F489782

General Info

Members Datasets Scaffolds Average Seq Length
1086 424 2170 299

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10015836|Ga0207660_100158362
Length 336
Sequence MSNPKLSVRGEESNREQNRHPTSLSESKAMTTPQTIKQYLAQLRAALAGADPAMIQDALYDAEEHLRSELAENPGMSEAELLAKIATSYGAPDEVAEIYRTTEQTVTRALRTPRRQPRRSAIGRFFGVIADPHTYGAMFYMLLSLATGIFYFVWAVTGLSLSAGFTVLIIGLPFFLLFMASVRGLSLLESRIIESMLGVRMPRRPPYTGRERPWLQRIAAMLTDPRTWATLLYMLLMLPLGIAYFIIVVALSSVSLALMFTPMAMACDFFGFGRDFIDGYVTVDWGFGAHIPGWGDAIAMFVVGFFLLFGTLHLVRGIGRMHGAFAKHLLVKSARV

Samples

Sample ID Description Type Environment
1 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
120 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
136 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
144 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
155 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
156 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
227 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
235 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
236 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
237 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
262 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
263 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
267 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
268 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
269 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
270 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
271 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
272 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
273 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
274 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
275 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
278 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
279 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
280 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
281 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
282 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
283 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
286 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
287 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
359 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
360 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
366 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
374 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
375 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
376 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
377 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
378 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
379 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
380 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
384 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
385 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
386 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
387 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
388 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
389 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
390 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
391 2739367700 Dyella sp. YR388 Isolate Unclassified
392 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
393 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
394 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
395 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
396 2818991457 Xanthomonas translucens 569 Isolate Unclassified
397 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
398 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
399 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
400 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
401 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
402 2884411467 Dyella sp. AD56 Isolate Rhizosphere
403 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
404 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
405 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
406 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
407 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
408 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
409 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
410 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
411 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
412 2928963466 Dyella japonica 1073 Isolate Unclassified
413 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
414 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
415 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
416 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
417 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
418 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
419 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
420 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
421 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
422 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
423 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
424 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 0.64
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.8
Nodule 0.09
Rhizoplane 2.76
Rhizosphere 73.11
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207660_10015836 3300025917 Bacteria 4984
2 JGI24741J21665_1000582 3300001915 Bacteria 11068
3 JGI24741J21665_1000998 3300001915 Bacteria 8495
4 JGI24741J21665_1005282 3300001915 Bacteria 2729
5 JGI24740J21852_10006312 3300001979 Bacteria 4921
6 JGI24740J21852_10011109 3300001979 Bacteria 3440
7 JGI24739J22299_10000076 3300001989 Bacteria 27668
8 JGI24737J22298_10000304 3300001990 Bacteria 16452
9 JGI24737J22298_10020632 3300001990 Bacteria 2103
10 JGI24735J21928_10005423 3300002067 Bacteria 4234
11 JGI25156J39149_1006923 3300002705 Bacteria 3043
12 JGI25162J39368_1000260 3300002737 Bacteria 50536
13 JGI25162J39368_1000752 3300002737 Bacteria 22042
14 JGI25162J39368_1000979 3300002737 Bacteria 18126
15 JGI25162J39368_1006678 3300002737 Unclassified 1943
16 JGI25154J39366_1010699 3300002738 Bacteria 1077
17 JGI25157J39369_1000236 3300002741 Bacteria 42812
18 JGI25157J39369_1000364 3300002741 Bacteria 31214
19 JGI25157J39369_1002550 3300002741 Bacteria 4394
20 JGI25157J39369_1004633 3300002741 Bacteria 2436
21 JGI25163J39215_1002102 3300002771 Bacteria 2339
22 JGI25164J39214_1000035 3300002772 Bacteria 139987
23 JGI25164J39214_1000133 3300002772 Bacteria 71595
24 JGI25152J39213_1000018 3300002773 Bacteria 109715
25 JGI25150J39212_1000159 3300002774 Bacteria 38345
26 JGI25151J46595_10000106 3300003187 Bacteria 113352
27 JGI25151J46595_10000111 3300003187 Bacteria 111802
28 JGI25151J46595_10056892 3300003187 Bacteria 1279
29 JGI25165J46597_1000255 3300003214 Bacteria 71595
30 JGI25165J46597_1000397 3300003214 Bacteria 46032
31 JGI25153J46596_10000085 3300003215 Bacteria 111802
32 JGI25153J46596_10013672 3300003215 Bacteria 3417
33 rootH1_10000986 3300003316 Bacteria 7605
34 rootH2_10017930 3300003320 Bacteria 6833
35 rootH1_10094545 3300003323 Bacteria 3287
36 rootH1_10265301 3300003323 Bacteria 1972
37 Ga0055538_1000340 3300003751 Bacteria 20779
38 Ga0055539_1008553 3300003752 Bacteria 1279
39 Ga0055533_1001312 3300003756 Bacteria 6757
40 Ga0055525_1000089 3300003759 Bacteria 142096
41 Ga0055527_1000084 3300003760 Bacteria 74303
42 Ga0055535_1000317 3300003761 Bacteria 48674
43 Ga0055535_1000349 3300003761 Bacteria 45885
44 Ga0055535_1000374 3300003761 Bacteria 42774
45 Ga0055535_1000579 3300003761 Bacteria 30773
46 Ga0055535_1001574 3300003761 Bacteria 11033
47 Ga0055542_1000082 3300003762 Bacteria 128120
48 Ga0055542_1000195 3300003762 Bacteria 74303
49 Ga0055542_1000327 3300003762 Bacteria 50536
50 Ga0055542_1000375 3300003762 Bacteria 45897
51 Ga0055542_1000600 3300003762 Bacteria 30773
52 Ga0055529_1000228 3300003763 Bacteria 71595
53 Ga0055529_1000254 3300003763 Bacteria 64036
54 Ga0055529_1000507 3300003763 Bacteria 35026
55 Ga0055529_1000613 3300003763 Bacteria 26951
56 Ga0055529_1001360 3300003763 Bacteria 8004
57 Ga0055526_1000011 3300003771 Bacteria 236316
58 Ga0055526_1008071 3300003771 Bacteria 5311
59 Ga0055537_1000007 3300003773 Bacteria 144691
60 Ga0055524_1000034 3300003775 Bacteria 180672
61 Ga0055524_1025274 3300003775 Bacteria 1863
62 Ga0055536_1000574 3300003781 Bacteria 25068
63 Ga0055536_1003563 3300003781 Bacteria 8322
64 Ga0055536_1012015 3300003781 Bacteria 3253
65 Ga0055536_1017437 3300003781 Bacteria 2351
66 Ga0055534_1000013 3300003784 Bacteria 151209
67 Ga0055528_1000005 3300003790 Bacteria 236316
68 Ga0055530_10002885 3300003791 Bacteria 10467
69 Ga0055531_10004761 3300003794 Bacteria 8109
70 Ga0055531_10006099 3300003794 Bacteria 6902
71 Ga0055531_10026539 3300003794 Bacteria 2062
72 Ga0058692_1000002 3300003856 Bacteria 508401
73 Ga0058692_1000020 3300003856 Bacteria 250589
74 Ga0065165_1004080 3300005262 Bacteria 9458
75 Ga0065704_10104057 3300005289 Bacteria 2153
76 Ga0065715_10155065 3300005293 Bacteria 1686
77 Ga0070658_10001143 3300005327 Bacteria 22624
78 Ga0070658_10043237 3300005327 Bacteria 3640
79 Ga0070658_10112166 3300005327 Bacteria 2260
80 Ga0070658_10118006 3300005327 Bacteria 2203
81 Ga0070683_100023206 3300005329 Bacteria 5548
82 Ga0070683_100393267 3300005329 Bacteria 1322
83 Ga0070670_100021191 3300005331 Bacteria 5591
84 Ga0070670_100110745 3300005331 Bacteria 2366
85 Ga0070670_100116209 3300005331 Bacteria 2307
86 Ga0068869_100072047 3300005334 Bacteria 2560
87 Ga0070666_10000058 3300005335 Bacteria 89886
88 Ga0070666_10000645 3300005335 Bacteria 21011
89 Ga0070666_10008427 3300005335 Bacteria 6401
90 Ga0070666_10065608 3300005335 Unclassified 2463
91 Ga0070680_100048875 3300005336 Bacteria 3447
92 Ga0070680_100079588 3300005336 Bacteria 2701
93 Ga0070680_100089873 3300005336 Bacteria 2542
94 Ga0070680_100404582 3300005336 Bacteria 1164
95 Ga0070682_100015190 3300005337 Bacteria 4457
96 Ga0070682_100040396 3300005337 Bacteria 2870
97 Ga0068868_100075510 3300005338 Bacteria 2693
98 Ga0070660_100101733 3300005339 Bacteria 2277
99 Ga0070660_100165217 3300005339 Bacteria 1785
100 Ga0070689_100004531 3300005340 Bacteria 9407
101 Ga0070691_10000346 3300005341 Bacteria 16494
102 Ga0070691_10037455 3300005341 Bacteria 2288
103 Ga0070661_100050296 3300005344 Bacteria 3049
104 Ga0070661_100092709 3300005344 Bacteria 2238
105 Ga0070661_100194031 3300005344 Bacteria 1550
106 Ga0070692_10011513 3300005345 Bacteria 4064
107 Ga0070692_10028849 3300005345 Bacteria 2762
108 Ga0070692_10034803 3300005345 Bacteria 2546
109 Ga0070668_100062063 3300005347 Bacteria 2895
110 Ga0070669_100105474 3300005353 Unclassified 2132
111 Ga0070675_100015466 3300005354 Bacteria 6034
112 Ga0070671_100006750 3300005355 Bacteria 9185
113 Ga0070671_100030620 3300005355 Bacteria 4441
114 Ga0070671_100160182 3300005355 Bacteria 1902
115 Ga0070673_100185622 3300005364 Bacteria 1783
116 Ga0070688_100096994 3300005365 Bacteria 1937
117 Ga0070688_100336701 3300005365 Bacteria 1101
118 Ga0070659_100007680 3300005366 Bacteria 7844
119 Ga0070659_100017729 3300005366 Bacteria 5363
120 Ga0070667_100000108 3300005367 Bacteria 105301
121 Ga0070667_100009016 3300005367 Bacteria 8256
122 Ga0070667_100016038 3300005367 Bacteria 6198
123 Ga0070667_100027922 3300005367 Bacteria 4696
124 Ga0070709_10000036 3300005434 Bacteria 109782
125 Ga0070714_100000325 3300005435 Bacteria 35978
126 Ga0070714_100000671 3300005435 Bacteria 24217
127 Ga0070710_10134963 3300005437 Bacteria 1508
128 Ga0070701_10085606 3300005438 Bacteria 1716
129 Ga0070711_100175012 3300005439 Bacteria 1639
130 Ga0070694_100019707 3300005444 Bacteria 4293
131 Ga0070663_100004271 3300005455 Bacteria 8363
132 Ga0070663_100009276 3300005455 Bacteria 6088
133 Ga0070663_100015624 3300005455 Bacteria 4908
134 Ga0070663_100034811 3300005455 Bacteria 3490
135 Ga0070663_100128550 3300005455 Bacteria 1921
136 Ga0070663_100265697 3300005455 Bacteria 1362
137 Ga0070662_100029363 3300005457 Bacteria 3837
138 Ga0070662_100057601 3300005457 Bacteria 2824
139 Ga0070681_10000500 3300005458 Bacteria 32052
140 Ga0070681_10000944 3300005458 Bacteria 24477
141 Ga0070681_10009676 3300005458 Bacteria 9483
142 Ga0070681_10031335 3300005458 Bacteria 5338
143 Ga0070681_10073083 3300005458 Bacteria 3391
144 Ga0070681_10081516 3300005458 Bacteria 3191
145 Ga0070681_10280926 3300005458 Bacteria 1575
146 Ga0070685_10013087 3300005466 Bacteria 4368
147 Ga0070685_10021517 3300005466 Bacteria 3507
148 Ga0070698_100010813 3300005471 Bacteria 9714
149 Ga0070699_100128344 3300005518 Bacteria 2234
150 Ga0070679_100001195 3300005530 Bacteria 22809
151 Ga0070679_100025730 3300005530 Bacteria 5775
152 Ga0070679_100072387 3300005530 Bacteria 3439
153 Ga0070679_100073914 3300005530 Bacteria 3400
154 Ga0070679_100238081 3300005530 Bacteria 1778
155 Ga0070684_100309740 3300005535 Bacteria 1450
156 Ga0068853_100001578 3300005539 Bacteria 16612
157 Ga0068853_100005018 3300005539 Bacteria 10318
158 Ga0068853_100008085 3300005539 Bacteria 8439
159 Ga0068853_100011045 3300005539 Bacteria 7325
160 Ga0068853_100016267 3300005539 Bacteria 6121
161 Ga0068853_100068959 3300005539 Bacteria 3075
162 Ga0068853_100082454 3300005539 Bacteria 2817
163 Ga0068853_100110422 3300005539 Bacteria 2442
164 Ga0068853_100183866 3300005539 Bacteria 1896
165 Ga0068853_100363436 3300005539 Bacteria 1349
166 Ga0068853_100618446 3300005539 Bacteria 1029
167 Ga0070696_100037311 3300005546 Bacteria 3352
168 Ga0070696_100103901 3300005546 Bacteria 2039
169 Ga0070696_100454096 3300005546 Bacteria 1012
170 Ga0070693_100096686 3300005547 Bacteria 1791
171 Ga0070693_100250112 3300005547 Bacteria 1174
172 Ga0070665_100000057 3300005548 Bacteria 237271
173 Ga0070665_100000715 3300005548 Bacteria 44234
174 Ga0070665_100002937 3300005548 Bacteria 18413
175 Ga0070665_100021486 3300005548 Bacteria 6489
176 Ga0070665_100068712 3300005548 Bacteria 3552
177 Ga0070665_100230042 3300005548 Bacteria 1854
178 Ga0070665_100235983 3300005548 Bacteria 1829
179 Ga0070665_100271579 3300005548 Bacteria 1697
180 Ga0070665_100313763 3300005548 Bacteria 1572
181 Ga0070665_100524923 3300005548 Bacteria 1196
182 Ga0070704_100106240 3300005549 Bacteria 2127
183 Ga0068855_100001307 3300005563 Bacteria 30848
184 Ga0068855_100004050 3300005563 Bacteria 17881
185 Ga0068855_100037140 3300005563 Bacteria 5795
186 Ga0068855_100043353 3300005563 Bacteria 5330
187 Ga0068855_100078773 3300005563 Bacteria 3822
188 Ga0068855_100248155 3300005563 Bacteria 1986
189 Ga0068855_100330214 3300005563 Bacteria 1684
190 Ga0068855_100354255 3300005563 Bacteria 1616
191 Ga0068855_100393414 3300005563 Bacteria 1520
192 Ga0070664_100166958 3300005564 Bacteria 1950
193 Ga0068857_100000300 3300005577 Bacteria 34132
194 Ga0068857_100037641 3300005577 Bacteria 4287
195 Ga0068857_100063147 3300005577 Bacteria 3292
196 Ga0068857_100472084 3300005577 Bacteria 1175
197 Ga0068854_100000343 3300005578 Bacteria 29961
198 Ga0068854_100002114 3300005578 Bacteria 12177
199 Ga0068854_100004724 3300005578 Bacteria 8586
200 Ga0068854_100042054 3300005578 Bacteria 3232
201 Ga0068854_100091855 3300005578 Bacteria 2260
202 Ga0068854_100141759 3300005578 Bacteria 1845
203 Ga0068854_100218564 3300005578 Bacteria 1506
204 Ga0068856_100000116 3300005614 Bacteria 79220
205 Ga0068856_100084443 3300005614 Bacteria 3154
206 Ga0068856_100111094 3300005614 Bacteria 2738
207 Ga0068856_100187473 3300005614 Bacteria 2082
208 Ga0068852_100004275 3300005616 Bacteria 10079
209 Ga0068852_100008693 3300005616 Bacteria 7505
210 Ga0068852_100010857 3300005616 Bacteria 6825
211 Ga0068852_100124333 3300005616 Bacteria 2366
212 Ga0068859_100000351 3300005617 Bacteria 45794
213 Ga0068859_100015319 3300005617 Bacteria 7702
214 Ga0068859_100225471 3300005617 Bacteria 1962
215 Ga0068864_100090044 3300005618 Bacteria 2704
216 Ga0068864_100140516 3300005618 Bacteria 2178
217 Ga0068861_100316989 3300005719 Bacteria 1357
218 Ga0068851_10004625 3300005834 Bacteria 6210
219 Ga0068851_10009946 3300005834 Bacteria 4428
220 Ga0068851_10062656 3300005834 Bacteria 1908
221 Ga0068863_100006425 3300005841 Bacteria 11525
222 Ga0068863_100014475 3300005841 Bacteria 7596
223 Ga0068863_100020112 3300005841 Bacteria 6386
224 Ga0068863_100379835 3300005841 Bacteria 1379
225 Ga0068858_100006259 3300005842 Bacteria 11599
226 Ga0068858_100006693 3300005842 Bacteria 11213
227 Ga0068858_100006944 3300005842 Bacteria 11004
228 Ga0068858_100436838 3300005842 Bacteria 1260
229 Ga0068860_100045552 3300005843 Bacteria 4183
230 Ga0068860_100203927 3300005843 Unclassified 1917
231 Ga0068860_100248002 3300005843 Bacteria 1733
232 Ga0068860_100736321 3300005843 Bacteria 997
233 Ga0068862_100195260 3300005844 Bacteria 1823
234 Ga0081455_10000039 3300005937 Bacteria 135506
235 Ga0075364_10102798 3300006051 Bacteria 1903
236 Ga0075364_10120923 3300006051 Bacteria 1753
237 Ga0070716_100004881 3300006173 Bacteria 6450
238 Ga0075369_10028360 3300006186 Bacteria 2346
239 Ga0097621_100055267 3300006237 Bacteria 3241
240 Ga0097621_100181344 3300006237 Bacteria 1819
241 Ga0068871_100267943 3300006358 Bacteria 1491
242 Ga0075428_100569576 3300006844 Bacteria 1210
243 Ga0075431_100060414 3300006847 Bacteria 3911
244 Ga0075433_10001939 3300006852 Bacteria 15560
245 Ga0075433_10290073 3300006852 Bacteria 1449
246 Ga0068865_100047107 3300006881 Bacteria 2961
247 Ga0068865_100068084 3300006881 Bacteria 2516
248 Ga0097620_100000351 3300006931 Bacteria 45794
249 Ga0097620_100015319 3300006931 Bacteria 7702
250 Ga0097620_100225471 3300006931 Bacteria 1962
251 Ga0105244_10051498 3300009036 Bacteria 2098
252 Ga0105250_10038121 3300009092 Bacteria 1928
253 Ga0105240_10000315 3300009093 Bacteria 92923
254 Ga0105240_10007869 3300009093 Bacteria 15381
255 Ga0105240_10009439 3300009093 Bacteria 13810
256 Ga0105240_10012686 3300009093 Bacteria 11613
257 Ga0105240_10015093 3300009093 Bacteria 10515
258 Ga0105240_10051502 3300009093 Bacteria 5178
259 Ga0105240_10060620 3300009093 Bacteria 4716
260 Ga0105240_10098547 3300009093 Bacteria 3559
261 Ga0105240_10167205 3300009093 Bacteria 2608
262 Ga0105240_10226538 3300009093 Bacteria 2175
263 Ga0105240_10263224 3300009093 Bacteria 1988
264 Ga0105240_10550138 3300009093 Bacteria 1277
265 Ga0111539_10044756 3300009094 Bacteria 5301
266 Ga0111539_10424364 3300009094 Bacteria 1549
267 Ga0105247_10000975 3300009101 Bacteria 21605
268 Ga0105247_10014302 3300009101 Bacteria 4764
269 Ga0114129_10138582 3300009147 Bacteria 3337
270 Ga0114129_10262478 3300009147 Bacteria 2314
271 Ga0105243_10033621 3300009148 Bacteria 3966
272 Ga0105241_10004652 3300009174 Bacteria 10140
273 Ga0105241_10013451 3300009174 Bacteria 5998
274 Ga0105241_10165241 3300009174 Bacteria 1823
275 Ga0105241_10414866 3300009174 Bacteria 1184
276 Ga0105242_10128547 3300009176 Bacteria 2184
277 Ga0105248_10001678 3300009177 Bacteria 24646
278 Ga0105248_10047487 3300009177 Bacteria 4815
279 Ga0105248_10203594 3300009177 Bacteria 2230
280 Ga0105248_10217562 3300009177 Bacteria 2151
281 Ga0105248_10225150 3300009177 Bacteria 2111
282 Ga0105248_10240948 3300009177 Bacteria 2036
283 Ga0105237_10000063 3300009545 Bacteria 141759
284 Ga0105237_10000105 3300009545 Bacteria 118218
285 Ga0105237_10003289 3300009545 Bacteria 19301
286 Ga0105237_10007234 3300009545 Bacteria 12175
287 Ga0105237_10008174 3300009545 Bacteria 11366
288 Ga0105237_10052875 3300009545 Bacteria 4075
289 Ga0105237_10172728 3300009545 Bacteria 2161
290 Ga0105237_10295994 3300009545 Bacteria 1621
291 Ga0105237_10665916 3300009545 Bacteria 1048
292 Ga0105238_10000270 3300009551 Bacteria 58093
293 Ga0105238_10000290 3300009551 Bacteria 55810
294 Ga0105238_10004841 3300009551 Bacteria 13319
295 Ga0105238_10020657 3300009551 Bacteria 6708
296 Ga0105238_10074121 3300009551 Bacteria 3397
297 Ga0105238_10204191 3300009551 Bacteria 1952
298 Ga0105238_10459728 3300009551 Bacteria 1270
299 Ga0105238_10464757 3300009551 Bacteria 1263
300 Ga0105238_10517491 3300009551 Bacteria 1196
301 Ga0105249_10002422 3300009553 Bacteria 16191
302 Ga0105249_10006721 3300009553 Bacteria 10016
303 Ga0105249_10014184 3300009553 Bacteria 7045
304 Ga0105249_10020841 3300009553 Bacteria 5861
305 Ga0105249_10087409 3300009553 Bacteria 2908
306 Ga0105029_103430 3300009984 Bacteria 1060
307 Ga0105030_101208 3300009987 Bacteria 2295
308 Ga0105239_10000043 3300010375 Bacteria 196600
309 Ga0105239_10006032 3300010375 Bacteria 14100
310 Ga0105239_10019878 3300010375 Bacteria 7412
311 Ga0105239_10026229 3300010375 Bacteria 6414
312 Ga0105239_10142571 3300010375 Bacteria 2671
313 Ga0105239_10161584 3300010375 Bacteria 2502
314 Ga0105239_10215793 3300010375 Bacteria 2151
315 Ga0105239_10297253 3300010375 Bacteria 1818
316 Ga0105246_10064508 3300011119 Bacteria 2559
317 Ga0157373_10004602 3300013100 Bacteria 10374
318 Ga0157373_10007629 3300013100 Bacteria 8036
319 Ga0157373_10057113 3300013100 Bacteria 2769
320 Ga0157373_10080857 3300013100 Bacteria 2291
321 Ga0157373_10291515 3300013100 Bacteria 1157
322 Ga0157371_10003532 3300013102 Bacteria 14107
323 Ga0157371_10008518 3300013102 Bacteria 8163
324 Ga0157371_10010934 3300013102 Bacteria 7036
325 Ga0157371_10021786 3300013102 Bacteria 4701
326 Ga0157371_10032772 3300013102 Bacteria 3737
327 Ga0157371_10085550 3300013102 Bacteria 2234
328 Ga0157370_10001634 3300013104 Bacteria 27668
329 Ga0157370_10007704 3300013104 Bacteria 11679
330 Ga0157370_10009139 3300013104 Bacteria 10626
331 Ga0157370_10082212 3300013104 Bacteria 3030
332 Ga0157370_10145538 3300013104 Bacteria 2206
333 Ga0157370_10208301 3300013104 Bacteria 1813
334 Ga0157370_10304008 3300013104 Bacteria 1472
335 Ga0157369_10050010 3300013105 Bacteria 4530
336 Ga0157369_10063808 3300013105 Bacteria 3968
337 Ga0157369_10093815 3300013105 Bacteria 3204
338 Ga0157369_10105890 3300013105 Bacteria 2993
339 Ga0157369_10140278 3300013105 Bacteria 2558
340 Ga0157369_10283292 3300013105 Bacteria 1726
341 Ga0157374_10111331 3300013296 Bacteria 2634
342 Ga0157374_10150041 3300013296 Bacteria 2266
343 Ga0163162_10013992 3300013306 Bacteria 7843
344 Ga0163162_10056831 3300013306 Bacteria 3941
345 Ga0157372_10003149 3300013307 Bacteria 17791
346 Ga0157372_10007198 3300013307 Bacteria 11848
347 Ga0157372_10007498 3300013307 Bacteria 11602
348 Ga0157372_10042687 3300013307 Bacteria 5017
349 Ga0157372_10074444 3300013307 Bacteria 3829
350 Ga0157372_10104344 3300013307 Bacteria 3240
351 Ga0157372_10123380 3300013307 Bacteria 2977
352 Ga0157372_10208720 3300013307 Bacteria 2263
353 Ga0157372_10271820 3300013307 Bacteria 1970
354 Ga0157372_10295703 3300013307 Bacteria 1883
355 Ga0157372_10745377 3300013307 Bacteria 1139
356 Ga0157380_10030483 3300014326 Bacteria 4131
357 Ga0157380_10083091 3300014326 Bacteria 2622
358 Ga0157380_10754189 3300014326 Unclassified 985
359 Ga0182008_10000371 3300014497 Bacteria 34744
360 Ga0157377_10058154 3300014745 Bacteria 2201
361 Ga0157379_10073278 3300014968 Bacteria 3065
362 Ga0157379_10266631 3300014968 Bacteria 1557
363 Ga0157376_10096560 3300014969 Bacteria 2572
364 Ga0157376_10139856 3300014969 Bacteria 2170
365 Ga0157376_10237463 3300014969 Bacteria 1696
366 Ga0183368_1004 3300015687 Bacteria 1211761
367 Ga0183360_10001 3300015689 Bacteria 3943671
368 Ga0163161_10069854 3300017792 Bacteria 2568
369 Ga0197907_10957944 3300020069 Bacteria 1296
370 Ga0206356_11098649 3300020070 Bacteria 2627
371 Ga0206356_11322499 3300020070 Bacteria 2298
372 Ga0206351_10917985 3300020077 Bacteria 2266
373 Ga0206354_11670857 3300020081 Bacteria 2083
374 Ga0206353_10228217 3300020082 Bacteria 1276
375 Ga0206353_11044475 3300020082 Bacteria 1384
376 Ga0209435_101367 3300025206 Bacteria 3127
377 Ga0209760_100727 3300025207 Bacteria 4910
378 Ga0209784_100133 3300025224 Bacteria 72169
379 Ga0209566_102250 3300025225 Bacteria 3775
380 Ga0209674_100148 3300025226 Bacteria 98100
381 Ga0209674_100269 3300025226 Bacteria 39856
382 Ga0209672_100007 3300025228 Bacteria 959482
383 Ga0209672_100029 3300025228 Bacteria 339298
384 Ga0209672_100058 3300025228 Bacteria 211992
385 Ga0209672_100434 3300025228 Bacteria 24040
386 Ga0209672_100841 3300025228 Bacteria 14165
387 Ga0209563_100051 3300025230 Bacteria 340545
388 Ga0207427_100013 3300025231 Bacteria 581419
389 Ga0207427_100033 3300025231 Bacteria 338459
390 Ga0207427_101041 3300025231 Bacteria 11548
391 Ga0209437_100015 3300025233 Bacteria 713457
392 Ga0209437_100106 3300025233 Bacteria 219071
393 Ga0209437_100352 3300025233 Bacteria 52711
394 Ga0209258_100046 3300025242 Bacteria 369794
395 Ga0209258_100053 3300025242 Bacteria 339233
396 Ga0209258_100164 3300025242 Bacteria 148838
397 Ga0209258_100413 3300025242 Bacteria 51260
398 Ga0209258_100444 3300025242 Bacteria 46475
399 Ga0209258_100991 3300025242 Bacteria 13111
400 Ga0209258_101490 3300025242 Bacteria 8031
401 Ga0207425_1000028 3300025245 Bacteria 286333
402 Ga0207425_1002659 3300025245 Bacteria 6143
403 Ga0209646_1001493 3300025246 Bacteria 6223
404 Ga0209646_1004243 3300025246 Bacteria 2641
405 Ga0209646_1009044 3300025246 Bacteria 1587
406 Ga0209026_1000074 3300025250 Bacteria 203820
407 Ga0209026_1000092 3300025250 Bacteria 170960
408 Ga0209026_1000111 3300025250 Bacteria 140599
409 Ga0209026_1001965 3300025250 Bacteria 8246
410 Ga0209677_103982 3300025253 Bacteria 4480
411 Ga0209148_1000002 3300025254 Bacteria 2399500
412 Ga0209148_1000009 3300025254 Bacteria 1395625
413 Ga0209148_1000010 3300025254 Bacteria 1265567
414 Ga0209148_1000039 3300025254 Bacteria 482479
415 Ga0209148_1000087 3300025254 Bacteria 260905
416 Ga0209148_1000098 3300025254 Bacteria 233172
417 Ga0209759_1000110 3300025256 Bacteria 144917
418 Ga0209759_1000278 3300025256 Bacteria 71965
419 Ga0209759_1000353 3300025256 Bacteria 59779
420 Ga0209759_1003639 3300025256 Bacteria 6066
421 Ga0209759_1004660 3300025256 Bacteria 5034
422 Ga0209759_1008783 3300025256 Bacteria 3119
423 Ga0209129_1000065 3300025258 Bacteria 232568
424 Ga0209233_1000009 3300025261 Bacteria 1265567
425 Ga0209233_1000080 3300025261 Bacteria 338459
426 Ga0209233_1004727 3300025261 Bacteria 4592
427 Ga0209233_1010689 3300025261 Bacteria 2736
428 Ga0209565_1000005 3300025263 Bacteria 947317
429 Ga0209455_1000010 3300025272 Bacteria 959482
430 Ga0209455_1000034 3300025272 Bacteria 483129
431 Ga0209455_1000060 3300025272 Bacteria 339298
432 Ga0209455_1000120 3300025272 Bacteria 173966
433 Ga0209455_1000211 3300025272 Bacteria 82660
434 Ga0209673_1000011 3300025273 Bacteria 586604
435 Ga0209130_1006918 3300025284 Bacteria 3590
436 Ga0209675_1000004 3300025291 Bacteria 947166
437 Ga0209675_1028589 3300025291 Bacteria 1353
438 Ga0209676_1000047 3300025292 Bacteria 408645
439 Ga0209676_1001228 3300025292 Bacteria 27113
440 Ga0209676_1003790 3300025292 Bacteria 8947
441 Ga0209676_1046886 3300025292 Bacteria 1165
442 Ga0209025_1000002 3300025294 Bacteria 1393142
443 Ga0209025_1000036 3300025294 Bacteria 404113
444 Ga0209025_1001523 3300025294 Bacteria 29655
445 Ga0209025_1002530 3300025294 Bacteria 19117
446 Ga0209025_1074280 3300025294 Bacteria 1188
447 Ga0209564_1000018 3300025295 Bacteria 586913
448 Ga0209564_1010242 3300025295 Bacteria 4347
449 Ga0209758_1000003 3300025297 Bacteria 1398533
450 Ga0209758_1001152 3300025297 Bacteria 33838
451 Ga0209758_1007625 3300025297 Bacteria 7300
452 Ga0209758_1019267 3300025297 Bacteria 3298
453 Ga0209050_1002237 3300025298 Bacteria 17278
454 Ga0209050_1029950 3300025298 Bacteria 1727
455 Ga0209256_1000021 3300025299 Bacteria 537097
456 Ga0209256_1000539 3300025299 Bacteria 54888
457 Ga0209256_1002619 3300025299 Bacteria 14223
458 Ga0209256_1002635 3300025299 Bacteria 14134
459 Ga0209256_1004402 3300025299 Bacteria 8875
460 Ga0209257_1000133 3300025304 Bacteria 208808
461 Ga0209257_1000362 3300025304 Bacteria 92009
462 Ga0209257_1002869 3300025304 Bacteria 16068
463 Ga0209257_1004114 3300025304 Bacteria 11619
464 Ga0209257_1005108 3300025304 Bacteria 9516
465 Ga0207656_10001165 3300025321 Bacteria 8642
466 Ga0207655_1022286 3300025728 Bacteria 3182
467 Ga0207710_10000934 3300025900 Bacteria 15560
468 Ga0207710_10022209 3300025900 Bacteria 2723
469 Ga0207680_10000006 3300025903 Bacteria 635950
470 Ga0207680_10028853 3300025903 Bacteria 3109
471 Ga0207680_10063513 3300025903 Unclassified 2260
472 Ga0207647_10000504 3300025904 Bacteria 31238
473 Ga0207647_10000677 3300025904 Bacteria 26730
474 Ga0207647_10001610 3300025904 Bacteria 17365
475 Ga0207647_10004217 3300025904 Bacteria 10660
476 Ga0207647_10009312 3300025904 Bacteria 6982
477 Ga0207647_10034794 3300025904 Bacteria 3213
478 Ga0207699_10000222 3300025906 Bacteria 33473
479 Ga0207645_10105586 3300025907 Bacteria 1820
480 Ga0207705_10001829 3300025909 Bacteria 16749
481 Ga0207705_10002514 3300025909 Bacteria 14134
482 Ga0207705_10004714 3300025909 Bacteria 10274
483 Ga0207705_10004985 3300025909 Bacteria 9962
484 Ga0207705_10106810 3300025909 Bacteria 2065
485 Ga0207707_10000578 3300025912 Bacteria 37213
486 Ga0207707_10001419 3300025912 Bacteria 22162
487 Ga0207707_10001729 3300025912 Bacteria 20054
488 Ga0207707_10003100 3300025912 Bacteria 14752
489 Ga0207707_10006039 3300025912 Bacteria 10596
490 Ga0207707_10030276 3300025912 Bacteria 4735
491 Ga0207707_10032224 3300025912 Bacteria 4587
492 Ga0207707_10090685 3300025912 Bacteria 2671
493 Ga0207707_10112131 3300025912 Bacteria 2384
494 Ga0207695_10000033 3300025913 Bacteria 507477
495 Ga0207695_10001058 3300025913 Bacteria 48255
496 Ga0207695_10001605 3300025913 Bacteria 36692
497 Ga0207695_10002167 3300025913 Bacteria 29675
498 Ga0207695_10004738 3300025913 Bacteria 18411
499 Ga0207695_10007278 3300025913 Bacteria 14135
500 Ga0207695_10013378 3300025913 Bacteria 9791
501 Ga0207695_10016800 3300025913 Bacteria 8546
502 Ga0207695_10016841 3300025913 Bacteria 8533
503 Ga0207695_10020794 3300025913 Bacteria 7507
504 Ga0207695_10032853 3300025913 Bacteria 5672
505 Ga0207695_10037705 3300025913 Bacteria 5213
506 Ga0207695_10049935 3300025913 Bacteria 4403
507 Ga0207695_10110706 3300025913 Bacteria 2726
508 Ga0207695_10166538 3300025913 Bacteria 2132
509 Ga0207695_10187385 3300025913 Bacteria 1988
510 Ga0207695_10245362 3300025913 Bacteria 1691
511 Ga0207695_10462887 3300025913 Bacteria 1151
512 Ga0207671_10000021 3300025914 Bacteria 300409
513 Ga0207671_10000292 3300025914 Bacteria 73798
514 Ga0207671_10004135 3300025914 Bacteria 14033
515 Ga0207671_10032312 3300025914 Bacteria 3896
516 Ga0207671_10036274 3300025914 Bacteria 3656
517 Ga0207671_10065929 3300025914 Bacteria 2694
518 Ga0207671_10198885 3300025914 Bacteria 1565
519 Ga0207671_10303947 3300025914 Bacteria 1260
520 Ga0207663_10155888 3300025916 Bacteria 1606
521 Ga0207660_10007012 3300025917 Bacteria 7298
522 Ga0207660_10018231 3300025917 Bacteria 4676
523 Ga0207660_10059800 3300025917 Bacteria 2737
524 Ga0207660_10062281 3300025917 Bacteria 2687
525 Ga0207660_10070120 3300025917 Bacteria 2547
526 Ga0207660_10072900 3300025917 Bacteria 2502
527 Ga0207657_10008479 3300025919 Bacteria 10427
528 Ga0207657_10018265 3300025919 Bacteria 6705
529 Ga0207649_10026175 3300025920 Bacteria 3410
530 Ga0207649_10032086 3300025920 Bacteria 3128
531 Ga0207649_10148275 3300025920 Bacteria 1613
532 Ga0207652_10000022 3300025921 Bacteria 158642
533 Ga0207652_10000390 3300025921 Bacteria 45701
534 Ga0207652_10003362 3300025921 Bacteria 13211
535 Ga0207652_10005539 3300025921 Bacteria 10237
536 Ga0207652_10008522 3300025921 Bacteria 8251
537 Ga0207652_10044028 3300025921 Bacteria 3802
538 Ga0207652_10103776 3300025921 Bacteria 2514
539 Ga0207652_10189655 3300025921 Bacteria 1849
540 Ga0207694_10001330 3300025924 Bacteria 21257
541 Ga0207694_10004279 3300025924 Bacteria 11175
542 Ga0207694_10005966 3300025924 Bacteria 9333
543 Ga0207694_10011925 3300025924 Bacteria 6554
544 Ga0207694_10044992 3300025924 Bacteria 3409
545 Ga0207694_10115403 3300025924 Bacteria 2139
546 Ga0207694_10209248 3300025924 Bacteria 1588
547 Ga0207694_10296739 3300025924 Bacteria 1330
548 Ga0207650_10008638 3300025925 Bacteria 6955
549 Ga0207659_10011103 3300025926 Bacteria 5682
550 Ga0207664_10000235 3300025929 Bacteria 41962
551 Ga0207664_10011140 3300025929 Bacteria 6374
552 Ga0207690_10000913 3300025932 Bacteria 18868
553 Ga0207690_10004594 3300025932 Bacteria 8161
554 Ga0207690_10010359 3300025932 Bacteria 5537
555 Ga0207690_10029874 3300025932 Bacteria 3469
556 Ga0207690_10032193 3300025932 Bacteria 3362
557 Ga0207690_10035611 3300025932 Bacteria 3217
558 Ga0207690_10054269 3300025932 Bacteria 2694
559 Ga0207690_10058416 3300025932 Bacteria 2609
560 Ga0207706_10022271 3300025933 Bacteria 5686
561 Ga0207706_10055705 3300025933 Bacteria 3486
562 Ga0207709_10017863 3300025935 Bacteria 3966
563 Ga0207670_10005647 3300025936 Bacteria 6882
564 Ga0207704_10090033 3300025938 Bacteria 2012
565 Ga0207665_10010651 3300025939 Bacteria 6040
566 Ga0207711_10000411 3300025941 Bacteria 45483
567 Ga0207711_10162762 3300025941 Bacteria 2021
568 Ga0207689_10132399 3300025942 Bacteria 2052
569 Ga0207661_10004890 3300025944 Bacteria 9390
570 Ga0207661_10052160 3300025944 Bacteria 3266
571 Ga0207661_10262590 3300025944 Bacteria 1538
572 Ga0207679_10141999 3300025945 Bacteria 1942
573 Ga0207679_10276455 3300025945 Bacteria 1438
574 Ga0207667_10000142 3300025949 Bacteria 109610
575 Ga0207667_10000198 3300025949 Bacteria 87446
576 Ga0207667_10001230 3300025949 Bacteria 32103
577 Ga0207667_10001994 3300025949 Bacteria 25606
578 Ga0207667_10005471 3300025949 Bacteria 15483
579 Ga0207667_10008565 3300025949 Bacteria 12139
580 Ga0207667_10024202 3300025949 Bacteria 6672
581 Ga0207667_10040901 3300025949 Bacteria 4934
582 Ga0207667_10047035 3300025949 Bacteria 4568
583 Ga0207667_10056633 3300025949 Bacteria 4117
584 Ga0207651_10098631 3300025960 Bacteria 2161
585 Ga0207712_10001488 3300025961 Bacteria 15904
586 Ga0207712_10001504 3300025961 Bacteria 15809
587 Ga0207712_10295140 3300025961 Bacteria 1328
588 Ga0207640_10000014 3300025981 Bacteria 219683
589 Ga0207640_10000016 3300025981 Bacteria 208390
590 Ga0207640_10002697 3300025981 Bacteria 9505
591 Ga0207640_10009566 3300025981 Bacteria 5432
592 Ga0207640_10064612 3300025981 Bacteria 2438
593 Ga0207640_10067102 3300025981 Bacteria 2399
594 Ga0207640_10169824 3300025981 Bacteria 1624
595 Ga0207658_10000093 3300025986 Bacteria 98928
596 Ga0207658_10014676 3300025986 Bacteria 5367
597 Ga0207658_10031098 3300025986 Bacteria 3787
598 Ga0207658_10058641 3300025986 Unclassified 2865
599 Ga0207658_10275731 3300025986 Bacteria 1439
600 Ga0207703_10000734 3300026035 Bacteria 32244
601 Ga0207703_10000802 3300026035 Bacteria 30959
602 Ga0207703_10001191 3300026035 Bacteria 24462
603 Ga0207703_10369464 3300026035 Bacteria 1325
604 Ga0207703_10579792 3300026035 Bacteria 1060
605 Ga0207639_10000374 3300026041 Bacteria 30955
606 Ga0207639_10001926 3300026041 Bacteria 13943
607 Ga0207639_10005288 3300026041 Bacteria 8715
608 Ga0207639_10006208 3300026041 Bacteria 8117
609 Ga0207639_10006318 3300026041 Bacteria 8045
610 Ga0207639_10028040 3300026041 Bacteria 4107
611 Ga0207639_10084920 3300026041 Bacteria 2516
612 Ga0207678_10000619 3300026067 Bacteria 32528
613 Ga0207678_10004139 3300026067 Bacteria 13034
614 Ga0207678_10006047 3300026067 Bacteria 10765
615 Ga0207678_10012768 3300026067 Bacteria 7377
616 Ga0207678_10029974 3300026067 Bacteria 4750
617 Ga0207678_10042614 3300026067 Bacteria 3931
618 Ga0207678_10124365 3300026067 Bacteria 2201
619 Ga0207678_10170381 3300026067 Bacteria 1859
620 Ga0207702_10000170 3300026078 Bacteria 77504
621 Ga0207702_10003761 3300026078 Bacteria 13704
622 Ga0207702_10011516 3300026078 Bacteria 7369
623 Ga0207702_10097457 3300026078 Bacteria 2588
624 Ga0207702_10191442 3300026078 Bacteria 1890
625 Ga0207641_10001117 3300026088 Bacteria 26998
626 Ga0207641_10058664 3300026088 Unclassified 3276
627 Ga0207641_10381244 3300026088 Bacteria 1350
628 Ga0207641_10398813 3300026088 Bacteria 1320
629 Ga0207676_10197284 3300026095 Bacteria 1776
630 Ga0207674_10000623 3300026116 Bacteria 46466
631 Ga0207674_10001397 3300026116 Bacteria 31130
632 Ga0207674_10016247 3300026116 Bacteria 8152
633 Ga0207674_10026041 3300026116 Bacteria 6224
634 Ga0207674_10030846 3300026116 Bacteria 5635
635 Ga0207674_10050111 3300026116 Bacteria 4268
636 Ga0207674_10064493 3300026116 Bacteria 3695
637 Ga0207674_10421608 3300026116 Bacteria 1290
638 Ga0207675_100162159 3300026118 Bacteria 2133
639 Ga0207675_100306075 3300026118 Bacteria 1549
640 Ga0207698_10001202 3300026142 Bacteria 15100
641 Ga0207698_10001610 3300026142 Bacteria 13138
642 Ga0207698_10005754 3300026142 Bacteria 7692
643 Ga0209371_1000004 3300027312 Bacteria 1098197
644 Ga0209371_1000011 3300027312 Bacteria 848456
645 Ga0209969_1002780 3300027360 Bacteria 2424
646 Ga0210002_1000841 3300027617 Bacteria 4195
647 Ga0207428_10060265 3300027907 Bacteria 3007
648 Ga0268266_10000001 3300028379 Bacteria 4040580
649 Ga0268266_10000006 3300028379 Bacteria 1410021
650 Ga0268266_10000043 3300028379 Bacteria 316604
651 Ga0268266_10002855 3300028379 Bacteria 18003
652 Ga0268266_10002895 3300028379 Bacteria 17786
653 Ga0268266_10031831 3300028379 Bacteria 4481
654 Ga0268266_10062485 3300028379 Bacteria 3215
655 Ga0268266_10248304 3300028379 Bacteria 1645
656 Ga0268266_10288577 3300028379 Bacteria 1527
657 Ga0268265_10055779 3300028380 Bacteria 3004
658 Ga0268264_10000293 3300028381 Bacteria 83870
659 Ga0268264_10054427 3300028381 Bacteria 3341
660 Ga0268264_10067856 3300028381 Bacteria 3011
661 Ga0268264_10171012 3300028381 Unclassified 1965
662 Ga0268264_10353112 3300028381 Bacteria 1400
663 Ga0265334_10000015 3300028573 Bacteria 150318
664 Ga0265334_10004047 3300028573 Bacteria 6574
665 Ga0265318_10003682 3300028577 Bacteria 7656
666 Ga0265338_10036293 3300028800 Bacteria 4720
667 Ga0268256_1000005 3300030500 Bacteria 1082342
668 Ga0268256_1000011 3300030500 Bacteria 848625
669 Ga0316176_1094510 3300030732 Bacteria 1504
670 Ga0265328_10010215 3300031239 Bacteria 3785
671 Ga0265320_10015039 3300031240 Bacteria 4383
672 Ga0265316_10021492 3300031344 Bacteria 5464
673 Ga0265316_10131573 3300031344 Bacteria 1884
674 Ga0307513_10024959 3300031456 Bacteria 6940
675 Ga0307509_10000017 3300031507 Bacteria 265012
676 Ga0307408_100003986 3300031548 Bacteria 10064
677 Ga0307408_100167188 3300031548 Bacteria 1753
678 Ga0265313_10002491 3300031595 Bacteria 15868
679 Ga0265313_10041420 3300031595 Bacteria 2269
680 Ga0316575_10002942 3300031665 Bacteria 5801
681 Ga0316579_10080255 3300031691 Bacteria 1553
682 Ga0316576_10059061 3300031727 Bacteria 2806
683 Ga0307405_10015248 3300031731 Bacteria 4157
684 Ga0307405_10028736 3300031731 Bacteria 3242
685 Ga0316577_10002497 3300031733 Bacteria 9135
686 Ga0316577_10057023 3300031733 Bacteria 2181
687 Ga0307413_10055894 3300031824 Bacteria 2404
688 Ga0307413_10283373 3300031824 Bacteria 1247
689 Ga0307413_10370001 3300031824 Bacteria 1113
690 Ga0307410_10001595 3300031852 Bacteria 10400
691 Ga0307406_10029620 3300031901 Bacteria 3316
692 Ga0307407_10005839 3300031903 Bacteria 5394
693 Ga0307407_10165348 3300031903 Bacteria 1452
694 Ga0307407_10340612 3300031903 Bacteria 1058
695 Ga0307412_10016096 3300031911 Bacteria 4446
696 Ga0307412_10248530 3300031911 Bacteria 1380
697 Ga0307409_100283503 3300031995 Bacteria 1532
698 Ga0307416_100001112 3300032002 Bacteria 14440
699 Ga0307416_100066445 3300032002 Bacteria 2969
700 Ga0307414_10069220 3300032004 Bacteria 2536
701 Ga0307411_10000563 3300032005 Bacteria 13225
702 Ga0307411_10168620 3300032005 Bacteria 1648
703 Ga0307411_10276872 3300032005 Bacteria 1333
704 Ga0307415_100000772 3300032126 Bacteria 14475
705 Ga0307507_10225759 3300033179 Bacteria 1251
706 Ga0307510_10000002 3300033180 Bacteria 801565
707 Ga0307510_10000233 3300033180 Bacteria 49994
708 Ga0316574_0133934 3300035398 Bacteria 1595
709 Ga0373927_0000002 3300035695 Bacteria 966219
710 Ga0373933_0008933 3300035724 Bacteria 5466
711 Ga0316584_0144292 3300036712 Bacteria 1774
712 Ga0395899_0000309 3300037312 Bacteria 62448
713 Ga0395899_0001578 3300037312 Bacteria 19176
714 Ga0395899_0028102 3300037312 Bacteria 4237
715 Ga0395899_0033120 3300037312 Bacteria 3882
716 Ga0395900_0000163 3300037418 Bacteria 109199
717 Ga0395900_0002478 3300037418 Bacteria 20291
718 Ga0395900_0003412 3300037418 Bacteria 17173
719 Ga0395900_0008384 3300037418 Bacteria 10638
720 Ga0395900_0011470 3300037418 Bacteria 9071
721 Ga0395900_0068100 3300037418 Bacteria 3657
722 Ga0395900_0069483 3300037418 Bacteria 3620
723 Ga0395900_0282558 3300037418 Bacteria 1651
724 Ga0395898_0000144 3300037466 Bacteria 187889
725 Ga0395898_0000305 3300037466 Bacteria 116565
726 Ga0395898_0025292 3300037466 Bacteria 5984
727 Ga0395898_0026570 3300037466 Bacteria 5822
728 Ga0395898_0140963 3300037466 Bacteria 2308
729 Ga0395898_0343110 3300037466 Bacteria 1424
730 Ga0395905_0001012 3300037471 Bacteria 35880
731 Ga0395905_0353689 3300037471 Bacteria 1361
732 Ga0395901_0009632 3300038443 Bacteria 9801
733 Ga0395901_0011011 3300038443 Bacteria 9163
734 Ga0395901_0028170 3300038443 Bacteria 5778
735 Ga0395901_0070506 3300038443 Bacteria 3641
736 Ga0395901_0136557 3300038443 Bacteria 2577
737 Ga0395901_0148164 3300038443 Bacteria 2466
738 Ga0395901_0193979 3300038443 Bacteria 2130
739 Ga0395901_0212471 3300038443 Bacteria 2024
740 Ga0395901_0261349 3300038443 Bacteria 1802
741 Ga0237819_03353 3300038705 Bacteria 2872
742 Ga0400489_43493 3300039093 Bacteria 1935
743 Ga0400489_65269 3300039093 Unclassified 3227
744 Ga0237816_00097 3300039145 Bacteria 6479
745 Ga0436365_1276167 3300039437 Bacteria 1358
746 Ga0436363_0328143 3300039450 Bacteria 5546
747 Ga0439447_003716 3300041407 Bacteria 5377
748 Ga0439461_0013007 3300041410 Bacteria 1565
749 Ga0451791_0790747 3300041451 Bacteria 4124
750 Ga0451793_1323418 3300041452 Bacteria 1122
751 Ga0451797_1149682 3300041453 Bacteria 1889
752 Ga0451800_0043135 3300041459 Bacteria 15391
753 Ga0451800_0844354 3300041459 Bacteria 1187
754 Ga0451806_227471 3300041462 Bacteria 9726
755 Ga0451807_0696539 3300041486 Bacteria 6801
756 Ga0451807_1184572 3300041486 Bacteria 5477
757 Ga0451807_1852622 3300041486 Bacteria 2506
758 Ga0451841_0914442 3300041498 Unclassified 1845
759 Ga0451843_0048063 3300041509 Bacteria 1453
760 Ga0451843_1201883 3300041509 Bacteria 1634
761 Ga0451853_0743661 3300041512 Bacteria 1457
762 Ga0439433_0028572 3300041999 Bacteria 1269
763 Ga0439449_0057096 3300042007 Bacteria 1441
764 Ga0439456_036297 3300042013 Bacteria 1063
765 Ga0450894_002938 3300042131 Bacteria 2258
766 Ga0450896_003162 3300042133 Bacteria 2172
767 Ga0439446_0051666 3300042156 Bacteria 1229
768 Ga0450908_000229 3300042184 Bacteria 11277
769 Ga0451577_0002744 3300042876 Bacteria 20405
770 Ga0451577_0004710 3300042876 Bacteria 14314
771 Ga0451577_0095577 3300042876 Bacteria 2653
772 Ga0451577_0107004 3300042876 Bacteria 2500
773 Ga0466969_0003624 3300044656 Bacteria 8219
774 Ga0466972_0001350 3300044658 Bacteria 11881
775 Ga0466972_0029651 3300044658 Bacteria 2693
776 Ga0466982_0000004 3300044672 Bacteria 386724
777 Ga0466965_0008083 3300044683 Bacteria 4860
778 Ga0466966_0011778 3300044684 Bacteria 5794
779 Ga0466966_0056156 3300044684 Bacteria 2491
780 Ga0466966_0120907 3300044684 Bacteria 1608
781 Ga0466961_0000946 3300044693 Bacteria 17985
782 Ga0466961_0006538 3300044693 Bacteria 7411
783 Ga0466961_0020260 3300044693 Bacteria 4278
784 Ga0466961_0028864 3300044693 Bacteria 3567
785 Ga0453684_0013282 3300044712 Bacteria 13410
786 Ga0453684_0154833 3300044712 Bacteria 2719
787 Ga0453684_0277213 3300044712 Bacteria 1914
788 Ga0466971_0011479 3300044719 Bacteria 3878
789 Ga0466971_0029561 3300044719 Bacteria 2451
790 Ga0466970_0003008 3300044765 Bacteria 8177
791 Ga0466970_0006449 3300044765 Bacteria 5868
792 Ga0466970_0018394 3300044765 Bacteria 3616
793 Ga0466970_0035184 3300044765 Bacteria 2653
794 Ga0466970_0047948 3300044765 Bacteria 2277
795 Ga0466957_0000516 3300044842 Bacteria 19357
796 Ga0466957_0253270 3300044842 Bacteria 1171
797 Ga0466959_0007966 3300045049 Bacteria 7463
798 Ga0466959_0021228 3300045049 Bacteria 4788
799 Ga0466959_0052826 3300045049 Bacteria 2974
800 Ga0466959_0070991 3300045049 Bacteria 2522
801 Ga0466959_0092683 3300045049 Bacteria 2168
802 Ga0466958_0063566 3300045836 Bacteria 2251
803 Ga0466958_0211287 3300045836 Bacteria 1236
804 Ga0466967_0449729 3300045976 Bacteria 1259
805 Ga0495638_0000094 3300046460 Bacteria 142168
806 Ga0495638_0008208 3300046460 Bacteria 7422
807 Ga0495650_0000027 3300046471 Bacteria 475071
808 Ga0495650_0000078 3300046471 Bacteria 245487
809 Ga0495606_0094497 3300046507 Bacteria 1832
810 Ga0495622_0029037 3300046557 Bacteria 2584
811 Ga0495633_0020840 3300046558 Bacteria 3289
812 Ga0495633_0171164 3300046558 Bacteria 1001
813 Ga0495668_0005550 3300046616 Bacteria 8495
814 Ga0495625_0011559 3300046660 Bacteria 7189
815 Ga0495625_0033091 3300046660 Bacteria 3826
816 Ga0495659_0005813 3300046664 Bacteria 3893
817 Ga0495649_0015687 3300046694 Bacteria 4307
818 Ga0495686_0035377 3300047472 Bacteria 3211
819 Ga0496100_0010485 3300048903 Bacteria 5248
820 Ga0496101_0001877 3300048904 Bacteria 12689
821 Ga0496101_0228940 3300048904 Bacteria 1444
822 Ga0496102_0175832 3300048905 Bacteria 2016
823 Ga0496104_0858165 3300048907 Bacteria 813
824 Ga0496105_0005421 3300048908 Bacteria 9678
825 Ga0496107_0077961 3300048910 Bacteria 2414
826 Ga0496108_0041356 3300048911 Bacteria 3848
827 Ga0496109_0162354 3300048912 Bacteria 2093
828 Ga0496110_0192786 3300048913 Bacteria 1850
829 Ga0496111_0111864 3300048914 Bacteria 2011
830 Ga0496113_0031778 3300048916 Bacteria 3834
831 Ga0496113_0160888 3300048916 Bacteria 1775
832 Ga0496113_0338231 3300048916 Bacteria 1207
833 Ga0496114_0000933 3300048917 Bacteria 21868
834 Ga0496114_0322788 3300048917 Bacteria 1364
835 Ga0496115_0000032 3300048918 Bacteria 136928
836 Ga0496115_0005442 3300048918 Bacteria 9261
837 Ga0496115_0020292 3300048918 Bacteria 5125
838 Ga0496115_0195007 3300048918 Bacteria 1673
839 Ga0496115_0205476 3300048918 Bacteria 1627
840 Ga0496116_0003550 3300048919 Bacteria 15344
841 Ga0496116_0039310 3300048919 Bacteria 3273
842 Ga0496117_0000140 3300048920 Bacteria 158390
843 Ga0496117_0010288 3300048920 Bacteria 8556
844 Ga0496117_0010696 3300048920 Bacteria 8302
845 Ga0496117_0015129 3300048920 Bacteria 6603
846 Ga0496117_0027762 3300048920 Bacteria 4399
847 Ga0496117_0063260 3300048920 Bacteria 2530
848 Ga0496118_0000102 3300048921 Bacteria 158228
849 Ga0496118_0000880 3300048921 Bacteria 47321
850 Ga0496118_0000955 3300048921 Bacteria 45248
851 Ga0496118_0001297 3300048921 Bacteria 38064
852 Ga0496118_0001780 3300048921 Bacteria 31106
853 Ga0496118_0012943 3300048921 Bacteria 7943
854 Ga0496118_0014401 3300048921 Bacteria 7406
855 Ga0496118_0031489 3300048921 Bacteria 4395
856 Ga0496119_0000131 3300048922 Bacteria 105813
857 Ga0496119_0001546 3300048922 Bacteria 27486
858 Ga0496119_0004641 3300048922 Bacteria 13558
859 Ga0496119_0016319 3300048922 Bacteria 5659
860 Ga0496120_0001431 3300048923 Bacteria 28786
861 Ga0496120_0008466 3300048923 Bacteria 7464
862 Ga0496120_0013980 3300048923 Bacteria 5371
863 Ga0496120_0014910 3300048923 Bacteria 5152
864 Ga0496121_0003311 3300048924 Bacteria 23135
865 Ga0496121_0011146 3300048924 Bacteria 10024
866 Ga0496121_0011290 3300048924 Bacteria 9948
867 Ga0496121_0029198 3300048924 Bacteria 5109
868 Ga0496121_0032860 3300048924 Bacteria 4707
869 Ga0496121_0054691 3300048924 Bacteria 3333
870 Ga0496121_0058645 3300048924 Bacteria 3180
871 Ga0496121_0152730 3300048924 Bacteria 1697
872 Ga0496122_0000560 3300048925 Bacteria 76145
873 Ga0496122_0001084 3300048925 Bacteria 47272
874 Ga0496122_0019108 3300048925 Bacteria 6282
875 Ga0496122_0024697 3300048925 Bacteria 5250
876 Ga0496123_0000647 3300048926 Bacteria 58089
877 Ga0496123_0001603 3300048926 Bacteria 30651
878 Ga0496123_0008306 3300048926 Bacteria 9557
879 Ga0496123_0095356 3300048926 Bacteria 1750
880 Ga0496124_0000009 3300048927 Bacteria 734820
881 Ga0496124_0001249 3300048927 Bacteria 39002
882 Ga0496124_0015214 3300048927 Bacteria 7385
883 Ga0496124_0025530 3300048927 Bacteria 5350
884 Ga0496124_0079522 3300048927 Bacteria 2699
885 Ga0496125_0000338 3300048928 Bacteria 89749
886 Ga0496125_0000813 3300048928 Bacteria 50736
887 Ga0496125_0074511 3300048928 Unclassified 2631
888 Ga0496125_0119145 3300048928 Unclassified 1888
889 Ga0496126_0000925 3300048929 Bacteria 50764
890 Ga0496126_0033341 3300048929 Bacteria 4845
891 Ga0496126_0075605 3300048929 Bacteria 2989
892 Ga0496126_0093327 3300048929 Bacteria 2643
893 Ga0496126_0101027 3300048929 Bacteria 2523
894 Ga0496126_0204570 3300048929 Bacteria 1665
895 Ga0496126_0237999 3300048929 Unclassified 1522
896 Ga0496126_0289276 3300048929 Unclassified 1355
897 Ga0496126_0454901 3300048929 Bacteria 1030
898 Ga0501031_0092333 3300049568 Bacteria 1975
899 Ga0501032_0024280 3300049569 Bacteria 4187
900 Ga0501032_0124634 3300049569 Bacteria 1702
901 Ga0501032_0229841 3300049569 Bacteria 1206
902 Ga0501033_0014100 3300049570 Bacteria 6077
903 Ga0501033_0033971 3300049570 Bacteria 3827
904 Ga0501033_0166299 3300049570 Bacteria 1585
905 Ga0501033_0338496 3300049570 Bacteria 1055
906 Ga0501034_0001783 3300049571 Bacteria 27492
907 Ga0501034_0002029 3300049571 Bacteria 25488
908 Ga0501034_0019163 3300049571 Bacteria 7005
909 Ga0501034_0134835 3300049571 Bacteria 2450
910 Ga0501034_0158367 3300049571 Bacteria 2237
911 Ga0501034_0360241 3300049571 Bacteria 1382
912 Ga0501034_0363297 3300049571 Bacteria 1374
913 Ga0501034_0479543 3300049571 Bacteria 1159
914 Ga0501036_0015065 3300049572 Bacteria 6453
915 Ga0501036_0151227 3300049572 Bacteria 1958
916 Ga0501037_0023125 3300049573 Bacteria 4597
917 Ga0501037_0029500 3300049573 Bacteria 4053
918 Ga0501037_0047342 3300049573 Bacteria 3151
919 Ga0501038_0052046 3300049574 Bacteria 3531
920 Ga0501038_0084957 3300049574 Bacteria 2662
921 Ga0501038_0094416 3300049574 Bacteria 2500
922 Ga0501038_0105071 3300049574 Bacteria 2346
923 Ga0501038_0169538 3300049574 Bacteria 1768
924 Ga0501038_0235756 3300049574 Bacteria 1454
925 Ga0501039_0009425 3300049575 Bacteria 7442
926 Ga0501040_0023303 3300049576 Bacteria 4151
927 Ga0501041_0034229 3300049577 Bacteria 3075
928 Ga0501041_0285374 3300049577 Bacteria 1039
929 Ga0501042_0029618 3300049578 Bacteria 3861
930 Ga0501043_0000496 3300049579 Bacteria 35374
931 Ga0501043_0029223 3300049579 Bacteria 4329
932 Ga0501043_0050226 3300049579 Bacteria 3278
933 Ga0501043_0067859 3300049579 Bacteria 2800
934 Ga0501043_0101501 3300049579 Bacteria 2261
935 Ga0501043_0255835 3300049579 Bacteria 1348
936 Ga0501046_0062128 3300049580 Bacteria 2919
937 Ga0501047_0001140 3300049581 Bacteria 26350
938 Ga0501047_0007292 3300049581 Bacteria 10394
939 Ga0501047_0023799 3300049581 Bacteria 5880
940 Ga0501047_0059351 3300049581 Bacteria 3693
941 Ga0501047_0133726 3300049581 Bacteria 2360
942 Ga0501047_0148832 3300049581 Bacteria 2217
943 Ga0501047_0257612 3300049581 Bacteria 1592
944 Ga0501047_0450570 3300049581 Bacteria 1116
945 Ga0501048_0016783 3300049582 Bacteria 5397
946 Ga0501048_0132080 3300049582 Bacteria 1765
947 Ga0501048_0139155 3300049582 Bacteria 1716
948 Ga0501048_0215406 3300049582 Bacteria 1362
949 Ga0501067_0052188 3300049583 Bacteria 2265
950 Ga0501068_0006207 3300049584 Bacteria 6573
951 Ga0501068_0034604 3300049584 Bacteria 3012
952 Ga0501068_0187634 3300049584 Bacteria 1309
953 Ga0501068_0275921 3300049584 Bacteria 1074
954 Ga0501069_0001130 3300049585 Bacteria 12879
955 Ga0501069_0002195 3300049585 Bacteria 9822
956 Ga0501069_0012617 3300049585 Bacteria 4494
957 Ga0501069_0024698 3300049585 Bacteria 3279
958 Ga0501070_0000311 3300049586 Bacteria 44330
959 Ga0501070_0002127 3300049586 Bacteria 17382
960 Ga0501070_0002625 3300049586 Bacteria 15701
961 Ga0501070_0014841 3300049586 Bacteria 6554
962 Ga0501070_0022398 3300049586 Bacteria 5292
963 Ga0501070_0031449 3300049586 Bacteria 4447
964 Ga0501070_0034110 3300049586 Bacteria 4257
965 Ga0501070_0059879 3300049586 Bacteria 3156
966 Ga0501070_0090362 3300049586 Bacteria 2534
967 Ga0501070_0188158 3300049586 Bacteria 1697
968 Ga0501070_0201633 3300049586 Bacteria 1634
969 Ga0501070_0345081 3300049586 Bacteria 1209
970 Ga0501071_0003538 3300049587 Bacteria 9773
971 Ga0501071_0009446 3300049587 Bacteria 6496
972 Ga0501072_0044654 3300049588 Bacteria 3484
973 Ga0501072_0051742 3300049588 Bacteria 3234
974 Ga0501073_0006399 3300049589 Bacteria 8768
975 Ga0501073_0013127 3300049589 Bacteria 6039
976 Ga0501074_0037381 3300049590 Bacteria 3519
977 Ga0501074_0078440 3300049590 Bacteria 2370
978 Ga0501074_0204688 3300049590 Bacteria 1406
979 Ga0501075_0038876 3300049591 Bacteria 3558
980 Ga0501076_0113941 3300049592 Bacteria 2188
981 Ga0501076_0479841 3300049592 Bacteria 1024
982 Ga0501077_0050341 3300049593 Bacteria 2648
983 Ga0501077_0143043 3300049593 Bacteria 1517
984 Ga0501202_005533 3300049652 Bacteria 2239
985 Ga0501252_001883 3300049682 Bacteria 2018
986 Ga0501225_0036472 3300049705 Bacteria 1355
987 Ga0501079_0101847 3300049741 Bacteria 2227
988 Ga0501079_0251125 3300049741 Bacteria 1382
989 Ga0501080_0002966 3300049742 Bacteria 14930
990 Ga0501080_0011069 3300049742 Bacteria 8255
991 Ga0501080_0023665 3300049742 Bacteria 5690
992 Ga0501080_0040846 3300049742 Bacteria 4325
993 Ga0501080_0088000 3300049742 Bacteria 2885
994 Ga0501080_0119484 3300049742 Bacteria 2443
995 Ga0501080_0146971 3300049742 Bacteria 2179
996 Ga0501080_0152329 3300049742 Bacteria 2137
997 Ga0501080_0215751 3300049742 Bacteria 1757
998 Ga0501081_0018189 3300049743 Bacteria 4665
999 Ga0501081_0026486 3300049743 Bacteria 3911
1000 Ga0501081_0037240 3300049743 Bacteria 3318
1001 Ga0501081_0038763 3300049743 Bacteria 3258
1002 Ga0501081_0175373 3300049743 Bacteria 1549
1003 Ga0501083_0001933 3300049744 Bacteria 14251
1004 Ga0501268_007367 3300049765 Bacteria 1640
1005 Ga0501270_005293 3300049767 Bacteria 1494
1006 Ga0501035_0021058 3300049822 Bacteria 5994
1007 Ga0501035_0058490 3300049822 Bacteria 3434
1008 Ga0501035_0107029 3300049822 Bacteria 2451
1009 Ga0501035_0124980 3300049822 Bacteria 2246
1010 Ga0501035_0187509 3300049822 Bacteria 1779
1011 Ga0501035_0200083 3300049822 Bacteria 1714
1012 Ga0501035_0253760 3300049822 Bacteria 1493
1013 Ga0501035_0426102 3300049822 Bacteria 1101
1014 Ga0501044_0008911 3300049823 Bacteria 10966
1015 Ga0501044_0018635 3300049823 Bacteria 7434
1016 Ga0501044_0032184 3300049823 Bacteria 5513
1017 Ga0501044_0037048 3300049823 Bacteria 5100
1018 Ga0501044_0073236 3300049823 Bacteria 3482
1019 Ga0501044_0081840 3300049823 Bacteria 3268
1020 Ga0501044_0087059 3300049823 Bacteria 3155
1021 Ga0501044_0091349 3300049823 Bacteria 3071
1022 Ga0501044_0098277 3300049823 Bacteria 2947
1023 Ga0501044_0106247 3300049823 Bacteria 2819
1024 Ga0501044_0234806 3300049823 Bacteria 1780
1025 Ga0501045_0050182 3300049824 Bacteria 3044
1026 nmdc:mga08y16_90845_c1 3300050511 Bacteria 3183
1027 nmdc:mga0rr50_189198_c1 3300050513 Unclassified 1686
1028 nmdc:mga0a205_3120_c1 3300050515 Bacteria 14709
1029 Ga0500610_0090838 3300053079 Bacteria 1586
1030 Ga0500643_007517 3300053087 Bacteria 4378
1031 Ga0500583_0034295 3300053092 Unclassified 2255
1032 Ga0500651_0037918 3300053093 Bacteria 3036
1033 Ga0500651_0122514 3300053093 Bacteria 1577
1034 Ga0500641_0000743 3300053096 Bacteria 11809
1035 Ga0500641_0017371 3300053096 Bacteria 2690
1036 Ga0500597_000111 3300053120 Bacteria 16697
1037 Ga0500634_0007244 3300053161 Bacteria 5448
1038 Ga0501084_0039591 3300054114 Bacteria 3942
1039 Ga0501082_0000672 3300060353 Bacteria 30077
1040 Ga0501082_0034095 3300060353 Bacteria 4391
1041 Ga0501082_0176585 3300060353 Bacteria 1857
1042 Ga0466962_0004616 3300061719 Bacteria 6613
1043 Ga0466962_0017050 3300061719 Bacteria 3499
1044 Ga0530510_0034971 3300061734 Bacteria 3621
1045 2538832381 2537561836 Bacteria 3910579
1046 2547501526 2547132130 Bacteria 4660562
1047 2578459056 2576861471 Bacteria 4648976
1048 2643830399 2643221562 Bacteria 4048635
1049 2643894138 2643221577 Bacteria 3710843
1050 2644476341 2643221685 Bacteria 3673288
1051 2687582302 2687453130 Bacteria 4227172
1052 2739730554 2739367700 Bacteria 4747630
1053 2747950075 2747842428 Bacteria 4689383
1054 2748015964 2747842501 Bacteria 5293829
1055 2765578328 2765235840 Bacteria 4663337
1056 2816516346 2816332141 Bacteria 4436036
1057 2819663667 2818991457 Bacteria 5323295
1058 2842392943 2842391507 Bacteria 4486072
1059 2842758719 2842757796 Bacteria 3981385
1060 2842781217 2842780639 Bacteria 4337790
1061 2852686362 2852684882 Bacteria 5463342
1062 2874220948 2874220319 Bacteria 4594709
1063 2884413281 2884411467 Bacteria 5246714
1064 2895398848 2895395659 Bacteria 3983269
1065 2895500868 2895498888 Bacteria 5283788
1066 2895516263 2895511927 Bacteria 6802080
1067 2895523819 2895522137 Bacteria 3284416
1068 2895526599 2895525241 Bacteria 3388457
1069 2919091157 2919089067 Bacteria 4560942
1070 2919132479 2919130084 Bacteria 5301837
1071 2919136808 2919134579 Bacteria 4480386
1072 2928497790 2928496128 Bacteria 4631123
1073 2928964381 2928963466 Bacteria 5165703
1074 2929197053 2929195423 Bacteria 5325372
1075 2931381407 2931380184 Bacteria 4455911
1076 2937611769 2937610967 Bacteria 4618818
1077 2939612405 2939611941 Bacteria 3892017
1078 2939626687 2939622612 Bacteria 4698046
1079 2939627708 2939626828 Bacteria 4695272
1080 2961047713 2961047084 Bacteria 4594415
1081 2961067054 2961064222 Bacteria 4749990
1082 2987608272 2987605356 Bacteria 4187822
1083 8002869479 8002869464 Bacteria 3588529
1084 8003016477 8003014200 Bacteria 4059994
1085 8021648551 8021648035 Bacteria 4772378
1086 Ga0207660_10015836
1087 JGI24741J21665_1000582
1088 JGI24741J21665_1000998
1089 JGI24741J21665_1005282
1090 JGI24740J21852_10006312
1091 JGI24740J21852_10011109
1092 JGI24739J22299_10000076
1093 JGI24737J22298_10000304
1094 JGI24737J22298_10020632
1095 JGI24735J21928_10005423
1096 JGI25156J39149_1006923
1097 JGI25162J39368_1000260
1098 JGI25162J39368_1000752
1099 JGI25162J39368_1000979
1100 JGI25162J39368_1006678
1101 JGI25154J39366_1010699
1102 JGI25157J39369_1000236
1103 JGI25157J39369_1000364
1104 JGI25157J39369_1002550
1105 JGI25157J39369_1004633
1106 JGI25163J39215_1002102
1107 JGI25164J39214_1000035
1108 JGI25164J39214_1000133
1109 JGI25152J39213_1000018
1110 JGI25150J39212_1000159
1111 JGI25151J46595_10000106
1112 JGI25151J46595_10000111
1113 JGI25151J46595_10056892
1114 JGI25165J46597_1000255
1115 JGI25165J46597_1000397
1116 JGI25153J46596_10000085
1117 JGI25153J46596_10013672
1118 rootH1_10000986
1119 rootH2_10017930
1120 rootH1_10094545
1121 rootH1_10265301
1122 Ga0055538_1000340
1123 Ga0055539_1008553
1124 Ga0055533_1001312
1125 Ga0055525_1000089
1126 Ga0055527_1000084
1127 Ga0055535_1000317
1128 Ga0055535_1000349
1129 Ga0055535_1000374
1130 Ga0055535_1000579
1131 Ga0055535_1001574
1132 Ga0055542_1000082
1133 Ga0055542_1000195
1134 Ga0055542_1000327
1135 Ga0055542_1000375
1136 Ga0055542_1000600
1137 Ga0055529_1000228
1138 Ga0055529_1000254
1139 Ga0055529_1000507
1140 Ga0055529_1000613
1141 Ga0055529_1001360
1142 Ga0055526_1000011
1143 Ga0055526_1008071
1144 Ga0055537_1000007
1145 Ga0055524_1000034
1146 Ga0055524_1025274
1147 Ga0055536_1000574
1148 Ga0055536_1003563
1149 Ga0055536_1012015
1150 Ga0055536_1017437
1151 Ga0055534_1000013
1152 Ga0055528_1000005
1153 Ga0055530_10002885
1154 Ga0055531_10004761
1155 Ga0055531_10006099
1156 Ga0055531_10026539
1157 Ga0058692_1000002
1158 Ga0058692_1000020
1159 Ga0065165_1004080
1160 Ga0065704_10104057
1161 Ga0065715_10155065
1162 Ga0070658_10001143
1163 Ga0070658_10043237
1164 Ga0070658_10112166
1165 Ga0070658_10118006
1166 Ga0070683_100023206
1167 Ga0070683_100393267
1168 Ga0070670_100021191
1169 Ga0070670_100110745
1170 Ga0070670_100116209
1171 Ga0068869_100072047
1172 Ga0070666_10000058
1173 Ga0070666_10000645
1174 Ga0070666_10008427
1175 Ga0070666_10065608
1176 Ga0070680_100048875
1177 Ga0070680_100079588
1178 Ga0070680_100089873
1179 Ga0070680_100404582
1180 Ga0070682_100015190
1181 Ga0070682_100040396
1182 Ga0068868_100075510
1183 Ga0070660_100101733
1184 Ga0070660_100165217
1185 Ga0070689_100004531
1186 Ga0070691_10000346
1187 Ga0070691_10037455
1188 Ga0070661_100050296
1189 Ga0070661_100092709
1190 Ga0070661_100194031
1191 Ga0070692_10011513
1192 Ga0070692_10028849
1193 Ga0070692_10034803
1194 Ga0070668_100062063
1195 Ga0070669_100105474
1196 Ga0070675_100015466
1197 Ga0070671_100006750
1198 Ga0070671_100030620
1199 Ga0070671_100160182
1200 Ga0070673_100185622
1201 Ga0070688_100096994
1202 Ga0070688_100336701
1203 Ga0070659_100007680
1204 Ga0070659_100017729
1205 Ga0070667_100000108
1206 Ga0070667_100009016
1207 Ga0070667_100016038
1208 Ga0070667_100027922
1209 Ga0070709_10000036
1210 Ga0070714_100000325
1211 Ga0070714_100000671
1212 Ga0070710_10134963
1213 Ga0070701_10085606
1214 Ga0070711_100175012
1215 Ga0070694_100019707
1216 Ga0070663_100004271
1217 Ga0070663_100009276
1218 Ga0070663_100015624
1219 Ga0070663_100034811
1220 Ga0070663_100128550
1221 Ga0070663_100265697
1222 Ga0070662_100029363
1223 Ga0070662_100057601
1224 Ga0070681_10000500
1225 Ga0070681_10000944
1226 Ga0070681_10009676
1227 Ga0070681_10031335
1228 Ga0070681_10073083
1229 Ga0070681_10081516
1230 Ga0070681_10280926
1231 Ga0070685_10013087
1232 Ga0070685_10021517
1233 Ga0070698_100010813
1234 Ga0070699_100128344
1235 Ga0070679_100001195
1236 Ga0070679_100025730
1237 Ga0070679_100072387
1238 Ga0070679_100073914
1239 Ga0070679_100238081
1240 Ga0070684_100309740
1241 Ga0068853_100001578
1242 Ga0068853_100005018
1243 Ga0068853_100008085
1244 Ga0068853_100011045
1245 Ga0068853_100016267
1246 Ga0068853_100068959
1247 Ga0068853_100082454
1248 Ga0068853_100110422
1249 Ga0068853_100183866
1250 Ga0068853_100363436
1251 Ga0068853_100618446
1252 Ga0070696_100037311
1253 Ga0070696_100103901
1254 Ga0070696_100454096
1255 Ga0070693_100096686
1256 Ga0070693_100250112
1257 Ga0070665_100000057
1258 Ga0070665_100000715
1259 Ga0070665_100002937
1260 Ga0070665_100021486
1261 Ga0070665_100068712
1262 Ga0070665_100230042
1263 Ga0070665_100235983
1264 Ga0070665_100271579
1265 Ga0070665_100313763
1266 Ga0070665_100524923
1267 Ga0070704_100106240
1268 Ga0068855_100001307
1269 Ga0068855_100004050
1270 Ga0068855_100037140
1271 Ga0068855_100043353
1272 Ga0068855_100078773
1273 Ga0068855_100248155
1274 Ga0068855_100330214
1275 Ga0068855_100354255
1276 Ga0068855_100393414
1277 Ga0070664_100166958
1278 Ga0068857_100000300
1279 Ga0068857_100037641
1280 Ga0068857_100063147
1281 Ga0068857_100472084
1282 Ga0068854_100000343
1283 Ga0068854_100002114
1284 Ga0068854_100004724
1285 Ga0068854_100042054
1286 Ga0068854_100091855
1287 Ga0068854_100141759
1288 Ga0068854_100218564
1289 Ga0068856_100000116
1290 Ga0068856_100084443
1291 Ga0068856_100111094
1292 Ga0068856_100187473
1293 Ga0068852_100004275
1294 Ga0068852_100008693
1295 Ga0068852_100010857
1296 Ga0068852_100124333
1297 Ga0068859_100000351
1298 Ga0068859_100015319
1299 Ga0068859_100225471
1300 Ga0068864_100090044
1301 Ga0068864_100140516
1302 Ga0068861_100316989
1303 Ga0068851_10004625
1304 Ga0068851_10009946
1305 Ga0068851_10062656
1306 Ga0068863_100006425
1307 Ga0068863_100014475
1308 Ga0068863_100020112
1309 Ga0068863_100379835
1310 Ga0068858_100006259
1311 Ga0068858_100006693
1312 Ga0068858_100006944
1313 Ga0068858_100436838
1314 Ga0068860_100045552
1315 Ga0068860_100203927
1316 Ga0068860_100248002
1317 Ga0068860_100736321
1318 Ga0068862_100195260
1319 Ga0081455_10000039
1320 Ga0075364_10102798
1321 Ga0075364_10120923
1322 Ga0070716_100004881
1323 Ga0075369_10028360
1324 Ga0097621_100055267
1325 Ga0097621_100181344
1326 Ga0068871_100267943
1327 Ga0075428_100569576
1328 Ga0075431_100060414
1329 Ga0075433_10001939
1330 Ga0075433_10290073
1331 Ga0068865_100047107
1332 Ga0068865_100068084
1333 Ga0097620_100000351
1334 Ga0097620_100015319
1335 Ga0097620_100225471
1336 Ga0105244_10051498
1337 Ga0105250_10038121
1338 Ga0105240_10000315
1339 Ga0105240_10007869
1340 Ga0105240_10009439
1341 Ga0105240_10012686
1342 Ga0105240_10015093
1343 Ga0105240_10051502
1344 Ga0105240_10060620
1345 Ga0105240_10098547
1346 Ga0105240_10167205
1347 Ga0105240_10226538
1348 Ga0105240_10263224
1349 Ga0105240_10550138
1350 Ga0111539_10044756
1351 Ga0111539_10424364
1352 Ga0105247_10000975
1353 Ga0105247_10014302
1354 Ga0114129_10138582
1355 Ga0114129_10262478
1356 Ga0105243_10033621
1357 Ga0105241_10004652
1358 Ga0105241_10013451
1359 Ga0105241_10165241
1360 Ga0105241_10414866
1361 Ga0105242_10128547
1362 Ga0105248_10001678
1363 Ga0105248_10047487
1364 Ga0105248_10203594
1365 Ga0105248_10217562
1366 Ga0105248_10225150
1367 Ga0105248_10240948
1368 Ga0105237_10000063
1369 Ga0105237_10000105
1370 Ga0105237_10003289
1371 Ga0105237_10007234
1372 Ga0105237_10008174
1373 Ga0105237_10052875
1374 Ga0105237_10172728
1375 Ga0105237_10295994
1376 Ga0105237_10665916
1377 Ga0105238_10000270
1378 Ga0105238_10000290
1379 Ga0105238_10004841
1380 Ga0105238_10020657
1381 Ga0105238_10074121
1382 Ga0105238_10204191
1383 Ga0105238_10459728
1384 Ga0105238_10464757
1385 Ga0105238_10517491
1386 Ga0105249_10002422
1387 Ga0105249_10006721
1388 Ga0105249_10014184
1389 Ga0105249_10020841
1390 Ga0105249_10087409
1391 Ga0105029_103430
1392 Ga0105030_101208
1393 Ga0105239_10000043
1394 Ga0105239_10006032
1395 Ga0105239_10019878
1396 Ga0105239_10026229
1397 Ga0105239_10142571
1398 Ga0105239_10161584
1399 Ga0105239_10215793
1400 Ga0105239_10297253
1401 Ga0105246_10064508
1402 Ga0157373_10004602
1403 Ga0157373_10007629
1404 Ga0157373_10057113
1405 Ga0157373_10080857
1406 Ga0157373_10291515
1407 Ga0157371_10003532
1408 Ga0157371_10008518
1409 Ga0157371_10010934
1410 Ga0157371_10021786
1411 Ga0157371_10032772
1412 Ga0157371_10085550
1413 Ga0157370_10001634
1414 Ga0157370_10007704
1415 Ga0157370_10009139
1416 Ga0157370_10082212
1417 Ga0157370_10145538
1418 Ga0157370_10208301
1419 Ga0157370_10304008
1420 Ga0157369_10050010
1421 Ga0157369_10063808
1422 Ga0157369_10093815
1423 Ga0157369_10105890
1424 Ga0157369_10140278
1425 Ga0157369_10283292
1426 Ga0157374_10111331
1427 Ga0157374_10150041
1428 Ga0163162_10013992
1429 Ga0163162_10056831
1430 Ga0157372_10003149
1431 Ga0157372_10007198
1432 Ga0157372_10007498
1433 Ga0157372_10042687
1434 Ga0157372_10074444
1435 Ga0157372_10104344
1436 Ga0157372_10123380
1437 Ga0157372_10208720
1438 Ga0157372_10271820
1439 Ga0157372_10295703
1440 Ga0157372_10745377
1441 Ga0157380_10030483
1442 Ga0157380_10083091
1443 Ga0157380_10754189
1444 Ga0182008_10000371
1445 Ga0157377_10058154
1446 Ga0157379_10073278
1447 Ga0157379_10266631
1448 Ga0157376_10096560
1449 Ga0157376_10139856
1450 Ga0157376_10237463
1451 Ga0183368_1004
1452 Ga0183360_10001
1453 Ga0163161_10069854
1454 Ga0197907_10957944
1455 Ga0206356_11098649
1456 Ga0206356_11322499
1457 Ga0206351_10917985
1458 Ga0206354_11670857
1459 Ga0206353_10228217
1460 Ga0206353_11044475
1461 Ga0209435_101367
1462 Ga0209760_100727
1463 Ga0209784_100133
1464 Ga0209566_102250
1465 Ga0209674_100148
1466 Ga0209674_100269
1467 Ga0209672_100007
1468 Ga0209672_100029
1469 Ga0209672_100058
1470 Ga0209672_100434
1471 Ga0209672_100841
1472 Ga0209563_100051
1473 Ga0207427_100013
1474 Ga0207427_100033
1475 Ga0207427_101041
1476 Ga0209437_100015
1477 Ga0209437_100106
1478 Ga0209437_100352
1479 Ga0209258_100046
1480 Ga0209258_100053
1481 Ga0209258_100164
1482 Ga0209258_100413
1483 Ga0209258_100444
1484 Ga0209258_100991
1485 Ga0209258_101490
1486 Ga0207425_1000028
1487 Ga0207425_1002659
1488 Ga0209646_1001493
1489 Ga0209646_1004243
1490 Ga0209646_1009044
1491 Ga0209026_1000074
1492 Ga0209026_1000092
1493 Ga0209026_1000111
1494 Ga0209026_1001965
1495 Ga0209677_103982
1496 Ga0209148_1000002
1497 Ga0209148_1000009
1498 Ga0209148_1000010
1499 Ga0209148_1000039
1500 Ga0209148_1000087
1501 Ga0209148_1000098
1502 Ga0209759_1000110
1503 Ga0209759_1000278
1504 Ga0209759_1000353
1505 Ga0209759_1003639
1506 Ga0209759_1004660
1507 Ga0209759_1008783
1508 Ga0209129_1000065
1509 Ga0209233_1000009
1510 Ga0209233_1000080
1511 Ga0209233_1004727
1512 Ga0209233_1010689
1513 Ga0209565_1000005
1514 Ga0209455_1000010
1515 Ga0209455_1000034
1516 Ga0209455_1000060
1517 Ga0209455_1000120
1518 Ga0209455_1000211
1519 Ga0209673_1000011
1520 Ga0209130_1006918
1521 Ga0209675_1000004
1522 Ga0209675_1028589
1523 Ga0209676_1000047
1524 Ga0209676_1001228
1525 Ga0209676_1003790
1526 Ga0209676_1046886
1527 Ga0209025_1000002
1528 Ga0209025_1000036
1529 Ga0209025_1001523
1530 Ga0209025_1002530
1531 Ga0209025_1074280
1532 Ga0209564_1000018
1533 Ga0209564_1010242
1534 Ga0209758_1000003
1535 Ga0209758_1001152
1536 Ga0209758_1007625
1537 Ga0209758_1019267
1538 Ga0209050_1002237
1539 Ga0209050_1029950
1540 Ga0209256_1000021
1541 Ga0209256_1000539
1542 Ga0209256_1002619
1543 Ga0209256_1002635
1544 Ga0209256_1004402
1545 Ga0209257_1000133
1546 Ga0209257_1000362
1547 Ga0209257_1002869
1548 Ga0209257_1004114
1549 Ga0209257_1005108
1550 Ga0207656_10001165
1551 Ga0207655_1022286
1552 Ga0207710_10000934
1553 Ga0207710_10022209
1554 Ga0207680_10000006
1555 Ga0207680_10028853
1556 Ga0207680_10063513
1557 Ga0207647_10000504
1558 Ga0207647_10000677
1559 Ga0207647_10001610
1560 Ga0207647_10004217
1561 Ga0207647_10009312
1562 Ga0207647_10034794
1563 Ga0207699_10000222
1564 Ga0207645_10105586
1565 Ga0207705_10001829
1566 Ga0207705_10002514
1567 Ga0207705_10004714
1568 Ga0207705_10004985
1569 Ga0207705_10106810
1570 Ga0207707_10000578
1571 Ga0207707_10001419
1572 Ga0207707_10001729
1573 Ga0207707_10003100
1574 Ga0207707_10006039
1575 Ga0207707_10030276
1576 Ga0207707_10032224
1577 Ga0207707_10090685
1578 Ga0207707_10112131
1579 Ga0207695_10000033
1580 Ga0207695_10001058
1581 Ga0207695_10001605
1582 Ga0207695_10002167
1583 Ga0207695_10004738
1584 Ga0207695_10007278
1585 Ga0207695_10013378
1586 Ga0207695_10016800
1587 Ga0207695_10016841
1588 Ga0207695_10020794
1589 Ga0207695_10032853
1590 Ga0207695_10037705
1591 Ga0207695_10049935
1592 Ga0207695_10110706
1593 Ga0207695_10166538
1594 Ga0207695_10187385
1595 Ga0207695_10245362
1596 Ga0207695_10462887
1597 Ga0207671_10000021
1598 Ga0207671_10000292
1599 Ga0207671_10004135
1600 Ga0207671_10032312
1601 Ga0207671_10036274
1602 Ga0207671_10065929
1603 Ga0207671_10198885
1604 Ga0207671_10303947
1605 Ga0207663_10155888
1606 Ga0207660_10007012
1607 Ga0207660_10018231
1608 Ga0207660_10059800
1609 Ga0207660_10062281
1610 Ga0207660_10070120
1611 Ga0207660_10072900
1612 Ga0207657_10008479
1613 Ga0207657_10018265
1614 Ga0207649_10026175
1615 Ga0207649_10032086
1616 Ga0207649_10148275
1617 Ga0207652_10000022
1618 Ga0207652_10000390
1619 Ga0207652_10003362
1620 Ga0207652_10005539
1621 Ga0207652_10008522
1622 Ga0207652_10044028
1623 Ga0207652_10103776
1624 Ga0207652_10189655
1625 Ga0207694_10001330
1626 Ga0207694_10004279
1627 Ga0207694_10005966
1628 Ga0207694_10011925
1629 Ga0207694_10044992
1630 Ga0207694_10115403
1631 Ga0207694_10209248
1632 Ga0207694_10296739
1633 Ga0207650_10008638
1634 Ga0207659_10011103
1635 Ga0207664_10000235
1636 Ga0207664_10011140
1637 Ga0207690_10000913
1638 Ga0207690_10004594
1639 Ga0207690_10010359
1640 Ga0207690_10029874
1641 Ga0207690_10032193
1642 Ga0207690_10035611
1643 Ga0207690_10054269
1644 Ga0207690_10058416
1645 Ga0207706_10022271
1646 Ga0207706_10055705
1647 Ga0207709_10017863
1648 Ga0207670_10005647
1649 Ga0207704_10090033
1650 Ga0207665_10010651
1651 Ga0207711_10000411
1652 Ga0207711_10162762
1653 Ga0207689_10132399
1654 Ga0207661_10004890
1655 Ga0207661_10052160
1656 Ga0207661_10262590
1657 Ga0207679_10141999
1658 Ga0207679_10276455
1659 Ga0207667_10000142
1660 Ga0207667_10000198
1661 Ga0207667_10001230
1662 Ga0207667_10001994
1663 Ga0207667_10005471
1664 Ga0207667_10008565
1665 Ga0207667_10024202
1666 Ga0207667_10040901
1667 Ga0207667_10047035
1668 Ga0207667_10056633
1669 Ga0207651_10098631
1670 Ga0207712_10001488
1671 Ga0207712_10001504
1672 Ga0207712_10295140
1673 Ga0207640_10000014
1674 Ga0207640_10000016
1675 Ga0207640_10002697
1676 Ga0207640_10009566
1677 Ga0207640_10064612
1678 Ga0207640_10067102
1679 Ga0207640_10169824
1680 Ga0207658_10000093
1681 Ga0207658_10014676
1682 Ga0207658_10031098
1683 Ga0207658_10058641
1684 Ga0207658_10275731
1685 Ga0207703_10000734
1686 Ga0207703_10000802
1687 Ga0207703_10001191
1688 Ga0207703_10369464
1689 Ga0207703_10579792
1690 Ga0207639_10000374
1691 Ga0207639_10001926
1692 Ga0207639_10005288
1693 Ga0207639_10006208
1694 Ga0207639_10006318
1695 Ga0207639_10028040
1696 Ga0207639_10084920
1697 Ga0207678_10000619
1698 Ga0207678_10004139
1699 Ga0207678_10006047
1700 Ga0207678_10012768
1701 Ga0207678_10029974
1702 Ga0207678_10042614
1703 Ga0207678_10124365
1704 Ga0207678_10170381
1705 Ga0207702_10000170
1706 Ga0207702_10003761
1707 Ga0207702_10011516
1708 Ga0207702_10097457
1709 Ga0207702_10191442
1710 Ga0207641_10001117
1711 Ga0207641_10058664
1712 Ga0207641_10381244
1713 Ga0207641_10398813
1714 Ga0207676_10197284
1715 Ga0207674_10000623
1716 Ga0207674_10001397
1717 Ga0207674_10016247
1718 Ga0207674_10026041
1719 Ga0207674_10030846
1720 Ga0207674_10050111
1721 Ga0207674_10064493
1722 Ga0207674_10421608
1723 Ga0207675_100162159
1724 Ga0207675_100306075
1725 Ga0207698_10001202
1726 Ga0207698_10001610
1727 Ga0207698_10005754
1728 Ga0209371_1000004
1729 Ga0209371_1000011
1730 Ga0209969_1002780
1731 Ga0210002_1000841
1732 Ga0207428_10060265
1733 Ga0268266_10000001
1734 Ga0268266_10000006
1735 Ga0268266_10000043
1736 Ga0268266_10002855
1737 Ga0268266_10002895
1738 Ga0268266_10031831
1739 Ga0268266_10062485
1740 Ga0268266_10248304
1741 Ga0268266_10288577
1742 Ga0268265_10055779
1743 Ga0268264_10000293
1744 Ga0268264_10054427
1745 Ga0268264_10067856
1746 Ga0268264_10171012
1747 Ga0268264_10353112
1748 Ga0265334_10000015
1749 Ga0265334_10004047
1750 Ga0265318_10003682
1751 Ga0265338_10036293
1752 Ga0268256_1000005
1753 Ga0268256_1000011
1754 Ga0316176_1094510
1755 Ga0265328_10010215
1756 Ga0265320_10015039
1757 Ga0265316_10021492
1758 Ga0265316_10131573
1759 Ga0307513_10024959
1760 Ga0307509_10000017
1761 Ga0307408_100003986
1762 Ga0307408_100167188
1763 Ga0265313_10002491
1764 Ga0265313_10041420
1765 Ga0316575_10002942
1766 Ga0316579_10080255
1767 Ga0316576_10059061
1768 Ga0307405_10015248
1769 Ga0307405_10028736
1770 Ga0316577_10002497
1771 Ga0316577_10057023
1772 Ga0307413_10055894
1773 Ga0307413_10283373
1774 Ga0307413_10370001
1775 Ga0307410_10001595
1776 Ga0307406_10029620
1777 Ga0307407_10005839
1778 Ga0307407_10165348
1779 Ga0307407_10340612
1780 Ga0307412_10016096
1781 Ga0307412_10248530
1782 Ga0307409_100283503
1783 Ga0307416_100001112
1784 Ga0307416_100066445
1785 Ga0307414_10069220
1786 Ga0307411_10000563
1787 Ga0307411_10168620
1788 Ga0307411_10276872
1789 Ga0307415_100000772
1790 Ga0307507_10225759
1791 Ga0307510_10000002
1792 Ga0307510_10000233
1793 Ga0316574_0133934
1794 Ga0373927_0000002
1795 Ga0373933_0008933
1796 Ga0316584_0144292
1797 Ga0395899_0000309
1798 Ga0395899_0001578
1799 Ga0395899_0028102
1800 Ga0395899_0033120
1801 Ga0395900_0000163
1802 Ga0395900_0002478
1803 Ga0395900_0003412
1804 Ga0395900_0008384
1805 Ga0395900_0011470
1806 Ga0395900_0068100
1807 Ga0395900_0069483
1808 Ga0395900_0282558
1809 Ga0395898_0000144
1810 Ga0395898_0000305
1811 Ga0395898_0025292
1812 Ga0395898_0026570
1813 Ga0395898_0140963
1814 Ga0395898_0343110
1815 Ga0395905_0001012
1816 Ga0395905_0353689
1817 Ga0395901_0009632
1818 Ga0395901_0011011
1819 Ga0395901_0028170
1820 Ga0395901_0070506
1821 Ga0395901_0136557
1822 Ga0395901_0148164
1823 Ga0395901_0193979
1824 Ga0395901_0212471
1825 Ga0395901_0261349
1826 Ga0237819_03353
1827 Ga0400489_43493
1828 Ga0400489_65269
1829 Ga0237816_00097
1830 Ga0436365_1276167
1831 Ga0436363_0328143
1832 Ga0439447_003716
1833 Ga0439461_0013007
1834 Ga0451791_0790747
1835 Ga0451793_1323418
1836 Ga0451797_1149682
1837 Ga0451800_0043135
1838 Ga0451800_0844354
1839 Ga0451806_227471
1840 Ga0451807_0696539
1841 Ga0451807_1184572
1842 Ga0451807_1852622
1843 Ga0451841_0914442
1844 Ga0451843_0048063
1845 Ga0451843_1201883
1846 Ga0451853_0743661
1847 Ga0439433_0028572
1848 Ga0439449_0057096
1849 Ga0439456_036297
1850 Ga0450894_002938
1851 Ga0450896_003162
1852 Ga0439446_0051666
1853 Ga0450908_000229
1854 Ga0451577_0002744
1855 Ga0451577_0004710
1856 Ga0451577_0095577
1857 Ga0451577_0107004
1858 Ga0466969_0003624
1859 Ga0466972_0001350
1860 Ga0466972_0029651
1861 Ga0466982_0000004
1862 Ga0466965_0008083
1863 Ga0466966_0011778
1864 Ga0466966_0056156
1865 Ga0466966_0120907
1866 Ga0466961_0000946
1867 Ga0466961_0006538
1868 Ga0466961_0020260
1869 Ga0466961_0028864
1870 Ga0453684_0013282
1871 Ga0453684_0154833
1872 Ga0453684_0277213
1873 Ga0466971_0011479
1874 Ga0466971_0029561
1875 Ga0466970_0003008
1876 Ga0466970_0006449
1877 Ga0466970_0018394
1878 Ga0466970_0035184
1879 Ga0466970_0047948
1880 Ga0466957_0000516
1881 Ga0466957_0253270
1882 Ga0466959_0007966
1883 Ga0466959_0021228
1884 Ga0466959_0052826
1885 Ga0466959_0070991
1886 Ga0466959_0092683
1887 Ga0466958_0063566
1888 Ga0466958_0211287
1889 Ga0466967_0449729
1890 Ga0495638_0000094
1891 Ga0495638_0008208
1892 Ga0495650_0000027
1893 Ga0495650_0000078
1894 Ga0495606_0094497
1895 Ga0495622_0029037
1896 Ga0495633_0020840
1897 Ga0495633_0171164
1898 Ga0495668_0005550
1899 Ga0495625_0011559
1900 Ga0495625_0033091
1901 Ga0495659_0005813
1902 Ga0495649_0015687
1903 Ga0495686_0035377
1904 Ga0496100_0010485
1905 Ga0496101_0001877
1906 Ga0496101_0228940
1907 Ga0496102_0175832
1908 Ga0496104_0858165
1909 Ga0496105_0005421
1910 Ga0496107_0077961
1911 Ga0496108_0041356
1912 Ga0496109_0162354
1913 Ga0496110_0192786
1914 Ga0496111_0111864
1915 Ga0496113_0031778
1916 Ga0496113_0160888
1917 Ga0496113_0338231
1918 Ga0496114_0000933
1919 Ga0496114_0322788
1920 Ga0496115_0000032
1921 Ga0496115_0005442
1922 Ga0496115_0020292
1923 Ga0496115_0195007
1924 Ga0496115_0205476
1925 Ga0496116_0003550
1926 Ga0496116_0039310
1927 Ga0496117_0000140
1928 Ga0496117_0010288
1929 Ga0496117_0010696
1930 Ga0496117_0015129
1931 Ga0496117_0027762
1932 Ga0496117_0063260
1933 Ga0496118_0000102
1934 Ga0496118_0000880
1935 Ga0496118_0000955
1936 Ga0496118_0001297
1937 Ga0496118_0001780
1938 Ga0496118_0012943
1939 Ga0496118_0014401
1940 Ga0496118_0031489
1941 Ga0496119_0000131
1942 Ga0496119_0001546
1943 Ga0496119_0004641
1944 Ga0496119_0016319
1945 Ga0496120_0001431
1946 Ga0496120_0008466
1947 Ga0496120_0013980
1948 Ga0496120_0014910
1949 Ga0496121_0003311
1950 Ga0496121_0011146
1951 Ga0496121_0011290
1952 Ga0496121_0029198
1953 Ga0496121_0032860
1954 Ga0496121_0054691
1955 Ga0496121_0058645
1956 Ga0496121_0152730
1957 Ga0496122_0000560
1958 Ga0496122_0001084
1959 Ga0496122_0019108
1960 Ga0496122_0024697
1961 Ga0496123_0000647
1962 Ga0496123_0001603
1963 Ga0496123_0008306
1964 Ga0496123_0095356
1965 Ga0496124_0000009
1966 Ga0496124_0001249
1967 Ga0496124_0015214
1968 Ga0496124_0025530
1969 Ga0496124_0079522
1970 Ga0496125_0000338
1971 Ga0496125_0000813
1972 Ga0496125_0074511
1973 Ga0496125_0119145
1974 Ga0496126_0000925
1975 Ga0496126_0033341
1976 Ga0496126_0075605
1977 Ga0496126_0093327
1978 Ga0496126_0101027
1979 Ga0496126_0204570
1980 Ga0496126_0237999
1981 Ga0496126_0289276
1982 Ga0496126_0454901
1983 Ga0501031_0092333
1984 Ga0501032_0024280
1985 Ga0501032_0124634
1986 Ga0501032_0229841
1987 Ga0501033_0014100
1988 Ga0501033_0033971
1989 Ga0501033_0166299
1990 Ga0501033_0338496
1991 Ga0501034_0001783
1992 Ga0501034_0002029
1993 Ga0501034_0019163
1994 Ga0501034_0134835
1995 Ga0501034_0158367
1996 Ga0501034_0360241
1997 Ga0501034_0363297
1998 Ga0501034_0479543
1999 Ga0501036_0015065
2000 Ga0501036_0151227
2001 Ga0501037_0023125
2002 Ga0501037_0029500
2003 Ga0501037_0047342
2004 Ga0501038_0052046
2005 Ga0501038_0084957
2006 Ga0501038_0094416
2007 Ga0501038_0105071
2008 Ga0501038_0169538
2009 Ga0501038_0235756
2010 Ga0501039_0009425
2011 Ga0501040_0023303
2012 Ga0501041_0034229
2013 Ga0501041_0285374
2014 Ga0501042_0029618
2015 Ga0501043_0000496
2016 Ga0501043_0029223
2017 Ga0501043_0050226
2018 Ga0501043_0067859
2019 Ga0501043_0101501
2020 Ga0501043_0255835
2021 Ga0501046_0062128
2022 Ga0501047_0001140
2023 Ga0501047_0007292
2024 Ga0501047_0023799
2025 Ga0501047_0059351
2026 Ga0501047_0133726
2027 Ga0501047_0148832
2028 Ga0501047_0257612
2029 Ga0501047_0450570
2030 Ga0501048_0016783
2031 Ga0501048_0132080
2032 Ga0501048_0139155
2033 Ga0501048_0215406
2034 Ga0501067_0052188
2035 Ga0501068_0006207
2036 Ga0501068_0034604
2037 Ga0501068_0187634
2038 Ga0501068_0275921
2039 Ga0501069_0001130
2040 Ga0501069_0002195
2041 Ga0501069_0012617
2042 Ga0501069_0024698
2043 Ga0501070_0000311
2044 Ga0501070_0002127
2045 Ga0501070_0002625
2046 Ga0501070_0014841
2047 Ga0501070_0022398
2048 Ga0501070_0031449
2049 Ga0501070_0034110
2050 Ga0501070_0059879
2051 Ga0501070_0090362
2052 Ga0501070_0188158
2053 Ga0501070_0201633
2054 Ga0501070_0345081
2055 Ga0501071_0003538
2056 Ga0501071_0009446
2057 Ga0501072_0044654
2058 Ga0501072_0051742
2059 Ga0501073_0006399
2060 Ga0501073_0013127
2061 Ga0501074_0037381
2062 Ga0501074_0078440
2063 Ga0501074_0204688
2064 Ga0501075_0038876
2065 Ga0501076_0113941
2066 Ga0501076_0479841
2067 Ga0501077_0050341
2068 Ga0501077_0143043
2069 Ga0501202_005533
2070 Ga0501252_001883
2071 Ga0501225_0036472
2072 Ga0501079_0101847
2073 Ga0501079_0251125
2074 Ga0501080_0002966
2075 Ga0501080_0011069
2076 Ga0501080_0023665
2077 Ga0501080_0040846
2078 Ga0501080_0088000
2079 Ga0501080_0119484
2080 Ga0501080_0146971
2081 Ga0501080_0152329
2082 Ga0501080_0215751
2083 Ga0501081_0018189
2084 Ga0501081_0026486
2085 Ga0501081_0037240
2086 Ga0501081_0038763
2087 Ga0501081_0175373
2088 Ga0501083_0001933
2089 Ga0501268_007367
2090 Ga0501270_005293
2091 Ga0501035_0021058
2092 Ga0501035_0058490
2093 Ga0501035_0107029
2094 Ga0501035_0124980
2095 Ga0501035_0187509
2096 Ga0501035_0200083
2097 Ga0501035_0253760
2098 Ga0501035_0426102
2099 Ga0501044_0008911
2100 Ga0501044_0018635
2101 Ga0501044_0032184
2102 Ga0501044_0037048
2103 Ga0501044_0073236
2104 Ga0501044_0081840
2105 Ga0501044_0087059
2106 Ga0501044_0091349
2107 Ga0501044_0098277
2108 Ga0501044_0106247
2109 Ga0501044_0234806
2110 Ga0501045_0050182
2111 nmdc:mga08y16_90845_c1
2112 nmdc:mga0rr50_189198_c1
2113 nmdc:mga0a205_3120_c1
2114 Ga0500610_0090838
2115 Ga0500643_007517
2116 Ga0500583_0034295
2117 Ga0500651_0037918
2118 Ga0500651_0122514
2119 Ga0500641_0000743
2120 Ga0500641_0017371
2121 Ga0500597_000111
2122 Ga0500634_0007244
2123 Ga0501084_0039591
2124 Ga0501082_0000672
2125 Ga0501082_0034095
2126 Ga0501082_0176585
2127 Ga0466962_0004616
2128 Ga0466962_0017050
2129 Ga0530510_0034971
2130 2538832381
2131 2547501526
2132 2578459056
2133 2643830399
2134 2643894138
2135 2644476341
2136 2687582302
2137 2739730554
2138 2747950075
2139 2748015964
2140 2765578328
2141 2816516346
2142 2819663667
2143 2842392943
2144 2842758719
2145 2842781217
2146 2852686362
2147 2874220948
2148 2884413281
2149 2895398848
2150 2895500868
2151 2895516263
2152 2895523819
2153 2895526599
2154 2919091157
2155 2919132479
2156 2919136808
2157 2928497790
2158 2928964381
2159 2929197053
2160 2931381407
2161 2937611769
2162 2939612405
2163 2939626687
2164 2939627708
2165 2961047713
2166 2961067054
2167 2987608272
2168 8002869479
2169 8003016477
2170 8021648551

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22564

HAAS

HAAS

38

98

0.94

PF13796

Sensor

Putative sensor

140

330

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m6u-assembly1.cif.gz_I crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e 0.351 112 266
6m6u-assembly1.cif.gz_D crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e 0.3421 112 266
7aer-assembly1.cif.gz_B rebuilt and re-refined pdb entry 5yep: tri-ampylated shewanella oneidensis hepn toxin in complex with mnt antitoxin 0.341 112 260
6m6u-assembly1.cif.gz_I crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e 0.3404 112 266
6m6u-assembly1.cif.gz_D crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e 0.3325 112 266
ID Description Score Start End Superfamily
af_Q99PA5_49_164_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3759 107 213 1.20.140.150
af_Q4CZP8_573_734_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3484 106 279 1.10.1760.20
af_Q99PA5_49_164_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3349 107 213 1.20.140.150
af_F1RB62_85_233_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.3348 73 264 1.20.120.350
af_Q4DUB6_274_435_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3344 102 214 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A848Q8A6-F1-model_v4 deleted 0.9672 1 77
AF-A0A848Q8A6-F1-model_v4 deleted 0.9433 1 77
AF-A0A522SMK6-F1-model_v4 Putative sensor domain-containing protein 0.9056 1 281 GO:0016020
AF-A0A522SMK6-F1-model_v4 Putative sensor domain-containing protein 0.9025 1 281 GO:0016020
AF-T1BM38-F1-model_v4 Sensor protein 0.8867 1 91

Map