F489782
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1086 | 424 | 2170 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300025917|Ga0207660_10015836|Ga0207660_100158362 |
| Length | 336 |
| Sequence | MSNPKLSVRGEESNREQNRHPTSLSESKAMTTPQTIKQYLAQLRAALAGADPAMIQDALYDAEEHLRSELAENPGMSEAELLAKIATSYGAPDEVAEIYRTTEQTVTRALRTPRRQPRRSAIGRFFGVIADPHTYGAMFYMLLSLATGIFYFVWAVTGLSLSAGFTVLIIGLPFFLLFMASVRGLSLLESRIIESMLGVRMPRRPPYTGRERPWLQRIAAMLTDPRTWATLLYMLLMLPLGIAYFIIVVALSSVSLALMFTPMAMACDFFGFGRDFIDGYVTVDWGFGAHIPGWGDAIAMFVVGFFLLFGTLHLVRGIGRMHGAFAKHLLVKSARV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 120 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 136 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 236 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 237 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 262 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 263 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 264 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 267 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 268 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 275 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 276 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 277 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 278 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 279 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 280 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 281 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 282 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 283 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 284 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 285 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 286 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 287 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 292 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 297 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 298 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 359 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 360 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 366 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 375 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 376 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 377 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 378 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 379 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 380 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 384 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 385 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 386 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 387 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 388 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 389 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 390 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 391 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 392 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 393 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 394 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 395 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 396 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 397 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 398 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 399 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 400 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 401 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 402 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 403 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 404 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 405 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 406 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 407 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 408 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 409 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 410 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 411 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 412 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 413 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 414 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 415 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 416 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 417 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 418 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 419 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 420 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 421 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 422 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 423 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 424 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.58 |
| Metatranscriptomes | 0.64 |
| Isolates | 3.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.8 |
| Nodule | 0.09 |
| Rhizoplane | 2.76 |
| Rhizosphere | 73.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207660_10015836 | 3300025917 | Bacteria | 4984 |
| 2 | JGI24741J21665_1000582 | 3300001915 | Bacteria | 11068 |
| 3 | JGI24741J21665_1000998 | 3300001915 | Bacteria | 8495 |
| 4 | JGI24741J21665_1005282 | 3300001915 | Bacteria | 2729 |
| 5 | JGI24740J21852_10006312 | 3300001979 | Bacteria | 4921 |
| 6 | JGI24740J21852_10011109 | 3300001979 | Bacteria | 3440 |
| 7 | JGI24739J22299_10000076 | 3300001989 | Bacteria | 27668 |
| 8 | JGI24737J22298_10000304 | 3300001990 | Bacteria | 16452 |
| 9 | JGI24737J22298_10020632 | 3300001990 | Bacteria | 2103 |
| 10 | JGI24735J21928_10005423 | 3300002067 | Bacteria | 4234 |
| 11 | JGI25156J39149_1006923 | 3300002705 | Bacteria | 3043 |
| 12 | JGI25162J39368_1000260 | 3300002737 | Bacteria | 50536 |
| 13 | JGI25162J39368_1000752 | 3300002737 | Bacteria | 22042 |
| 14 | JGI25162J39368_1000979 | 3300002737 | Bacteria | 18126 |
| 15 | JGI25162J39368_1006678 | 3300002737 | Unclassified | 1943 |
| 16 | JGI25154J39366_1010699 | 3300002738 | Bacteria | 1077 |
| 17 | JGI25157J39369_1000236 | 3300002741 | Bacteria | 42812 |
| 18 | JGI25157J39369_1000364 | 3300002741 | Bacteria | 31214 |
| 19 | JGI25157J39369_1002550 | 3300002741 | Bacteria | 4394 |
| 20 | JGI25157J39369_1004633 | 3300002741 | Bacteria | 2436 |
| 21 | JGI25163J39215_1002102 | 3300002771 | Bacteria | 2339 |
| 22 | JGI25164J39214_1000035 | 3300002772 | Bacteria | 139987 |
| 23 | JGI25164J39214_1000133 | 3300002772 | Bacteria | 71595 |
| 24 | JGI25152J39213_1000018 | 3300002773 | Bacteria | 109715 |
| 25 | JGI25150J39212_1000159 | 3300002774 | Bacteria | 38345 |
| 26 | JGI25151J46595_10000106 | 3300003187 | Bacteria | 113352 |
| 27 | JGI25151J46595_10000111 | 3300003187 | Bacteria | 111802 |
| 28 | JGI25151J46595_10056892 | 3300003187 | Bacteria | 1279 |
| 29 | JGI25165J46597_1000255 | 3300003214 | Bacteria | 71595 |
| 30 | JGI25165J46597_1000397 | 3300003214 | Bacteria | 46032 |
| 31 | JGI25153J46596_10000085 | 3300003215 | Bacteria | 111802 |
| 32 | JGI25153J46596_10013672 | 3300003215 | Bacteria | 3417 |
| 33 | rootH1_10000986 | 3300003316 | Bacteria | 7605 |
| 34 | rootH2_10017930 | 3300003320 | Bacteria | 6833 |
| 35 | rootH1_10094545 | 3300003323 | Bacteria | 3287 |
| 36 | rootH1_10265301 | 3300003323 | Bacteria | 1972 |
| 37 | Ga0055538_1000340 | 3300003751 | Bacteria | 20779 |
| 38 | Ga0055539_1008553 | 3300003752 | Bacteria | 1279 |
| 39 | Ga0055533_1001312 | 3300003756 | Bacteria | 6757 |
| 40 | Ga0055525_1000089 | 3300003759 | Bacteria | 142096 |
| 41 | Ga0055527_1000084 | 3300003760 | Bacteria | 74303 |
| 42 | Ga0055535_1000317 | 3300003761 | Bacteria | 48674 |
| 43 | Ga0055535_1000349 | 3300003761 | Bacteria | 45885 |
| 44 | Ga0055535_1000374 | 3300003761 | Bacteria | 42774 |
| 45 | Ga0055535_1000579 | 3300003761 | Bacteria | 30773 |
| 46 | Ga0055535_1001574 | 3300003761 | Bacteria | 11033 |
| 47 | Ga0055542_1000082 | 3300003762 | Bacteria | 128120 |
| 48 | Ga0055542_1000195 | 3300003762 | Bacteria | 74303 |
| 49 | Ga0055542_1000327 | 3300003762 | Bacteria | 50536 |
| 50 | Ga0055542_1000375 | 3300003762 | Bacteria | 45897 |
| 51 | Ga0055542_1000600 | 3300003762 | Bacteria | 30773 |
| 52 | Ga0055529_1000228 | 3300003763 | Bacteria | 71595 |
| 53 | Ga0055529_1000254 | 3300003763 | Bacteria | 64036 |
| 54 | Ga0055529_1000507 | 3300003763 | Bacteria | 35026 |
| 55 | Ga0055529_1000613 | 3300003763 | Bacteria | 26951 |
| 56 | Ga0055529_1001360 | 3300003763 | Bacteria | 8004 |
| 57 | Ga0055526_1000011 | 3300003771 | Bacteria | 236316 |
| 58 | Ga0055526_1008071 | 3300003771 | Bacteria | 5311 |
| 59 | Ga0055537_1000007 | 3300003773 | Bacteria | 144691 |
| 60 | Ga0055524_1000034 | 3300003775 | Bacteria | 180672 |
| 61 | Ga0055524_1025274 | 3300003775 | Bacteria | 1863 |
| 62 | Ga0055536_1000574 | 3300003781 | Bacteria | 25068 |
| 63 | Ga0055536_1003563 | 3300003781 | Bacteria | 8322 |
| 64 | Ga0055536_1012015 | 3300003781 | Bacteria | 3253 |
| 65 | Ga0055536_1017437 | 3300003781 | Bacteria | 2351 |
| 66 | Ga0055534_1000013 | 3300003784 | Bacteria | 151209 |
| 67 | Ga0055528_1000005 | 3300003790 | Bacteria | 236316 |
| 68 | Ga0055530_10002885 | 3300003791 | Bacteria | 10467 |
| 69 | Ga0055531_10004761 | 3300003794 | Bacteria | 8109 |
| 70 | Ga0055531_10006099 | 3300003794 | Bacteria | 6902 |
| 71 | Ga0055531_10026539 | 3300003794 | Bacteria | 2062 |
| 72 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 73 | Ga0058692_1000020 | 3300003856 | Bacteria | 250589 |
| 74 | Ga0065165_1004080 | 3300005262 | Bacteria | 9458 |
| 75 | Ga0065704_10104057 | 3300005289 | Bacteria | 2153 |
| 76 | Ga0065715_10155065 | 3300005293 | Bacteria | 1686 |
| 77 | Ga0070658_10001143 | 3300005327 | Bacteria | 22624 |
| 78 | Ga0070658_10043237 | 3300005327 | Bacteria | 3640 |
| 79 | Ga0070658_10112166 | 3300005327 | Bacteria | 2260 |
| 80 | Ga0070658_10118006 | 3300005327 | Bacteria | 2203 |
| 81 | Ga0070683_100023206 | 3300005329 | Bacteria | 5548 |
| 82 | Ga0070683_100393267 | 3300005329 | Bacteria | 1322 |
| 83 | Ga0070670_100021191 | 3300005331 | Bacteria | 5591 |
| 84 | Ga0070670_100110745 | 3300005331 | Bacteria | 2366 |
| 85 | Ga0070670_100116209 | 3300005331 | Bacteria | 2307 |
| 86 | Ga0068869_100072047 | 3300005334 | Bacteria | 2560 |
| 87 | Ga0070666_10000058 | 3300005335 | Bacteria | 89886 |
| 88 | Ga0070666_10000645 | 3300005335 | Bacteria | 21011 |
| 89 | Ga0070666_10008427 | 3300005335 | Bacteria | 6401 |
| 90 | Ga0070666_10065608 | 3300005335 | Unclassified | 2463 |
| 91 | Ga0070680_100048875 | 3300005336 | Bacteria | 3447 |
| 92 | Ga0070680_100079588 | 3300005336 | Bacteria | 2701 |
| 93 | Ga0070680_100089873 | 3300005336 | Bacteria | 2542 |
| 94 | Ga0070680_100404582 | 3300005336 | Bacteria | 1164 |
| 95 | Ga0070682_100015190 | 3300005337 | Bacteria | 4457 |
| 96 | Ga0070682_100040396 | 3300005337 | Bacteria | 2870 |
| 97 | Ga0068868_100075510 | 3300005338 | Bacteria | 2693 |
| 98 | Ga0070660_100101733 | 3300005339 | Bacteria | 2277 |
| 99 | Ga0070660_100165217 | 3300005339 | Bacteria | 1785 |
| 100 | Ga0070689_100004531 | 3300005340 | Bacteria | 9407 |
| 101 | Ga0070691_10000346 | 3300005341 | Bacteria | 16494 |
| 102 | Ga0070691_10037455 | 3300005341 | Bacteria | 2288 |
| 103 | Ga0070661_100050296 | 3300005344 | Bacteria | 3049 |
| 104 | Ga0070661_100092709 | 3300005344 | Bacteria | 2238 |
| 105 | Ga0070661_100194031 | 3300005344 | Bacteria | 1550 |
| 106 | Ga0070692_10011513 | 3300005345 | Bacteria | 4064 |
| 107 | Ga0070692_10028849 | 3300005345 | Bacteria | 2762 |
| 108 | Ga0070692_10034803 | 3300005345 | Bacteria | 2546 |
| 109 | Ga0070668_100062063 | 3300005347 | Bacteria | 2895 |
| 110 | Ga0070669_100105474 | 3300005353 | Unclassified | 2132 |
| 111 | Ga0070675_100015466 | 3300005354 | Bacteria | 6034 |
| 112 | Ga0070671_100006750 | 3300005355 | Bacteria | 9185 |
| 113 | Ga0070671_100030620 | 3300005355 | Bacteria | 4441 |
| 114 | Ga0070671_100160182 | 3300005355 | Bacteria | 1902 |
| 115 | Ga0070673_100185622 | 3300005364 | Bacteria | 1783 |
| 116 | Ga0070688_100096994 | 3300005365 | Bacteria | 1937 |
| 117 | Ga0070688_100336701 | 3300005365 | Bacteria | 1101 |
| 118 | Ga0070659_100007680 | 3300005366 | Bacteria | 7844 |
| 119 | Ga0070659_100017729 | 3300005366 | Bacteria | 5363 |
| 120 | Ga0070667_100000108 | 3300005367 | Bacteria | 105301 |
| 121 | Ga0070667_100009016 | 3300005367 | Bacteria | 8256 |
| 122 | Ga0070667_100016038 | 3300005367 | Bacteria | 6198 |
| 123 | Ga0070667_100027922 | 3300005367 | Bacteria | 4696 |
| 124 | Ga0070709_10000036 | 3300005434 | Bacteria | 109782 |
| 125 | Ga0070714_100000325 | 3300005435 | Bacteria | 35978 |
| 126 | Ga0070714_100000671 | 3300005435 | Bacteria | 24217 |
| 127 | Ga0070710_10134963 | 3300005437 | Bacteria | 1508 |
| 128 | Ga0070701_10085606 | 3300005438 | Bacteria | 1716 |
| 129 | Ga0070711_100175012 | 3300005439 | Bacteria | 1639 |
| 130 | Ga0070694_100019707 | 3300005444 | Bacteria | 4293 |
| 131 | Ga0070663_100004271 | 3300005455 | Bacteria | 8363 |
| 132 | Ga0070663_100009276 | 3300005455 | Bacteria | 6088 |
| 133 | Ga0070663_100015624 | 3300005455 | Bacteria | 4908 |
| 134 | Ga0070663_100034811 | 3300005455 | Bacteria | 3490 |
| 135 | Ga0070663_100128550 | 3300005455 | Bacteria | 1921 |
| 136 | Ga0070663_100265697 | 3300005455 | Bacteria | 1362 |
| 137 | Ga0070662_100029363 | 3300005457 | Bacteria | 3837 |
| 138 | Ga0070662_100057601 | 3300005457 | Bacteria | 2824 |
| 139 | Ga0070681_10000500 | 3300005458 | Bacteria | 32052 |
| 140 | Ga0070681_10000944 | 3300005458 | Bacteria | 24477 |
| 141 | Ga0070681_10009676 | 3300005458 | Bacteria | 9483 |
| 142 | Ga0070681_10031335 | 3300005458 | Bacteria | 5338 |
| 143 | Ga0070681_10073083 | 3300005458 | Bacteria | 3391 |
| 144 | Ga0070681_10081516 | 3300005458 | Bacteria | 3191 |
| 145 | Ga0070681_10280926 | 3300005458 | Bacteria | 1575 |
| 146 | Ga0070685_10013087 | 3300005466 | Bacteria | 4368 |
| 147 | Ga0070685_10021517 | 3300005466 | Bacteria | 3507 |
| 148 | Ga0070698_100010813 | 3300005471 | Bacteria | 9714 |
| 149 | Ga0070699_100128344 | 3300005518 | Bacteria | 2234 |
| 150 | Ga0070679_100001195 | 3300005530 | Bacteria | 22809 |
| 151 | Ga0070679_100025730 | 3300005530 | Bacteria | 5775 |
| 152 | Ga0070679_100072387 | 3300005530 | Bacteria | 3439 |
| 153 | Ga0070679_100073914 | 3300005530 | Bacteria | 3400 |
| 154 | Ga0070679_100238081 | 3300005530 | Bacteria | 1778 |
| 155 | Ga0070684_100309740 | 3300005535 | Bacteria | 1450 |
| 156 | Ga0068853_100001578 | 3300005539 | Bacteria | 16612 |
| 157 | Ga0068853_100005018 | 3300005539 | Bacteria | 10318 |
| 158 | Ga0068853_100008085 | 3300005539 | Bacteria | 8439 |
| 159 | Ga0068853_100011045 | 3300005539 | Bacteria | 7325 |
| 160 | Ga0068853_100016267 | 3300005539 | Bacteria | 6121 |
| 161 | Ga0068853_100068959 | 3300005539 | Bacteria | 3075 |
| 162 | Ga0068853_100082454 | 3300005539 | Bacteria | 2817 |
| 163 | Ga0068853_100110422 | 3300005539 | Bacteria | 2442 |
| 164 | Ga0068853_100183866 | 3300005539 | Bacteria | 1896 |
| 165 | Ga0068853_100363436 | 3300005539 | Bacteria | 1349 |
| 166 | Ga0068853_100618446 | 3300005539 | Bacteria | 1029 |
| 167 | Ga0070696_100037311 | 3300005546 | Bacteria | 3352 |
| 168 | Ga0070696_100103901 | 3300005546 | Bacteria | 2039 |
| 169 | Ga0070696_100454096 | 3300005546 | Bacteria | 1012 |
| 170 | Ga0070693_100096686 | 3300005547 | Bacteria | 1791 |
| 171 | Ga0070693_100250112 | 3300005547 | Bacteria | 1174 |
| 172 | Ga0070665_100000057 | 3300005548 | Bacteria | 237271 |
| 173 | Ga0070665_100000715 | 3300005548 | Bacteria | 44234 |
| 174 | Ga0070665_100002937 | 3300005548 | Bacteria | 18413 |
| 175 | Ga0070665_100021486 | 3300005548 | Bacteria | 6489 |
| 176 | Ga0070665_100068712 | 3300005548 | Bacteria | 3552 |
| 177 | Ga0070665_100230042 | 3300005548 | Bacteria | 1854 |
| 178 | Ga0070665_100235983 | 3300005548 | Bacteria | 1829 |
| 179 | Ga0070665_100271579 | 3300005548 | Bacteria | 1697 |
| 180 | Ga0070665_100313763 | 3300005548 | Bacteria | 1572 |
| 181 | Ga0070665_100524923 | 3300005548 | Bacteria | 1196 |
| 182 | Ga0070704_100106240 | 3300005549 | Bacteria | 2127 |
| 183 | Ga0068855_100001307 | 3300005563 | Bacteria | 30848 |
| 184 | Ga0068855_100004050 | 3300005563 | Bacteria | 17881 |
| 185 | Ga0068855_100037140 | 3300005563 | Bacteria | 5795 |
| 186 | Ga0068855_100043353 | 3300005563 | Bacteria | 5330 |
| 187 | Ga0068855_100078773 | 3300005563 | Bacteria | 3822 |
| 188 | Ga0068855_100248155 | 3300005563 | Bacteria | 1986 |
| 189 | Ga0068855_100330214 | 3300005563 | Bacteria | 1684 |
| 190 | Ga0068855_100354255 | 3300005563 | Bacteria | 1616 |
| 191 | Ga0068855_100393414 | 3300005563 | Bacteria | 1520 |
| 192 | Ga0070664_100166958 | 3300005564 | Bacteria | 1950 |
| 193 | Ga0068857_100000300 | 3300005577 | Bacteria | 34132 |
| 194 | Ga0068857_100037641 | 3300005577 | Bacteria | 4287 |
| 195 | Ga0068857_100063147 | 3300005577 | Bacteria | 3292 |
| 196 | Ga0068857_100472084 | 3300005577 | Bacteria | 1175 |
| 197 | Ga0068854_100000343 | 3300005578 | Bacteria | 29961 |
| 198 | Ga0068854_100002114 | 3300005578 | Bacteria | 12177 |
| 199 | Ga0068854_100004724 | 3300005578 | Bacteria | 8586 |
| 200 | Ga0068854_100042054 | 3300005578 | Bacteria | 3232 |
| 201 | Ga0068854_100091855 | 3300005578 | Bacteria | 2260 |
| 202 | Ga0068854_100141759 | 3300005578 | Bacteria | 1845 |
| 203 | Ga0068854_100218564 | 3300005578 | Bacteria | 1506 |
| 204 | Ga0068856_100000116 | 3300005614 | Bacteria | 79220 |
| 205 | Ga0068856_100084443 | 3300005614 | Bacteria | 3154 |
| 206 | Ga0068856_100111094 | 3300005614 | Bacteria | 2738 |
| 207 | Ga0068856_100187473 | 3300005614 | Bacteria | 2082 |
| 208 | Ga0068852_100004275 | 3300005616 | Bacteria | 10079 |
| 209 | Ga0068852_100008693 | 3300005616 | Bacteria | 7505 |
| 210 | Ga0068852_100010857 | 3300005616 | Bacteria | 6825 |
| 211 | Ga0068852_100124333 | 3300005616 | Bacteria | 2366 |
| 212 | Ga0068859_100000351 | 3300005617 | Bacteria | 45794 |
| 213 | Ga0068859_100015319 | 3300005617 | Bacteria | 7702 |
| 214 | Ga0068859_100225471 | 3300005617 | Bacteria | 1962 |
| 215 | Ga0068864_100090044 | 3300005618 | Bacteria | 2704 |
| 216 | Ga0068864_100140516 | 3300005618 | Bacteria | 2178 |
| 217 | Ga0068861_100316989 | 3300005719 | Bacteria | 1357 |
| 218 | Ga0068851_10004625 | 3300005834 | Bacteria | 6210 |
| 219 | Ga0068851_10009946 | 3300005834 | Bacteria | 4428 |
| 220 | Ga0068851_10062656 | 3300005834 | Bacteria | 1908 |
| 221 | Ga0068863_100006425 | 3300005841 | Bacteria | 11525 |
| 222 | Ga0068863_100014475 | 3300005841 | Bacteria | 7596 |
| 223 | Ga0068863_100020112 | 3300005841 | Bacteria | 6386 |
| 224 | Ga0068863_100379835 | 3300005841 | Bacteria | 1379 |
| 225 | Ga0068858_100006259 | 3300005842 | Bacteria | 11599 |
| 226 | Ga0068858_100006693 | 3300005842 | Bacteria | 11213 |
| 227 | Ga0068858_100006944 | 3300005842 | Bacteria | 11004 |
| 228 | Ga0068858_100436838 | 3300005842 | Bacteria | 1260 |
| 229 | Ga0068860_100045552 | 3300005843 | Bacteria | 4183 |
| 230 | Ga0068860_100203927 | 3300005843 | Unclassified | 1917 |
| 231 | Ga0068860_100248002 | 3300005843 | Bacteria | 1733 |
| 232 | Ga0068860_100736321 | 3300005843 | Bacteria | 997 |
| 233 | Ga0068862_100195260 | 3300005844 | Bacteria | 1823 |
| 234 | Ga0081455_10000039 | 3300005937 | Bacteria | 135506 |
| 235 | Ga0075364_10102798 | 3300006051 | Bacteria | 1903 |
| 236 | Ga0075364_10120923 | 3300006051 | Bacteria | 1753 |
| 237 | Ga0070716_100004881 | 3300006173 | Bacteria | 6450 |
| 238 | Ga0075369_10028360 | 3300006186 | Bacteria | 2346 |
| 239 | Ga0097621_100055267 | 3300006237 | Bacteria | 3241 |
| 240 | Ga0097621_100181344 | 3300006237 | Bacteria | 1819 |
| 241 | Ga0068871_100267943 | 3300006358 | Bacteria | 1491 |
| 242 | Ga0075428_100569576 | 3300006844 | Bacteria | 1210 |
| 243 | Ga0075431_100060414 | 3300006847 | Bacteria | 3911 |
| 244 | Ga0075433_10001939 | 3300006852 | Bacteria | 15560 |
| 245 | Ga0075433_10290073 | 3300006852 | Bacteria | 1449 |
| 246 | Ga0068865_100047107 | 3300006881 | Bacteria | 2961 |
| 247 | Ga0068865_100068084 | 3300006881 | Bacteria | 2516 |
| 248 | Ga0097620_100000351 | 3300006931 | Bacteria | 45794 |
| 249 | Ga0097620_100015319 | 3300006931 | Bacteria | 7702 |
| 250 | Ga0097620_100225471 | 3300006931 | Bacteria | 1962 |
| 251 | Ga0105244_10051498 | 3300009036 | Bacteria | 2098 |
| 252 | Ga0105250_10038121 | 3300009092 | Bacteria | 1928 |
| 253 | Ga0105240_10000315 | 3300009093 | Bacteria | 92923 |
| 254 | Ga0105240_10007869 | 3300009093 | Bacteria | 15381 |
| 255 | Ga0105240_10009439 | 3300009093 | Bacteria | 13810 |
| 256 | Ga0105240_10012686 | 3300009093 | Bacteria | 11613 |
| 257 | Ga0105240_10015093 | 3300009093 | Bacteria | 10515 |
| 258 | Ga0105240_10051502 | 3300009093 | Bacteria | 5178 |
| 259 | Ga0105240_10060620 | 3300009093 | Bacteria | 4716 |
| 260 | Ga0105240_10098547 | 3300009093 | Bacteria | 3559 |
| 261 | Ga0105240_10167205 | 3300009093 | Bacteria | 2608 |
| 262 | Ga0105240_10226538 | 3300009093 | Bacteria | 2175 |
| 263 | Ga0105240_10263224 | 3300009093 | Bacteria | 1988 |
| 264 | Ga0105240_10550138 | 3300009093 | Bacteria | 1277 |
| 265 | Ga0111539_10044756 | 3300009094 | Bacteria | 5301 |
| 266 | Ga0111539_10424364 | 3300009094 | Bacteria | 1549 |
| 267 | Ga0105247_10000975 | 3300009101 | Bacteria | 21605 |
| 268 | Ga0105247_10014302 | 3300009101 | Bacteria | 4764 |
| 269 | Ga0114129_10138582 | 3300009147 | Bacteria | 3337 |
| 270 | Ga0114129_10262478 | 3300009147 | Bacteria | 2314 |
| 271 | Ga0105243_10033621 | 3300009148 | Bacteria | 3966 |
| 272 | Ga0105241_10004652 | 3300009174 | Bacteria | 10140 |
| 273 | Ga0105241_10013451 | 3300009174 | Bacteria | 5998 |
| 274 | Ga0105241_10165241 | 3300009174 | Bacteria | 1823 |
| 275 | Ga0105241_10414866 | 3300009174 | Bacteria | 1184 |
| 276 | Ga0105242_10128547 | 3300009176 | Bacteria | 2184 |
| 277 | Ga0105248_10001678 | 3300009177 | Bacteria | 24646 |
| 278 | Ga0105248_10047487 | 3300009177 | Bacteria | 4815 |
| 279 | Ga0105248_10203594 | 3300009177 | Bacteria | 2230 |
| 280 | Ga0105248_10217562 | 3300009177 | Bacteria | 2151 |
| 281 | Ga0105248_10225150 | 3300009177 | Bacteria | 2111 |
| 282 | Ga0105248_10240948 | 3300009177 | Bacteria | 2036 |
| 283 | Ga0105237_10000063 | 3300009545 | Bacteria | 141759 |
| 284 | Ga0105237_10000105 | 3300009545 | Bacteria | 118218 |
| 285 | Ga0105237_10003289 | 3300009545 | Bacteria | 19301 |
| 286 | Ga0105237_10007234 | 3300009545 | Bacteria | 12175 |
| 287 | Ga0105237_10008174 | 3300009545 | Bacteria | 11366 |
| 288 | Ga0105237_10052875 | 3300009545 | Bacteria | 4075 |
| 289 | Ga0105237_10172728 | 3300009545 | Bacteria | 2161 |
| 290 | Ga0105237_10295994 | 3300009545 | Bacteria | 1621 |
| 291 | Ga0105237_10665916 | 3300009545 | Bacteria | 1048 |
| 292 | Ga0105238_10000270 | 3300009551 | Bacteria | 58093 |
| 293 | Ga0105238_10000290 | 3300009551 | Bacteria | 55810 |
| 294 | Ga0105238_10004841 | 3300009551 | Bacteria | 13319 |
| 295 | Ga0105238_10020657 | 3300009551 | Bacteria | 6708 |
| 296 | Ga0105238_10074121 | 3300009551 | Bacteria | 3397 |
| 297 | Ga0105238_10204191 | 3300009551 | Bacteria | 1952 |
| 298 | Ga0105238_10459728 | 3300009551 | Bacteria | 1270 |
| 299 | Ga0105238_10464757 | 3300009551 | Bacteria | 1263 |
| 300 | Ga0105238_10517491 | 3300009551 | Bacteria | 1196 |
| 301 | Ga0105249_10002422 | 3300009553 | Bacteria | 16191 |
| 302 | Ga0105249_10006721 | 3300009553 | Bacteria | 10016 |
| 303 | Ga0105249_10014184 | 3300009553 | Bacteria | 7045 |
| 304 | Ga0105249_10020841 | 3300009553 | Bacteria | 5861 |
| 305 | Ga0105249_10087409 | 3300009553 | Bacteria | 2908 |
| 306 | Ga0105029_103430 | 3300009984 | Bacteria | 1060 |
| 307 | Ga0105030_101208 | 3300009987 | Bacteria | 2295 |
| 308 | Ga0105239_10000043 | 3300010375 | Bacteria | 196600 |
| 309 | Ga0105239_10006032 | 3300010375 | Bacteria | 14100 |
| 310 | Ga0105239_10019878 | 3300010375 | Bacteria | 7412 |
| 311 | Ga0105239_10026229 | 3300010375 | Bacteria | 6414 |
| 312 | Ga0105239_10142571 | 3300010375 | Bacteria | 2671 |
| 313 | Ga0105239_10161584 | 3300010375 | Bacteria | 2502 |
| 314 | Ga0105239_10215793 | 3300010375 | Bacteria | 2151 |
| 315 | Ga0105239_10297253 | 3300010375 | Bacteria | 1818 |
| 316 | Ga0105246_10064508 | 3300011119 | Bacteria | 2559 |
| 317 | Ga0157373_10004602 | 3300013100 | Bacteria | 10374 |
| 318 | Ga0157373_10007629 | 3300013100 | Bacteria | 8036 |
| 319 | Ga0157373_10057113 | 3300013100 | Bacteria | 2769 |
| 320 | Ga0157373_10080857 | 3300013100 | Bacteria | 2291 |
| 321 | Ga0157373_10291515 | 3300013100 | Bacteria | 1157 |
| 322 | Ga0157371_10003532 | 3300013102 | Bacteria | 14107 |
| 323 | Ga0157371_10008518 | 3300013102 | Bacteria | 8163 |
| 324 | Ga0157371_10010934 | 3300013102 | Bacteria | 7036 |
| 325 | Ga0157371_10021786 | 3300013102 | Bacteria | 4701 |
| 326 | Ga0157371_10032772 | 3300013102 | Bacteria | 3737 |
| 327 | Ga0157371_10085550 | 3300013102 | Bacteria | 2234 |
| 328 | Ga0157370_10001634 | 3300013104 | Bacteria | 27668 |
| 329 | Ga0157370_10007704 | 3300013104 | Bacteria | 11679 |
| 330 | Ga0157370_10009139 | 3300013104 | Bacteria | 10626 |
| 331 | Ga0157370_10082212 | 3300013104 | Bacteria | 3030 |
| 332 | Ga0157370_10145538 | 3300013104 | Bacteria | 2206 |
| 333 | Ga0157370_10208301 | 3300013104 | Bacteria | 1813 |
| 334 | Ga0157370_10304008 | 3300013104 | Bacteria | 1472 |
| 335 | Ga0157369_10050010 | 3300013105 | Bacteria | 4530 |
| 336 | Ga0157369_10063808 | 3300013105 | Bacteria | 3968 |
| 337 | Ga0157369_10093815 | 3300013105 | Bacteria | 3204 |
| 338 | Ga0157369_10105890 | 3300013105 | Bacteria | 2993 |
| 339 | Ga0157369_10140278 | 3300013105 | Bacteria | 2558 |
| 340 | Ga0157369_10283292 | 3300013105 | Bacteria | 1726 |
| 341 | Ga0157374_10111331 | 3300013296 | Bacteria | 2634 |
| 342 | Ga0157374_10150041 | 3300013296 | Bacteria | 2266 |
| 343 | Ga0163162_10013992 | 3300013306 | Bacteria | 7843 |
| 344 | Ga0163162_10056831 | 3300013306 | Bacteria | 3941 |
| 345 | Ga0157372_10003149 | 3300013307 | Bacteria | 17791 |
| 346 | Ga0157372_10007198 | 3300013307 | Bacteria | 11848 |
| 347 | Ga0157372_10007498 | 3300013307 | Bacteria | 11602 |
| 348 | Ga0157372_10042687 | 3300013307 | Bacteria | 5017 |
| 349 | Ga0157372_10074444 | 3300013307 | Bacteria | 3829 |
| 350 | Ga0157372_10104344 | 3300013307 | Bacteria | 3240 |
| 351 | Ga0157372_10123380 | 3300013307 | Bacteria | 2977 |
| 352 | Ga0157372_10208720 | 3300013307 | Bacteria | 2263 |
| 353 | Ga0157372_10271820 | 3300013307 | Bacteria | 1970 |
| 354 | Ga0157372_10295703 | 3300013307 | Bacteria | 1883 |
| 355 | Ga0157372_10745377 | 3300013307 | Bacteria | 1139 |
| 356 | Ga0157380_10030483 | 3300014326 | Bacteria | 4131 |
| 357 | Ga0157380_10083091 | 3300014326 | Bacteria | 2622 |
| 358 | Ga0157380_10754189 | 3300014326 | Unclassified | 985 |
| 359 | Ga0182008_10000371 | 3300014497 | Bacteria | 34744 |
| 360 | Ga0157377_10058154 | 3300014745 | Bacteria | 2201 |
| 361 | Ga0157379_10073278 | 3300014968 | Bacteria | 3065 |
| 362 | Ga0157379_10266631 | 3300014968 | Bacteria | 1557 |
| 363 | Ga0157376_10096560 | 3300014969 | Bacteria | 2572 |
| 364 | Ga0157376_10139856 | 3300014969 | Bacteria | 2170 |
| 365 | Ga0157376_10237463 | 3300014969 | Bacteria | 1696 |
| 366 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 367 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 368 | Ga0163161_10069854 | 3300017792 | Bacteria | 2568 |
| 369 | Ga0197907_10957944 | 3300020069 | Bacteria | 1296 |
| 370 | Ga0206356_11098649 | 3300020070 | Bacteria | 2627 |
| 371 | Ga0206356_11322499 | 3300020070 | Bacteria | 2298 |
| 372 | Ga0206351_10917985 | 3300020077 | Bacteria | 2266 |
| 373 | Ga0206354_11670857 | 3300020081 | Bacteria | 2083 |
| 374 | Ga0206353_10228217 | 3300020082 | Bacteria | 1276 |
| 375 | Ga0206353_11044475 | 3300020082 | Bacteria | 1384 |
| 376 | Ga0209435_101367 | 3300025206 | Bacteria | 3127 |
| 377 | Ga0209760_100727 | 3300025207 | Bacteria | 4910 |
| 378 | Ga0209784_100133 | 3300025224 | Bacteria | 72169 |
| 379 | Ga0209566_102250 | 3300025225 | Bacteria | 3775 |
| 380 | Ga0209674_100148 | 3300025226 | Bacteria | 98100 |
| 381 | Ga0209674_100269 | 3300025226 | Bacteria | 39856 |
| 382 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 383 | Ga0209672_100029 | 3300025228 | Bacteria | 339298 |
| 384 | Ga0209672_100058 | 3300025228 | Bacteria | 211992 |
| 385 | Ga0209672_100434 | 3300025228 | Bacteria | 24040 |
| 386 | Ga0209672_100841 | 3300025228 | Bacteria | 14165 |
| 387 | Ga0209563_100051 | 3300025230 | Bacteria | 340545 |
| 388 | Ga0207427_100013 | 3300025231 | Bacteria | 581419 |
| 389 | Ga0207427_100033 | 3300025231 | Bacteria | 338459 |
| 390 | Ga0207427_101041 | 3300025231 | Bacteria | 11548 |
| 391 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 392 | Ga0209437_100106 | 3300025233 | Bacteria | 219071 |
| 393 | Ga0209437_100352 | 3300025233 | Bacteria | 52711 |
| 394 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 395 | Ga0209258_100053 | 3300025242 | Bacteria | 339233 |
| 396 | Ga0209258_100164 | 3300025242 | Bacteria | 148838 |
| 397 | Ga0209258_100413 | 3300025242 | Bacteria | 51260 |
| 398 | Ga0209258_100444 | 3300025242 | Bacteria | 46475 |
| 399 | Ga0209258_100991 | 3300025242 | Bacteria | 13111 |
| 400 | Ga0209258_101490 | 3300025242 | Bacteria | 8031 |
| 401 | Ga0207425_1000028 | 3300025245 | Bacteria | 286333 |
| 402 | Ga0207425_1002659 | 3300025245 | Bacteria | 6143 |
| 403 | Ga0209646_1001493 | 3300025246 | Bacteria | 6223 |
| 404 | Ga0209646_1004243 | 3300025246 | Bacteria | 2641 |
| 405 | Ga0209646_1009044 | 3300025246 | Bacteria | 1587 |
| 406 | Ga0209026_1000074 | 3300025250 | Bacteria | 203820 |
| 407 | Ga0209026_1000092 | 3300025250 | Bacteria | 170960 |
| 408 | Ga0209026_1000111 | 3300025250 | Bacteria | 140599 |
| 409 | Ga0209026_1001965 | 3300025250 | Bacteria | 8246 |
| 410 | Ga0209677_103982 | 3300025253 | Bacteria | 4480 |
| 411 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 412 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 413 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 414 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 415 | Ga0209148_1000087 | 3300025254 | Bacteria | 260905 |
| 416 | Ga0209148_1000098 | 3300025254 | Bacteria | 233172 |
| 417 | Ga0209759_1000110 | 3300025256 | Bacteria | 144917 |
| 418 | Ga0209759_1000278 | 3300025256 | Bacteria | 71965 |
| 419 | Ga0209759_1000353 | 3300025256 | Bacteria | 59779 |
| 420 | Ga0209759_1003639 | 3300025256 | Bacteria | 6066 |
| 421 | Ga0209759_1004660 | 3300025256 | Bacteria | 5034 |
| 422 | Ga0209759_1008783 | 3300025256 | Bacteria | 3119 |
| 423 | Ga0209129_1000065 | 3300025258 | Bacteria | 232568 |
| 424 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 425 | Ga0209233_1000080 | 3300025261 | Bacteria | 338459 |
| 426 | Ga0209233_1004727 | 3300025261 | Bacteria | 4592 |
| 427 | Ga0209233_1010689 | 3300025261 | Bacteria | 2736 |
| 428 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 429 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 430 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 431 | Ga0209455_1000060 | 3300025272 | Bacteria | 339298 |
| 432 | Ga0209455_1000120 | 3300025272 | Bacteria | 173966 |
| 433 | Ga0209455_1000211 | 3300025272 | Bacteria | 82660 |
| 434 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 435 | Ga0209130_1006918 | 3300025284 | Bacteria | 3590 |
| 436 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 437 | Ga0209675_1028589 | 3300025291 | Bacteria | 1353 |
| 438 | Ga0209676_1000047 | 3300025292 | Bacteria | 408645 |
| 439 | Ga0209676_1001228 | 3300025292 | Bacteria | 27113 |
| 440 | Ga0209676_1003790 | 3300025292 | Bacteria | 8947 |
| 441 | Ga0209676_1046886 | 3300025292 | Bacteria | 1165 |
| 442 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 443 | Ga0209025_1000036 | 3300025294 | Bacteria | 404113 |
| 444 | Ga0209025_1001523 | 3300025294 | Bacteria | 29655 |
| 445 | Ga0209025_1002530 | 3300025294 | Bacteria | 19117 |
| 446 | Ga0209025_1074280 | 3300025294 | Bacteria | 1188 |
| 447 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 448 | Ga0209564_1010242 | 3300025295 | Bacteria | 4347 |
| 449 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 450 | Ga0209758_1001152 | 3300025297 | Bacteria | 33838 |
| 451 | Ga0209758_1007625 | 3300025297 | Bacteria | 7300 |
| 452 | Ga0209758_1019267 | 3300025297 | Bacteria | 3298 |
| 453 | Ga0209050_1002237 | 3300025298 | Bacteria | 17278 |
| 454 | Ga0209050_1029950 | 3300025298 | Bacteria | 1727 |
| 455 | Ga0209256_1000021 | 3300025299 | Bacteria | 537097 |
| 456 | Ga0209256_1000539 | 3300025299 | Bacteria | 54888 |
| 457 | Ga0209256_1002619 | 3300025299 | Bacteria | 14223 |
| 458 | Ga0209256_1002635 | 3300025299 | Bacteria | 14134 |
| 459 | Ga0209256_1004402 | 3300025299 | Bacteria | 8875 |
| 460 | Ga0209257_1000133 | 3300025304 | Bacteria | 208808 |
| 461 | Ga0209257_1000362 | 3300025304 | Bacteria | 92009 |
| 462 | Ga0209257_1002869 | 3300025304 | Bacteria | 16068 |
| 463 | Ga0209257_1004114 | 3300025304 | Bacteria | 11619 |
| 464 | Ga0209257_1005108 | 3300025304 | Bacteria | 9516 |
| 465 | Ga0207656_10001165 | 3300025321 | Bacteria | 8642 |
| 466 | Ga0207655_1022286 | 3300025728 | Bacteria | 3182 |
| 467 | Ga0207710_10000934 | 3300025900 | Bacteria | 15560 |
| 468 | Ga0207710_10022209 | 3300025900 | Bacteria | 2723 |
| 469 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 470 | Ga0207680_10028853 | 3300025903 | Bacteria | 3109 |
| 471 | Ga0207680_10063513 | 3300025903 | Unclassified | 2260 |
| 472 | Ga0207647_10000504 | 3300025904 | Bacteria | 31238 |
| 473 | Ga0207647_10000677 | 3300025904 | Bacteria | 26730 |
| 474 | Ga0207647_10001610 | 3300025904 | Bacteria | 17365 |
| 475 | Ga0207647_10004217 | 3300025904 | Bacteria | 10660 |
| 476 | Ga0207647_10009312 | 3300025904 | Bacteria | 6982 |
| 477 | Ga0207647_10034794 | 3300025904 | Bacteria | 3213 |
| 478 | Ga0207699_10000222 | 3300025906 | Bacteria | 33473 |
| 479 | Ga0207645_10105586 | 3300025907 | Bacteria | 1820 |
| 480 | Ga0207705_10001829 | 3300025909 | Bacteria | 16749 |
| 481 | Ga0207705_10002514 | 3300025909 | Bacteria | 14134 |
| 482 | Ga0207705_10004714 | 3300025909 | Bacteria | 10274 |
| 483 | Ga0207705_10004985 | 3300025909 | Bacteria | 9962 |
| 484 | Ga0207705_10106810 | 3300025909 | Bacteria | 2065 |
| 485 | Ga0207707_10000578 | 3300025912 | Bacteria | 37213 |
| 486 | Ga0207707_10001419 | 3300025912 | Bacteria | 22162 |
| 487 | Ga0207707_10001729 | 3300025912 | Bacteria | 20054 |
| 488 | Ga0207707_10003100 | 3300025912 | Bacteria | 14752 |
| 489 | Ga0207707_10006039 | 3300025912 | Bacteria | 10596 |
| 490 | Ga0207707_10030276 | 3300025912 | Bacteria | 4735 |
| 491 | Ga0207707_10032224 | 3300025912 | Bacteria | 4587 |
| 492 | Ga0207707_10090685 | 3300025912 | Bacteria | 2671 |
| 493 | Ga0207707_10112131 | 3300025912 | Bacteria | 2384 |
| 494 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 495 | Ga0207695_10001058 | 3300025913 | Bacteria | 48255 |
| 496 | Ga0207695_10001605 | 3300025913 | Bacteria | 36692 |
| 497 | Ga0207695_10002167 | 3300025913 | Bacteria | 29675 |
| 498 | Ga0207695_10004738 | 3300025913 | Bacteria | 18411 |
| 499 | Ga0207695_10007278 | 3300025913 | Bacteria | 14135 |
| 500 | Ga0207695_10013378 | 3300025913 | Bacteria | 9791 |
| 501 | Ga0207695_10016800 | 3300025913 | Bacteria | 8546 |
| 502 | Ga0207695_10016841 | 3300025913 | Bacteria | 8533 |
| 503 | Ga0207695_10020794 | 3300025913 | Bacteria | 7507 |
| 504 | Ga0207695_10032853 | 3300025913 | Bacteria | 5672 |
| 505 | Ga0207695_10037705 | 3300025913 | Bacteria | 5213 |
| 506 | Ga0207695_10049935 | 3300025913 | Bacteria | 4403 |
| 507 | Ga0207695_10110706 | 3300025913 | Bacteria | 2726 |
| 508 | Ga0207695_10166538 | 3300025913 | Bacteria | 2132 |
| 509 | Ga0207695_10187385 | 3300025913 | Bacteria | 1988 |
| 510 | Ga0207695_10245362 | 3300025913 | Bacteria | 1691 |
| 511 | Ga0207695_10462887 | 3300025913 | Bacteria | 1151 |
| 512 | Ga0207671_10000021 | 3300025914 | Bacteria | 300409 |
| 513 | Ga0207671_10000292 | 3300025914 | Bacteria | 73798 |
| 514 | Ga0207671_10004135 | 3300025914 | Bacteria | 14033 |
| 515 | Ga0207671_10032312 | 3300025914 | Bacteria | 3896 |
| 516 | Ga0207671_10036274 | 3300025914 | Bacteria | 3656 |
| 517 | Ga0207671_10065929 | 3300025914 | Bacteria | 2694 |
| 518 | Ga0207671_10198885 | 3300025914 | Bacteria | 1565 |
| 519 | Ga0207671_10303947 | 3300025914 | Bacteria | 1260 |
| 520 | Ga0207663_10155888 | 3300025916 | Bacteria | 1606 |
| 521 | Ga0207660_10007012 | 3300025917 | Bacteria | 7298 |
| 522 | Ga0207660_10018231 | 3300025917 | Bacteria | 4676 |
| 523 | Ga0207660_10059800 | 3300025917 | Bacteria | 2737 |
| 524 | Ga0207660_10062281 | 3300025917 | Bacteria | 2687 |
| 525 | Ga0207660_10070120 | 3300025917 | Bacteria | 2547 |
| 526 | Ga0207660_10072900 | 3300025917 | Bacteria | 2502 |
| 527 | Ga0207657_10008479 | 3300025919 | Bacteria | 10427 |
| 528 | Ga0207657_10018265 | 3300025919 | Bacteria | 6705 |
| 529 | Ga0207649_10026175 | 3300025920 | Bacteria | 3410 |
| 530 | Ga0207649_10032086 | 3300025920 | Bacteria | 3128 |
| 531 | Ga0207649_10148275 | 3300025920 | Bacteria | 1613 |
| 532 | Ga0207652_10000022 | 3300025921 | Bacteria | 158642 |
| 533 | Ga0207652_10000390 | 3300025921 | Bacteria | 45701 |
| 534 | Ga0207652_10003362 | 3300025921 | Bacteria | 13211 |
| 535 | Ga0207652_10005539 | 3300025921 | Bacteria | 10237 |
| 536 | Ga0207652_10008522 | 3300025921 | Bacteria | 8251 |
| 537 | Ga0207652_10044028 | 3300025921 | Bacteria | 3802 |
| 538 | Ga0207652_10103776 | 3300025921 | Bacteria | 2514 |
| 539 | Ga0207652_10189655 | 3300025921 | Bacteria | 1849 |
| 540 | Ga0207694_10001330 | 3300025924 | Bacteria | 21257 |
| 541 | Ga0207694_10004279 | 3300025924 | Bacteria | 11175 |
| 542 | Ga0207694_10005966 | 3300025924 | Bacteria | 9333 |
| 543 | Ga0207694_10011925 | 3300025924 | Bacteria | 6554 |
| 544 | Ga0207694_10044992 | 3300025924 | Bacteria | 3409 |
| 545 | Ga0207694_10115403 | 3300025924 | Bacteria | 2139 |
| 546 | Ga0207694_10209248 | 3300025924 | Bacteria | 1588 |
| 547 | Ga0207694_10296739 | 3300025924 | Bacteria | 1330 |
| 548 | Ga0207650_10008638 | 3300025925 | Bacteria | 6955 |
| 549 | Ga0207659_10011103 | 3300025926 | Bacteria | 5682 |
| 550 | Ga0207664_10000235 | 3300025929 | Bacteria | 41962 |
| 551 | Ga0207664_10011140 | 3300025929 | Bacteria | 6374 |
| 552 | Ga0207690_10000913 | 3300025932 | Bacteria | 18868 |
| 553 | Ga0207690_10004594 | 3300025932 | Bacteria | 8161 |
| 554 | Ga0207690_10010359 | 3300025932 | Bacteria | 5537 |
| 555 | Ga0207690_10029874 | 3300025932 | Bacteria | 3469 |
| 556 | Ga0207690_10032193 | 3300025932 | Bacteria | 3362 |
| 557 | Ga0207690_10035611 | 3300025932 | Bacteria | 3217 |
| 558 | Ga0207690_10054269 | 3300025932 | Bacteria | 2694 |
| 559 | Ga0207690_10058416 | 3300025932 | Bacteria | 2609 |
| 560 | Ga0207706_10022271 | 3300025933 | Bacteria | 5686 |
| 561 | Ga0207706_10055705 | 3300025933 | Bacteria | 3486 |
| 562 | Ga0207709_10017863 | 3300025935 | Bacteria | 3966 |
| 563 | Ga0207670_10005647 | 3300025936 | Bacteria | 6882 |
| 564 | Ga0207704_10090033 | 3300025938 | Bacteria | 2012 |
| 565 | Ga0207665_10010651 | 3300025939 | Bacteria | 6040 |
| 566 | Ga0207711_10000411 | 3300025941 | Bacteria | 45483 |
| 567 | Ga0207711_10162762 | 3300025941 | Bacteria | 2021 |
| 568 | Ga0207689_10132399 | 3300025942 | Bacteria | 2052 |
| 569 | Ga0207661_10004890 | 3300025944 | Bacteria | 9390 |
| 570 | Ga0207661_10052160 | 3300025944 | Bacteria | 3266 |
| 571 | Ga0207661_10262590 | 3300025944 | Bacteria | 1538 |
| 572 | Ga0207679_10141999 | 3300025945 | Bacteria | 1942 |
| 573 | Ga0207679_10276455 | 3300025945 | Bacteria | 1438 |
| 574 | Ga0207667_10000142 | 3300025949 | Bacteria | 109610 |
| 575 | Ga0207667_10000198 | 3300025949 | Bacteria | 87446 |
| 576 | Ga0207667_10001230 | 3300025949 | Bacteria | 32103 |
| 577 | Ga0207667_10001994 | 3300025949 | Bacteria | 25606 |
| 578 | Ga0207667_10005471 | 3300025949 | Bacteria | 15483 |
| 579 | Ga0207667_10008565 | 3300025949 | Bacteria | 12139 |
| 580 | Ga0207667_10024202 | 3300025949 | Bacteria | 6672 |
| 581 | Ga0207667_10040901 | 3300025949 | Bacteria | 4934 |
| 582 | Ga0207667_10047035 | 3300025949 | Bacteria | 4568 |
| 583 | Ga0207667_10056633 | 3300025949 | Bacteria | 4117 |
| 584 | Ga0207651_10098631 | 3300025960 | Bacteria | 2161 |
| 585 | Ga0207712_10001488 | 3300025961 | Bacteria | 15904 |
| 586 | Ga0207712_10001504 | 3300025961 | Bacteria | 15809 |
| 587 | Ga0207712_10295140 | 3300025961 | Bacteria | 1328 |
| 588 | Ga0207640_10000014 | 3300025981 | Bacteria | 219683 |
| 589 | Ga0207640_10000016 | 3300025981 | Bacteria | 208390 |
| 590 | Ga0207640_10002697 | 3300025981 | Bacteria | 9505 |
| 591 | Ga0207640_10009566 | 3300025981 | Bacteria | 5432 |
| 592 | Ga0207640_10064612 | 3300025981 | Bacteria | 2438 |
| 593 | Ga0207640_10067102 | 3300025981 | Bacteria | 2399 |
| 594 | Ga0207640_10169824 | 3300025981 | Bacteria | 1624 |
| 595 | Ga0207658_10000093 | 3300025986 | Bacteria | 98928 |
| 596 | Ga0207658_10014676 | 3300025986 | Bacteria | 5367 |
| 597 | Ga0207658_10031098 | 3300025986 | Bacteria | 3787 |
| 598 | Ga0207658_10058641 | 3300025986 | Unclassified | 2865 |
| 599 | Ga0207658_10275731 | 3300025986 | Bacteria | 1439 |
| 600 | Ga0207703_10000734 | 3300026035 | Bacteria | 32244 |
| 601 | Ga0207703_10000802 | 3300026035 | Bacteria | 30959 |
| 602 | Ga0207703_10001191 | 3300026035 | Bacteria | 24462 |
| 603 | Ga0207703_10369464 | 3300026035 | Bacteria | 1325 |
| 604 | Ga0207703_10579792 | 3300026035 | Bacteria | 1060 |
| 605 | Ga0207639_10000374 | 3300026041 | Bacteria | 30955 |
| 606 | Ga0207639_10001926 | 3300026041 | Bacteria | 13943 |
| 607 | Ga0207639_10005288 | 3300026041 | Bacteria | 8715 |
| 608 | Ga0207639_10006208 | 3300026041 | Bacteria | 8117 |
| 609 | Ga0207639_10006318 | 3300026041 | Bacteria | 8045 |
| 610 | Ga0207639_10028040 | 3300026041 | Bacteria | 4107 |
| 611 | Ga0207639_10084920 | 3300026041 | Bacteria | 2516 |
| 612 | Ga0207678_10000619 | 3300026067 | Bacteria | 32528 |
| 613 | Ga0207678_10004139 | 3300026067 | Bacteria | 13034 |
| 614 | Ga0207678_10006047 | 3300026067 | Bacteria | 10765 |
| 615 | Ga0207678_10012768 | 3300026067 | Bacteria | 7377 |
| 616 | Ga0207678_10029974 | 3300026067 | Bacteria | 4750 |
| 617 | Ga0207678_10042614 | 3300026067 | Bacteria | 3931 |
| 618 | Ga0207678_10124365 | 3300026067 | Bacteria | 2201 |
| 619 | Ga0207678_10170381 | 3300026067 | Bacteria | 1859 |
| 620 | Ga0207702_10000170 | 3300026078 | Bacteria | 77504 |
| 621 | Ga0207702_10003761 | 3300026078 | Bacteria | 13704 |
| 622 | Ga0207702_10011516 | 3300026078 | Bacteria | 7369 |
| 623 | Ga0207702_10097457 | 3300026078 | Bacteria | 2588 |
| 624 | Ga0207702_10191442 | 3300026078 | Bacteria | 1890 |
| 625 | Ga0207641_10001117 | 3300026088 | Bacteria | 26998 |
| 626 | Ga0207641_10058664 | 3300026088 | Unclassified | 3276 |
| 627 | Ga0207641_10381244 | 3300026088 | Bacteria | 1350 |
| 628 | Ga0207641_10398813 | 3300026088 | Bacteria | 1320 |
| 629 | Ga0207676_10197284 | 3300026095 | Bacteria | 1776 |
| 630 | Ga0207674_10000623 | 3300026116 | Bacteria | 46466 |
| 631 | Ga0207674_10001397 | 3300026116 | Bacteria | 31130 |
| 632 | Ga0207674_10016247 | 3300026116 | Bacteria | 8152 |
| 633 | Ga0207674_10026041 | 3300026116 | Bacteria | 6224 |
| 634 | Ga0207674_10030846 | 3300026116 | Bacteria | 5635 |
| 635 | Ga0207674_10050111 | 3300026116 | Bacteria | 4268 |
| 636 | Ga0207674_10064493 | 3300026116 | Bacteria | 3695 |
| 637 | Ga0207674_10421608 | 3300026116 | Bacteria | 1290 |
| 638 | Ga0207675_100162159 | 3300026118 | Bacteria | 2133 |
| 639 | Ga0207675_100306075 | 3300026118 | Bacteria | 1549 |
| 640 | Ga0207698_10001202 | 3300026142 | Bacteria | 15100 |
| 641 | Ga0207698_10001610 | 3300026142 | Bacteria | 13138 |
| 642 | Ga0207698_10005754 | 3300026142 | Bacteria | 7692 |
| 643 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 644 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 645 | Ga0209969_1002780 | 3300027360 | Bacteria | 2424 |
| 646 | Ga0210002_1000841 | 3300027617 | Bacteria | 4195 |
| 647 | Ga0207428_10060265 | 3300027907 | Bacteria | 3007 |
| 648 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 649 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 650 | Ga0268266_10000043 | 3300028379 | Bacteria | 316604 |
| 651 | Ga0268266_10002855 | 3300028379 | Bacteria | 18003 |
| 652 | Ga0268266_10002895 | 3300028379 | Bacteria | 17786 |
| 653 | Ga0268266_10031831 | 3300028379 | Bacteria | 4481 |
| 654 | Ga0268266_10062485 | 3300028379 | Bacteria | 3215 |
| 655 | Ga0268266_10248304 | 3300028379 | Bacteria | 1645 |
| 656 | Ga0268266_10288577 | 3300028379 | Bacteria | 1527 |
| 657 | Ga0268265_10055779 | 3300028380 | Bacteria | 3004 |
| 658 | Ga0268264_10000293 | 3300028381 | Bacteria | 83870 |
| 659 | Ga0268264_10054427 | 3300028381 | Bacteria | 3341 |
| 660 | Ga0268264_10067856 | 3300028381 | Bacteria | 3011 |
| 661 | Ga0268264_10171012 | 3300028381 | Unclassified | 1965 |
| 662 | Ga0268264_10353112 | 3300028381 | Bacteria | 1400 |
| 663 | Ga0265334_10000015 | 3300028573 | Bacteria | 150318 |
| 664 | Ga0265334_10004047 | 3300028573 | Bacteria | 6574 |
| 665 | Ga0265318_10003682 | 3300028577 | Bacteria | 7656 |
| 666 | Ga0265338_10036293 | 3300028800 | Bacteria | 4720 |
| 667 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 668 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 669 | Ga0316176_1094510 | 3300030732 | Bacteria | 1504 |
| 670 | Ga0265328_10010215 | 3300031239 | Bacteria | 3785 |
| 671 | Ga0265320_10015039 | 3300031240 | Bacteria | 4383 |
| 672 | Ga0265316_10021492 | 3300031344 | Bacteria | 5464 |
| 673 | Ga0265316_10131573 | 3300031344 | Bacteria | 1884 |
| 674 | Ga0307513_10024959 | 3300031456 | Bacteria | 6940 |
| 675 | Ga0307509_10000017 | 3300031507 | Bacteria | 265012 |
| 676 | Ga0307408_100003986 | 3300031548 | Bacteria | 10064 |
| 677 | Ga0307408_100167188 | 3300031548 | Bacteria | 1753 |
| 678 | Ga0265313_10002491 | 3300031595 | Bacteria | 15868 |
| 679 | Ga0265313_10041420 | 3300031595 | Bacteria | 2269 |
| 680 | Ga0316575_10002942 | 3300031665 | Bacteria | 5801 |
| 681 | Ga0316579_10080255 | 3300031691 | Bacteria | 1553 |
| 682 | Ga0316576_10059061 | 3300031727 | Bacteria | 2806 |
| 683 | Ga0307405_10015248 | 3300031731 | Bacteria | 4157 |
| 684 | Ga0307405_10028736 | 3300031731 | Bacteria | 3242 |
| 685 | Ga0316577_10002497 | 3300031733 | Bacteria | 9135 |
| 686 | Ga0316577_10057023 | 3300031733 | Bacteria | 2181 |
| 687 | Ga0307413_10055894 | 3300031824 | Bacteria | 2404 |
| 688 | Ga0307413_10283373 | 3300031824 | Bacteria | 1247 |
| 689 | Ga0307413_10370001 | 3300031824 | Bacteria | 1113 |
| 690 | Ga0307410_10001595 | 3300031852 | Bacteria | 10400 |
| 691 | Ga0307406_10029620 | 3300031901 | Bacteria | 3316 |
| 692 | Ga0307407_10005839 | 3300031903 | Bacteria | 5394 |
| 693 | Ga0307407_10165348 | 3300031903 | Bacteria | 1452 |
| 694 | Ga0307407_10340612 | 3300031903 | Bacteria | 1058 |
| 695 | Ga0307412_10016096 | 3300031911 | Bacteria | 4446 |
| 696 | Ga0307412_10248530 | 3300031911 | Bacteria | 1380 |
| 697 | Ga0307409_100283503 | 3300031995 | Bacteria | 1532 |
| 698 | Ga0307416_100001112 | 3300032002 | Bacteria | 14440 |
| 699 | Ga0307416_100066445 | 3300032002 | Bacteria | 2969 |
| 700 | Ga0307414_10069220 | 3300032004 | Bacteria | 2536 |
| 701 | Ga0307411_10000563 | 3300032005 | Bacteria | 13225 |
| 702 | Ga0307411_10168620 | 3300032005 | Bacteria | 1648 |
| 703 | Ga0307411_10276872 | 3300032005 | Bacteria | 1333 |
| 704 | Ga0307415_100000772 | 3300032126 | Bacteria | 14475 |
| 705 | Ga0307507_10225759 | 3300033179 | Bacteria | 1251 |
| 706 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 707 | Ga0307510_10000233 | 3300033180 | Bacteria | 49994 |
| 708 | Ga0316574_0133934 | 3300035398 | Bacteria | 1595 |
| 709 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 710 | Ga0373933_0008933 | 3300035724 | Bacteria | 5466 |
| 711 | Ga0316584_0144292 | 3300036712 | Bacteria | 1774 |
| 712 | Ga0395899_0000309 | 3300037312 | Bacteria | 62448 |
| 713 | Ga0395899_0001578 | 3300037312 | Bacteria | 19176 |
| 714 | Ga0395899_0028102 | 3300037312 | Bacteria | 4237 |
| 715 | Ga0395899_0033120 | 3300037312 | Bacteria | 3882 |
| 716 | Ga0395900_0000163 | 3300037418 | Bacteria | 109199 |
| 717 | Ga0395900_0002478 | 3300037418 | Bacteria | 20291 |
| 718 | Ga0395900_0003412 | 3300037418 | Bacteria | 17173 |
| 719 | Ga0395900_0008384 | 3300037418 | Bacteria | 10638 |
| 720 | Ga0395900_0011470 | 3300037418 | Bacteria | 9071 |
| 721 | Ga0395900_0068100 | 3300037418 | Bacteria | 3657 |
| 722 | Ga0395900_0069483 | 3300037418 | Bacteria | 3620 |
| 723 | Ga0395900_0282558 | 3300037418 | Bacteria | 1651 |
| 724 | Ga0395898_0000144 | 3300037466 | Bacteria | 187889 |
| 725 | Ga0395898_0000305 | 3300037466 | Bacteria | 116565 |
| 726 | Ga0395898_0025292 | 3300037466 | Bacteria | 5984 |
| 727 | Ga0395898_0026570 | 3300037466 | Bacteria | 5822 |
| 728 | Ga0395898_0140963 | 3300037466 | Bacteria | 2308 |
| 729 | Ga0395898_0343110 | 3300037466 | Bacteria | 1424 |
| 730 | Ga0395905_0001012 | 3300037471 | Bacteria | 35880 |
| 731 | Ga0395905_0353689 | 3300037471 | Bacteria | 1361 |
| 732 | Ga0395901_0009632 | 3300038443 | Bacteria | 9801 |
| 733 | Ga0395901_0011011 | 3300038443 | Bacteria | 9163 |
| 734 | Ga0395901_0028170 | 3300038443 | Bacteria | 5778 |
| 735 | Ga0395901_0070506 | 3300038443 | Bacteria | 3641 |
| 736 | Ga0395901_0136557 | 3300038443 | Bacteria | 2577 |
| 737 | Ga0395901_0148164 | 3300038443 | Bacteria | 2466 |
| 738 | Ga0395901_0193979 | 3300038443 | Bacteria | 2130 |
| 739 | Ga0395901_0212471 | 3300038443 | Bacteria | 2024 |
| 740 | Ga0395901_0261349 | 3300038443 | Bacteria | 1802 |
| 741 | Ga0237819_03353 | 3300038705 | Bacteria | 2872 |
| 742 | Ga0400489_43493 | 3300039093 | Bacteria | 1935 |
| 743 | Ga0400489_65269 | 3300039093 | Unclassified | 3227 |
| 744 | Ga0237816_00097 | 3300039145 | Bacteria | 6479 |
| 745 | Ga0436365_1276167 | 3300039437 | Bacteria | 1358 |
| 746 | Ga0436363_0328143 | 3300039450 | Bacteria | 5546 |
| 747 | Ga0439447_003716 | 3300041407 | Bacteria | 5377 |
| 748 | Ga0439461_0013007 | 3300041410 | Bacteria | 1565 |
| 749 | Ga0451791_0790747 | 3300041451 | Bacteria | 4124 |
| 750 | Ga0451793_1323418 | 3300041452 | Bacteria | 1122 |
| 751 | Ga0451797_1149682 | 3300041453 | Bacteria | 1889 |
| 752 | Ga0451800_0043135 | 3300041459 | Bacteria | 15391 |
| 753 | Ga0451800_0844354 | 3300041459 | Bacteria | 1187 |
| 754 | Ga0451806_227471 | 3300041462 | Bacteria | 9726 |
| 755 | Ga0451807_0696539 | 3300041486 | Bacteria | 6801 |
| 756 | Ga0451807_1184572 | 3300041486 | Bacteria | 5477 |
| 757 | Ga0451807_1852622 | 3300041486 | Bacteria | 2506 |
| 758 | Ga0451841_0914442 | 3300041498 | Unclassified | 1845 |
| 759 | Ga0451843_0048063 | 3300041509 | Bacteria | 1453 |
| 760 | Ga0451843_1201883 | 3300041509 | Bacteria | 1634 |
| 761 | Ga0451853_0743661 | 3300041512 | Bacteria | 1457 |
| 762 | Ga0439433_0028572 | 3300041999 | Bacteria | 1269 |
| 763 | Ga0439449_0057096 | 3300042007 | Bacteria | 1441 |
| 764 | Ga0439456_036297 | 3300042013 | Bacteria | 1063 |
| 765 | Ga0450894_002938 | 3300042131 | Bacteria | 2258 |
| 766 | Ga0450896_003162 | 3300042133 | Bacteria | 2172 |
| 767 | Ga0439446_0051666 | 3300042156 | Bacteria | 1229 |
| 768 | Ga0450908_000229 | 3300042184 | Bacteria | 11277 |
| 769 | Ga0451577_0002744 | 3300042876 | Bacteria | 20405 |
| 770 | Ga0451577_0004710 | 3300042876 | Bacteria | 14314 |
| 771 | Ga0451577_0095577 | 3300042876 | Bacteria | 2653 |
| 772 | Ga0451577_0107004 | 3300042876 | Bacteria | 2500 |
| 773 | Ga0466969_0003624 | 3300044656 | Bacteria | 8219 |
| 774 | Ga0466972_0001350 | 3300044658 | Bacteria | 11881 |
| 775 | Ga0466972_0029651 | 3300044658 | Bacteria | 2693 |
| 776 | Ga0466982_0000004 | 3300044672 | Bacteria | 386724 |
| 777 | Ga0466965_0008083 | 3300044683 | Bacteria | 4860 |
| 778 | Ga0466966_0011778 | 3300044684 | Bacteria | 5794 |
| 779 | Ga0466966_0056156 | 3300044684 | Bacteria | 2491 |
| 780 | Ga0466966_0120907 | 3300044684 | Bacteria | 1608 |
| 781 | Ga0466961_0000946 | 3300044693 | Bacteria | 17985 |
| 782 | Ga0466961_0006538 | 3300044693 | Bacteria | 7411 |
| 783 | Ga0466961_0020260 | 3300044693 | Bacteria | 4278 |
| 784 | Ga0466961_0028864 | 3300044693 | Bacteria | 3567 |
| 785 | Ga0453684_0013282 | 3300044712 | Bacteria | 13410 |
| 786 | Ga0453684_0154833 | 3300044712 | Bacteria | 2719 |
| 787 | Ga0453684_0277213 | 3300044712 | Bacteria | 1914 |
| 788 | Ga0466971_0011479 | 3300044719 | Bacteria | 3878 |
| 789 | Ga0466971_0029561 | 3300044719 | Bacteria | 2451 |
| 790 | Ga0466970_0003008 | 3300044765 | Bacteria | 8177 |
| 791 | Ga0466970_0006449 | 3300044765 | Bacteria | 5868 |
| 792 | Ga0466970_0018394 | 3300044765 | Bacteria | 3616 |
| 793 | Ga0466970_0035184 | 3300044765 | Bacteria | 2653 |
| 794 | Ga0466970_0047948 | 3300044765 | Bacteria | 2277 |
| 795 | Ga0466957_0000516 | 3300044842 | Bacteria | 19357 |
| 796 | Ga0466957_0253270 | 3300044842 | Bacteria | 1171 |
| 797 | Ga0466959_0007966 | 3300045049 | Bacteria | 7463 |
| 798 | Ga0466959_0021228 | 3300045049 | Bacteria | 4788 |
| 799 | Ga0466959_0052826 | 3300045049 | Bacteria | 2974 |
| 800 | Ga0466959_0070991 | 3300045049 | Bacteria | 2522 |
| 801 | Ga0466959_0092683 | 3300045049 | Bacteria | 2168 |
| 802 | Ga0466958_0063566 | 3300045836 | Bacteria | 2251 |
| 803 | Ga0466958_0211287 | 3300045836 | Bacteria | 1236 |
| 804 | Ga0466967_0449729 | 3300045976 | Bacteria | 1259 |
| 805 | Ga0495638_0000094 | 3300046460 | Bacteria | 142168 |
| 806 | Ga0495638_0008208 | 3300046460 | Bacteria | 7422 |
| 807 | Ga0495650_0000027 | 3300046471 | Bacteria | 475071 |
| 808 | Ga0495650_0000078 | 3300046471 | Bacteria | 245487 |
| 809 | Ga0495606_0094497 | 3300046507 | Bacteria | 1832 |
| 810 | Ga0495622_0029037 | 3300046557 | Bacteria | 2584 |
| 811 | Ga0495633_0020840 | 3300046558 | Bacteria | 3289 |
| 812 | Ga0495633_0171164 | 3300046558 | Bacteria | 1001 |
| 813 | Ga0495668_0005550 | 3300046616 | Bacteria | 8495 |
| 814 | Ga0495625_0011559 | 3300046660 | Bacteria | 7189 |
| 815 | Ga0495625_0033091 | 3300046660 | Bacteria | 3826 |
| 816 | Ga0495659_0005813 | 3300046664 | Bacteria | 3893 |
| 817 | Ga0495649_0015687 | 3300046694 | Bacteria | 4307 |
| 818 | Ga0495686_0035377 | 3300047472 | Bacteria | 3211 |
| 819 | Ga0496100_0010485 | 3300048903 | Bacteria | 5248 |
| 820 | Ga0496101_0001877 | 3300048904 | Bacteria | 12689 |
| 821 | Ga0496101_0228940 | 3300048904 | Bacteria | 1444 |
| 822 | Ga0496102_0175832 | 3300048905 | Bacteria | 2016 |
| 823 | Ga0496104_0858165 | 3300048907 | Bacteria | 813 |
| 824 | Ga0496105_0005421 | 3300048908 | Bacteria | 9678 |
| 825 | Ga0496107_0077961 | 3300048910 | Bacteria | 2414 |
| 826 | Ga0496108_0041356 | 3300048911 | Bacteria | 3848 |
| 827 | Ga0496109_0162354 | 3300048912 | Bacteria | 2093 |
| 828 | Ga0496110_0192786 | 3300048913 | Bacteria | 1850 |
| 829 | Ga0496111_0111864 | 3300048914 | Bacteria | 2011 |
| 830 | Ga0496113_0031778 | 3300048916 | Bacteria | 3834 |
| 831 | Ga0496113_0160888 | 3300048916 | Bacteria | 1775 |
| 832 | Ga0496113_0338231 | 3300048916 | Bacteria | 1207 |
| 833 | Ga0496114_0000933 | 3300048917 | Bacteria | 21868 |
| 834 | Ga0496114_0322788 | 3300048917 | Bacteria | 1364 |
| 835 | Ga0496115_0000032 | 3300048918 | Bacteria | 136928 |
| 836 | Ga0496115_0005442 | 3300048918 | Bacteria | 9261 |
| 837 | Ga0496115_0020292 | 3300048918 | Bacteria | 5125 |
| 838 | Ga0496115_0195007 | 3300048918 | Bacteria | 1673 |
| 839 | Ga0496115_0205476 | 3300048918 | Bacteria | 1627 |
| 840 | Ga0496116_0003550 | 3300048919 | Bacteria | 15344 |
| 841 | Ga0496116_0039310 | 3300048919 | Bacteria | 3273 |
| 842 | Ga0496117_0000140 | 3300048920 | Bacteria | 158390 |
| 843 | Ga0496117_0010288 | 3300048920 | Bacteria | 8556 |
| 844 | Ga0496117_0010696 | 3300048920 | Bacteria | 8302 |
| 845 | Ga0496117_0015129 | 3300048920 | Bacteria | 6603 |
| 846 | Ga0496117_0027762 | 3300048920 | Bacteria | 4399 |
| 847 | Ga0496117_0063260 | 3300048920 | Bacteria | 2530 |
| 848 | Ga0496118_0000102 | 3300048921 | Bacteria | 158228 |
| 849 | Ga0496118_0000880 | 3300048921 | Bacteria | 47321 |
| 850 | Ga0496118_0000955 | 3300048921 | Bacteria | 45248 |
| 851 | Ga0496118_0001297 | 3300048921 | Bacteria | 38064 |
| 852 | Ga0496118_0001780 | 3300048921 | Bacteria | 31106 |
| 853 | Ga0496118_0012943 | 3300048921 | Bacteria | 7943 |
| 854 | Ga0496118_0014401 | 3300048921 | Bacteria | 7406 |
| 855 | Ga0496118_0031489 | 3300048921 | Bacteria | 4395 |
| 856 | Ga0496119_0000131 | 3300048922 | Bacteria | 105813 |
| 857 | Ga0496119_0001546 | 3300048922 | Bacteria | 27486 |
| 858 | Ga0496119_0004641 | 3300048922 | Bacteria | 13558 |
| 859 | Ga0496119_0016319 | 3300048922 | Bacteria | 5659 |
| 860 | Ga0496120_0001431 | 3300048923 | Bacteria | 28786 |
| 861 | Ga0496120_0008466 | 3300048923 | Bacteria | 7464 |
| 862 | Ga0496120_0013980 | 3300048923 | Bacteria | 5371 |
| 863 | Ga0496120_0014910 | 3300048923 | Bacteria | 5152 |
| 864 | Ga0496121_0003311 | 3300048924 | Bacteria | 23135 |
| 865 | Ga0496121_0011146 | 3300048924 | Bacteria | 10024 |
| 866 | Ga0496121_0011290 | 3300048924 | Bacteria | 9948 |
| 867 | Ga0496121_0029198 | 3300048924 | Bacteria | 5109 |
| 868 | Ga0496121_0032860 | 3300048924 | Bacteria | 4707 |
| 869 | Ga0496121_0054691 | 3300048924 | Bacteria | 3333 |
| 870 | Ga0496121_0058645 | 3300048924 | Bacteria | 3180 |
| 871 | Ga0496121_0152730 | 3300048924 | Bacteria | 1697 |
| 872 | Ga0496122_0000560 | 3300048925 | Bacteria | 76145 |
| 873 | Ga0496122_0001084 | 3300048925 | Bacteria | 47272 |
| 874 | Ga0496122_0019108 | 3300048925 | Bacteria | 6282 |
| 875 | Ga0496122_0024697 | 3300048925 | Bacteria | 5250 |
| 876 | Ga0496123_0000647 | 3300048926 | Bacteria | 58089 |
| 877 | Ga0496123_0001603 | 3300048926 | Bacteria | 30651 |
| 878 | Ga0496123_0008306 | 3300048926 | Bacteria | 9557 |
| 879 | Ga0496123_0095356 | 3300048926 | Bacteria | 1750 |
| 880 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 881 | Ga0496124_0001249 | 3300048927 | Bacteria | 39002 |
| 882 | Ga0496124_0015214 | 3300048927 | Bacteria | 7385 |
| 883 | Ga0496124_0025530 | 3300048927 | Bacteria | 5350 |
| 884 | Ga0496124_0079522 | 3300048927 | Bacteria | 2699 |
| 885 | Ga0496125_0000338 | 3300048928 | Bacteria | 89749 |
| 886 | Ga0496125_0000813 | 3300048928 | Bacteria | 50736 |
| 887 | Ga0496125_0074511 | 3300048928 | Unclassified | 2631 |
| 888 | Ga0496125_0119145 | 3300048928 | Unclassified | 1888 |
| 889 | Ga0496126_0000925 | 3300048929 | Bacteria | 50764 |
| 890 | Ga0496126_0033341 | 3300048929 | Bacteria | 4845 |
| 891 | Ga0496126_0075605 | 3300048929 | Bacteria | 2989 |
| 892 | Ga0496126_0093327 | 3300048929 | Bacteria | 2643 |
| 893 | Ga0496126_0101027 | 3300048929 | Bacteria | 2523 |
| 894 | Ga0496126_0204570 | 3300048929 | Bacteria | 1665 |
| 895 | Ga0496126_0237999 | 3300048929 | Unclassified | 1522 |
| 896 | Ga0496126_0289276 | 3300048929 | Unclassified | 1355 |
| 897 | Ga0496126_0454901 | 3300048929 | Bacteria | 1030 |
| 898 | Ga0501031_0092333 | 3300049568 | Bacteria | 1975 |
| 899 | Ga0501032_0024280 | 3300049569 | Bacteria | 4187 |
| 900 | Ga0501032_0124634 | 3300049569 | Bacteria | 1702 |
| 901 | Ga0501032_0229841 | 3300049569 | Bacteria | 1206 |
| 902 | Ga0501033_0014100 | 3300049570 | Bacteria | 6077 |
| 903 | Ga0501033_0033971 | 3300049570 | Bacteria | 3827 |
| 904 | Ga0501033_0166299 | 3300049570 | Bacteria | 1585 |
| 905 | Ga0501033_0338496 | 3300049570 | Bacteria | 1055 |
| 906 | Ga0501034_0001783 | 3300049571 | Bacteria | 27492 |
| 907 | Ga0501034_0002029 | 3300049571 | Bacteria | 25488 |
| 908 | Ga0501034_0019163 | 3300049571 | Bacteria | 7005 |
| 909 | Ga0501034_0134835 | 3300049571 | Bacteria | 2450 |
| 910 | Ga0501034_0158367 | 3300049571 | Bacteria | 2237 |
| 911 | Ga0501034_0360241 | 3300049571 | Bacteria | 1382 |
| 912 | Ga0501034_0363297 | 3300049571 | Bacteria | 1374 |
| 913 | Ga0501034_0479543 | 3300049571 | Bacteria | 1159 |
| 914 | Ga0501036_0015065 | 3300049572 | Bacteria | 6453 |
| 915 | Ga0501036_0151227 | 3300049572 | Bacteria | 1958 |
| 916 | Ga0501037_0023125 | 3300049573 | Bacteria | 4597 |
| 917 | Ga0501037_0029500 | 3300049573 | Bacteria | 4053 |
| 918 | Ga0501037_0047342 | 3300049573 | Bacteria | 3151 |
| 919 | Ga0501038_0052046 | 3300049574 | Bacteria | 3531 |
| 920 | Ga0501038_0084957 | 3300049574 | Bacteria | 2662 |
| 921 | Ga0501038_0094416 | 3300049574 | Bacteria | 2500 |
| 922 | Ga0501038_0105071 | 3300049574 | Bacteria | 2346 |
| 923 | Ga0501038_0169538 | 3300049574 | Bacteria | 1768 |
| 924 | Ga0501038_0235756 | 3300049574 | Bacteria | 1454 |
| 925 | Ga0501039_0009425 | 3300049575 | Bacteria | 7442 |
| 926 | Ga0501040_0023303 | 3300049576 | Bacteria | 4151 |
| 927 | Ga0501041_0034229 | 3300049577 | Bacteria | 3075 |
| 928 | Ga0501041_0285374 | 3300049577 | Bacteria | 1039 |
| 929 | Ga0501042_0029618 | 3300049578 | Bacteria | 3861 |
| 930 | Ga0501043_0000496 | 3300049579 | Bacteria | 35374 |
| 931 | Ga0501043_0029223 | 3300049579 | Bacteria | 4329 |
| 932 | Ga0501043_0050226 | 3300049579 | Bacteria | 3278 |
| 933 | Ga0501043_0067859 | 3300049579 | Bacteria | 2800 |
| 934 | Ga0501043_0101501 | 3300049579 | Bacteria | 2261 |
| 935 | Ga0501043_0255835 | 3300049579 | Bacteria | 1348 |
| 936 | Ga0501046_0062128 | 3300049580 | Bacteria | 2919 |
| 937 | Ga0501047_0001140 | 3300049581 | Bacteria | 26350 |
| 938 | Ga0501047_0007292 | 3300049581 | Bacteria | 10394 |
| 939 | Ga0501047_0023799 | 3300049581 | Bacteria | 5880 |
| 940 | Ga0501047_0059351 | 3300049581 | Bacteria | 3693 |
| 941 | Ga0501047_0133726 | 3300049581 | Bacteria | 2360 |
| 942 | Ga0501047_0148832 | 3300049581 | Bacteria | 2217 |
| 943 | Ga0501047_0257612 | 3300049581 | Bacteria | 1592 |
| 944 | Ga0501047_0450570 | 3300049581 | Bacteria | 1116 |
| 945 | Ga0501048_0016783 | 3300049582 | Bacteria | 5397 |
| 946 | Ga0501048_0132080 | 3300049582 | Bacteria | 1765 |
| 947 | Ga0501048_0139155 | 3300049582 | Bacteria | 1716 |
| 948 | Ga0501048_0215406 | 3300049582 | Bacteria | 1362 |
| 949 | Ga0501067_0052188 | 3300049583 | Bacteria | 2265 |
| 950 | Ga0501068_0006207 | 3300049584 | Bacteria | 6573 |
| 951 | Ga0501068_0034604 | 3300049584 | Bacteria | 3012 |
| 952 | Ga0501068_0187634 | 3300049584 | Bacteria | 1309 |
| 953 | Ga0501068_0275921 | 3300049584 | Bacteria | 1074 |
| 954 | Ga0501069_0001130 | 3300049585 | Bacteria | 12879 |
| 955 | Ga0501069_0002195 | 3300049585 | Bacteria | 9822 |
| 956 | Ga0501069_0012617 | 3300049585 | Bacteria | 4494 |
| 957 | Ga0501069_0024698 | 3300049585 | Bacteria | 3279 |
| 958 | Ga0501070_0000311 | 3300049586 | Bacteria | 44330 |
| 959 | Ga0501070_0002127 | 3300049586 | Bacteria | 17382 |
| 960 | Ga0501070_0002625 | 3300049586 | Bacteria | 15701 |
| 961 | Ga0501070_0014841 | 3300049586 | Bacteria | 6554 |
| 962 | Ga0501070_0022398 | 3300049586 | Bacteria | 5292 |
| 963 | Ga0501070_0031449 | 3300049586 | Bacteria | 4447 |
| 964 | Ga0501070_0034110 | 3300049586 | Bacteria | 4257 |
| 965 | Ga0501070_0059879 | 3300049586 | Bacteria | 3156 |
| 966 | Ga0501070_0090362 | 3300049586 | Bacteria | 2534 |
| 967 | Ga0501070_0188158 | 3300049586 | Bacteria | 1697 |
| 968 | Ga0501070_0201633 | 3300049586 | Bacteria | 1634 |
| 969 | Ga0501070_0345081 | 3300049586 | Bacteria | 1209 |
| 970 | Ga0501071_0003538 | 3300049587 | Bacteria | 9773 |
| 971 | Ga0501071_0009446 | 3300049587 | Bacteria | 6496 |
| 972 | Ga0501072_0044654 | 3300049588 | Bacteria | 3484 |
| 973 | Ga0501072_0051742 | 3300049588 | Bacteria | 3234 |
| 974 | Ga0501073_0006399 | 3300049589 | Bacteria | 8768 |
| 975 | Ga0501073_0013127 | 3300049589 | Bacteria | 6039 |
| 976 | Ga0501074_0037381 | 3300049590 | Bacteria | 3519 |
| 977 | Ga0501074_0078440 | 3300049590 | Bacteria | 2370 |
| 978 | Ga0501074_0204688 | 3300049590 | Bacteria | 1406 |
| 979 | Ga0501075_0038876 | 3300049591 | Bacteria | 3558 |
| 980 | Ga0501076_0113941 | 3300049592 | Bacteria | 2188 |
| 981 | Ga0501076_0479841 | 3300049592 | Bacteria | 1024 |
| 982 | Ga0501077_0050341 | 3300049593 | Bacteria | 2648 |
| 983 | Ga0501077_0143043 | 3300049593 | Bacteria | 1517 |
| 984 | Ga0501202_005533 | 3300049652 | Bacteria | 2239 |
| 985 | Ga0501252_001883 | 3300049682 | Bacteria | 2018 |
| 986 | Ga0501225_0036472 | 3300049705 | Bacteria | 1355 |
| 987 | Ga0501079_0101847 | 3300049741 | Bacteria | 2227 |
| 988 | Ga0501079_0251125 | 3300049741 | Bacteria | 1382 |
| 989 | Ga0501080_0002966 | 3300049742 | Bacteria | 14930 |
| 990 | Ga0501080_0011069 | 3300049742 | Bacteria | 8255 |
| 991 | Ga0501080_0023665 | 3300049742 | Bacteria | 5690 |
| 992 | Ga0501080_0040846 | 3300049742 | Bacteria | 4325 |
| 993 | Ga0501080_0088000 | 3300049742 | Bacteria | 2885 |
| 994 | Ga0501080_0119484 | 3300049742 | Bacteria | 2443 |
| 995 | Ga0501080_0146971 | 3300049742 | Bacteria | 2179 |
| 996 | Ga0501080_0152329 | 3300049742 | Bacteria | 2137 |
| 997 | Ga0501080_0215751 | 3300049742 | Bacteria | 1757 |
| 998 | Ga0501081_0018189 | 3300049743 | Bacteria | 4665 |
| 999 | Ga0501081_0026486 | 3300049743 | Bacteria | 3911 |
| 1000 | Ga0501081_0037240 | 3300049743 | Bacteria | 3318 |
| 1001 | Ga0501081_0038763 | 3300049743 | Bacteria | 3258 |
| 1002 | Ga0501081_0175373 | 3300049743 | Bacteria | 1549 |
| 1003 | Ga0501083_0001933 | 3300049744 | Bacteria | 14251 |
| 1004 | Ga0501268_007367 | 3300049765 | Bacteria | 1640 |
| 1005 | Ga0501270_005293 | 3300049767 | Bacteria | 1494 |
| 1006 | Ga0501035_0021058 | 3300049822 | Bacteria | 5994 |
| 1007 | Ga0501035_0058490 | 3300049822 | Bacteria | 3434 |
| 1008 | Ga0501035_0107029 | 3300049822 | Bacteria | 2451 |
| 1009 | Ga0501035_0124980 | 3300049822 | Bacteria | 2246 |
| 1010 | Ga0501035_0187509 | 3300049822 | Bacteria | 1779 |
| 1011 | Ga0501035_0200083 | 3300049822 | Bacteria | 1714 |
| 1012 | Ga0501035_0253760 | 3300049822 | Bacteria | 1493 |
| 1013 | Ga0501035_0426102 | 3300049822 | Bacteria | 1101 |
| 1014 | Ga0501044_0008911 | 3300049823 | Bacteria | 10966 |
| 1015 | Ga0501044_0018635 | 3300049823 | Bacteria | 7434 |
| 1016 | Ga0501044_0032184 | 3300049823 | Bacteria | 5513 |
| 1017 | Ga0501044_0037048 | 3300049823 | Bacteria | 5100 |
| 1018 | Ga0501044_0073236 | 3300049823 | Bacteria | 3482 |
| 1019 | Ga0501044_0081840 | 3300049823 | Bacteria | 3268 |
| 1020 | Ga0501044_0087059 | 3300049823 | Bacteria | 3155 |
| 1021 | Ga0501044_0091349 | 3300049823 | Bacteria | 3071 |
| 1022 | Ga0501044_0098277 | 3300049823 | Bacteria | 2947 |
| 1023 | Ga0501044_0106247 | 3300049823 | Bacteria | 2819 |
| 1024 | Ga0501044_0234806 | 3300049823 | Bacteria | 1780 |
| 1025 | Ga0501045_0050182 | 3300049824 | Bacteria | 3044 |
| 1026 | nmdc:mga08y16_90845_c1 | 3300050511 | Bacteria | 3183 |
| 1027 | nmdc:mga0rr50_189198_c1 | 3300050513 | Unclassified | 1686 |
| 1028 | nmdc:mga0a205_3120_c1 | 3300050515 | Bacteria | 14709 |
| 1029 | Ga0500610_0090838 | 3300053079 | Bacteria | 1586 |
| 1030 | Ga0500643_007517 | 3300053087 | Bacteria | 4378 |
| 1031 | Ga0500583_0034295 | 3300053092 | Unclassified | 2255 |
| 1032 | Ga0500651_0037918 | 3300053093 | Bacteria | 3036 |
| 1033 | Ga0500651_0122514 | 3300053093 | Bacteria | 1577 |
| 1034 | Ga0500641_0000743 | 3300053096 | Bacteria | 11809 |
| 1035 | Ga0500641_0017371 | 3300053096 | Bacteria | 2690 |
| 1036 | Ga0500597_000111 | 3300053120 | Bacteria | 16697 |
| 1037 | Ga0500634_0007244 | 3300053161 | Bacteria | 5448 |
| 1038 | Ga0501084_0039591 | 3300054114 | Bacteria | 3942 |
| 1039 | Ga0501082_0000672 | 3300060353 | Bacteria | 30077 |
| 1040 | Ga0501082_0034095 | 3300060353 | Bacteria | 4391 |
| 1041 | Ga0501082_0176585 | 3300060353 | Bacteria | 1857 |
| 1042 | Ga0466962_0004616 | 3300061719 | Bacteria | 6613 |
| 1043 | Ga0466962_0017050 | 3300061719 | Bacteria | 3499 |
| 1044 | Ga0530510_0034971 | 3300061734 | Bacteria | 3621 |
| 1045 | 2538832381 | 2537561836 | Bacteria | 3910579 |
| 1046 | 2547501526 | 2547132130 | Bacteria | 4660562 |
| 1047 | 2578459056 | 2576861471 | Bacteria | 4648976 |
| 1048 | 2643830399 | 2643221562 | Bacteria | 4048635 |
| 1049 | 2643894138 | 2643221577 | Bacteria | 3710843 |
| 1050 | 2644476341 | 2643221685 | Bacteria | 3673288 |
| 1051 | 2687582302 | 2687453130 | Bacteria | 4227172 |
| 1052 | 2739730554 | 2739367700 | Bacteria | 4747630 |
| 1053 | 2747950075 | 2747842428 | Bacteria | 4689383 |
| 1054 | 2748015964 | 2747842501 | Bacteria | 5293829 |
| 1055 | 2765578328 | 2765235840 | Bacteria | 4663337 |
| 1056 | 2816516346 | 2816332141 | Bacteria | 4436036 |
| 1057 | 2819663667 | 2818991457 | Bacteria | 5323295 |
| 1058 | 2842392943 | 2842391507 | Bacteria | 4486072 |
| 1059 | 2842758719 | 2842757796 | Bacteria | 3981385 |
| 1060 | 2842781217 | 2842780639 | Bacteria | 4337790 |
| 1061 | 2852686362 | 2852684882 | Bacteria | 5463342 |
| 1062 | 2874220948 | 2874220319 | Bacteria | 4594709 |
| 1063 | 2884413281 | 2884411467 | Bacteria | 5246714 |
| 1064 | 2895398848 | 2895395659 | Bacteria | 3983269 |
| 1065 | 2895500868 | 2895498888 | Bacteria | 5283788 |
| 1066 | 2895516263 | 2895511927 | Bacteria | 6802080 |
| 1067 | 2895523819 | 2895522137 | Bacteria | 3284416 |
| 1068 | 2895526599 | 2895525241 | Bacteria | 3388457 |
| 1069 | 2919091157 | 2919089067 | Bacteria | 4560942 |
| 1070 | 2919132479 | 2919130084 | Bacteria | 5301837 |
| 1071 | 2919136808 | 2919134579 | Bacteria | 4480386 |
| 1072 | 2928497790 | 2928496128 | Bacteria | 4631123 |
| 1073 | 2928964381 | 2928963466 | Bacteria | 5165703 |
| 1074 | 2929197053 | 2929195423 | Bacteria | 5325372 |
| 1075 | 2931381407 | 2931380184 | Bacteria | 4455911 |
| 1076 | 2937611769 | 2937610967 | Bacteria | 4618818 |
| 1077 | 2939612405 | 2939611941 | Bacteria | 3892017 |
| 1078 | 2939626687 | 2939622612 | Bacteria | 4698046 |
| 1079 | 2939627708 | 2939626828 | Bacteria | 4695272 |
| 1080 | 2961047713 | 2961047084 | Bacteria | 4594415 |
| 1081 | 2961067054 | 2961064222 | Bacteria | 4749990 |
| 1082 | 2987608272 | 2987605356 | Bacteria | 4187822 |
| 1083 | 8002869479 | 8002869464 | Bacteria | 3588529 |
| 1084 | 8003016477 | 8003014200 | Bacteria | 4059994 |
| 1085 | 8021648551 | 8021648035 | Bacteria | 4772378 |
| 1086 | Ga0207660_10015836 | |||
| 1087 | JGI24741J21665_1000582 | |||
| 1088 | JGI24741J21665_1000998 | |||
| 1089 | JGI24741J21665_1005282 | |||
| 1090 | JGI24740J21852_10006312 | |||
| 1091 | JGI24740J21852_10011109 | |||
| 1092 | JGI24739J22299_10000076 | |||
| 1093 | JGI24737J22298_10000304 | |||
| 1094 | JGI24737J22298_10020632 | |||
| 1095 | JGI24735J21928_10005423 | |||
| 1096 | JGI25156J39149_1006923 | |||
| 1097 | JGI25162J39368_1000260 | |||
| 1098 | JGI25162J39368_1000752 | |||
| 1099 | JGI25162J39368_1000979 | |||
| 1100 | JGI25162J39368_1006678 | |||
| 1101 | JGI25154J39366_1010699 | |||
| 1102 | JGI25157J39369_1000236 | |||
| 1103 | JGI25157J39369_1000364 | |||
| 1104 | JGI25157J39369_1002550 | |||
| 1105 | JGI25157J39369_1004633 | |||
| 1106 | JGI25163J39215_1002102 | |||
| 1107 | JGI25164J39214_1000035 | |||
| 1108 | JGI25164J39214_1000133 | |||
| 1109 | JGI25152J39213_1000018 | |||
| 1110 | JGI25150J39212_1000159 | |||
| 1111 | JGI25151J46595_10000106 | |||
| 1112 | JGI25151J46595_10000111 | |||
| 1113 | JGI25151J46595_10056892 | |||
| 1114 | JGI25165J46597_1000255 | |||
| 1115 | JGI25165J46597_1000397 | |||
| 1116 | JGI25153J46596_10000085 | |||
| 1117 | JGI25153J46596_10013672 | |||
| 1118 | rootH1_10000986 | |||
| 1119 | rootH2_10017930 | |||
| 1120 | rootH1_10094545 | |||
| 1121 | rootH1_10265301 | |||
| 1122 | Ga0055538_1000340 | |||
| 1123 | Ga0055539_1008553 | |||
| 1124 | Ga0055533_1001312 | |||
| 1125 | Ga0055525_1000089 | |||
| 1126 | Ga0055527_1000084 | |||
| 1127 | Ga0055535_1000317 | |||
| 1128 | Ga0055535_1000349 | |||
| 1129 | Ga0055535_1000374 | |||
| 1130 | Ga0055535_1000579 | |||
| 1131 | Ga0055535_1001574 | |||
| 1132 | Ga0055542_1000082 | |||
| 1133 | Ga0055542_1000195 | |||
| 1134 | Ga0055542_1000327 | |||
| 1135 | Ga0055542_1000375 | |||
| 1136 | Ga0055542_1000600 | |||
| 1137 | Ga0055529_1000228 | |||
| 1138 | Ga0055529_1000254 | |||
| 1139 | Ga0055529_1000507 | |||
| 1140 | Ga0055529_1000613 | |||
| 1141 | Ga0055529_1001360 | |||
| 1142 | Ga0055526_1000011 | |||
| 1143 | Ga0055526_1008071 | |||
| 1144 | Ga0055537_1000007 | |||
| 1145 | Ga0055524_1000034 | |||
| 1146 | Ga0055524_1025274 | |||
| 1147 | Ga0055536_1000574 | |||
| 1148 | Ga0055536_1003563 | |||
| 1149 | Ga0055536_1012015 | |||
| 1150 | Ga0055536_1017437 | |||
| 1151 | Ga0055534_1000013 | |||
| 1152 | Ga0055528_1000005 | |||
| 1153 | Ga0055530_10002885 | |||
| 1154 | Ga0055531_10004761 | |||
| 1155 | Ga0055531_10006099 | |||
| 1156 | Ga0055531_10026539 | |||
| 1157 | Ga0058692_1000002 | |||
| 1158 | Ga0058692_1000020 | |||
| 1159 | Ga0065165_1004080 | |||
| 1160 | Ga0065704_10104057 | |||
| 1161 | Ga0065715_10155065 | |||
| 1162 | Ga0070658_10001143 | |||
| 1163 | Ga0070658_10043237 | |||
| 1164 | Ga0070658_10112166 | |||
| 1165 | Ga0070658_10118006 | |||
| 1166 | Ga0070683_100023206 | |||
| 1167 | Ga0070683_100393267 | |||
| 1168 | Ga0070670_100021191 | |||
| 1169 | Ga0070670_100110745 | |||
| 1170 | Ga0070670_100116209 | |||
| 1171 | Ga0068869_100072047 | |||
| 1172 | Ga0070666_10000058 | |||
| 1173 | Ga0070666_10000645 | |||
| 1174 | Ga0070666_10008427 | |||
| 1175 | Ga0070666_10065608 | |||
| 1176 | Ga0070680_100048875 | |||
| 1177 | Ga0070680_100079588 | |||
| 1178 | Ga0070680_100089873 | |||
| 1179 | Ga0070680_100404582 | |||
| 1180 | Ga0070682_100015190 | |||
| 1181 | Ga0070682_100040396 | |||
| 1182 | Ga0068868_100075510 | |||
| 1183 | Ga0070660_100101733 | |||
| 1184 | Ga0070660_100165217 | |||
| 1185 | Ga0070689_100004531 | |||
| 1186 | Ga0070691_10000346 | |||
| 1187 | Ga0070691_10037455 | |||
| 1188 | Ga0070661_100050296 | |||
| 1189 | Ga0070661_100092709 | |||
| 1190 | Ga0070661_100194031 | |||
| 1191 | Ga0070692_10011513 | |||
| 1192 | Ga0070692_10028849 | |||
| 1193 | Ga0070692_10034803 | |||
| 1194 | Ga0070668_100062063 | |||
| 1195 | Ga0070669_100105474 | |||
| 1196 | Ga0070675_100015466 | |||
| 1197 | Ga0070671_100006750 | |||
| 1198 | Ga0070671_100030620 | |||
| 1199 | Ga0070671_100160182 | |||
| 1200 | Ga0070673_100185622 | |||
| 1201 | Ga0070688_100096994 | |||
| 1202 | Ga0070688_100336701 | |||
| 1203 | Ga0070659_100007680 | |||
| 1204 | Ga0070659_100017729 | |||
| 1205 | Ga0070667_100000108 | |||
| 1206 | Ga0070667_100009016 | |||
| 1207 | Ga0070667_100016038 | |||
| 1208 | Ga0070667_100027922 | |||
| 1209 | Ga0070709_10000036 | |||
| 1210 | Ga0070714_100000325 | |||
| 1211 | Ga0070714_100000671 | |||
| 1212 | Ga0070710_10134963 | |||
| 1213 | Ga0070701_10085606 | |||
| 1214 | Ga0070711_100175012 | |||
| 1215 | Ga0070694_100019707 | |||
| 1216 | Ga0070663_100004271 | |||
| 1217 | Ga0070663_100009276 | |||
| 1218 | Ga0070663_100015624 | |||
| 1219 | Ga0070663_100034811 | |||
| 1220 | Ga0070663_100128550 | |||
| 1221 | Ga0070663_100265697 | |||
| 1222 | Ga0070662_100029363 | |||
| 1223 | Ga0070662_100057601 | |||
| 1224 | Ga0070681_10000500 | |||
| 1225 | Ga0070681_10000944 | |||
| 1226 | Ga0070681_10009676 | |||
| 1227 | Ga0070681_10031335 | |||
| 1228 | Ga0070681_10073083 | |||
| 1229 | Ga0070681_10081516 | |||
| 1230 | Ga0070681_10280926 | |||
| 1231 | Ga0070685_10013087 | |||
| 1232 | Ga0070685_10021517 | |||
| 1233 | Ga0070698_100010813 | |||
| 1234 | Ga0070699_100128344 | |||
| 1235 | Ga0070679_100001195 | |||
| 1236 | Ga0070679_100025730 | |||
| 1237 | Ga0070679_100072387 | |||
| 1238 | Ga0070679_100073914 | |||
| 1239 | Ga0070679_100238081 | |||
| 1240 | Ga0070684_100309740 | |||
| 1241 | Ga0068853_100001578 | |||
| 1242 | Ga0068853_100005018 | |||
| 1243 | Ga0068853_100008085 | |||
| 1244 | Ga0068853_100011045 | |||
| 1245 | Ga0068853_100016267 | |||
| 1246 | Ga0068853_100068959 | |||
| 1247 | Ga0068853_100082454 | |||
| 1248 | Ga0068853_100110422 | |||
| 1249 | Ga0068853_100183866 | |||
| 1250 | Ga0068853_100363436 | |||
| 1251 | Ga0068853_100618446 | |||
| 1252 | Ga0070696_100037311 | |||
| 1253 | Ga0070696_100103901 | |||
| 1254 | Ga0070696_100454096 | |||
| 1255 | Ga0070693_100096686 | |||
| 1256 | Ga0070693_100250112 | |||
| 1257 | Ga0070665_100000057 | |||
| 1258 | Ga0070665_100000715 | |||
| 1259 | Ga0070665_100002937 | |||
| 1260 | Ga0070665_100021486 | |||
| 1261 | Ga0070665_100068712 | |||
| 1262 | Ga0070665_100230042 | |||
| 1263 | Ga0070665_100235983 | |||
| 1264 | Ga0070665_100271579 | |||
| 1265 | Ga0070665_100313763 | |||
| 1266 | Ga0070665_100524923 | |||
| 1267 | Ga0070704_100106240 | |||
| 1268 | Ga0068855_100001307 | |||
| 1269 | Ga0068855_100004050 | |||
| 1270 | Ga0068855_100037140 | |||
| 1271 | Ga0068855_100043353 | |||
| 1272 | Ga0068855_100078773 | |||
| 1273 | Ga0068855_100248155 | |||
| 1274 | Ga0068855_100330214 | |||
| 1275 | Ga0068855_100354255 | |||
| 1276 | Ga0068855_100393414 | |||
| 1277 | Ga0070664_100166958 | |||
| 1278 | Ga0068857_100000300 | |||
| 1279 | Ga0068857_100037641 | |||
| 1280 | Ga0068857_100063147 | |||
| 1281 | Ga0068857_100472084 | |||
| 1282 | Ga0068854_100000343 | |||
| 1283 | Ga0068854_100002114 | |||
| 1284 | Ga0068854_100004724 | |||
| 1285 | Ga0068854_100042054 | |||
| 1286 | Ga0068854_100091855 | |||
| 1287 | Ga0068854_100141759 | |||
| 1288 | Ga0068854_100218564 | |||
| 1289 | Ga0068856_100000116 | |||
| 1290 | Ga0068856_100084443 | |||
| 1291 | Ga0068856_100111094 | |||
| 1292 | Ga0068856_100187473 | |||
| 1293 | Ga0068852_100004275 | |||
| 1294 | Ga0068852_100008693 | |||
| 1295 | Ga0068852_100010857 | |||
| 1296 | Ga0068852_100124333 | |||
| 1297 | Ga0068859_100000351 | |||
| 1298 | Ga0068859_100015319 | |||
| 1299 | Ga0068859_100225471 | |||
| 1300 | Ga0068864_100090044 | |||
| 1301 | Ga0068864_100140516 | |||
| 1302 | Ga0068861_100316989 | |||
| 1303 | Ga0068851_10004625 | |||
| 1304 | Ga0068851_10009946 | |||
| 1305 | Ga0068851_10062656 | |||
| 1306 | Ga0068863_100006425 | |||
| 1307 | Ga0068863_100014475 | |||
| 1308 | Ga0068863_100020112 | |||
| 1309 | Ga0068863_100379835 | |||
| 1310 | Ga0068858_100006259 | |||
| 1311 | Ga0068858_100006693 | |||
| 1312 | Ga0068858_100006944 | |||
| 1313 | Ga0068858_100436838 | |||
| 1314 | Ga0068860_100045552 | |||
| 1315 | Ga0068860_100203927 | |||
| 1316 | Ga0068860_100248002 | |||
| 1317 | Ga0068860_100736321 | |||
| 1318 | Ga0068862_100195260 | |||
| 1319 | Ga0081455_10000039 | |||
| 1320 | Ga0075364_10102798 | |||
| 1321 | Ga0075364_10120923 | |||
| 1322 | Ga0070716_100004881 | |||
| 1323 | Ga0075369_10028360 | |||
| 1324 | Ga0097621_100055267 | |||
| 1325 | Ga0097621_100181344 | |||
| 1326 | Ga0068871_100267943 | |||
| 1327 | Ga0075428_100569576 | |||
| 1328 | Ga0075431_100060414 | |||
| 1329 | Ga0075433_10001939 | |||
| 1330 | Ga0075433_10290073 | |||
| 1331 | Ga0068865_100047107 | |||
| 1332 | Ga0068865_100068084 | |||
| 1333 | Ga0097620_100000351 | |||
| 1334 | Ga0097620_100015319 | |||
| 1335 | Ga0097620_100225471 | |||
| 1336 | Ga0105244_10051498 | |||
| 1337 | Ga0105250_10038121 | |||
| 1338 | Ga0105240_10000315 | |||
| 1339 | Ga0105240_10007869 | |||
| 1340 | Ga0105240_10009439 | |||
| 1341 | Ga0105240_10012686 | |||
| 1342 | Ga0105240_10015093 | |||
| 1343 | Ga0105240_10051502 | |||
| 1344 | Ga0105240_10060620 | |||
| 1345 | Ga0105240_10098547 | |||
| 1346 | Ga0105240_10167205 | |||
| 1347 | Ga0105240_10226538 | |||
| 1348 | Ga0105240_10263224 | |||
| 1349 | Ga0105240_10550138 | |||
| 1350 | Ga0111539_10044756 | |||
| 1351 | Ga0111539_10424364 | |||
| 1352 | Ga0105247_10000975 | |||
| 1353 | Ga0105247_10014302 | |||
| 1354 | Ga0114129_10138582 | |||
| 1355 | Ga0114129_10262478 | |||
| 1356 | Ga0105243_10033621 | |||
| 1357 | Ga0105241_10004652 | |||
| 1358 | Ga0105241_10013451 | |||
| 1359 | Ga0105241_10165241 | |||
| 1360 | Ga0105241_10414866 | |||
| 1361 | Ga0105242_10128547 | |||
| 1362 | Ga0105248_10001678 | |||
| 1363 | Ga0105248_10047487 | |||
| 1364 | Ga0105248_10203594 | |||
| 1365 | Ga0105248_10217562 | |||
| 1366 | Ga0105248_10225150 | |||
| 1367 | Ga0105248_10240948 | |||
| 1368 | Ga0105237_10000063 | |||
| 1369 | Ga0105237_10000105 | |||
| 1370 | Ga0105237_10003289 | |||
| 1371 | Ga0105237_10007234 | |||
| 1372 | Ga0105237_10008174 | |||
| 1373 | Ga0105237_10052875 | |||
| 1374 | Ga0105237_10172728 | |||
| 1375 | Ga0105237_10295994 | |||
| 1376 | Ga0105237_10665916 | |||
| 1377 | Ga0105238_10000270 | |||
| 1378 | Ga0105238_10000290 | |||
| 1379 | Ga0105238_10004841 | |||
| 1380 | Ga0105238_10020657 | |||
| 1381 | Ga0105238_10074121 | |||
| 1382 | Ga0105238_10204191 | |||
| 1383 | Ga0105238_10459728 | |||
| 1384 | Ga0105238_10464757 | |||
| 1385 | Ga0105238_10517491 | |||
| 1386 | Ga0105249_10002422 | |||
| 1387 | Ga0105249_10006721 | |||
| 1388 | Ga0105249_10014184 | |||
| 1389 | Ga0105249_10020841 | |||
| 1390 | Ga0105249_10087409 | |||
| 1391 | Ga0105029_103430 | |||
| 1392 | Ga0105030_101208 | |||
| 1393 | Ga0105239_10000043 | |||
| 1394 | Ga0105239_10006032 | |||
| 1395 | Ga0105239_10019878 | |||
| 1396 | Ga0105239_10026229 | |||
| 1397 | Ga0105239_10142571 | |||
| 1398 | Ga0105239_10161584 | |||
| 1399 | Ga0105239_10215793 | |||
| 1400 | Ga0105239_10297253 | |||
| 1401 | Ga0105246_10064508 | |||
| 1402 | Ga0157373_10004602 | |||
| 1403 | Ga0157373_10007629 | |||
| 1404 | Ga0157373_10057113 | |||
| 1405 | Ga0157373_10080857 | |||
| 1406 | Ga0157373_10291515 | |||
| 1407 | Ga0157371_10003532 | |||
| 1408 | Ga0157371_10008518 | |||
| 1409 | Ga0157371_10010934 | |||
| 1410 | Ga0157371_10021786 | |||
| 1411 | Ga0157371_10032772 | |||
| 1412 | Ga0157371_10085550 | |||
| 1413 | Ga0157370_10001634 | |||
| 1414 | Ga0157370_10007704 | |||
| 1415 | Ga0157370_10009139 | |||
| 1416 | Ga0157370_10082212 | |||
| 1417 | Ga0157370_10145538 | |||
| 1418 | Ga0157370_10208301 | |||
| 1419 | Ga0157370_10304008 | |||
| 1420 | Ga0157369_10050010 | |||
| 1421 | Ga0157369_10063808 | |||
| 1422 | Ga0157369_10093815 | |||
| 1423 | Ga0157369_10105890 | |||
| 1424 | Ga0157369_10140278 | |||
| 1425 | Ga0157369_10283292 | |||
| 1426 | Ga0157374_10111331 | |||
| 1427 | Ga0157374_10150041 | |||
| 1428 | Ga0163162_10013992 | |||
| 1429 | Ga0163162_10056831 | |||
| 1430 | Ga0157372_10003149 | |||
| 1431 | Ga0157372_10007198 | |||
| 1432 | Ga0157372_10007498 | |||
| 1433 | Ga0157372_10042687 | |||
| 1434 | Ga0157372_10074444 | |||
| 1435 | Ga0157372_10104344 | |||
| 1436 | Ga0157372_10123380 | |||
| 1437 | Ga0157372_10208720 | |||
| 1438 | Ga0157372_10271820 | |||
| 1439 | Ga0157372_10295703 | |||
| 1440 | Ga0157372_10745377 | |||
| 1441 | Ga0157380_10030483 | |||
| 1442 | Ga0157380_10083091 | |||
| 1443 | Ga0157380_10754189 | |||
| 1444 | Ga0182008_10000371 | |||
| 1445 | Ga0157377_10058154 | |||
| 1446 | Ga0157379_10073278 | |||
| 1447 | Ga0157379_10266631 | |||
| 1448 | Ga0157376_10096560 | |||
| 1449 | Ga0157376_10139856 | |||
| 1450 | Ga0157376_10237463 | |||
| 1451 | Ga0183368_1004 | |||
| 1452 | Ga0183360_10001 | |||
| 1453 | Ga0163161_10069854 | |||
| 1454 | Ga0197907_10957944 | |||
| 1455 | Ga0206356_11098649 | |||
| 1456 | Ga0206356_11322499 | |||
| 1457 | Ga0206351_10917985 | |||
| 1458 | Ga0206354_11670857 | |||
| 1459 | Ga0206353_10228217 | |||
| 1460 | Ga0206353_11044475 | |||
| 1461 | Ga0209435_101367 | |||
| 1462 | Ga0209760_100727 | |||
| 1463 | Ga0209784_100133 | |||
| 1464 | Ga0209566_102250 | |||
| 1465 | Ga0209674_100148 | |||
| 1466 | Ga0209674_100269 | |||
| 1467 | Ga0209672_100007 | |||
| 1468 | Ga0209672_100029 | |||
| 1469 | Ga0209672_100058 | |||
| 1470 | Ga0209672_100434 | |||
| 1471 | Ga0209672_100841 | |||
| 1472 | Ga0209563_100051 | |||
| 1473 | Ga0207427_100013 | |||
| 1474 | Ga0207427_100033 | |||
| 1475 | Ga0207427_101041 | |||
| 1476 | Ga0209437_100015 | |||
| 1477 | Ga0209437_100106 | |||
| 1478 | Ga0209437_100352 | |||
| 1479 | Ga0209258_100046 | |||
| 1480 | Ga0209258_100053 | |||
| 1481 | Ga0209258_100164 | |||
| 1482 | Ga0209258_100413 | |||
| 1483 | Ga0209258_100444 | |||
| 1484 | Ga0209258_100991 | |||
| 1485 | Ga0209258_101490 | |||
| 1486 | Ga0207425_1000028 | |||
| 1487 | Ga0207425_1002659 | |||
| 1488 | Ga0209646_1001493 | |||
| 1489 | Ga0209646_1004243 | |||
| 1490 | Ga0209646_1009044 | |||
| 1491 | Ga0209026_1000074 | |||
| 1492 | Ga0209026_1000092 | |||
| 1493 | Ga0209026_1000111 | |||
| 1494 | Ga0209026_1001965 | |||
| 1495 | Ga0209677_103982 | |||
| 1496 | Ga0209148_1000002 | |||
| 1497 | Ga0209148_1000009 | |||
| 1498 | Ga0209148_1000010 | |||
| 1499 | Ga0209148_1000039 | |||
| 1500 | Ga0209148_1000087 | |||
| 1501 | Ga0209148_1000098 | |||
| 1502 | Ga0209759_1000110 | |||
| 1503 | Ga0209759_1000278 | |||
| 1504 | Ga0209759_1000353 | |||
| 1505 | Ga0209759_1003639 | |||
| 1506 | Ga0209759_1004660 | |||
| 1507 | Ga0209759_1008783 | |||
| 1508 | Ga0209129_1000065 | |||
| 1509 | Ga0209233_1000009 | |||
| 1510 | Ga0209233_1000080 | |||
| 1511 | Ga0209233_1004727 | |||
| 1512 | Ga0209233_1010689 | |||
| 1513 | Ga0209565_1000005 | |||
| 1514 | Ga0209455_1000010 | |||
| 1515 | Ga0209455_1000034 | |||
| 1516 | Ga0209455_1000060 | |||
| 1517 | Ga0209455_1000120 | |||
| 1518 | Ga0209455_1000211 | |||
| 1519 | Ga0209673_1000011 | |||
| 1520 | Ga0209130_1006918 | |||
| 1521 | Ga0209675_1000004 | |||
| 1522 | Ga0209675_1028589 | |||
| 1523 | Ga0209676_1000047 | |||
| 1524 | Ga0209676_1001228 | |||
| 1525 | Ga0209676_1003790 | |||
| 1526 | Ga0209676_1046886 | |||
| 1527 | Ga0209025_1000002 | |||
| 1528 | Ga0209025_1000036 | |||
| 1529 | Ga0209025_1001523 | |||
| 1530 | Ga0209025_1002530 | |||
| 1531 | Ga0209025_1074280 | |||
| 1532 | Ga0209564_1000018 | |||
| 1533 | Ga0209564_1010242 | |||
| 1534 | Ga0209758_1000003 | |||
| 1535 | Ga0209758_1001152 | |||
| 1536 | Ga0209758_1007625 | |||
| 1537 | Ga0209758_1019267 | |||
| 1538 | Ga0209050_1002237 | |||
| 1539 | Ga0209050_1029950 | |||
| 1540 | Ga0209256_1000021 | |||
| 1541 | Ga0209256_1000539 | |||
| 1542 | Ga0209256_1002619 | |||
| 1543 | Ga0209256_1002635 | |||
| 1544 | Ga0209256_1004402 | |||
| 1545 | Ga0209257_1000133 | |||
| 1546 | Ga0209257_1000362 | |||
| 1547 | Ga0209257_1002869 | |||
| 1548 | Ga0209257_1004114 | |||
| 1549 | Ga0209257_1005108 | |||
| 1550 | Ga0207656_10001165 | |||
| 1551 | Ga0207655_1022286 | |||
| 1552 | Ga0207710_10000934 | |||
| 1553 | Ga0207710_10022209 | |||
| 1554 | Ga0207680_10000006 | |||
| 1555 | Ga0207680_10028853 | |||
| 1556 | Ga0207680_10063513 | |||
| 1557 | Ga0207647_10000504 | |||
| 1558 | Ga0207647_10000677 | |||
| 1559 | Ga0207647_10001610 | |||
| 1560 | Ga0207647_10004217 | |||
| 1561 | Ga0207647_10009312 | |||
| 1562 | Ga0207647_10034794 | |||
| 1563 | Ga0207699_10000222 | |||
| 1564 | Ga0207645_10105586 | |||
| 1565 | Ga0207705_10001829 | |||
| 1566 | Ga0207705_10002514 | |||
| 1567 | Ga0207705_10004714 | |||
| 1568 | Ga0207705_10004985 | |||
| 1569 | Ga0207705_10106810 | |||
| 1570 | Ga0207707_10000578 | |||
| 1571 | Ga0207707_10001419 | |||
| 1572 | Ga0207707_10001729 | |||
| 1573 | Ga0207707_10003100 | |||
| 1574 | Ga0207707_10006039 | |||
| 1575 | Ga0207707_10030276 | |||
| 1576 | Ga0207707_10032224 | |||
| 1577 | Ga0207707_10090685 | |||
| 1578 | Ga0207707_10112131 | |||
| 1579 | Ga0207695_10000033 | |||
| 1580 | Ga0207695_10001058 | |||
| 1581 | Ga0207695_10001605 | |||
| 1582 | Ga0207695_10002167 | |||
| 1583 | Ga0207695_10004738 | |||
| 1584 | Ga0207695_10007278 | |||
| 1585 | Ga0207695_10013378 | |||
| 1586 | Ga0207695_10016800 | |||
| 1587 | Ga0207695_10016841 | |||
| 1588 | Ga0207695_10020794 | |||
| 1589 | Ga0207695_10032853 | |||
| 1590 | Ga0207695_10037705 | |||
| 1591 | Ga0207695_10049935 | |||
| 1592 | Ga0207695_10110706 | |||
| 1593 | Ga0207695_10166538 | |||
| 1594 | Ga0207695_10187385 | |||
| 1595 | Ga0207695_10245362 | |||
| 1596 | Ga0207695_10462887 | |||
| 1597 | Ga0207671_10000021 | |||
| 1598 | Ga0207671_10000292 | |||
| 1599 | Ga0207671_10004135 | |||
| 1600 | Ga0207671_10032312 | |||
| 1601 | Ga0207671_10036274 | |||
| 1602 | Ga0207671_10065929 | |||
| 1603 | Ga0207671_10198885 | |||
| 1604 | Ga0207671_10303947 | |||
| 1605 | Ga0207663_10155888 | |||
| 1606 | Ga0207660_10007012 | |||
| 1607 | Ga0207660_10018231 | |||
| 1608 | Ga0207660_10059800 | |||
| 1609 | Ga0207660_10062281 | |||
| 1610 | Ga0207660_10070120 | |||
| 1611 | Ga0207660_10072900 | |||
| 1612 | Ga0207657_10008479 | |||
| 1613 | Ga0207657_10018265 | |||
| 1614 | Ga0207649_10026175 | |||
| 1615 | Ga0207649_10032086 | |||
| 1616 | Ga0207649_10148275 | |||
| 1617 | Ga0207652_10000022 | |||
| 1618 | Ga0207652_10000390 | |||
| 1619 | Ga0207652_10003362 | |||
| 1620 | Ga0207652_10005539 | |||
| 1621 | Ga0207652_10008522 | |||
| 1622 | Ga0207652_10044028 | |||
| 1623 | Ga0207652_10103776 | |||
| 1624 | Ga0207652_10189655 | |||
| 1625 | Ga0207694_10001330 | |||
| 1626 | Ga0207694_10004279 | |||
| 1627 | Ga0207694_10005966 | |||
| 1628 | Ga0207694_10011925 | |||
| 1629 | Ga0207694_10044992 | |||
| 1630 | Ga0207694_10115403 | |||
| 1631 | Ga0207694_10209248 | |||
| 1632 | Ga0207694_10296739 | |||
| 1633 | Ga0207650_10008638 | |||
| 1634 | Ga0207659_10011103 | |||
| 1635 | Ga0207664_10000235 | |||
| 1636 | Ga0207664_10011140 | |||
| 1637 | Ga0207690_10000913 | |||
| 1638 | Ga0207690_10004594 | |||
| 1639 | Ga0207690_10010359 | |||
| 1640 | Ga0207690_10029874 | |||
| 1641 | Ga0207690_10032193 | |||
| 1642 | Ga0207690_10035611 | |||
| 1643 | Ga0207690_10054269 | |||
| 1644 | Ga0207690_10058416 | |||
| 1645 | Ga0207706_10022271 | |||
| 1646 | Ga0207706_10055705 | |||
| 1647 | Ga0207709_10017863 | |||
| 1648 | Ga0207670_10005647 | |||
| 1649 | Ga0207704_10090033 | |||
| 1650 | Ga0207665_10010651 | |||
| 1651 | Ga0207711_10000411 | |||
| 1652 | Ga0207711_10162762 | |||
| 1653 | Ga0207689_10132399 | |||
| 1654 | Ga0207661_10004890 | |||
| 1655 | Ga0207661_10052160 | |||
| 1656 | Ga0207661_10262590 | |||
| 1657 | Ga0207679_10141999 | |||
| 1658 | Ga0207679_10276455 | |||
| 1659 | Ga0207667_10000142 | |||
| 1660 | Ga0207667_10000198 | |||
| 1661 | Ga0207667_10001230 | |||
| 1662 | Ga0207667_10001994 | |||
| 1663 | Ga0207667_10005471 | |||
| 1664 | Ga0207667_10008565 | |||
| 1665 | Ga0207667_10024202 | |||
| 1666 | Ga0207667_10040901 | |||
| 1667 | Ga0207667_10047035 | |||
| 1668 | Ga0207667_10056633 | |||
| 1669 | Ga0207651_10098631 | |||
| 1670 | Ga0207712_10001488 | |||
| 1671 | Ga0207712_10001504 | |||
| 1672 | Ga0207712_10295140 | |||
| 1673 | Ga0207640_10000014 | |||
| 1674 | Ga0207640_10000016 | |||
| 1675 | Ga0207640_10002697 | |||
| 1676 | Ga0207640_10009566 | |||
| 1677 | Ga0207640_10064612 | |||
| 1678 | Ga0207640_10067102 | |||
| 1679 | Ga0207640_10169824 | |||
| 1680 | Ga0207658_10000093 | |||
| 1681 | Ga0207658_10014676 | |||
| 1682 | Ga0207658_10031098 | |||
| 1683 | Ga0207658_10058641 | |||
| 1684 | Ga0207658_10275731 | |||
| 1685 | Ga0207703_10000734 | |||
| 1686 | Ga0207703_10000802 | |||
| 1687 | Ga0207703_10001191 | |||
| 1688 | Ga0207703_10369464 | |||
| 1689 | Ga0207703_10579792 | |||
| 1690 | Ga0207639_10000374 | |||
| 1691 | Ga0207639_10001926 | |||
| 1692 | Ga0207639_10005288 | |||
| 1693 | Ga0207639_10006208 | |||
| 1694 | Ga0207639_10006318 | |||
| 1695 | Ga0207639_10028040 | |||
| 1696 | Ga0207639_10084920 | |||
| 1697 | Ga0207678_10000619 | |||
| 1698 | Ga0207678_10004139 | |||
| 1699 | Ga0207678_10006047 | |||
| 1700 | Ga0207678_10012768 | |||
| 1701 | Ga0207678_10029974 | |||
| 1702 | Ga0207678_10042614 | |||
| 1703 | Ga0207678_10124365 | |||
| 1704 | Ga0207678_10170381 | |||
| 1705 | Ga0207702_10000170 | |||
| 1706 | Ga0207702_10003761 | |||
| 1707 | Ga0207702_10011516 | |||
| 1708 | Ga0207702_10097457 | |||
| 1709 | Ga0207702_10191442 | |||
| 1710 | Ga0207641_10001117 | |||
| 1711 | Ga0207641_10058664 | |||
| 1712 | Ga0207641_10381244 | |||
| 1713 | Ga0207641_10398813 | |||
| 1714 | Ga0207676_10197284 | |||
| 1715 | Ga0207674_10000623 | |||
| 1716 | Ga0207674_10001397 | |||
| 1717 | Ga0207674_10016247 | |||
| 1718 | Ga0207674_10026041 | |||
| 1719 | Ga0207674_10030846 | |||
| 1720 | Ga0207674_10050111 | |||
| 1721 | Ga0207674_10064493 | |||
| 1722 | Ga0207674_10421608 | |||
| 1723 | Ga0207675_100162159 | |||
| 1724 | Ga0207675_100306075 | |||
| 1725 | Ga0207698_10001202 | |||
| 1726 | Ga0207698_10001610 | |||
| 1727 | Ga0207698_10005754 | |||
| 1728 | Ga0209371_1000004 | |||
| 1729 | Ga0209371_1000011 | |||
| 1730 | Ga0209969_1002780 | |||
| 1731 | Ga0210002_1000841 | |||
| 1732 | Ga0207428_10060265 | |||
| 1733 | Ga0268266_10000001 | |||
| 1734 | Ga0268266_10000006 | |||
| 1735 | Ga0268266_10000043 | |||
| 1736 | Ga0268266_10002855 | |||
| 1737 | Ga0268266_10002895 | |||
| 1738 | Ga0268266_10031831 | |||
| 1739 | Ga0268266_10062485 | |||
| 1740 | Ga0268266_10248304 | |||
| 1741 | Ga0268266_10288577 | |||
| 1742 | Ga0268265_10055779 | |||
| 1743 | Ga0268264_10000293 | |||
| 1744 | Ga0268264_10054427 | |||
| 1745 | Ga0268264_10067856 | |||
| 1746 | Ga0268264_10171012 | |||
| 1747 | Ga0268264_10353112 | |||
| 1748 | Ga0265334_10000015 | |||
| 1749 | Ga0265334_10004047 | |||
| 1750 | Ga0265318_10003682 | |||
| 1751 | Ga0265338_10036293 | |||
| 1752 | Ga0268256_1000005 | |||
| 1753 | Ga0268256_1000011 | |||
| 1754 | Ga0316176_1094510 | |||
| 1755 | Ga0265328_10010215 | |||
| 1756 | Ga0265320_10015039 | |||
| 1757 | Ga0265316_10021492 | |||
| 1758 | Ga0265316_10131573 | |||
| 1759 | Ga0307513_10024959 | |||
| 1760 | Ga0307509_10000017 | |||
| 1761 | Ga0307408_100003986 | |||
| 1762 | Ga0307408_100167188 | |||
| 1763 | Ga0265313_10002491 | |||
| 1764 | Ga0265313_10041420 | |||
| 1765 | Ga0316575_10002942 | |||
| 1766 | Ga0316579_10080255 | |||
| 1767 | Ga0316576_10059061 | |||
| 1768 | Ga0307405_10015248 | |||
| 1769 | Ga0307405_10028736 | |||
| 1770 | Ga0316577_10002497 | |||
| 1771 | Ga0316577_10057023 | |||
| 1772 | Ga0307413_10055894 | |||
| 1773 | Ga0307413_10283373 | |||
| 1774 | Ga0307413_10370001 | |||
| 1775 | Ga0307410_10001595 | |||
| 1776 | Ga0307406_10029620 | |||
| 1777 | Ga0307407_10005839 | |||
| 1778 | Ga0307407_10165348 | |||
| 1779 | Ga0307407_10340612 | |||
| 1780 | Ga0307412_10016096 | |||
| 1781 | Ga0307412_10248530 | |||
| 1782 | Ga0307409_100283503 | |||
| 1783 | Ga0307416_100001112 | |||
| 1784 | Ga0307416_100066445 | |||
| 1785 | Ga0307414_10069220 | |||
| 1786 | Ga0307411_10000563 | |||
| 1787 | Ga0307411_10168620 | |||
| 1788 | Ga0307411_10276872 | |||
| 1789 | Ga0307415_100000772 | |||
| 1790 | Ga0307507_10225759 | |||
| 1791 | Ga0307510_10000002 | |||
| 1792 | Ga0307510_10000233 | |||
| 1793 | Ga0316574_0133934 | |||
| 1794 | Ga0373927_0000002 | |||
| 1795 | Ga0373933_0008933 | |||
| 1796 | Ga0316584_0144292 | |||
| 1797 | Ga0395899_0000309 | |||
| 1798 | Ga0395899_0001578 | |||
| 1799 | Ga0395899_0028102 | |||
| 1800 | Ga0395899_0033120 | |||
| 1801 | Ga0395900_0000163 | |||
| 1802 | Ga0395900_0002478 | |||
| 1803 | Ga0395900_0003412 | |||
| 1804 | Ga0395900_0008384 | |||
| 1805 | Ga0395900_0011470 | |||
| 1806 | Ga0395900_0068100 | |||
| 1807 | Ga0395900_0069483 | |||
| 1808 | Ga0395900_0282558 | |||
| 1809 | Ga0395898_0000144 | |||
| 1810 | Ga0395898_0000305 | |||
| 1811 | Ga0395898_0025292 | |||
| 1812 | Ga0395898_0026570 | |||
| 1813 | Ga0395898_0140963 | |||
| 1814 | Ga0395898_0343110 | |||
| 1815 | Ga0395905_0001012 | |||
| 1816 | Ga0395905_0353689 | |||
| 1817 | Ga0395901_0009632 | |||
| 1818 | Ga0395901_0011011 | |||
| 1819 | Ga0395901_0028170 | |||
| 1820 | Ga0395901_0070506 | |||
| 1821 | Ga0395901_0136557 | |||
| 1822 | Ga0395901_0148164 | |||
| 1823 | Ga0395901_0193979 | |||
| 1824 | Ga0395901_0212471 | |||
| 1825 | Ga0395901_0261349 | |||
| 1826 | Ga0237819_03353 | |||
| 1827 | Ga0400489_43493 | |||
| 1828 | Ga0400489_65269 | |||
| 1829 | Ga0237816_00097 | |||
| 1830 | Ga0436365_1276167 | |||
| 1831 | Ga0436363_0328143 | |||
| 1832 | Ga0439447_003716 | |||
| 1833 | Ga0439461_0013007 | |||
| 1834 | Ga0451791_0790747 | |||
| 1835 | Ga0451793_1323418 | |||
| 1836 | Ga0451797_1149682 | |||
| 1837 | Ga0451800_0043135 | |||
| 1838 | Ga0451800_0844354 | |||
| 1839 | Ga0451806_227471 | |||
| 1840 | Ga0451807_0696539 | |||
| 1841 | Ga0451807_1184572 | |||
| 1842 | Ga0451807_1852622 | |||
| 1843 | Ga0451841_0914442 | |||
| 1844 | Ga0451843_0048063 | |||
| 1845 | Ga0451843_1201883 | |||
| 1846 | Ga0451853_0743661 | |||
| 1847 | Ga0439433_0028572 | |||
| 1848 | Ga0439449_0057096 | |||
| 1849 | Ga0439456_036297 | |||
| 1850 | Ga0450894_002938 | |||
| 1851 | Ga0450896_003162 | |||
| 1852 | Ga0439446_0051666 | |||
| 1853 | Ga0450908_000229 | |||
| 1854 | Ga0451577_0002744 | |||
| 1855 | Ga0451577_0004710 | |||
| 1856 | Ga0451577_0095577 | |||
| 1857 | Ga0451577_0107004 | |||
| 1858 | Ga0466969_0003624 | |||
| 1859 | Ga0466972_0001350 | |||
| 1860 | Ga0466972_0029651 | |||
| 1861 | Ga0466982_0000004 | |||
| 1862 | Ga0466965_0008083 | |||
| 1863 | Ga0466966_0011778 | |||
| 1864 | Ga0466966_0056156 | |||
| 1865 | Ga0466966_0120907 | |||
| 1866 | Ga0466961_0000946 | |||
| 1867 | Ga0466961_0006538 | |||
| 1868 | Ga0466961_0020260 | |||
| 1869 | Ga0466961_0028864 | |||
| 1870 | Ga0453684_0013282 | |||
| 1871 | Ga0453684_0154833 | |||
| 1872 | Ga0453684_0277213 | |||
| 1873 | Ga0466971_0011479 | |||
| 1874 | Ga0466971_0029561 | |||
| 1875 | Ga0466970_0003008 | |||
| 1876 | Ga0466970_0006449 | |||
| 1877 | Ga0466970_0018394 | |||
| 1878 | Ga0466970_0035184 | |||
| 1879 | Ga0466970_0047948 | |||
| 1880 | Ga0466957_0000516 | |||
| 1881 | Ga0466957_0253270 | |||
| 1882 | Ga0466959_0007966 | |||
| 1883 | Ga0466959_0021228 | |||
| 1884 | Ga0466959_0052826 | |||
| 1885 | Ga0466959_0070991 | |||
| 1886 | Ga0466959_0092683 | |||
| 1887 | Ga0466958_0063566 | |||
| 1888 | Ga0466958_0211287 | |||
| 1889 | Ga0466967_0449729 | |||
| 1890 | Ga0495638_0000094 | |||
| 1891 | Ga0495638_0008208 | |||
| 1892 | Ga0495650_0000027 | |||
| 1893 | Ga0495650_0000078 | |||
| 1894 | Ga0495606_0094497 | |||
| 1895 | Ga0495622_0029037 | |||
| 1896 | Ga0495633_0020840 | |||
| 1897 | Ga0495633_0171164 | |||
| 1898 | Ga0495668_0005550 | |||
| 1899 | Ga0495625_0011559 | |||
| 1900 | Ga0495625_0033091 | |||
| 1901 | Ga0495659_0005813 | |||
| 1902 | Ga0495649_0015687 | |||
| 1903 | Ga0495686_0035377 | |||
| 1904 | Ga0496100_0010485 | |||
| 1905 | Ga0496101_0001877 | |||
| 1906 | Ga0496101_0228940 | |||
| 1907 | Ga0496102_0175832 | |||
| 1908 | Ga0496104_0858165 | |||
| 1909 | Ga0496105_0005421 | |||
| 1910 | Ga0496107_0077961 | |||
| 1911 | Ga0496108_0041356 | |||
| 1912 | Ga0496109_0162354 | |||
| 1913 | Ga0496110_0192786 | |||
| 1914 | Ga0496111_0111864 | |||
| 1915 | Ga0496113_0031778 | |||
| 1916 | Ga0496113_0160888 | |||
| 1917 | Ga0496113_0338231 | |||
| 1918 | Ga0496114_0000933 | |||
| 1919 | Ga0496114_0322788 | |||
| 1920 | Ga0496115_0000032 | |||
| 1921 | Ga0496115_0005442 | |||
| 1922 | Ga0496115_0020292 | |||
| 1923 | Ga0496115_0195007 | |||
| 1924 | Ga0496115_0205476 | |||
| 1925 | Ga0496116_0003550 | |||
| 1926 | Ga0496116_0039310 | |||
| 1927 | Ga0496117_0000140 | |||
| 1928 | Ga0496117_0010288 | |||
| 1929 | Ga0496117_0010696 | |||
| 1930 | Ga0496117_0015129 | |||
| 1931 | Ga0496117_0027762 | |||
| 1932 | Ga0496117_0063260 | |||
| 1933 | Ga0496118_0000102 | |||
| 1934 | Ga0496118_0000880 | |||
| 1935 | Ga0496118_0000955 | |||
| 1936 | Ga0496118_0001297 | |||
| 1937 | Ga0496118_0001780 | |||
| 1938 | Ga0496118_0012943 | |||
| 1939 | Ga0496118_0014401 | |||
| 1940 | Ga0496118_0031489 | |||
| 1941 | Ga0496119_0000131 | |||
| 1942 | Ga0496119_0001546 | |||
| 1943 | Ga0496119_0004641 | |||
| 1944 | Ga0496119_0016319 | |||
| 1945 | Ga0496120_0001431 | |||
| 1946 | Ga0496120_0008466 | |||
| 1947 | Ga0496120_0013980 | |||
| 1948 | Ga0496120_0014910 | |||
| 1949 | Ga0496121_0003311 | |||
| 1950 | Ga0496121_0011146 | |||
| 1951 | Ga0496121_0011290 | |||
| 1952 | Ga0496121_0029198 | |||
| 1953 | Ga0496121_0032860 | |||
| 1954 | Ga0496121_0054691 | |||
| 1955 | Ga0496121_0058645 | |||
| 1956 | Ga0496121_0152730 | |||
| 1957 | Ga0496122_0000560 | |||
| 1958 | Ga0496122_0001084 | |||
| 1959 | Ga0496122_0019108 | |||
| 1960 | Ga0496122_0024697 | |||
| 1961 | Ga0496123_0000647 | |||
| 1962 | Ga0496123_0001603 | |||
| 1963 | Ga0496123_0008306 | |||
| 1964 | Ga0496123_0095356 | |||
| 1965 | Ga0496124_0000009 | |||
| 1966 | Ga0496124_0001249 | |||
| 1967 | Ga0496124_0015214 | |||
| 1968 | Ga0496124_0025530 | |||
| 1969 | Ga0496124_0079522 | |||
| 1970 | Ga0496125_0000338 | |||
| 1971 | Ga0496125_0000813 | |||
| 1972 | Ga0496125_0074511 | |||
| 1973 | Ga0496125_0119145 | |||
| 1974 | Ga0496126_0000925 | |||
| 1975 | Ga0496126_0033341 | |||
| 1976 | Ga0496126_0075605 | |||
| 1977 | Ga0496126_0093327 | |||
| 1978 | Ga0496126_0101027 | |||
| 1979 | Ga0496126_0204570 | |||
| 1980 | Ga0496126_0237999 | |||
| 1981 | Ga0496126_0289276 | |||
| 1982 | Ga0496126_0454901 | |||
| 1983 | Ga0501031_0092333 | |||
| 1984 | Ga0501032_0024280 | |||
| 1985 | Ga0501032_0124634 | |||
| 1986 | Ga0501032_0229841 | |||
| 1987 | Ga0501033_0014100 | |||
| 1988 | Ga0501033_0033971 | |||
| 1989 | Ga0501033_0166299 | |||
| 1990 | Ga0501033_0338496 | |||
| 1991 | Ga0501034_0001783 | |||
| 1992 | Ga0501034_0002029 | |||
| 1993 | Ga0501034_0019163 | |||
| 1994 | Ga0501034_0134835 | |||
| 1995 | Ga0501034_0158367 | |||
| 1996 | Ga0501034_0360241 | |||
| 1997 | Ga0501034_0363297 | |||
| 1998 | Ga0501034_0479543 | |||
| 1999 | Ga0501036_0015065 | |||
| 2000 | Ga0501036_0151227 | |||
| 2001 | Ga0501037_0023125 | |||
| 2002 | Ga0501037_0029500 | |||
| 2003 | Ga0501037_0047342 | |||
| 2004 | Ga0501038_0052046 | |||
| 2005 | Ga0501038_0084957 | |||
| 2006 | Ga0501038_0094416 | |||
| 2007 | Ga0501038_0105071 | |||
| 2008 | Ga0501038_0169538 | |||
| 2009 | Ga0501038_0235756 | |||
| 2010 | Ga0501039_0009425 | |||
| 2011 | Ga0501040_0023303 | |||
| 2012 | Ga0501041_0034229 | |||
| 2013 | Ga0501041_0285374 | |||
| 2014 | Ga0501042_0029618 | |||
| 2015 | Ga0501043_0000496 | |||
| 2016 | Ga0501043_0029223 | |||
| 2017 | Ga0501043_0050226 | |||
| 2018 | Ga0501043_0067859 | |||
| 2019 | Ga0501043_0101501 | |||
| 2020 | Ga0501043_0255835 | |||
| 2021 | Ga0501046_0062128 | |||
| 2022 | Ga0501047_0001140 | |||
| 2023 | Ga0501047_0007292 | |||
| 2024 | Ga0501047_0023799 | |||
| 2025 | Ga0501047_0059351 | |||
| 2026 | Ga0501047_0133726 | |||
| 2027 | Ga0501047_0148832 | |||
| 2028 | Ga0501047_0257612 | |||
| 2029 | Ga0501047_0450570 | |||
| 2030 | Ga0501048_0016783 | |||
| 2031 | Ga0501048_0132080 | |||
| 2032 | Ga0501048_0139155 | |||
| 2033 | Ga0501048_0215406 | |||
| 2034 | Ga0501067_0052188 | |||
| 2035 | Ga0501068_0006207 | |||
| 2036 | Ga0501068_0034604 | |||
| 2037 | Ga0501068_0187634 | |||
| 2038 | Ga0501068_0275921 | |||
| 2039 | Ga0501069_0001130 | |||
| 2040 | Ga0501069_0002195 | |||
| 2041 | Ga0501069_0012617 | |||
| 2042 | Ga0501069_0024698 | |||
| 2043 | Ga0501070_0000311 | |||
| 2044 | Ga0501070_0002127 | |||
| 2045 | Ga0501070_0002625 | |||
| 2046 | Ga0501070_0014841 | |||
| 2047 | Ga0501070_0022398 | |||
| 2048 | Ga0501070_0031449 | |||
| 2049 | Ga0501070_0034110 | |||
| 2050 | Ga0501070_0059879 | |||
| 2051 | Ga0501070_0090362 | |||
| 2052 | Ga0501070_0188158 | |||
| 2053 | Ga0501070_0201633 | |||
| 2054 | Ga0501070_0345081 | |||
| 2055 | Ga0501071_0003538 | |||
| 2056 | Ga0501071_0009446 | |||
| 2057 | Ga0501072_0044654 | |||
| 2058 | Ga0501072_0051742 | |||
| 2059 | Ga0501073_0006399 | |||
| 2060 | Ga0501073_0013127 | |||
| 2061 | Ga0501074_0037381 | |||
| 2062 | Ga0501074_0078440 | |||
| 2063 | Ga0501074_0204688 | |||
| 2064 | Ga0501075_0038876 | |||
| 2065 | Ga0501076_0113941 | |||
| 2066 | Ga0501076_0479841 | |||
| 2067 | Ga0501077_0050341 | |||
| 2068 | Ga0501077_0143043 | |||
| 2069 | Ga0501202_005533 | |||
| 2070 | Ga0501252_001883 | |||
| 2071 | Ga0501225_0036472 | |||
| 2072 | Ga0501079_0101847 | |||
| 2073 | Ga0501079_0251125 | |||
| 2074 | Ga0501080_0002966 | |||
| 2075 | Ga0501080_0011069 | |||
| 2076 | Ga0501080_0023665 | |||
| 2077 | Ga0501080_0040846 | |||
| 2078 | Ga0501080_0088000 | |||
| 2079 | Ga0501080_0119484 | |||
| 2080 | Ga0501080_0146971 | |||
| 2081 | Ga0501080_0152329 | |||
| 2082 | Ga0501080_0215751 | |||
| 2083 | Ga0501081_0018189 | |||
| 2084 | Ga0501081_0026486 | |||
| 2085 | Ga0501081_0037240 | |||
| 2086 | Ga0501081_0038763 | |||
| 2087 | Ga0501081_0175373 | |||
| 2088 | Ga0501083_0001933 | |||
| 2089 | Ga0501268_007367 | |||
| 2090 | Ga0501270_005293 | |||
| 2091 | Ga0501035_0021058 | |||
| 2092 | Ga0501035_0058490 | |||
| 2093 | Ga0501035_0107029 | |||
| 2094 | Ga0501035_0124980 | |||
| 2095 | Ga0501035_0187509 | |||
| 2096 | Ga0501035_0200083 | |||
| 2097 | Ga0501035_0253760 | |||
| 2098 | Ga0501035_0426102 | |||
| 2099 | Ga0501044_0008911 | |||
| 2100 | Ga0501044_0018635 | |||
| 2101 | Ga0501044_0032184 | |||
| 2102 | Ga0501044_0037048 | |||
| 2103 | Ga0501044_0073236 | |||
| 2104 | Ga0501044_0081840 | |||
| 2105 | Ga0501044_0087059 | |||
| 2106 | Ga0501044_0091349 | |||
| 2107 | Ga0501044_0098277 | |||
| 2108 | Ga0501044_0106247 | |||
| 2109 | Ga0501044_0234806 | |||
| 2110 | Ga0501045_0050182 | |||
| 2111 | nmdc:mga08y16_90845_c1 | |||
| 2112 | nmdc:mga0rr50_189198_c1 | |||
| 2113 | nmdc:mga0a205_3120_c1 | |||
| 2114 | Ga0500610_0090838 | |||
| 2115 | Ga0500643_007517 | |||
| 2116 | Ga0500583_0034295 | |||
| 2117 | Ga0500651_0037918 | |||
| 2118 | Ga0500651_0122514 | |||
| 2119 | Ga0500641_0000743 | |||
| 2120 | Ga0500641_0017371 | |||
| 2121 | Ga0500597_000111 | |||
| 2122 | Ga0500634_0007244 | |||
| 2123 | Ga0501084_0039591 | |||
| 2124 | Ga0501082_0000672 | |||
| 2125 | Ga0501082_0034095 | |||
| 2126 | Ga0501082_0176585 | |||
| 2127 | Ga0466962_0004616 | |||
| 2128 | Ga0466962_0017050 | |||
| 2129 | Ga0530510_0034971 | |||
| 2130 | 2538832381 | |||
| 2131 | 2547501526 | |||
| 2132 | 2578459056 | |||
| 2133 | 2643830399 | |||
| 2134 | 2643894138 | |||
| 2135 | 2644476341 | |||
| 2136 | 2687582302 | |||
| 2137 | 2739730554 | |||
| 2138 | 2747950075 | |||
| 2139 | 2748015964 | |||
| 2140 | 2765578328 | |||
| 2141 | 2816516346 | |||
| 2142 | 2819663667 | |||
| 2143 | 2842392943 | |||
| 2144 | 2842758719 | |||
| 2145 | 2842781217 | |||
| 2146 | 2852686362 | |||
| 2147 | 2874220948 | |||
| 2148 | 2884413281 | |||
| 2149 | 2895398848 | |||
| 2150 | 2895500868 | |||
| 2151 | 2895516263 | |||
| 2152 | 2895523819 | |||
| 2153 | 2895526599 | |||
| 2154 | 2919091157 | |||
| 2155 | 2919132479 | |||
| 2156 | 2919136808 | |||
| 2157 | 2928497790 | |||
| 2158 | 2928964381 | |||
| 2159 | 2929197053 | |||
| 2160 | 2931381407 | |||
| 2161 | 2937611769 | |||
| 2162 | 2939612405 | |||
| 2163 | 2939626687 | |||
| 2164 | 2939627708 | |||
| 2165 | 2961047713 | |||
| 2166 | 2961067054 | |||
| 2167 | 2987608272 | |||
| 2168 | 8002869479 | |||
| 2169 | 8003016477 | |||
| 2170 | 8021648551 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m6u-assembly1.cif.gz_I | crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e | 0.351 | 112 | 266 |
| 6m6u-assembly1.cif.gz_D | crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e | 0.3421 | 112 | 266 |
| 7aer-assembly1.cif.gz_B | rebuilt and re-refined pdb entry 5yep: tri-ampylated shewanella oneidensis hepn toxin in complex with mnt antitoxin | 0.341 | 112 | 260 |
| 6m6u-assembly1.cif.gz_I | crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e | 0.3404 | 112 | 266 |
| 6m6u-assembly1.cif.gz_D | crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e | 0.3325 | 112 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q99PA5_49_164_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3759 | 107 | 213 | 1.20.140.150 |
| af_Q4CZP8_573_734_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3484 | 106 | 279 | 1.10.1760.20 |
| af_Q99PA5_49_164_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3349 | 107 | 213 | 1.20.140.150 |
| af_F1RB62_85_233_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.3348 | 73 | 264 | 1.20.120.350 |
| af_Q4DUB6_274_435_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3344 | 102 | 214 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848Q8A6-F1-model_v4 | deleted | 0.9672 | 1 | 77 |
|
| AF-A0A848Q8A6-F1-model_v4 | deleted | 0.9433 | 1 | 77 |
|
| AF-A0A522SMK6-F1-model_v4 | Putative sensor domain-containing protein | 0.9056 | 1 | 281 |
GO:0016020
|
| AF-A0A522SMK6-F1-model_v4 | Putative sensor domain-containing protein | 0.9025 | 1 | 281 |
GO:0016020
|
| AF-T1BM38-F1-model_v4 | Sensor protein | 0.8867 | 1 | 91 |
|