046514 | Bacteria | 3516 |
| 834 | Ga0495628_0003637 | 3300046516 | Bacteria | 13765 |
| 835 | Ga0495628_0005486 | 3300046516 | Bacteria | 11108 |
| 836 | Ga0495628_0005510 | 3300046516 | Bacteria | 11076 |
| 837 | Ga0495630_0013074 | 3300046517 | Bacteria | 6034 |
| 838 | Ga0495643_0034095 | 3300046522 | Bacteria | 2811 |
| 839 | Ga0495666_0002970 | 3300046526 | Bacteria | 8505 |
| 840 | Ga0495652_0068635 | 3300046529 | Bacteria | 2969 |
| 841 | Ga0495652_0119582 | 3300046529 | Bacteria | 2104 |
| 842 | Ga0495665_0029205 | 3300046531 | Bacteria | 2954 |
| 843 | Ga0495640_0028427 | 3300046533 | Bacteria | 4026 |
| 844 | Ga0495640_0089675 | 3300046533 | Bacteria | 2030 |
| 845 | Ga0495586_0005862 | 3300046535 | Bacteria | 6564 |
| 846 | Ga0495645_0000805 | 3300046543 | Bacteria | 21490 |
| 847 | Ga0495645_0011488 | 3300046543 | Bacteria | 6233 |
| 848 | Ga0495645_0044980 | 3300046543 | Bacteria | 3220 |
| 849 | Ga0495667_0031612 | 3300046559 | Bacteria | 3551 |
| 850 | Ga0495599_0001555 | 3300046678 | Bacteria | 13210 |
| 851 | Ga0495599_0007529 | 3300046678 | Bacteria | 6603 |
| 852 | Ga0495599_0024818 | 3300046678 | Bacteria | 3749 |
| 853 | Ga0495623_0013933 | 3300046679 | Bacteria | 5212 |
| 854 | Ga0495658_0000516 | 3300046683 | Bacteria | 21141 |
| 855 | Ga0495658_0020543 | 3300046683 | Bacteria | 3466 |
| 856 | Ga0495669_0000652 | 3300046684 | Bacteria | 15120 |
| 857 | Ga0495613_0107840 | 3300046689 | Bacteria | 2009 |
| 858 | Ga0495624_0045296 | 3300046690 | Bacteria | 2801 |
| 859 | Ga0495600_0044687 | 3300046809 | Bacteria | 2889 |
| 860 | Ga0495660_0055057 | 3300046810 | Bacteria | 2154 |
| 861 | Ga0495604_0031357 | 3300047317 | Bacteria | 4215 |
| 862 | Ga0495604_0045037 | 3300047317 | Bacteria | 3444 |
| 863 | Ga0495636_0015741 | 3300047318 | Bacteria | 3015 |
| 864 | Ga0495674_0002263 | 3300047319 | Bacteria | 18906 |
| 865 | Ga0495674_0068720 | 3300047319 | Bacteria | 3065 |
| 866 | Ga0495687_013582 | 3300047443 | Bacteria | 4239 |
| 867 | Ga0495687_013583 | 3300047443 | Bacteria | 4239 |
| 868 | Ga0495675_0004295 | 3300047444 | Bacteria | 8624 |
| 869 | Ga0495684_0032466 | 3300047471 | Bacteria | 4009 |
| 870 | Ga0495593_0027349 | 3300047673 | Bacteria | 3141 |
| 871 | Ga0495602_0010213 | 3300048088 | Bacteria | 9745 |
| 872 | Ga0496100_0003222 | 3300048903 | Bacteria | 8472 |
| 873 | Ga0496100_0054653 | 3300048903 | Bacteria | 2605 |
| 874 | Ga0496100_0077440 | 3300048903 | Bacteria | 2236 |
| 875 | Ga0496101_0019775 | 3300048904 | Bacteria | 4603 |
| 876 | Ga0496101_0084395 | 3300048904 | Bacteria | 2352 |
| 877 | Ga0496102_0025167 | 3300048905 | Bacteria | 5295 |
| 878 | Ga0496102_0028045 | 3300048905 | Bacteria | 5031 |
| 879 | Ga0496103_0088480 | 3300048906 | Bacteria | 1953 |
| 880 | Ga0496104_0007802 | 3300048907 | Bacteria | 9487 |
| 881 | Ga0496104_0028037 | 3300048907 | Bacteria | 5216 |
| 882 | Ga0496105_0045957 | 3300048908 | Bacteria | 3603 |
| 883 | Ga0496105_0113865 | 3300048908 | Bacteria | 2231 |
| 884 | Ga0496106_0000409 | 3300048909 | Bacteria | 30485 |
| 885 | Ga0496106_0012598 | 3300048909 | Bacteria | 6245 |
| 886 | Ga0496106_0087778 | 3300048909 | Bacteria | 2396 |
| 887 | Ga0496106_0108062 | 3300048909 | Bacteria | 2164 |
| 888 | Ga0496107_0001500 | 3300048910 | Bacteria | 14486 |
| 889 | Ga0496107_0010331 | 3300048910 | Bacteria | 6485 |
| 890 | Ga0496107_0018604 | 3300048910 | Bacteria | 4893 |
| 891 | Ga0496107_0036835 | 3300048910 | Bacteria | 3509 |
| 892 | Ga0496108_0021496 | 3300048911 | Bacteria | 5303 |
| 893 | Ga0496108_0085042 | 3300048911 | Bacteria | 2684 |
| 894 | Ga0496109_0028329 | 3300048912 | Bacteria | 5008 |
| 895 | Ga0496109_0033917 | 3300048912 | Bacteria | 4594 |
| 896 | Ga0496109_0072536 | 3300048912 | Bacteria | 3163 |
| 897 | Ga0496110_0001394 | 3300048913 | Bacteria | 17455 |
| 898 | Ga0496110_0010836 | 3300048913 | Bacteria | 7434 |
| 899 | Ga0496110_0017084 | 3300048913 | Bacteria | 6065 |
| 900 | Ga0496110_0060043 | 3300048913 | Bacteria | 3353 |
| 901 | Ga0496111_0001106 | 3300048914 | Bacteria | 14931 |
| 902 | Ga0496111_0010890 | 3300048914 | Bacteria | 6117 |
| 903 | Ga0496111_0026927 | 3300048914 | Bacteria | 4063 |
| 904 | Ga0496112_0048854 | 3300048915 | Bacteria | 4145 |
| 905 | Ga0496112_0089723 | 3300048915 | Bacteria | 3042 |
| 906 | Ga0496113_0000433 | 3300048916 | Bacteria | 20324 |
| 907 | Ga0496113_0003368 | 3300048916 | Bacteria | 9553 |
| 908 | Ga0496113_0119221 | 3300048916 | Bacteria | 2061 |
| 909 | Ga0496114_0031499 | 3300048917 | Bacteria | 4363 |
| 910 | Ga0496114_0049787 | 3300048917 | Bacteria | 3486 |
| 911 | Ga0496114_0113459 | 3300048917 | Bacteria | 2323 |
| 912 | Ga0496115_0033365 | 3300048918 | Bacteria | 4064 |
| 913 | Ga0496117_0054705 | 3300048920 | Bacteria | 2794 |
| 914 | Ga0496121_0004741 | 3300048924 | Bacteria | 17950 |
| 915 | Ga0496121_0077159 | 3300048924 | Bacteria | 2654 |
| 916 | Ga0496122_0027243 | 3300048925 | Bacteria | 4892 |
| 917 | Ga0496126_0000159 | 3300048929 | Bacteria | 155348 |
| 918 | Ga0496126_0009928 | 3300048929 | Bacteria | 10050 |
| 919 | Ga0495682_0006404 | 3300049460 | Bacteria | 4763 |
| 920 | Ga0501031_0048296 | 3300049568 | Bacteria | 2774 |
| 921 | Ga0501031_0053677 | 3300049568 | Bacteria | 2627 |
| 922 | Ga0501032_0012026 | 3300049569 | Bacteria | 6196 |
| 923 | Ga0501033_0001351 | 3300049570 | Bacteria | 21848 |
| 924 | Ga0501033_0002716 | 3300049570 | Bacteria | 14843 |
| 925 | Ga0501033_0083700 | 3300049570 | Bacteria | 2338 |
| 926 | Ga0501036_0000919 | 3300049572 | Bacteria | 22109 |
| 927 | Ga0501036_0014798 | 3300049572 | Bacteria | 6507 |
| 928 | Ga0501036_0076002 | 3300049572 | Bacteria | 2841 |
| 929 | Ga0501037_0091707 | 3300049573 | Bacteria | 2197 |
| 930 | Ga0501038_0000462 | 3300049574 | Bacteria | 35656 |
| 931 | Ga0501038_0082005 | 3300049574 | Bacteria | 2716 |
| 932 | Ga0501039_0000199 | 3300049575 | Bacteria | 43314 |
| 933 | Ga0501039_0052576 | 3300049575 | Bacteria | 3151 |
| 934 | Ga0501040_0000082 | 3300049576 | Bacteria | 46447 |
| 935 | Ga0501040_0019848 | 3300049576 | Bacteria | 4473 |
| 936 | Ga0501041_0019561 | 3300049577 | Bacteria | 4044 |
| 937 | Ga0501042_0000848 | 3300049578 | Bacteria | 17046 |
| 938 | Ga0501042_0025259 | 3300049578 | Bacteria | 4171 |
| 939 | Ga0501042_0030699 | 3300049578 | Bacteria | 3798 |
| 940 | Ga0501043_0033537 | 3300049579 | Bacteria | 4040 |
| 941 | Ga0501046_0000011 | 3300049580 | Bacteria | 326457 |
| 942 | Ga0501046_0000972 | 3300049580 | Bacteria | 28056 |
| 943 | Ga0501046_0014558 | 3300049580 | Bacteria | 6630 |
| 944 | Ga0501068_0001236 | 3300049584 | Bacteria | 13565 |
| 945 | Ga0501068_0006927 | 3300049584 | Bacteria | 6272 |
| 946 | Ga0501069_0017298 | 3300049585 | Bacteria | 3878 |
| 947 | Ga0501070_0000312 | 3300049586 | Bacteria | 44306 |
| 948 | Ga0501071_0016203 | 3300049587 | Bacteria | 5123 |
| 949 | Ga0501071_0097790 | 3300049587 | Bacteria | 2161 |
| 950 | Ga0501072_0000700 | 3300049588 | Bacteria | 24296 |
| 951 | Ga0501072_0098325 | 3300049588 | Bacteria | 2326 |
| 952 | Ga0501073_0002018 | 3300049589 | Bacteria | 15166 |
| 953 | Ga0501073_0022687 | 3300049589 | Bacteria | 4516 |
| 954 | Ga0501074_0037128 | 3300049590 | Bacteria | 3532 |
| 955 | Ga0501074_0076168 | 3300049590 | Bacteria | 2408 |
| 956 | Ga0501075_0001404 | 3300049591 | Bacteria | 15675 |
| 957 | Ga0501075_0006900 | 3300049591 | Bacteria | 7845 |
| 958 | Ga0501075_0110847 | 3300049591 | Bacteria | 2086 |
| 959 | Ga0501076_0009779 | 3300049592 | Bacteria | 7083 |
| 960 | Ga0501076_0010451 | 3300049592 | Bacteria | 6890 |
| 961 | Ga0501076_0073281 | 3300049592 | Bacteria | 2742 |
| 962 | Ga0501076_0081417 | 3300049592 | Bacteria | 2599 |
| 963 | Ga0501077_0006183 | 3300049593 | Bacteria | 7314 |
| 964 | Ga0501077_0036294 | 3300049593 | Bacteria | 3139 |
| 965 | Ga0501079_0000165 | 3300049741 | Bacteria | 36937 |
| 966 | Ga0501079_0003510 | 3300049741 | Bacteria | 11524 |
| 967 | Ga0501079_0014941 | 3300049741 | Bacteria | 5918 |
| 968 | Ga0501079_0046237 | 3300049741 | Bacteria | 3358 |
| 969 | Ga0501080_0000275 | 3300049742 | Bacteria | 38762 |
| 970 | Ga0501080_0001307 | 3300049742 | Bacteria | 20747 |
| 971 | Ga0501080_0006486 | 3300049742 | Bacteria | 10508 |
| 972 | Ga0501080_0012157 | 3300049742 | Bacteria | 7889 |
| 973 | Ga0501080_0031292 | 3300049742 | Bacteria | 4958 |
| 974 | Ga0501080_0079550 | 3300049742 | Bacteria | 3047 |
| 975 | Ga0501080_0095681 | 3300049742 | Bacteria | 2757 |
| 976 | Ga0501081_0000057 | 3300049743 | Bacteria | 42708 |
| 977 | Ga0501081_0000305 | 3300049743 | Bacteria | 26307 |
| 978 | Ga0501081_0013933 | 3300049743 | Bacteria | 5293 |
| 979 | Ga0501081_0021013 | 3300049743 | Bacteria | 4356 |
| 980 | Ga0501035_0000425 | 3300049822 | Bacteria | 47628 |
| 981 | Ga0501035_0000738 | 3300049822 | Bacteria | 35218 |
| 982 | Ga0501035_0025898 | 3300049822 | Bacteria | 5374 |
| 983 | Ga0501035_0038385 | 3300049822 | Bacteria | 4336 |
| 984 | Ga0501044_0028265 | 3300049823 | Bacteria | 5919 |
| 985 | Ga0501044_0031130 | 3300049823 | Bacteria | 5617 |
| 986 | Ga0501044_0071590 | 3300049823 | Bacteria | 3525 |
| 987 | Ga0501044_0093705 | 3300049823 | Bacteria | 3028 |
| 988 | Ga0501045_0000012 | 3300049824 | Bacteria | 74001 |
| 989 | Ga0501045_0034813 | 3300049824 | Bacteria | 3656 |
| 990 | Ga0501045_0038849 | 3300049824 | Bacteria | 3463 |
| 991 | nmdc:mga05p37_120455_c1 | 3300050507 | Bacteria | 3224 |
| 992 | nmdc:mga05p37_12922_c1 | 3300050507 | Bacteria | 9987 |
| 993 | nmdc:mga05p37_35895_c1 | 3300050507 | Bacteria | 6083 |
| 994 | nmdc:mga09592_298_c1 | 3300050508 | Bacteria | 36073 |
| 995 | nmdc:mga06r32_197388_c1 | 3300050510 | Bacteria | 2000 |
| 996 | nmdc:mga06r32_5705_c1 | 3300050510 | Bacteria | 11210 |
| 997 | nmdc:mga08y16_109972_c1 | 3300050511 | Bacteria | 2870 |
| 998 | nmdc:mga08y16_78946_c1 | 3300050511 | Bacteria | 3431 |
| 999 | nmdc:mga0n895_34781_c1 | 3300050512 | Bacteria | 4853 |
| 1000 | nmdc:mga0rr50_29742_c1 | 3300050513 | Bacteria | 3858 |
| 1001 | nmdc:mga0rr50_6619_c1 | 3300050513 | Bacteria | 7081 |
| 1002 | nmdc:mga0rr50_98579_c1 | 3300050513 | Bacteria | 2291 |
| 1003 | nmdc:mga08x19_20033_c1 | 3300050514 | Bacteria | 4116 |
| 1004 | nmdc:mga08x19_69_c1 | 3300050514 | Bacteria | 100711 |
| 1005 | nmdc:mga08x19_7162_c1 | 3300050514 | Bacteria | 6625 |
| 1006 | nmdc:mga0a205_14531_c1 | 3300050515 | Bacteria | 7346 |
| 1007 | nmdc:mga0a205_184043_c1 | 3300050515 | Bacteria | 1983 |
| 1008 | nmdc:mga0a205_41429_c1 | 3300050515 | Bacteria | 4434 |
| 1009 | nmdc:mga0a205_44992_c1 | 3300050515 | Bacteria | 4257 |
| 1010 | Ga0495601_0000453 | 3300053077 | Bacteria | 21492 |
| 1011 | Ga0495601_0002598 | 3300053077 | Bacteria | 10240 |
| 1012 | Ga0495612_0016272 | 3300053078 | Bacteria | 2980 |
| 1013 | Ga0500635_0002964 | 3300053080 | Bacteria | 4226 |
| 1014 | Ga0495595_0003407 | 3300053084 | Bacteria | 6314 |
| 1015 | Ga0495595_0015967 | 3300053084 | Bacteria | 3206 |
| 1016 | Ga0495595_0039777 | 3300053084 | Bacteria | 2147 |
| 1017 | Ga0495619_0004357 | 3300053085 | Bacteria | 9029 |
| 1018 | Ga0495619_0050300 | 3300053085 | Bacteria | 2751 |
| 1019 | Ga0500644_0008882 | 3300053088 | Bacteria | 2667 |
| 1020 | Ga0500559_0000011 | 3300053136 | Bacteria | 164751 |
| 1021 | Ga0500603_000170 | 3300053150 | Bacteria | 16461 |
| 1022 | Ga0500616_0003543 | 3300053153 | Bacteria | 11832 |
| 1023 | Ga0500622_0089846 | 3300053156 | Bacteria | 1525 |
| 1024 | Ga0500637_0000793 | 3300053178 | Bacteria | 12680 |
| 1025 | Ga0500601_000089 | 3300053737 | Bacteria | 19050 |
| 1026 | Ga0500587_001060 | 3300053739 | Bacteria | 3752 |
| 1027 | Ga0501084_0000154 | 3300054114 | Bacteria | 52658 |
| 1028 | Ga0501084_0000200 | 3300054114 | Bacteria | 46374 |
| 1029 | Ga0501084_0019185 | 3300054114 | Bacteria | 5696 |
| 1030 | Ga0501084_0123048 | 3300054114 | Bacteria | 2182 |
| 1031 | Ga0501082_0001611 | 3300060353 | Bacteria | 19883 |
| 1032 | Ga0501082_0016067 | 3300060353 | Bacteria | 6439 |
| 1033 | Ga0501082_0136752 | 3300060353 | Bacteria | 2126 |
| 1034 | Ga0466962_0005109 | 3300061719 | Bacteria | 6313 |
| 1035 | Ga0530510_0000572 | 3300061734 | Bacteria | 23723 |
| 1036 | Ga0530510_0020973 | 3300061734 | Bacteria | 4647 |
| 1037 | Ga0530510_0026913 | 3300061734 | Bacteria | 4119 |
| 1038 | 2501074833 | 2501025501 | Bacteria | 7768574 |
| 1039 | 2501083919 | 2501025502 | Bacteria | 9641094 |
| 1040 | 2501413045 | 2501025504 | Bacteria | 8008976 |
| 1041 | 2509077840 | 2508501114 | Bacteria | 7082538 |
| 1042 | 2511087261 | 2510917013 | Bacteria | 9951648 |
| 1043 | 2511100511 | 2510917014 | Bacteria | 8296963 |
| 1044 | 2511105826 | 2510917015 | Bacteria | 7950052 |
| 1045 | 2513551730 | 2513237082 | Bacteria | 8640282 |
| 1046 | 2513561867 | 2513237083 | Bacteria | 8410967 |
| 1047 | 2516017613 | 2515154189 | Bacteria | 9629850 |
| 1048 | 2519461661 | 2519103095 | Bacteria | 6629912 |
| 1049 | 2545676352 | 2545555834 | Bacteria | 8130841 |
| 1050 | 2545676766 | 2545555834 | Bacteria | 8130841 |
| 1051 | 2585293274 | 2582581311 | Bacteria | 6763856 |
| 1052 | 2599735141 | 2599185239 | Bacteria | 8686614 |
| 1053 | 2599743269 | 2599185240 | Bacteria | 7968121 |
| 1054 | 2600205499 | 2599185355 | Bacteria | 7968906 |
| 1055 | 2643757603 | 2643221547 | Bacteria | 4740017 |
| 1056 | 2676740796 | 2675903129 | Bacteria | 7964495 |
| 1057 | 2817258537 | 2816332253 | Bacteria | 6764532 |
| 1058 | 2817281045 | 2816332256 | Bacteria | 6891714 |
| 1059 | 2817453230 | 2816332286 | Bacteria | 6853759 |
| 1060 | 2819632049 | 2818991452 | Bacteria | 8442785 |
| 1061 | 2841914214 | 2841911363 | Bacteria | 6173697 |
| 1062 | 2841921417 | 2841917233 | Bacteria | 6173500 |
| 1063 | 2863422440 | 2863421361 | Bacteria | 7300805 |
| 1064 | 2870072664 | 2870068957 | Bacteria | 8925310 |
| 1065 | 2883090005 | 2883087390 | Bacteria | 9532701 |
| 1066 | 2928157141 | 2928157003 | Bacteria | 7522202 |
| 1067 | 2928168975 | 2928163908 | Bacteria | 7561269 |
| 1068 | 2928172218 | 2928170801 | Bacteria | 8785406 |
| 1069 | 2981994992 | 2981990288 | Bacteria | 7590678 |
| 1070 | 2998347691 | 2998344455 | Bacteria | 4222996 |
| 1071 | 3003667237 | 3003665799 | Bacteria | 7279786 |
| 1072 | 3005598918 | 3005594810 | Bacteria | 8716512 |
| 1073 | 641568642 | 641522639 | Bacteria | 7737025 |
| 1074 | 641642903 | 641522639 | Bacteria | 7737025 |
| 1075 | 642419949 | 641736154 | Bacteria | 7689995 |
| 1076 | 643599813 | 643348564 | Bacteria | 8839022 |
| 1077 | 8003956896 | 8003955200 | Bacteria | 8601927 |
| 1078 | 8018852084 | 8018845410 | Bacteria | 8933938 |
| 1079 | 8020809180 | 8020807995 | Bacteria | 6801506 |
| 1080 | 8020939755 | 8020938398 | Bacteria | 7472757 |
| 1081 | 8020945744 | 8020945358 | Bacteria | 8467355 |
| 1082 | 8020957375 | 8020953355 | Bacteria | 7439080 |
| 1083 | 8021120489 | 8021120328 | Bacteria | 8782274 |
| 1084 | 8039101307 | 8039098773 | Bacteria | 6602928 |
| 1085 | 8040167637 | 8040167225 | Bacteria | 6542727 |
| 1086 | 8040177697 | 8040173305 | Bacteria | 6827067 |
| 1087 | Ga0081539_10000496 | |||
| 1088 | JGI24746J21847_1002939 | |||
| 1089 | JGI24737J22298_10009297 | |||
| 1090 | JGI24738J21930_10005230 | |||
| 1091 | JGI25406J46586_10001412 | |||
| 1092 | rootH2_10022601 | |||
| 1093 | Ga0055532_1000772 | |||
| 1094 | Ga0055542_1001051 | |||
| 1095 | Ga0055529_1000131 | |||
| 1096 | Ga0070658_10002727 | |||
| 1097 | Ga0070658_10064981 | |||
| 1098 | Ga0070658_10065792 | |||
| 1099 | Ga0070676_10000349 | |||
| 1100 | Ga0070676_10000987 | |||
| 1101 | Ga0070676_10005202 | |||
| 1102 | Ga0070676_10015434 | |||
| 1103 | Ga0070683_100002745 | |||
| 1104 | Ga0070683_100004485 | |||
| 1105 | Ga0070683_100075858 | |||
| 1106 | Ga0070683_100088458 | |||
| 1107 | Ga0070690_100000506 | |||
| 1108 | Ga0070690_100013601 | |||
| 1109 | Ga0070670_100001013 | |||
| 1110 | Ga0070670_100001094 | |||
| 1111 | Ga0070670_100003011 | |||
| 1112 | Ga0070670_100016870 | |||
| 1113 | Ga0070670_100052172 | |||
| 1114 | Ga0070670_100084487 | |||
| 1115 | Ga0070677_10000462 | |||
| 1116 | Ga0070677_10007080 | |||
| 1117 | Ga0070677_10014455 | |||
| 1118 | Ga0068869_100001630 | |||
| 1119 | Ga0068869_100010248 | |||
| 1120 | Ga0068869_100014001 | |||
| 1121 | Ga0070666_10000887 | |||
| 1122 | Ga0070666_10007044 | |||
| 1123 | Ga0070666_10069523 | |||
| 1124 | Ga0070680_100000080 | |||
| 1125 | Ga0070680_100004773 | |||
| 1126 | Ga0070680_100007360 | |||
| 1127 | Ga0070680_100013393 | |||
| 1128 | Ga0070682_100002558 | |||
| 1129 | Ga0070682_100004488 | |||
| 1130 | Ga0068868_100000392 | |||
| 1131 | Ga0068868_100002888 | |||
| 1132 | Ga0068868_100104538 | |||
| 1133 | Ga0070660_100000062 | |||
| 1134 | Ga0070660_100000397 | |||
| 1135 | Ga0070660_100000724 | |||
| 1136 | Ga0070660_100001178 | |||
| 1137 | Ga0070660_100017996 | |||
| 1138 | Ga0070660_100020072 | |||
| 1139 | Ga0070660_100041186 | |||
| 1140 | Ga0070660_100046347 | |||
| 1141 | Ga0070660_100072692 | |||
| 1142 | Ga0070660_100151033 | |||
| 1143 | Ga0070689_100018917 | |||
| 1144 | Ga0070689_100019225 | |||
| 1145 | Ga0070689_100048868 | |||
| 1146 | Ga0070689_100055169 | |||
| 1147 | Ga0070689_100103624 | |||
| 1148 | Ga0070691_10000155 | |||
| 1149 | Ga0070691_10001017 | |||
| 1150 | Ga0070691_10001118 | |||
| 1151 | Ga0070687_100051538 | |||
| 1152 | Ga0070661_100001464 | |||
| 1153 | Ga0070661_100002343 | |||
| 1154 | Ga0070661_100003355 | |||
| 1155 | Ga0070661_100005661 | |||
| 1156 | Ga0070661_100005900 | |||
| 1157 | Ga0070661_100047359 | |||
| 1158 | Ga0070692_10026817 | |||
| 1159 | Ga0070668_100000692 | |||
| 1160 | Ga0070668_100003532 | |||
| 1161 | Ga0070668_100013464 | |||
| 1162 | Ga0070668_100017674 | |||
| 1163 | Ga0070668_100075436 | |||
| 1164 | Ga0070668_100088029 | |||
| 1165 | Ga0070669_100000807 | |||
| 1166 | Ga0070675_100000476 | |||
| 1167 | Ga0070675_100000513 | |||
| 1168 | Ga0070675_100001608 | |||
| 1169 | Ga0070675_100007518 | |||
| 1170 | Ga0070675_100023055 | |||
| 1171 | Ga0070671_100001074 | |||
| 1172 | Ga0070671_100001121 | |||
| 1173 | Ga0070671_100002250 | |||
| 1174 | Ga0070671_100005680 | |||
| 1175 | Ga0070671_100044183 | |||
| 1176 | Ga0070671_100136290 | |||
| 1177 | Ga0070671_100141938 | |||
| 1178 | Ga0070674_100000409 | |||
| 1179 | Ga0070674_100006863 | |||
| 1180 | Ga0070674_100020582 | |||
| 1181 | Ga0070674_100024604 | |||
| 1182 | Ga0070673_100000626 | |||
| 1183 | Ga0070673_100002929 | |||
| 1184 | Ga0070673_100017319 | |||
| 1185 | Ga0070673_100063487 | |||
| 1186 | Ga0070688_100002617 | |||
| 1187 | Ga0070688_100004271 | |||
| 1188 | Ga0070688_100019031 | |||
| 1189 | Ga0070659_100000064 | |||
| 1190 | Ga0070659_100000714 | |||
| 1191 | Ga0070659_100002581 | |||
| 1192 | Ga0070659_100004099 | |||
| 1193 | Ga0070659_100007825 | |||
| 1194 | Ga0070659_100024084 | |||
| 1195 | Ga0070659_100038264 | |||
| 1196 | Ga0070667_100000550 | |||
| 1197 | Ga0070667_100005155 | |||
| 1198 | Ga0070667_100097648 | |||
| 1199 | Ga0070667_100205788 | |||
| 1200 | Ga0070709_10001303 | |||
| 1201 | Ga0070709_10001983 | |||
| 1202 | Ga0070714_100002022 | |||
| 1203 | Ga0070714_100006596 | |||
| 1204 | Ga0070714_100010152 | |||
| 1205 | Ga0070714_100035311 | |||
| 1206 | Ga0070714_100056654 | |||
| 1207 | Ga0070713_100000016 | |||
| 1208 | Ga0070713_100044333 | |||
| 1209 | Ga0070710_10002492 | |||
| 1210 | Ga0070701_10003768 | |||
| 1211 | Ga0070711_100037867 | |||
| 1212 | Ga0070711_100087535 | |||
| 1213 | Ga0070705_100002627 | |||
| 1214 | Ga0070700_100002580 | |||
| 1215 | Ga0070700_100055510 | |||
| 1216 | Ga0070700_100088860 | |||
| 1217 | Ga0070694_100000874 | |||
| 1218 | Ga0070663_100000667 | |||
| 1219 | Ga0070663_100001067 | |||
| 1220 | Ga0070663_100001570 | |||
| 1221 | Ga0070663_100002231 | |||
| 1222 | Ga0070663_100002517 | |||
| 1223 | Ga0070663_100015336 | |||
| 1224 | Ga0070663_100017401 | |||
| 1225 | Ga0070678_100000416 | |||
| 1226 | Ga0070678_100000560 | |||
| 1227 | Ga0070678_100000734 | |||
| 1228 | Ga0070678_100013100 | |||
| 1229 | Ga0070678_100060889 | |||
| 1230 | Ga0070662_100007856 | |||
| 1231 | Ga0070662_100060569 | |||
| 1232 | Ga0070681_10000002 | |||
| 1233 | Ga0070681_10004430 | |||
| 1234 | Ga0070681_10007824 | |||
| 1235 | Ga0070681_10049694 | |||
| 1236 | Ga0068867_100001865 | |||
| 1237 | Ga0068867_100009128 | |||
| 1238 | Ga0068867_100013640 | |||
| 1239 | Ga0068867_100126063 | |||
| 1240 | Ga0070685_10036953 | |||
| 1241 | Ga0070707_100067464 | |||
| 1242 | Ga0070698_100010987 | |||
| 1243 | Ga0070679_100004878 | |||
| 1244 | Ga0070684_100003381 | |||
| 1245 | Ga0070684_100006377 | |||
| 1246 | Ga0070684_100012282 | |||
| 1247 | Ga0070684_100114230 | |||
| 1248 | Ga0070697_100011811 | |||
| 1249 | Ga0070697_100129474 | |||
| 1250 | Ga0068853_100000609 | |||
| 1251 | Ga0068853_100008978 | |||
| 1252 | Ga0068853_100045702 | |||
| 1253 | Ga0070672_100001311 | |||
| 1254 | Ga0070672_100002443 | |||
| 1255 | Ga0070672_100003001 | |||
| 1256 | Ga0070672_100003082 | |||
| 1257 | Ga0070672_100007374 | |||
| 1258 | Ga0070672_100024424 | |||
| 1259 | Ga0070686_100000266 | |||
| 1260 | Ga0070695_100000864 | |||
| 1261 | Ga0070695_100080823 | |||
| 1262 | Ga0070696_100003955 | |||
| 1263 | Ga0070696_100006127 | |||
| 1264 | Ga0070696_100021721 | |||
| 1265 | Ga0070693_100000326 | |||
| 1266 | Ga0070693_100001609 | |||
| 1267 | Ga0070665_100001447 | |||
| 1268 | Ga0070665_100005172 | |||
| 1269 | Ga0070665_100011369 | |||
| 1270 | Ga0070665_100017719 | |||
| 1271 | Ga0070665_100021535 | |||
| 1272 | Ga0070665_100079422 | |||
| 1273 | Ga0070704_100003256 | |||
| 1274 | Ga0070704_100012951 | |||
| 1275 | Ga0068855_100000114 | |||
| 1276 | Ga0068855_100001160 | |||
| 1277 | Ga0068855_100007887 | |||
| 1278 | Ga0068855_100007921 | |||
| 1279 | Ga0068855_100015359 | |||
| 1280 | Ga0068855_100019573 | |||
| 1281 | Ga0068855_100026872 | |||
| 1282 | Ga0068855_100102249 | |||
| 1283 | Ga0068855_100179313 | |||
| 1284 | Ga0070664_100000955 | |||
| 1285 | Ga0070664_100004911 | |||
| 1286 | Ga0070664_100007192 | |||
| 1287 | Ga0070664_100016653 | |||
| 1288 | Ga0070664_100027537 | |||
| 1289 | Ga0068857_100000070 | |||
| 1290 | Ga0068857_100005150 | |||
| 1291 | Ga0068857_100012116 | |||
| 1292 | Ga0068857_100016007 | |||
| 1293 | Ga0068857_100057359 | |||
| 1294 | Ga0068857_100086309 | |||
| 1295 | Ga0068854_100000885 | |||
| 1296 | Ga0068854_100004422 | |||
| 1297 | Ga0068854_100012083 | |||
| 1298 | Ga0068854_100015536 | |||
| 1299 | Ga0068856_100001185 | |||
| 1300 | Ga0068856_100002298 | |||
| 1301 | Ga0068856_100003266 | |||
| 1302 | Ga0068856_100004519 | |||
| 1303 | Ga0068856_100021495 | |||
| 1304 | Ga0068856_100021658 | |||
| 1305 | Ga0070702_100000139 | |||
| 1306 | Ga0070702_100007234 | |||
| 1307 | Ga0068852_100001471 | |||
| 1308 | Ga0068852_100001765 | |||
| 1309 | Ga0068852_100001969 | |||
| 1310 | Ga0068852_100002890 | |||
| 1311 | Ga0068852_100011333 | |||
| 1312 | Ga0068852_100084368 | |||
| 1313 | Ga0068859_100004507 | |||
| 1314 | Ga0068859_100050585 | |||
| 1315 | Ga0068859_100128179 | |||
| 1316 | Ga0068859_100232957 | |||
| 1317 | Ga0068864_100000938 | |||
| 1318 | Ga0068864_100005453 | |||
| 1319 | Ga0068864_100017766 | |||
| 1320 | Ga0068864_100020235 | |||
| 1321 | Ga0068864_100065978 | |||
| 1322 | Ga0068866_10006898 | |||
| 1323 | Ga0068866_10008849 | |||
| 1324 | Ga0068861_100006586 | |||
| 1325 | Ga0068851_10000301 | |||
| 1326 | Ga0068851_10003091 | |||
| 1327 | Ga0068851_10009069 | |||
| 1328 | Ga0068870_10000931 | |||
| 1329 | Ga0068870_10008311 | |||
| 1330 | Ga0068870_10052742 | |||
| 1331 | Ga0068863_100000834 | |||
| 1332 | Ga0068863_100001021 | |||
| 1333 | Ga0068863_100006710 | |||
| 1334 | Ga0068863_100015180 | |||
| 1335 | Ga0068863_100092203 | |||
| 1336 | Ga0068863_100160711 | |||
| 1337 | Ga0068858_100001979 | |||
| 1338 | Ga0068858_100010430 | |||
| 1339 | Ga0068858_100050949 | |||
| 1340 | Ga0068858_100055125 | |||
| 1341 | Ga0068860_100003430 | |||
| 1342 | Ga0068860_100003845 | |||
| 1343 | Ga0068860_100004777 | |||
| 1344 | Ga0068862_100020990 | |||
| 1345 | Ga0068862_100041607 | |||
| 1346 | Ga0068862_100071289 | |||
| 1347 | Ga0068862_100083555 | |||
| 1348 | Ga0068862_100105942 | |||
| 1349 | Ga0081455_10006353 | |||
| 1350 | Ga0081455_10134449 | |||
| 1351 | Ga0081540_1002279 | |||
| 1352 | Ga0081539_10000152 | |||
| 1353 | Ga0070717_10032271 | |||
| 1354 | Ga0075432_10007087 | |||
| 1355 | Ga0070715_10000935 | |||
| 1356 | Ga0070716_100000665 | |||
| 1357 | Ga0070712_100000203 | |||
| 1358 | Ga0070712_100000828 | |||
| 1359 | Ga0070712_100029785 | |||
| 1360 | Ga0075366_10004742 | |||
| 1361 | Ga0097621_100000425 | |||
| 1362 | Ga0097621_100013349 | |||
| 1363 | Ga0075370_10029497 | |||
| 1364 | Ga0068871_100000155 | |||
| 1365 | Ga0068871_100001041 | |||
| 1366 | Ga0068871_100033726 | |||
| 1367 | Ga0068871_100057388 | |||
| 1368 | Ga0068871_100087054 | |||
| 1369 | Ga0068871_100087404 | |||
| 1370 | Ga0075428_100037443 | |||
| 1371 | Ga0075431_100006419 | |||
| 1372 | Ga0075431_100009537 | |||
| 1373 | Ga0075433_10051734 | |||
| 1374 | Ga0075433_10082845 | |||
| 1375 | Ga0075434_100004596 | |||
| 1376 | Ga0075434_100005367 | |||
| 1377 | Ga0075434_100014949 | |||
| 1378 | Ga0075429_100008726 | |||
| 1379 | Ga0075429_100018004 | |||
| 1380 | Ga0075429_100053031 | |||
| 1381 | Ga0068865_100003538 | |||
| 1382 | Ga0068865_100010088 | |||
| 1383 | Ga0075436_100001015 | |||
| 1384 | Ga0075436_100001230 | |||
| 1385 | Ga0075436_100007319 | |||
| 1386 | Ga0075436_100019434 | |||
| 1387 | Ga0075436_100031963 | |||
| 1388 | Ga0097620_100004507 | |||
| 1389 | Ga0097620_100050580 | |||
| 1390 | Ga0097620_100128183 | |||
| 1391 | Ga0097620_100232962 | |||
| 1392 | Ga0075435_100006316 | |||
| 1393 | Ga0075435_100007635 | |||
| 1394 | Ga0075435_100022936 | |||
| 1395 | Ga0099795_10024506 | |||
| 1396 | Ga0105240_10003616 | |||
| 1397 | Ga0105240_10004119 | |||
| 1398 | Ga0105240_10007123 | |||
| 1399 | Ga0105240_10025822 | |||
| 1400 | Ga0105240_10027464 | |||
| 1401 | Ga0105240_10059391 | |||
| 1402 | Ga0111539_10017597 | |||
| 1403 | Ga0111539_10077658 | |||
| 1404 | Ga0111539_10083672 | |||
| 1405 | Ga0111539_10195350 | |||
| 1406 | Ga0111539_10205954 | |||
| 1407 | Ga0111539_10272648 | |||
| 1408 | Ga0105245_10001777 | |||
| 1409 | Ga0105245_10013654 | |||
| 1410 | Ga0105247_10018101 | |||
| 1411 | Ga0105247_10036957 | |||
| 1412 | Ga0105247_10049696 | |||
| 1413 | Ga0114129_10017581 | |||
| 1414 | Ga0114129_10122974 | |||
| 1415 | Ga0105243_10001724 | |||
| 1416 | Ga0105243_10076903 | |||
| 1417 | Ga0105243_10154504 | |||
| 1418 | Ga0105241_10002591 | |||
| 1419 | Ga0105241_10004583 | |||
| 1420 | Ga0105242_10003894 | |||
| 1421 | Ga0105248_10000015 | |||
| 1422 | Ga0105248_10001701 | |||
| 1423 | Ga0105248_10003894 | |||
| 1424 | Ga0105248_10004961 | |||
| 1425 | Ga0105248_10009860 | |||
| 1426 | Ga0105248_10127995 | |||
| 1427 | Ga0105237_10002479 | |||
| 1428 | Ga0105237_10012413 | |||
| 1429 | Ga0105238_10001172 | |||
| 1430 | Ga0105238_10024166 | |||
| 1431 | Ga0105238_10032470 | |||
| 1432 | Ga0105238_10049039 | |||
| 1433 | Ga0105238_10051580 | |||
| 1434 | Ga0105238_10091203 | |||
| 1435 | Ga0105249_10003900 | |||
| 1436 | Ga0105249_10020234 | |||
| 1437 | Ga0105249_10034762 | |||
| 1438 | Ga0105249_10047033 | |||
| 1439 | Ga0105239_10003755 | |||
| 1440 | Ga0105239_10034702 | |||
| 1441 | Ga0105239_10040693 | |||
| 1442 | Ga0105246_10005520 | |||
| 1443 | Ga0105246_10077382 | |||
| 1444 | Ga0157373_10000447 | |||
| 1445 | Ga0157373_10004559 | |||
| 1446 | Ga0157373_10007091 | |||
| 1447 | Ga0157373_10020254 | |||
| 1448 | Ga0157371_10001482 | |||
| 1449 | Ga0157371_10009450 | |||
| 1450 | Ga0157370_10002190 | |||
| 1451 | Ga0157370_10003331 | |||
| 1452 | Ga0157370_10004082 | |||
| 1453 | Ga0157370_10004142 | |||
| 1454 | Ga0157370_10014877 | |||
| 1455 | Ga0157370_10023307 | |||
| 1456 | Ga0157369_10004134 | |||
| 1457 | Ga0157369_10007459 | |||
| 1458 | Ga0157369_10031570 | |||
| 1459 | Ga0157369_10106207 | |||
| 1460 | Ga0157374_10000963 | |||
| 1461 | Ga0157374_10002201 | |||
| 1462 | Ga0157374_10006364 | |||
| 1463 | Ga0157374_10015242 | |||
| 1464 | Ga0157374_10053772 | |||
| 1465 | Ga0157374_10120295 | |||
| 1466 | Ga0157378_10003370 | |||
| 1467 | Ga0157378_10044606 | |||
| 1468 | Ga0157378_10052541 | |||
| 1469 | Ga0163162_10013236 | |||
| 1470 | Ga0163162_10015912 | |||
| 1471 | Ga0157372_10001631 | |||
| 1472 | Ga0157372_10007900 | |||
| 1473 | Ga0157372_10010743 | |||
| 1474 | Ga0157372_10011713 | |||
| 1475 | Ga0157372_10017421 | |||
| 1476 | Ga0157372_10022848 | |||
| 1477 | Ga0157372_10025657 | |||
| 1478 | Ga0157372_10089942 | |||
| 1479 | Ga0157375_10002885 | |||
| 1480 | Ga0157375_10003643 | |||
| 1481 | Ga0157375_10018541 | |||
| 1482 | Ga0157375_10048478 | |||
| 1483 | Ga0157375_10144027 | |||
| 1484 | Ga0157375_10210752 | |||
| 1485 | Ga0163163_10012637 | |||
| 1486 | Ga0163163_10074587 | |||
| 1487 | Ga0157380_10008877 | |||
| 1488 | Ga0157379_10005861 | |||
| 1489 | Ga0157379_10011241 | |||
| 1490 | Ga0157376_10016098 | |||
| 1491 | Ga0157376_10023142 | |||
| 1492 | Ga0157376_10030720 | |||
| 1493 | Ga0157376_10031347 | |||
| 1494 | Ga0163161_10003681 | |||
| 1495 | Ga0163161_10081970 | |||
| 1496 | Ga0163161_10094042 | |||
| 1497 | Ga0163161_10131346 | |||
| 1498 | Ga0213874_10003627 | |||
| 1499 | Ga0213876_10000198 | |||
| 1500 | Ga0213876_10001343 | |||
| 1501 | Ga0224712_10006834 | |||
| 1502 | Ga0209566_100145 | |||
| 1503 | Ga0209674_103149 | |||
| 1504 | Ga0209672_100015 | |||
| 1505 | Ga0209672_100031 | |||
| 1506 | Ga0209147_100016 | |||
| 1507 | Ga0209147_100034 | |||
| 1508 | Ga0209147_100040 | |||
| 1509 | Ga0209563_102361 | |||
| 1510 | Ga0209258_100026 | |||
| 1511 | Ga0209258_100061 | |||
| 1512 | Ga0209148_1000070 | |||
| 1513 | Ga0209148_1000510 | |||
| 1514 | Ga0209759_1002328 | |||
| 1515 | Ga0209455_1000069 | |||
| 1516 | Ga0209455_1000580 | |||
| 1517 | Ga0209673_1000026 | |||
| 1518 | Ga0207673_1003370 | |||
| 1519 | Ga0207697_10002483 | |||
| 1520 | Ga0207697_10017943 | |||
| 1521 | Ga0207682_10000233 | |||
| 1522 | Ga0207682_10000416 | |||
| 1523 | Ga0207682_10010231 | |||
| 1524 | Ga0207682_10010504 | |||
| 1525 | Ga0207642_10003017 | |||
| 1526 | Ga0207710_10006289 | |||
| 1527 | Ga0207710_10014857 | |||
| 1528 | Ga0207688_10003088 | |||
| 1529 | Ga0207688_10004305 | |||
| 1530 | Ga0207688_10027382 | |||
| 1531 | Ga0207680_10000750 | |||
| 1532 | Ga0207680_10014171 | |||
| 1533 | Ga0207680_10017832 | |||
| 1534 | Ga0207647_10007812 | |||
| 1535 | Ga0207685_10000329 | |||
| 1536 | Ga0207699_10000088 | |||
| 1537 | Ga0207699_10007672 | |||
| 1538 | Ga0207699_10015342 | |||
| 1539 | Ga0207645_10000807 | |||
| 1540 | Ga0207645_10003909 | |||
| 1541 | Ga0207645_10009032 | |||
| 1542 | Ga0207645_10021969 | |||
| 1543 | Ga0207645_10024971 | |||
| 1544 | Ga0207645_10038835 | |||
| 1545 | Ga0207643_10000238 | |||
| 1546 | Ga0207643_10024322 | |||
| 1547 | Ga0207705_10000158 | |||
| 1548 | Ga0207705_10052101 | |||
| 1549 | Ga0207705_10065637 | |||
| 1550 | Ga0207705_10070050 | |||
| 1551 | Ga0207654_10005989 | |||
| 1552 | Ga0207654_10092077 | |||
| 1553 | Ga0207707_10000002 | |||
| 1554 | Ga0207707_10000903 | |||
| 1555 | Ga0207707_10005142 | |||
| 1556 | Ga0207707_10038111 | |||
| 1557 | Ga0207707_10086757 | |||
| 1558 | Ga0207695_10000004 | |||
| 1559 | Ga0207695_10003068 | |||
| 1560 | Ga0207695_10088822 | |||
| 1561 | Ga0207671_10045754 | |||
| 1562 | Ga0207671_10047017 | |||
| 1563 | Ga0207693_10000107 | |||
| 1564 | Ga0207693_10000607 | |||
| 1565 | Ga0207693_10021441 | |||
| 1566 | Ga0207660_10000254 | |||
| 1567 | Ga0207660_10000565 | |||
| 1568 | Ga0207660_10010861 | |||
| 1569 | Ga0207660_10011496 | |||
| 1570 | Ga0207660_10101148 | |||
| 1571 | Ga0207662_10005247 | |||
| 1572 | Ga0207662_10016212 | |||
| 1573 | Ga0207662_10025676 | |||
| 1574 | Ga0207657_10000086 | |||
| 1575 | Ga0207657_10000097 | |||
| 1576 | Ga0207657_10000371 | |||
| 1577 | Ga0207657_10001198 | |||
| 1578 | Ga0207657_10002755 | |||
| 1579 | Ga0207657_10006206 | |||
| 1580 | Ga0207657_10015145 | |||
| 1581 | Ga0207657_10021092 | |||
| 1582 | Ga0207657_10027014 | |||
| 1583 | Ga0207649_10034385 | |||
| 1584 | Ga0207649_10035073 | |||
| 1585 | Ga0207652_10000352 | |||
| 1586 | Ga0207652_10000876 | |||
| 1587 | Ga0207652_10004130 | |||
| 1588 | Ga0207652_10015362 | |||
| 1589 | Ga0207652_10049214 | |||
| 1590 | Ga0207652_10064533 | |||
| 1591 | Ga0207652_10071243 | |||
| 1592 | Ga0207646_10024826 | |||
| 1593 | Ga0207681_10009676 | |||
| 1594 | Ga0207681_10019083 | |||
| 1595 | Ga0207681_10088797 | |||
| 1596 | Ga0207694_10000015 | |||
| 1597 | Ga0207694_10012104 | |||
| 1598 | Ga0207694_10040795 | |||
| 1599 | Ga0207650_10001788 | |||
| 1600 | Ga0207650_10001967 | |||
| 1601 | Ga0207650_10005860 | |||
| 1602 | Ga0207650_10009208 | |||
| 1603 | Ga0207650_10016423 | |||
| 1604 | Ga0207650_10021796 | |||
| 1605 | Ga0207650_10037928 | |||
| 1606 | Ga0207650_10044650 | |||
| 1607 | Ga0207650_10121830 | |||
| 1608 | Ga0207650_10143206 | |||
| 1609 | Ga0207659_10000297 | |||
| 1610 | Ga0207659_10005747 | |||
| 1611 | Ga0207659_10015152 | |||
| 1612 | Ga0207659_10023237 | |||
| 1613 | Ga0207687_10003118 | |||
| 1614 | Ga0207687_10090375 | |||
| 1615 | Ga0207687_10155171 | |||
| 1616 | Ga0207700_10000005 | |||
| 1617 | Ga0207664_10016848 | |||
| 1618 | Ga0207664_10057771 | |||
| 1619 | Ga0207644_10000693 | |||
| 1620 | Ga0207644_10002936 | |||
| 1621 | Ga0207644_10007417 | |||
| 1622 | Ga0207644_10012810 | |||
| 1623 | Ga0207644_10023554 | |||
| 1624 | Ga0207644_10031342 | |||
| 1625 | Ga0207690_10000079 | |||
| 1626 | Ga0207690_10001921 | |||
| 1627 | Ga0207690_10010672 | |||
| 1628 | Ga0207690_10021823 | |||
| 1629 | Ga0207690_10028587 | |||
| 1630 | Ga0207706_10000179 | |||
| 1631 | Ga0207706_10000234 | |||
| 1632 | Ga0207706_10008198 | |||
| 1633 | Ga0207706_10020705 | |||
| 1634 | Ga0207686_10003910 | |||
| 1635 | Ga0207686_10022388 | |||
| 1636 | Ga0207709_10006524 | |||
| 1637 | Ga0207670_10001825 | |||
| 1638 | Ga0207670_10004194 | |||
| 1639 | Ga0207670_10013492 | |||
| 1640 | Ga0207670_10141865 | |||
| 1641 | Ga0207669_10003123 | |||
| 1642 | Ga0207669_10004848 | |||
| 1643 | Ga0207669_10013107 | |||
| 1644 | Ga0207669_10020741 | |||
| 1645 | Ga0207669_10028999 | |||
| 1646 | Ga0207669_10090304 | |||
| 1647 | Ga0207665_10003143 | |||
| 1648 | Ga0207665_10010392 | |||
| 1649 | Ga0207691_10000006 | |||
| 1650 | Ga0207691_10000041 | |||
| 1651 | Ga0207691_10002140 | |||
| 1652 | Ga0207691_10003579 | |||
| 1653 | Ga0207691_10007242 | |||
| 1654 | Ga0207691_10023488 | |||
| 1655 | Ga0207691_10051142 | |||
| 1656 | Ga0207711_10000003 | |||
| 1657 | Ga0207711_10000005 | |||
| 1658 | Ga0207711_10000009 | |||
| 1659 | Ga0207711_10005744 | |||
| 1660 | Ga0207711_10052212 | |||
| 1661 | Ga0207711_10105987 | |||
| 1662 | Ga0207711_10167938 | |||
| 1663 | Ga0207689_10002625 | |||
| 1664 | Ga0207689_10013046 | |||
| 1665 | Ga0207689_10026766 | |||
| 1666 | Ga0207689_10040323 | |||
| 1667 | Ga0207689_10062096 | |||
| 1668 | Ga0207689_10091084 | |||
| 1669 | Ga0207661_10001297 | |||
| 1670 | Ga0207661_10043906 | |||
| 1671 | Ga0207679_10000854 | |||
| 1672 | Ga0207679_10008751 | |||
| 1673 | Ga0207667_10000012 | |||
| 1674 | Ga0207667_10010041 | |||
| 1675 | Ga0207667_10012475 | |||
| 1676 | Ga0207667_10016595 | |||
| 1677 | Ga0207667_10030042 | |||
| 1678 | Ga0207667_10033189 | |||
| 1679 | Ga0207651_10000821 | |||
| 1680 | Ga0207651_10013513 | |||
| 1681 | Ga0207651_10018012 | |||
| 1682 | Ga0207651_10026671 | |||
| 1683 | Ga0207712_10008168 | |||
| 1684 | Ga0207712_10030965 | |||
| 1685 | Ga0207712_10054342 | |||
| 1686 | Ga0207668_10012351 | |||
| 1687 | Ga0207668_10015304 | |||
| 1688 | Ga0207668_10041851 | |||
| 1689 | Ga0207668_10070945 | |||
| 1690 | Ga0207640_10001916 | |||
| 1691 | Ga0207640_10024196 | |||
| 1692 | Ga0207658_10000919 | |||
| 1693 | Ga0207658_10003069 | |||
| 1694 | Ga0207658_10044901 | |||
| 1695 | Ga0207658_10053095 | |||
| 1696 | Ga0207658_10100828 | |||
| 1697 | Ga0207677_10001381 | |||
| 1698 | Ga0207677_10008881 | |||
| 1699 | Ga0207677_10054070 | |||
| 1700 | Ga0207677_10102872 | |||
| 1701 | Ga0207703_10005123 | |||
| 1702 | Ga0207703_10021199 | |||
| 1703 | Ga0207703_10025888 | |||
| 1704 | Ga0207703_10047168 | |||
| 1705 | Ga0207703_10076878 | |||
| 1706 | Ga0207639_10000490 | |||
| 1707 | Ga0207639_10008869 | |||
| 1708 | Ga0207639_10021277 | |||
| 1709 | Ga0207639_10022263 | |||
| 1710 | Ga0207639_10113055 | |||
| 1711 | Ga0207678_10000048 | |||
| 1712 | Ga0207678_10000571 | |||
| 1713 | Ga0207678_10002945 | |||
| 1714 | Ga0207678_10004770 | |||
| 1715 | Ga0207678_10007754 | |||
| 1716 | Ga0207678_10009779 | |||
| 1717 | Ga0207678_10036581 | |||
| 1718 | Ga0207678_10047822 | |||
| 1719 | Ga0207708_10000443 | |||
| 1720 | Ga0207708_10025813 | |||
| 1721 | Ga0207702_10000159 | |||
| 1722 | Ga0207702_10002232 | |||
| 1723 | Ga0207702_10004049 | |||
| 1724 | Ga0207702_10009325 | |||
| 1725 | Ga0207702_10012569 | |||
| 1726 | Ga0207702_10102796 | |||
| 1727 | Ga0207702_10119111 | |||
| 1728 | Ga0207641_10005890 | |||
| 1729 | Ga0207641_10014561 | |||
| 1730 | Ga0207641_10029258 | |||
| 1731 | Ga0207641_10080992 | |||
| 1732 | Ga0207648_10000601 | |||
| 1733 | Ga0207648_10005057 | |||
| 1734 | Ga0207648_10005567 | |||
| 1735 | Ga0207648_10007647 | |||
| 1736 | Ga0207648_10028309 | |||
| 1737 | Ga0207648_10043296 | |||
| 1738 | Ga0207648_10046711 | |||
| 1739 | Ga0207648_10101206 | |||
| 1740 | Ga0207676_10013122 | |||
| 1741 | Ga0207676_10025294 | |||
| 1742 | Ga0207676_10025391 | |||
| 1743 | Ga0207676_10026337 | |||
| 1744 | Ga0207674_10000049 | |||
| 1745 | Ga0207674_10000370 | |||
| 1746 | Ga0207674_10001773 | |||
| 1747 | Ga0207674_10003550 | |||
| 1748 | Ga0207674_10015035 | |||
| 1749 | Ga0207675_100000155 | |||
| 1750 | Ga0207675_100009455 | |||
| 1751 | Ga0207675_100015985 | |||
| 1752 | Ga0207675_100017259 | |||
| 1753 | Ga0207683_10000011 | |||
| 1754 | Ga0207683_10000189 | |||
| 1755 | Ga0207683_10001926 | |||
| 1756 | Ga0207683_10002787 | |||
| 1757 | Ga0207683_10110301 | |||
| 1758 | Ga0207698_10001338 | |||
| 1759 | Ga0207698_10002962 | |||
| 1760 | Ga0207698_10003392 | |||
| 1761 | Ga0207698_10004499 | |||
| 1762 | Ga0207698_10005795 | |||
| 1763 | Ga0207698_10006260 | |||
| 1764 | Ga0207698_10030846 | |||
| 1765 | Ga0207698_10102178 | |||
| 1766 | Ga0209371_1000751 | |||
| 1767 | Ga0209179_1000384 | |||
| 1768 | Ga0209983_1006882 | |||
| 1769 | Ga0209588_1000210 | |||
| 1770 | Ga0209971_1002340 | |||
| 1771 | Ga0209966_1002324 | |||
| 1772 | Ga0209974_10000323 | |||
| 1773 | Ga0209974_10006470 | |||
| 1774 | Ga0207428_10008390 | |||
| 1775 | Ga0207428_10012418 | |||
| 1776 | Ga0207428_10068766 | |||
| 1777 | Ga0268266_10002385 | |||
| 1778 | Ga0268266_10047097 | |||
| 1779 | Ga0268266_10065304 | |||
| 1780 | Ga0268266_10070942 | |||
| 1781 | Ga0268265_10052141 | |||
| 1782 | Ga0268265_10083584 | |||
| 1783 | Ga0268264_10001396 | |||
| 1784 | Ga0268264_10006175 | |||
| 1785 | Ga0268264_10057327 | |||
| 1786 | Ga0265334_10002110 | |||
| 1787 | Ga0265318_10000592 | |||
| 1788 | Ga0265323_10004666 | |||
| 1789 | Ga0307515_10000006 | |||
| 1790 | Ga0307515_10090731 | |||
| 1791 | Ga0307515_10150586 | |||
| 1792 | Ga0265338_10004492 | |||
| 1793 | Ga0265338_10063820 | |||
| 1794 | Ga0268256_1002905 | |||
| 1795 | Ga0307512_10038108 | |||
| 1796 | Ga0265332_10000924 | |||
| 1797 | Ga0265328_10006776 | |||
| 1798 | Ga0265320_10000625 | |||
| 1799 | Ga0265320_10012670 | |||
| 1800 | Ga0265325_10000001 | |||
| 1801 | Ga0265325_10000673 | |||
| 1802 | Ga0265325_10005019 | |||
| 1803 | Ga0265325_10015283 | |||
| 1804 | Ga0265325_10017095 | |||
| 1805 | Ga0265329_10005832 | |||
| 1806 | Ga0265340_10003875 | |||
| 1807 | Ga0265340_10004765 | |||
| 1808 | Ga0265340_10030063 | |||
| 1809 | Ga0265339_10000178 | |||
| 1810 | Ga0265339_10005168 | |||
| 1811 | Ga0265331_10000009 | |||
| 1812 | Ga0265331_10000212 | |||
| 1813 | Ga0265331_10000310 | |||
| 1814 | Ga0265331_10001575 | |||
| 1815 | Ga0265331_10026759 | |||
| 1816 | Ga0265327_10000007 | |||
| 1817 | Ga0265327_10000158 | |||
| 1818 | Ga0265327_10009438 | |||
| 1819 | Ga0265316_10000026 | |||
| 1820 | Ga0265316_10009154 | |||
| 1821 | Ga0265316_10009219 | |||
| 1822 | Ga0265316_10021563 | |||
| 1823 | Ga0265316_10043664 | |||
| 1824 | Ga0307509_10000120 | |||
| 1825 | Ga0307408_100010986 | |||
| 1826 | Ga0265313_10000671 | |||
| 1827 | Ga0307508_10001852 | |||
| 1828 | Ga0307508_10025621 | |||
| 1829 | Ga0316575_10010304 | |||
| 1830 | Ga0316579_10008169 | |||
| 1831 | Ga0265314_10002254 | |||
| 1832 | Ga0265314_10003180 | |||
| 1833 | Ga0265314_10005106 | |||
| 1834 | Ga0265314_10012749 | |||
| 1835 | Ga0265314_10015735 | |||
| 1836 | Ga0265314_10023623 | |||
| 1837 | Ga0265314_10046915 | |||
| 1838 | Ga0265342_10021084 | |||
| 1839 | Ga0265342_10024917 | |||
| 1840 | Ga0316578_10016636 | |||
| 1841 | Ga0307407_10015656 | |||
| 1842 | Ga0307409_100014286 | |||
| 1843 | Ga0307409_100027306 | |||
| 1844 | Ga0307409_100039025 | |||
| 1845 | Ga0307411_10013561 | |||
| 1846 | Ga0307415_100013127 | |||
| 1847 | Ga0307510_10009222 | |||
| 1848 | Ga0373929_0004474 | |||
| 1849 | Ga0373934_0000354 | |||
| 1850 | Ga0373934_0001011 | |||
| 1851 | Ga0373923_0017531 | |||
| 1852 | Ga0373953_0022004 | |||
| 1853 | Ga0373954_0001117 | |||
| 1854 | Ga0373954_0008727 | |||
| 1855 | Ga0373956_0000015 | |||
| 1856 | Ga0373957_0001021 | |||
| 1857 | Ga0373957_0003087 | |||
| 1858 | Ga0373960_0005659 | |||
| 1859 | Ga0373946_0006343 | |||
| 1860 | Ga0373955_0001876 | |||
| 1861 | Ga0373955_0006100 | |||
| 1862 | Ga0373924_0005581 | |||
| 1863 | Ga0373931_0002837 | |||
| 1864 | Ga0373931_0003952 | |||
| 1865 | Ga0373931_0029355 | |||
| 1866 | Ga0373935_0021323 | |||
| 1867 | Ga0373927_0000105 | |||
| 1868 | Ga0373933_0015225 | |||
| 1869 | Ga0373933_0102922 | |||
| 1870 | Ga0373937_0000182 | |||
| 1871 | Ga0373937_0008540 | |||
| 1872 | Ga0373937_0041024 | |||
| 1873 | Ga0373937_0047865 | |||
| 1874 | Ga0316582_0039982 | |||
| 1875 | Ga0316584_0044557 | |||
| 1876 | Ga0316584_0135245 | |||
| 1877 | Ga0373925_0015839 | |||
| 1878 | Ga0373925_0042583 | |||
| 1879 | Ga0395900_0107137 | |||
| 1880 | Ga0395900_0129653 | |||
| 1881 | Ga0395898_0002100 | |||
| 1882 | Ga0395898_0019233 | |||
| 1883 | Ga0395898_0034834 | |||
| 1884 | Ga0395905_0016763 | |||
| 1885 | Ga0395905_0131121 | |||
| 1886 | Ga0316581_0002069 | |||
| 1887 | Ga0395901_0000012 | |||
| 1888 | Ga0436365_0943727 | |||
| 1889 | Ga0436365_1866721 | |||
| 1890 | Ga0436363_0556201 | |||
| 1891 | Ga0436363_1015978 | |||
| 1892 | Ga0451577_0008079 | |||
| 1893 | Ga0466966_0000358 | |||
| 1894 | Ga0466961_0050276 | |||
| 1895 | Ga0466971_0008411 | |||
| 1896 | Ga0451576_0010126 | |||
| 1897 | Ga0451576_0025520 | |||
| 1898 | Ga0466958_0050054 | |||
| 1899 | Ga0495592_0000222 | |||
| 1900 | Ga0495592_0001331 | |||
| 1901 | Ga0495592_0004668 | |||
| 1902 | Ga0495592_0009287 | |||
| 1903 | Ga0495592_0071067 | |||
| 1904 | Ga0495603_0041644 | |||
| 1905 | Ga0495590_0017656 | |||
| 1906 | Ga0495590_0017900 | |||
| 1907 | Ga0495629_0029934 | |||
| 1908 | Ga0495641_0007909 | |||
| 1909 | Ga0495651_0000027 | |||
| 1910 | Ga0495653_0005972 | |||
| 1911 | Ga0495580_0013264 | |||
| 1912 | Ga0495580_0065734 | |||
| 1913 | Ga0495605_0054297 | |||
| 1914 | Ga0495639_0002186 | |||
| 1915 | Ga0495664_0013806 | |||
| 1916 | Ga0495584_0032900 | |||
| 1917 | Ga0495594_0011392 | |||
| 1918 | Ga0495583_0000157 | |||
| 1919 | Ga0495618_0027905 | |||
| 1920 | Ga0495628_0003637 | |||
| 1921 | Ga0495628_0005486 | |||
| 1922 | Ga0495628_0005510 | |||
| 1923 | Ga0495630_0013074 | |||
| 1924 | Ga0495643_0034095 | |||
| 1925 | Ga0495666_0002970 | |||
| 1926 | Ga0495652_0068635 | |||
| 1927 | Ga0495652_0119582 | |||
| 1928 | Ga0495665_0029205 | |||
| 1929 | Ga0495640_0028427 | |||
| 1930 | Ga0495640_0089675 | |||
| 1931 | Ga0495586_0005862 | |||
| 1932 | Ga0495645_0000805 | |||
| 1933 | Ga0495645_0011488 | |||
| 1934 | Ga0495645_0044980 | |||
| 1935 | Ga0495667_0031612 | |||
| 1936 | Ga0495599_0001555 | |||
| 1937 | Ga0495599_0007529 | |||
| 1938 | Ga0495599_0024818 | |||
| 1939 | Ga0495623_0013933 | |||
| 1940 | Ga0495658_0000516 | |||
| 1941 | Ga0495658_0020543 | |||
| 1942 | Ga0495669_0000652 | |||
| 1943 | Ga0495613_0107840 | |||
| 1944 | Ga0495624_0045296 | |||
| 1945 | Ga0495600_0044687 | |||
| 1946 | Ga0495660_0055057 | |||
| 1947 | Ga0495604_0031357 | |||
| 1948 | Ga0495604_0045037 | |||
| 1949 | Ga0495636_0015741 | |||
| 1950 | Ga0495674_0002263 | |||
| 1951 | Ga0495674_0068720 | |||
| 1952 | Ga0495687_013582 | |||
| 1953 | Ga0495687_013583 | |||
| 1954 | Ga0495675_0004295 | |||
| 1955 | Ga0495684_0032466 | |||
| 1956 | Ga0495593_0027349 | |||
| 1957 | Ga0495602_0010213 | |||
| 1958 | Ga0496100_0003222 | |||
| 1959 | Ga0496100_0054653 | |||
| 1960 | Ga0496100_0077440 | |||
| 1961 | Ga0496101_0019775 | |||
| 1962 | Ga0496101_0084395 | |||
| 1963 | Ga0496102_0025167 | |||
| 1964 | Ga0496102_0028045 | |||
| 1965 | Ga0496103_0088480 | |||
| 1966 | Ga0496104_0007802 | |||
| 1967 | Ga0496104_0028037 | |||
| 1968 | Ga0496105_0045957 | |||
| 1969 | Ga0496105_0113865 | |||
| 1970 | Ga0496106_0000409 | |||
| 1971 | Ga0496106_0012598 | |||
| 1972 | Ga0496106_0087778 | |||
| 1973 | Ga0496106_0108062 | |||
| 1974 | Ga0496107_0001500 | |||
| 1975 | Ga0496107_0010331 | |||
| 1976 | Ga0496107_0018604 | |||
| 1977 | Ga0496107_0036835 | |||
| 1978 | Ga0496108_0021496 | |||
| 1979 | Ga0496108_0085042 | |||
| 1980 | Ga0496109_0028329 | |||
| 1981 | Ga0496109_0033917 | |||
| 1982 | Ga0496109_0072536 | |||
| 1983 | Ga0496110_0001394 | |||
| 1984 | Ga0496110_0010836 | |||
| 1985 | Ga0496110_0017084 | |||
| 1986 | Ga0496110_0060043 | |||
| 1987 | Ga0496111_0001106 | |||
| 1988 | Ga0496111_0010890 | |||
| 1989 | Ga0496111_0026927 | |||
| 1990 | Ga0496112_0048854 | |||
| 1991 | Ga0496112_0089723 | |||
| 1992 | Ga0496113_0000433 | |||
| 1993 | Ga0496113_0003368 | |||
| 1994 | Ga0496113_0119221 | |||
| 1995 | Ga0496114_0031499 | |||
| 1996 | Ga0496114_0049787 | |||
| 1997 | Ga0496114_0113459 | |||
| 1998 | Ga0496115_0033365 | |||
| 1999 | Ga0496117_0054705 | |||
| 2000 | Ga0496121_0004741 | |||
| 2001 | Ga0496121_0077159 | |||
| 2002 | Ga0496122_0027243 | |||
| 2003 | Ga0496126_0000159 | |||
| 2004 | Ga0496126_0009928 | |||
| 2005 | Ga0495682_0006404 | |||
| 2006 | Ga0501031_0048296 | |||
| 2007 | Ga0501031_0053677 | |||
| 2008 | Ga0501032_0012026 | |||
| 2009 | Ga0501033_0001351 | |||
| 2010 | Ga0501033_0002716 | |||
| 2011 | Ga0501033_0083700 | |||
| 2012 | Ga0501036_0000919 | |||
| 2013 | Ga0501036_0014798 | |||
| 2014 | Ga0501036_0076002 | |||
| 2015 | Ga0501037_0091707 | |||
| 2016 | Ga0501038_0000462 | |||
| 2017 | Ga0501038_0082005 | |||
| 2018 | Ga0501039_0000199 | |||
| 2019 | Ga0501039_0052576 | |||
| 2020 | Ga0501040_0000082 | |||
| 2021 | Ga0501040_0019848 | |||
| 2022 | Ga0501041_0019561 | |||
| 2023 | Ga0501042_0000848 | |||
| 2024 | Ga0501042_0025259 | |||
| 2025 | Ga0501042_0030699 | |||
| 2026 | Ga0501043_0033537 | |||
| 2027 | Ga0501046_0000011 | |||
| 2028 | Ga0501046_0000972 | |||
| 2029 | Ga0501046_0014558 | |||
| 2030 | Ga0501068_0001236 | |||
| 2031 | Ga0501068_0006927 | |||
| 2032 | Ga0501069_0017298 | |||
| 2033 | Ga0501070_0000312 | |||
| 2034 | Ga0501071_0016203 | |||
| 2035 | Ga0501071_0097790 | |||
| 2036 | Ga0501072_0000700 | |||
| 2037 | Ga0501072_0098325 | |||
| 2038 | Ga0501073_0002018 | |||
| 2039 | Ga0501073_0022687 | |||
| 2040 | Ga0501074_0037128 | |||
| 2041 | Ga0501074_0076168 | |||
| 2042 | Ga0501075_0001404 | |||
| 2043 | Ga0501075_0006900 | |||
| 2044 | Ga0501075_0110847 | |||
| 2045 | Ga0501076_0009779 | |||
| 2046 | Ga0501076_0010451 | |||
| 2047 | Ga0501076_0073281 | |||
| 2048 | Ga0501076_0081417 | |||
| 2049 | Ga0501077_0006183 | |||
| 2050 | Ga0501077_0036294 | |||
| 2051 | Ga0501079_0000165 | |||
| 2052 | Ga0501079_0003510 | |||
| 2053 | Ga0501079_0014941 | |||
| 2054 | Ga0501079_0046237 | |||
| 2055 | Ga0501080_0000275 | |||
| 2056 | Ga0501080_0001307 | |||
| 2057 | Ga0501080_0006486 | |||
| 2058 | Ga0501080_0012157 | |||
| 2059 | Ga0501080_0031292 | |||
| 2060 | Ga0501080_0079550 | |||
| 2061 | Ga0501080_0095681 | |||
| 2062 | Ga0501081_0000057 | |||
| 2063 | Ga0501081_0000305 | |||
| 2064 | Ga0501081_0013933 | |||
| 2065 | Ga0501081_0021013 | |||
| 2066 | Ga0501035_0000425 | |||
| 2067 | Ga0501035_0000738 | |||
| 2068 | Ga0501035_0025898 | |||
| 2069 | Ga0501035_0038385 | |||
| 2070 | Ga0501044_0028265 | |||
| 2071 | Ga0501044_0031130 | |||
| 2072 | Ga0501044_0071590 | |||
| 2073 | Ga0501044_0093705 | |||
| 2074 | Ga0501045_0000012 | |||
| 2075 | Ga0501045_0034813 | |||
| 2076 | Ga0501045_0038849 | |||
| 2077 | nmdc:mga05p37_120455_c1 | |||
| 2078 | nmdc:mga05p37_12922_c1 | |||
| 2079 | nmdc:mga05p37_35895_c1 | |||
| 2080 | nmdc:mga09592_298_c1 | |||
| 2081 | nmdc:mga06r32_197388_c1 | |||
| 2082 | nmdc:mga06r32_5705_c1 | |||
| 2083 | nmdc:mga08y16_109972_c1 | |||
| 2084 | nmdc:mga08y16_78946_c1 | |||
| 2085 | nmdc:mga0n895_34781_c1 | |||
| 2086 | nmdc:mga0rr50_29742_c1 | |||
| 2087 | nmdc:mga0rr50_6619_c1 | |||
| 2088 | nmdc:mga0rr50_98579_c1 | |||
| 2089 | nmdc:mga08x19_20033_c1 | |||
| 2090 | nmdc:mga08x19_69_c1 | |||
| 2091 | nmdc:mga08x19_7162_c1 | |||
| 2092 | nmdc:mga0a205_14531_c1 | |||
| 2093 | nmdc:mga0a205_184043_c1 | |||
| 2094 | nmdc:mga0a205_41429_c1 | |||
| 2095 | nmdc:mga0a205_44992_c1 | |||
| 2096 | Ga0495601_0000453 | |||
| 2097 | Ga0495601_0002598 | |||
| 2098 | Ga0495612_0016272 | |||
| 2099 | Ga0500635_0002964 | |||
| 2100 | Ga0495595_0003407 | |||
| 2101 | Ga0495595_0015967 | |||
| 2102 | Ga0495595_0039777 | |||
| 2103 | Ga0495619_0004357 | |||
| 2104 | Ga0495619_0050300 | |||
| 2105 | Ga0500644_0008882 | |||
| 2106 | Ga0500559_0000011 | |||
| 2107 | Ga0500603_000170 | |||
| 2108 | Ga0500616_0003543 | |||
| 2109 | Ga0500622_0089846 | |||
| 2110 | Ga0500637_0000793 | |||
| 2111 | Ga0500601_000089 | |||
| 2112 | Ga0500587_001060 | |||
| 2113 | Ga0501084_0000154 | |||
| 2114 | Ga0501084_0000200 | |||
| 2115 | Ga0501084_0019185 | |||
| 2116 | Ga0501084_0123048 | |||
| 2117 | Ga0501082_0001611 | |||
| 2118 | Ga0501082_0016067 | |||
| 2119 | Ga0501082_0136752 | |||
| 2120 | Ga0466962_0005109 | |||
| 2121 | Ga0530510_0000572 | |||
| 2122 | Ga0530510_0020973 | |||
| 2123 | Ga0530510_0026913 | |||
| 2124 | 2501074833 | |||
| 2125 | 2501083919 | |||
| 2126 | 2501413045 | |||
| 2127 | 2509077840 | |||
| 2128 | 2511087261 | |||
| 2129 | 2511100511 | |||
| 2130 | 2511105826 | |||
| 2131 | 2513551730 | |||
| 2132 | 2513561867 | |||
| 2133 | 2516017613 | |||
| 2134 | 2519461661 | |||
| 2135 | 2545676352 | |||
| 2136 | 2545676766 | |||
| 2137 | 2585293274 | |||
| 2138 | 2599735141 | |||
| 2139 | 2599743269 | |||
| 2140 | 2600205499 | |||
| 2141 | 2643757603 | |||
| 2142 | 2676740796 | |||
| 2143 | 2817258537 | |||
| 2144 | 2817281045 | |||
| 2145 | 2817453230 | |||
| 2146 | 2819632049 | |||
| 2147 | 2841914214 | |||
| 2148 | 2841921417 | |||
| 2149 | 2863422440 | |||
| 2150 | 2870072664 | |||
| 2151 | 2883090005 | |||
| 2152 | 2928157141 | |||
| 2153 | 2928168975 | |||
| 2154 | 2928172218 | |||
| 2155 | 2981994992 | |||
| 2156 | 2998347691 | |||
| 2157 | 3003667237 | |||
| 2158 | 3005598918 | |||
| 2159 | 641568642 | |||
| 2160 | 641642903 | |||
| 2161 | 642419949 | |||
| 2162 | 643599813 | |||
| 2163 | 8003956896 | |||
| 2164 | 8018852084 | |||
| 2165 | 8020809180 | |||
| 2166 | 8020939755 | |||
| 2167 | 8020945744 | |||
| 2168 | 8020957375 | |||
| 2169 | 8021120489 | |||
| 2170 | 8039101307 | |||
| 2171 | 8040167637 | |||
| 2172 | 8040177697 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u5y-assembly1.cif.gz_D | crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica | 0.917 | 460 | 547 |
| 5buq-assembly1.cif.gz_A | unliganded form of o-succinylbenzoate coenzyme a synthetase (mene) from bacillus subtilis, solved at 1.98 angstroms | 0.8998 | 26 | 529 |
| 5gtd-assembly1.cif.gz_A | o-succinylbenzoate coa synthetase (mene) from bacillus subtilis in complex with the acyl-adenylate intermediate osb-amp | 0.8978 | 26 | 544 |
| 5zrn-assembly1.cif.gz_A | inhibitor bound crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis | 0.8978 | 29 | 447 |
| 4fut-assembly1.cif.gz_A | crystal structure of atp bound matb from rhodopseudomonas palustris | 0.8974 | 26 | 550 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LQS1_441_544_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9919 | 450 | 547 | 3.30.300.30 |
| af_K7VHQ0_441_545_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9721 | 450 | 547 | 3.30.300.30 |
| af_P31552_422_517_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9703 | 450 | 543 | 3.30.300.30 |
| af_I1LI90_433_534_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9693 | 449 | 549 | 3.30.300.30 |
| af_P96843_409_507_3.30.300.30 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain | 0.9644 | 450 | 546 | 3.30.300.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L8I2M4-F1-model_v4 | Acyl-CoA synthetase | 0.9924 | 473 | 550 |
GO:0016874
|
| AF-A0A0D9AB56-F1-model_v4 | Acyl-CoA synthetase | 0.9748 | 14 | 549 |
GO:0016874
|
| AF-A0A846B0R2-F1-model_v4 | AMP-binding protein | 0.9724 | 21 | 465 |
GO:0016874
|
| AF-A0A1F4E6F9-F1-model_v4 | Acyl-CoA synthetase | 0.9724 | 8 | 420 |
GO:0016874
|
| AF-A0A846B0R2-F1-model_v4 | AMP-binding protein | 0.9703 | 21 | 465 |
GO:0016874
|