F489795

General Info

Members Datasets Scaffolds Average Seq Length
1087 333 2174 157

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_101415410|Ga0070675_1014154101
Length 166
Sequence VTARRAVVICASTRAATGVYPDRTGPLIVAALREWGYDVDDATVVPDGEAVSEALATALAASPDVVLTTGGTGISPTDATPEMTRRHLDREIPGIAEAIRAAGVEKGVPTAMLSRGLAGVAGHSLVVNLPGSTGGCRDGYAVLRPALGHALSLLADQPTRHQHTST

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
189 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
314 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 9.02
Rhizosphere 89.97
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_101415410 3300005354 Bacteria 641
2 JGI25406J46586_10054802 3300003203 Bacteria 1317
3 Ga0070658_10012791 3300005327 Bacteria 6733
4 Ga0070658_10037453 3300005327 Bacteria 3910
5 Ga0070658_10059517 3300005327 Bacteria 3110
6 Ga0070658_10337975 3300005327 Bacteria 1288
7 Ga0070658_11318679 3300005327 Unclassified 627
8 Ga0070683_100051957 3300005329 Bacteria 3796
9 Ga0070683_100061493 3300005329 Bacteria 3492
10 Ga0070683_100088710 3300005329 Bacteria 2902
11 Ga0070683_100097095 3300005329 Bacteria 2771
12 Ga0070683_100896286 3300005329 Bacteria 851
13 Ga0070683_101022265 3300005329 Bacteria 794
14 Ga0070683_101034342 3300005329 Bacteria 789
15 Ga0070680_100006253 3300005336 Bacteria 9033
16 Ga0070680_100169771 3300005336 Bacteria 1835
17 Ga0070680_100219668 3300005336 Bacteria 1604
18 Ga0070680_100232872 3300005336 Bacteria 1556
19 Ga0070680_101028469 3300005336 Bacteria 712
20 Ga0070682_100805388 3300005337 Bacteria 764
21 Ga0068868_100662810 3300005338 Bacteria 930
22 Ga0070660_100001098 3300005339 Bacteria 18183
23 Ga0070660_100046194 3300005339 Bacteria 3337
24 Ga0070660_100052003 3300005339 Bacteria 3156
25 Ga0070660_100080718 3300005339 Bacteria 2553
26 Ga0070660_100103559 3300005339 Bacteria 2257
27 Ga0070660_100128204 3300005339 Bacteria 2029
28 Ga0070660_100722728 3300005339 Bacteria 836
29 Ga0070661_100012445 3300005344 Bacteria 5951
30 Ga0070661_100065974 3300005344 Bacteria 2659
31 Ga0070661_100108966 3300005344 Bacteria 2067
32 Ga0070661_100202404 3300005344 Bacteria 1517
33 Ga0070661_100223911 3300005344 Bacteria 1444
34 Ga0070675_100161683 3300005354 Bacteria 1926
35 Ga0070674_100062493 3300005356 Bacteria 2602
36 Ga0070674_101164628 3300005356 Bacteria 683
37 Ga0070659_100031564 3300005366 Bacteria 4104
38 Ga0070659_100118677 3300005366 Bacteria 2140
39 Ga0070659_100150596 3300005366 Bacteria 1898
40 Ga0070659_100762250 3300005366 Bacteria 840
41 Ga0070659_100981294 3300005366 Bacteria 741
42 Ga0070659_101333969 3300005366 Bacteria 637
43 Ga0070703_10109839 3300005406 Bacteria 985
44 Ga0070709_10028844 3300005434 Bacteria 3313
45 Ga0070709_10606094 3300005434 Bacteria 843
46 Ga0070714_100025095 3300005435 Bacteria 4917
47 Ga0070714_100078883 3300005435 Bacteria 2862
48 Ga0070714_100210438 3300005435 Bacteria 1782
49 Ga0070714_100245545 3300005435 Bacteria 1654
50 Ga0070714_100384996 3300005435 Bacteria 1323
51 Ga0070713_100001060 3300005436 Bacteria 17565
52 Ga0070713_100243387 3300005436 Bacteria 1639
53 Ga0070713_101855192 3300005436 Bacteria 585
54 Ga0070710_10057608 3300005437 Bacteria 2202
55 Ga0070701_10214097 3300005438 Bacteria 1146
56 Ga0070711_100013538 3300005439 Bacteria 5122
57 Ga0070711_100021588 3300005439 Bacteria 4165
58 Ga0070711_100328492 3300005439 Bacteria 1224
59 Ga0070705_100599476 3300005440 Bacteria 852
60 Ga0070694_100063127 3300005444 Bacteria 2532
61 Ga0070708_100034217 3300005445 Bacteria 4420
62 Ga0070708_100762834 3300005445 Bacteria 910
63 Ga0070663_100520901 3300005455 Bacteria 990
64 Ga0070663_101347264 3300005455 Bacteria 631
65 Ga0070678_100711105 3300005456 Bacteria 906
66 Ga0070678_100931331 3300005456 Bacteria 796
67 Ga0070662_100509045 3300005457 Bacteria 1005
68 Ga0070681_10002995 3300005458 Bacteria 15675
69 Ga0070681_10013548 3300005458 Bacteria 8109
70 Ga0070681_10017738 3300005458 Bacteria 7114
71 Ga0070681_10065039 3300005458 Bacteria 3616
72 Ga0070681_10083232 3300005458 Bacteria 3153
73 Ga0070681_10141697 3300005458 Bacteria 2333
74 Ga0070681_10164387 3300005458 Bacteria 2142
75 Ga0070681_10257369 3300005458 Bacteria 1658
76 Ga0070681_10334239 3300005458 Bacteria 1424
77 Ga0070681_10421385 3300005458 Bacteria 1247
78 Ga0070681_10627253 3300005458 Bacteria 990
79 Ga0068867_100384385 3300005459 Bacteria 1180
80 Ga0070685_10302606 3300005466 Bacteria 1078
81 Ga0070707_100002712 3300005468 Bacteria 16848
82 Ga0070707_100100342 3300005468 Bacteria 2805
83 Ga0070707_100177888 3300005468 Bacteria 2074
84 Ga0070707_100345204 3300005468 Bacteria 1446
85 Ga0070707_101179352 3300005468 Bacteria 732
86 Ga0070698_100015615 3300005471 Bacteria 8020
87 Ga0070698_100190470 3300005471 Bacteria 1989
88 Ga0070698_100223671 3300005471 Bacteria 1815
89 Ga0070698_101389656 3300005471 Unclassified 653
90 Ga0070699_100851737 3300005518 Bacteria 834
91 Ga0070679_100032549 3300005530 Bacteria 5158
92 Ga0070679_100042729 3300005530 Bacteria 4515
93 Ga0070679_100156760 3300005530 Bacteria 2251
94 Ga0070679_100158918 3300005530 Bacteria 2234
95 Ga0070679_100587096 3300005530 Bacteria 1057
96 Ga0070679_101377065 3300005530 Bacteria 651
97 Ga0070684_100001409 3300005535 Bacteria 17288
98 Ga0070684_100029473 3300005535 Bacteria 4651
99 Ga0070684_100033593 3300005535 Bacteria 4382
100 Ga0070684_100040167 3300005535 Bacteria 4027
101 Ga0070684_100081507 3300005535 Bacteria 2863
102 Ga0070684_100090449 3300005535 Bacteria 2722
103 Ga0070684_100119746 3300005535 Bacteria 2368
104 Ga0070684_100223155 3300005535 Bacteria 1719
105 Ga0070684_100401996 3300005535 Bacteria 1263
106 Ga0070684_100469576 3300005535 Bacteria 1164
107 Ga0070684_101031928 3300005535 Bacteria 772
108 Ga0070697_101416259 3300005536 Bacteria 621
109 Ga0068853_100179062 3300005539 Bacteria 1922
110 Ga0068853_100344189 3300005539 Bacteria 1386
111 Ga0070672_100841375 3300005543 Bacteria 809
112 Ga0070672_100876960 3300005543 Bacteria 792
113 Ga0070695_100000029 3300005545 Bacteria 53859
114 Ga0070695_100496872 3300005545 Bacteria 943
115 Ga0070696_100073516 3300005546 Bacteria 2409
116 Ga0070696_100699724 3300005546 Bacteria 826
117 Ga0070696_101142914 3300005546 Bacteria 656
118 Ga0070665_100607463 3300005548 Bacteria 1107
119 Ga0068855_100034915 3300005563 Bacteria 5992
120 Ga0068855_100036011 3300005563 Bacteria 5892
121 Ga0068855_100038449 3300005563 Bacteria 5686
122 Ga0068855_100152218 3300005563 Bacteria 2630
123 Ga0068855_100366403 3300005563 Bacteria 1585
124 Ga0068855_100495992 3300005563 Bacteria 1327
125 Ga0070664_100096114 3300005564 Bacteria 2570
126 Ga0070664_100104597 3300005564 Bacteria 2465
127 Ga0068857_100074276 3300005577 Bacteria 3030
128 Ga0068857_100090560 3300005577 Bacteria 2737
129 Ga0068857_100278651 3300005577 Bacteria 1538
130 Ga0068854_100829579 3300005578 Bacteria 808
131 Ga0068856_100026801 3300005614 Bacteria 5620
132 Ga0068856_100185004 3300005614 Bacteria 2097
133 Ga0068856_100187549 3300005614 Bacteria 2082
134 Ga0068856_101974715 3300005614 Bacteria 594
135 Ga0070702_100432698 3300005615 Bacteria 950
136 Ga0068852_100031907 3300005616 Bacteria 4355
137 Ga0068852_101113974 3300005616 Bacteria 810
138 Ga0068852_101828372 3300005616 Bacteria 630
139 Ga0068861_100954612 3300005719 Bacteria 816
140 Ga0068858_101349966 3300005842 Bacteria 702
141 Ga0081540_1003860 3300005983 Bacteria 11698
142 Ga0081539_10001005 3300005985 Bacteria 52334
143 Ga0081539_10008668 3300005985 Bacteria 8758
144 Ga0070717_10159132 3300006028 Bacteria 1958
145 Ga0075432_10018976 3300006058 Bacteria 2348
146 Ga0070715_10001395 3300006163 Bacteria 6980
147 Ga0070715_10324663 3300006163 Bacteria 832
148 Ga0070716_100005635 3300006173 Bacteria 6082
149 Ga0070716_100012148 3300006173 Bacteria 4357
150 Ga0070716_100812872 3300006173 Bacteria 725
151 Ga0070712_100054382 3300006175 Bacteria 2799
152 Ga0070712_100096873 3300006175 Bacteria 2173
153 Ga0097621_100105826 3300006237 Bacteria 2372
154 Ga0075370_10425261 3300006353 Bacteria 798
155 Ga0068871_101496690 3300006358 Bacteria 638
156 Ga0075428_100188360 3300006844 Bacteria 2232
157 Ga0075428_100314079 3300006844 Bacteria 1684
158 Ga0075428_100346983 3300006844 Bacteria 1593
159 Ga0075428_101456319 3300006844 Bacteria 718
160 Ga0075430_100058807 3300006846 Bacteria 3231
161 Ga0075430_100362205 3300006846 Unclassified 1197
162 Ga0075431_100002910 3300006847 Bacteria 16568
163 Ga0075431_100088535 3300006847 Bacteria 3195
164 Ga0075431_100425413 3300006847 Bacteria 1327
165 Ga0075433_10005061 3300006852 Bacteria 10334
166 Ga0075433_10287233 3300006852 Bacteria 1457
167 Ga0075433_10515564 3300006852 Bacteria 1052
168 Ga0075434_100001294 3300006871 Bacteria 20866
169 Ga0075434_100005543 3300006871 Bacteria 11499
170 Ga0075434_100678115 3300006871 Bacteria 1048
171 Ga0075429_100115498 3300006880 Bacteria 2346
172 Ga0075429_100351487 3300006880 Bacteria 1290
173 Ga0075436_100122880 3300006914 Bacteria 1817
174 Ga0075436_100593226 3300006914 Bacteria 816
175 Ga0075435_100020701 3300007076 Bacteria 5048
176 Ga0075435_100325822 3300007076 Bacteria 1315
177 Ga0075435_100457583 3300007076 Bacteria 1101
178 Ga0075435_100476601 3300007076 Bacteria 1078
179 Ga0099795_10027214 3300007788 Bacteria 1933
180 Ga0105240_10017296 3300009093 Bacteria 9720
181 Ga0105240_10106166 3300009093 Bacteria 3407
182 Ga0105240_10180778 3300009093 Bacteria 2489
183 Ga0111539_10031645 3300009094 Bacteria 6427
184 Ga0111539_10275476 3300009094 Bacteria 1958
185 Ga0111539_10288660 3300009094 Bacteria 1909
186 Ga0111539_13098752 3300009094 Bacteria 536
187 Ga0105245_10130548 3300009098 Bacteria 2356
188 Ga0105245_10146073 3300009098 Bacteria 2231
189 Ga0105245_10158204 3300009098 Bacteria 2148
190 Ga0105245_10340504 3300009098 Bacteria 1483
191 Ga0105245_10434104 3300009098 Bacteria 1319
192 Ga0105245_10944344 3300009098 Bacteria 905
193 Ga0114129_10017841 3300009147 Bacteria 10107
194 Ga0114129_10229065 3300009147 Unclassified 2503
195 Ga0114129_12353518 3300009147 Bacteria 639
196 Ga0105243_10709385 3300009148 Bacteria 981
197 Ga0105243_10958826 3300009148 Bacteria 855
198 Ga0105241_10332887 3300009174 Bacteria 1313
199 Ga0105241_10391480 3300009174 Bacteria 1217
200 Ga0105242_10027540 3300009176 Bacteria 4514
201 Ga0105242_10074064 3300009176 Bacteria 2832
202 Ga0105248_10645438 3300009177 Bacteria 1194
203 Ga0105248_10791322 3300009177 Bacteria 1070
204 Ga0105237_10008817 3300009545 Bacteria 10876
205 Ga0105237_10522862 3300009545 Bacteria 1193
206 Ga0105237_10817718 3300009545 Bacteria 939
207 Ga0105238_10064901 3300009551 Bacteria 3651
208 Ga0105238_10253317 3300009551 Bacteria 1739
209 Ga0105238_10339069 3300009551 Bacteria 1491
210 Ga0105238_10686809 3300009551 Bacteria 1035
211 Ga0099796_10069171 3300010159 Bacteria 1270
212 Ga0105239_10261355 3300010375 Bacteria 1945
213 Ga0105239_10509694 3300010375 Unclassified 1368
214 Ga0105239_12051467 3300010375 Bacteria 664
215 Ga0157373_10151456 3300013100 Bacteria 1631
216 Ga0157373_10332684 3300013100 Bacteria 1082
217 Ga0157371_10264152 3300013102 Bacteria 1241
218 Ga0157371_10460145 3300013102 Bacteria 936
219 Ga0157370_10086075 3300013104 Bacteria 2953
220 Ga0157370_10096886 3300013104 Bacteria 2767
221 Ga0157370_10155624 3300013104 Bacteria 2127
222 Ga0157369_10002742 3300013105 Bacteria 21036
223 Ga0157369_10014160 3300013105 Bacteria 9011
224 Ga0157369_10028307 3300013105 Bacteria 6203
225 Ga0157369_10035760 3300013105 Bacteria 5445
226 Ga0157369_10087789 3300013105 Bacteria 3321
227 Ga0157369_10091640 3300013105 Bacteria 3244
228 Ga0157369_10149428 3300013105 Bacteria 2469
229 Ga0157369_10259355 3300013105 Bacteria 1813
230 Ga0157369_10267079 3300013105 Bacteria 1784
231 Ga0157369_11183293 3300013105 Bacteria 780
232 Ga0157374_10033900 3300013296 Bacteria 4661
233 Ga0157374_10085634 3300013296 Bacteria 2997
234 Ga0157378_10110998 3300013297 Bacteria 2514
235 Ga0163162_10641881 3300013306 Bacteria 1186
236 Ga0157372_10104611 3300013307 Bacteria 3236
237 Ga0157372_10238411 3300013307 Bacteria 2110
238 Ga0157372_10377093 3300013307 Bacteria 1653
239 Ga0157372_10507471 3300013307 Bacteria 1406
240 Ga0157372_10532690 3300013307 Bacteria 1369
241 Ga0157372_10689568 3300013307 Bacteria 1189
242 Ga0157375_10278747 3300013308 Bacteria 1835
243 Ga0163163_10184153 3300014325 Bacteria 2136
244 Ga0163163_10205677 3300014325 Bacteria 2017
245 Ga0163163_10235616 3300014325 Bacteria 1880
246 Ga0163163_10426316 3300014325 Unclassified 1385
247 Ga0157380_11247264 3300014326 Bacteria 789
248 Ga0182008_10000718 3300014497 Bacteria 23655
249 Ga0182008_10027803 3300014497 Bacteria 2862
250 Ga0182008_10108699 3300014497 Bacteria 1373
251 Ga0182008_10140612 3300014497 Bacteria 1207
252 Ga0157376_10061664 3300014969 Bacteria 3153
253 Ga0157376_10752696 3300014969 Bacteria 984
254 Ga0182007_10017644 3300015262 Bacteria 2602
255 Ga0197907_10472481 3300020069 Bacteria 765
256 Ga0197907_11274861 3300020069 Unclassified 530
257 Ga0197907_11434900 3300020069 Bacteria 4175
258 Ga0206356_10116221 3300020070 Bacteria 6173
259 Ga0206354_10772758 3300020081 Bacteria 1171
260 Ga0206354_11139686 3300020081 Bacteria 3303
261 Ga0206353_10417389 3300020082 Bacteria 1397
262 Ga0206353_10633007 3300020082 Bacteria 1757
263 Ga0206353_10862315 3300020082 Bacteria 1780
264 Ga0206353_11689011 3300020082 Bacteria 14322
265 Ga0206353_11755696 3300020082 Bacteria 4689
266 Ga0213874_10090979 3300021377 Bacteria 1002
267 Ga0224712_10006496 3300022467 Bacteria 3339
268 Ga0207692_10043244 3300025898 Bacteria 2240
269 Ga0207692_10145754 3300025898 Bacteria 1351
270 Ga0207688_10065403 3300025901 Bacteria 2055
271 Ga0207699_10018015 3300025906 Bacteria 3733
272 Ga0207699_10357131 3300025906 Bacteria 1033
273 Ga0207699_10751634 3300025906 Bacteria 715
274 Ga0207705_10079416 3300025909 Bacteria 2389
275 Ga0207705_10257238 3300025909 Bacteria 1332
276 Ga0207705_10333800 3300025909 Bacteria 1166
277 Ga0207705_10358496 3300025909 Bacteria 1124
278 Ga0207705_11044028 3300025909 Bacteria 631
279 Ga0207684_10423616 3300025910 Bacteria 1143
280 Ga0207684_10883971 3300025910 Bacteria 752
281 Ga0207654_10062092 3300025911 Bacteria 2188
282 Ga0207707_10020888 3300025912 Bacteria 5719
283 Ga0207707_10051153 3300025912 Bacteria 3598
284 Ga0207707_10091386 3300025912 Bacteria 2660
285 Ga0207707_10322561 3300025912 Bacteria 1333
286 Ga0207707_10336324 3300025912 Bacteria 1302
287 Ga0207707_10410299 3300025912 Bacteria 1162
288 Ga0207707_10571009 3300025912 Bacteria 959
289 Ga0207695_10052410 3300025913 Bacteria 4275
290 Ga0207695_10348733 3300025913 Bacteria 1368
291 Ga0207671_10113743 3300025914 Bacteria 2062
292 Ga0207671_10247303 3300025914 Bacteria 1402
293 Ga0207693_10007916 3300025915 Bacteria 8730
294 Ga0207693_10015138 3300025915 Bacteria 6191
295 Ga0207693_10069335 3300025915 Bacteria 2759
296 Ga0207693_10071338 3300025915 Bacteria 2718
297 Ga0207693_10441269 3300025915 Bacteria 1017
298 Ga0207693_10538489 3300025915 Bacteria 911
299 Ga0207693_10662770 3300025915 Bacteria 810
300 Ga0207693_10693421 3300025915 Bacteria 789
301 Ga0207663_10057469 3300025916 Bacteria 2451
302 Ga0207663_10101132 3300025916 Bacteria 1936
303 Ga0207663_10145925 3300025916 Bacteria 1654
304 Ga0207660_10039178 3300025917 Bacteria 3312
305 Ga0207660_10359275 3300025917 Bacteria 1168
306 Ga0207660_10437726 3300025917 Bacteria 1056
307 Ga0207660_10650777 3300025917 Bacteria 859
308 Ga0207660_10676895 3300025917 Bacteria 841
309 Ga0207660_10862154 3300025917 Bacteria 739
310 Ga0207657_10000988 3300025919 Bacteria 30190
311 Ga0207657_10001365 3300025919 Bacteria 26019
312 Ga0207657_10006228 3300025919 Bacteria 12402
313 Ga0207657_10015573 3300025919 Bacteria 7360
314 Ga0207657_10034259 3300025919 Bacteria 4569
315 Ga0207657_10060350 3300025919 Bacteria 3255
316 Ga0207657_10069096 3300025919 Bacteria 2999
317 Ga0207649_10024155 3300025920 Bacteria 3530
318 Ga0207649_10141788 3300025920 Bacteria 1645
319 Ga0207649_10256809 3300025920 Bacteria 1261
320 Ga0207649_10327814 3300025920 Bacteria 1127
321 Ga0207649_10755711 3300025920 Bacteria 757
322 Ga0207652_10007377 3300025921 Bacteria 8865
323 Ga0207652_10080258 3300025921 Bacteria 2852
324 Ga0207652_10090659 3300025921 Bacteria 2687
325 Ga0207652_10625203 3300025921 Bacteria 964
326 Ga0207652_10998968 3300025921 Bacteria 735
327 Ga0207646_10001768 3300025922 Bacteria 26172
328 Ga0207646_10353654 3300025922 Bacteria 1327
329 Ga0207646_10580598 3300025922 Bacteria 1007
330 Ga0207646_10734254 3300025922 Bacteria 882
331 Ga0207694_10064458 3300025924 Bacteria 2856
332 Ga0207694_10097107 3300025924 Bacteria 2331
333 Ga0207694_10166830 3300025924 Bacteria 1781
334 Ga0207650_10339276 3300025925 Bacteria 1234
335 Ga0207659_10079179 3300025926 Bacteria 2424
336 Ga0207659_10428017 3300025926 Bacteria 1111
337 Ga0207659_10655959 3300025926 Bacteria 897
338 Ga0207687_10050709 3300025927 Bacteria 2890
339 Ga0207687_10084981 3300025927 Bacteria 2295
340 Ga0207687_10284158 3300025927 Bacteria 1327
341 Ga0207687_10391892 3300025927 Bacteria 1140
342 Ga0207687_10555931 3300025927 Bacteria 963
343 Ga0207700_10094060 3300025928 Bacteria 2374
344 Ga0207700_10252655 3300025928 Bacteria 1506
345 Ga0207700_10788393 3300025928 Bacteria 850
346 Ga0207700_10877309 3300025928 Bacteria 803
347 Ga0207700_11118459 3300025928 Bacteria 704
348 Ga0207664_10022691 3300025929 Bacteria 4692
349 Ga0207664_10072301 3300025929 Bacteria 2780
350 Ga0207664_10126585 3300025929 Bacteria 2146
351 Ga0207664_10178626 3300025929 Bacteria 1821
352 Ga0207664_10284633 3300025929 Bacteria 1451
353 Ga0207644_10051087 3300025931 Bacteria 2966
354 Ga0207644_10151843 3300025931 Bacteria 1793
355 Ga0207690_10118173 3300025932 Bacteria 1921
356 Ga0207690_11304516 3300025932 Bacteria 607
357 Ga0207690_11305276 3300025932 Bacteria 606
358 Ga0207706_10650337 3300025933 Bacteria 903
359 Ga0207686_10263992 3300025934 Bacteria 1263
360 Ga0207686_10555958 3300025934 Bacteria 898
361 Ga0207709_10942909 3300025935 Bacteria 703
362 Ga0207704_11397505 3300025938 Bacteria 600
363 Ga0207665_10002358 3300025939 Bacteria 12754
364 Ga0207665_10071996 3300025939 Bacteria 2360
365 Ga0207665_10576630 3300025939 Bacteria 876
366 Ga0207665_11188140 3300025939 Bacteria 608
367 Ga0207711_10537339 3300025941 Bacteria 1090
368 Ga0207661_10003288 3300025944 Bacteria 11218
369 Ga0207661_10009282 3300025944 Bacteria 7050
370 Ga0207661_10088182 3300025944 Bacteria 2578
371 Ga0207661_10193808 3300025944 Bacteria 1783
372 Ga0207661_10203073 3300025944 Bacteria 1743
373 Ga0207661_10377804 3300025944 Bacteria 1282
374 Ga0207661_10580730 3300025944 Bacteria 1028
375 Ga0207679_10704156 3300025945 Bacteria 917
376 Ga0207679_11455360 3300025945 Bacteria 628
377 Ga0207667_10070378 3300025949 Bacteria 3641
378 Ga0207667_10160611 3300025949 Bacteria 2311
379 Ga0207667_10281783 3300025949 Bacteria 1698
380 Ga0207667_10370081 3300025949 Bacteria 1460
381 Ga0207667_10381307 3300025949 Bacteria 1436
382 Ga0207667_10554432 3300025949 Bacteria 1162
383 Ga0207667_10624700 3300025949 Bacteria 1085
384 Ga0207651_11031465 3300025960 Bacteria 736
385 Ga0207712_10302669 3300025961 Bacteria 1313
386 Ga0207640_10692175 3300025981 Bacteria 873
387 Ga0207640_11336005 3300025981 Bacteria 641
388 Ga0207658_10868277 3300025986 Bacteria 821
389 Ga0207677_10358783 3300026023 Bacteria 1224
390 Ga0207677_10740767 3300026023 Bacteria 875
391 Ga0207677_11031263 3300026023 Bacteria 747
392 Ga0207639_10234422 3300026041 Bacteria 1593
393 Ga0207639_10468825 3300026041 Bacteria 1146
394 Ga0207639_10691127 3300026041 Bacteria 946
395 Ga0207639_10903491 3300026041 Bacteria 825
396 Ga0207678_10629006 3300026067 Bacteria 942
397 Ga0207708_10747046 3300026075 Unclassified 839
398 Ga0207702_10136385 3300026078 Bacteria 2215
399 Ga0207702_10542527 3300026078 Bacteria 1137
400 Ga0207702_10559593 3300026078 Bacteria 1119
401 Ga0207641_10238689 3300026088 Bacteria 1693
402 Ga0207641_10396267 3300026088 Bacteria 1325
403 Ga0207676_10643291 3300026095 Bacteria 1023
404 Ga0207674_10003276 3300026116 Bacteria 19914
405 Ga0207674_10122383 3300026116 Bacteria 2568
406 Ga0207674_10137935 3300026116 Bacteria 2400
407 Ga0207674_10216189 3300026116 Bacteria 1865
408 Ga0207674_10269120 3300026116 Bacteria 1651
409 Ga0207674_10857443 3300026116 Bacteria 876
410 Ga0207675_100403066 3300026118 Bacteria 1348
411 Ga0207683_10254829 3300026121 Bacteria 1602
412 Ga0207698_10122159 3300026142 Bacteria 2206
413 Ga0207698_10255129 3300026142 Bacteria 1607
414 Ga0207698_10304494 3300026142 Bacteria 1485
415 Ga0207698_11303199 3300026142 Bacteria 741
416 Ga0207428_10009737 3300027907 Bacteria 8612
417 Ga0207428_10012767 3300027907 Bacteria 7368
418 Ga0207428_10079298 3300027907 Bacteria 2567
419 Ga0268266_11007485 3300028379 Bacteria 806
420 Ga0265319_1029856 3300028563 Bacteria 1911
421 Ga0265319_1039330 3300028563 Bacteria 1604
422 Ga0265319_1043375 3300028563 Bacteria 1511
423 Ga0265318_10003761 3300028577 Bacteria 7549
424 Ga0265318_10097709 3300028577 Bacteria 1081
425 Ga0265322_10060524 3300028654 Bacteria 1074
426 Ga0265338_10045788 3300028800 Bacteria 4018
427 Ga0265338_10145737 3300028800 Bacteria 1847
428 Ga0265338_10394954 3300028800 Bacteria 987
429 Ga0265320_10160639 3300031240 Bacteria 1012
430 Ga0265340_10185333 3300031247 Bacteria 940
431 Ga0265331_10056389 3300031250 Bacteria 1866
432 Ga0265327_10022085 3300031251 Bacteria 3819
433 Ga0307408_101886865 3300031548 Bacteria 573
434 Ga0307405_10284744 3300031731 Bacteria 1246
435 Ga0307410_10176923 3300031852 Bacteria 1612
436 Ga0307412_10291911 3300031911 Bacteria 1285
437 Ga0307409_100176900 3300031995 Bacteria 1884
438 Ga0307409_100450419 3300031995 Bacteria 1242
439 Ga0307416_100100631 3300032002 Bacteria 2514
440 Ga0307416_100502379 3300032002 Bacteria 1277
441 Ga0307411_10468061 3300032005 Bacteria 1058
442 Ga0307415_100037965 3300032126 Bacteria 3171
443 Ga0307415_100062191 3300032126 Bacteria 2588
444 Ga0373938_0040398 3300034957 Bacteria 1035
445 Ga0373940_0086838 3300035088 Bacteria 932
446 Ga0373936_0191139 3300035113 Bacteria 901
447 Ga0373945_0014109 3300035116 Bacteria 2673
448 Ga0373954_0134317 3300035118 Bacteria 1205
449 Ga0373957_0048124 3300035120 Bacteria 1624
450 Ga0373943_0007385 3300035170 Bacteria 4935
451 Ga0373943_0057666 3300035170 Bacteria 1930
452 Ga0373946_0010186 3300035171 Bacteria 3476
453 Ga0373946_0053165 3300035171 Bacteria 1700
454 Ga0373946_0266046 3300035171 Unclassified 840
455 Ga0373955_0022659 3300035172 Bacteria 3189
456 Ga0373955_0426795 3300035172 Bacteria 807
457 Ga0373924_0097993 3300035410 Bacteria 1259
458 Ga0373931_0007846 3300035691 Bacteria 5046
459 Ga0373935_0003843 3300035692 Bacteria 8762
460 Ga0373935_0088079 3300035692 Bacteria 2028
461 Ga0373935_0147731 3300035692 Bacteria 1593
462 Ga0373927_0182347 3300035695 Bacteria 1377
463 Ga0373927_0515955 3300035695 Bacteria 790
464 Ga0373947_0017632 3300035725 Bacteria 4108
465 Ga0373947_0018309 3300035725 Bacteria 4031
466 Ga0373937_0046394 3300036401 Bacteria 3973
467 Ga0373937_0410772 3300036401 Bacteria 1284
468 Ga0373937_0570721 3300036401 Bacteria 1075
469 Ga0373925_0002318 3300037068 Bacteria 15306
470 Ga0373925_0080148 3300037068 Bacteria 2481
471 Ga0395899_0003162 3300037312 Bacteria 13077
472 Ga0395899_0004845 3300037312 Bacteria 10480
473 Ga0395899_0007797 3300037312 Bacteria 8256
474 Ga0395899_0025379 3300037312 Bacteria 4474
475 Ga0395899_0145793 3300037312 Bacteria 1681
476 Ga0395899_0223208 3300037312 Bacteria 1304
477 Ga0395899_0244535 3300037312 Bacteria 1233
478 Ga0395899_0292532 3300037312 Bacteria 1105
479 Ga0395899_0343078 3300037312 Bacteria 1001
480 Ga0395899_0429466 3300037312 Bacteria 869
481 Ga0395899_0526105 3300037312 Bacteria 763
482 Ga0395900_0001640 3300037418 Bacteria 26256
483 Ga0395900_0003536 3300037418 Bacteria 16810
484 Ga0395900_0011339 3300037418 Bacteria 9119
485 Ga0395900_0014823 3300037418 Bacteria 7941
486 Ga0395900_0023113 3300037418 Bacteria 6362
487 Ga0395900_0027999 3300037418 Bacteria 5770
488 Ga0395900_0030855 3300037418 Bacteria 5504
489 Ga0395900_0083765 3300037418 Bacteria 3276
490 Ga0395900_0097722 3300037418 Bacteria 3017
491 Ga0395900_0117694 3300037418 Bacteria 2726
492 Ga0395900_0132440 3300037418 Bacteria 2554
493 Ga0395900_0257926 3300037418 Bacteria 1742
494 Ga0395900_0262216 3300037418 Bacteria 1725
495 Ga0395900_0276217 3300037418 Bacteria 1673
496 Ga0395900_0432957 3300037418 Bacteria 1274
497 Ga0395900_0568923 3300037418 Bacteria 1076
498 Ga0395900_0582845 3300037418 Bacteria 1060
499 Ga0395900_0806097 3300037418 Bacteria 867
500 Ga0395900_1130053 3300037418 Bacteria 700
501 Ga0395898_0003534 3300037466 Bacteria 17426
502 Ga0395898_0019282 3300037466 Bacteria 6944
503 Ga0395898_0019851 3300037466 Bacteria 6835
504 Ga0395898_0029685 3300037466 Bacteria 5473
505 Ga0395898_0047928 3300037466 Bacteria 4191
506 Ga0395898_0058471 3300037466 Bacteria 3753
507 Ga0395898_0083015 3300037466 Bacteria 3088
508 Ga0395898_0097904 3300037466 Bacteria 2816
509 Ga0395898_0125066 3300037466 Bacteria 2463
510 Ga0395898_0129495 3300037466 Bacteria 2418
511 Ga0395898_0150134 3300037466 Bacteria 2230
512 Ga0395898_0306945 3300037466 Bacteria 1513
513 Ga0395898_0373382 3300037466 Bacteria 1360
514 Ga0395898_0390625 3300037466 Bacteria 1327
515 Ga0395898_0492775 3300037466 Bacteria 1166
516 Ga0395898_0809495 3300037466 Bacteria 877
517 Ga0395898_0837631 3300037466 Bacteria 859
518 Ga0395898_0975986 3300037466 Bacteria 784
519 Ga0395898_0983422 3300037466 Bacteria 780
520 Ga0395898_0995180 3300037466 Unclassified 774
521 Ga0395898_1249463 3300037466 Bacteria 673
522 Ga0395898_1698890 3300037466 Bacteria 554
523 Ga0395905_0003269 3300037471 Bacteria 17422
524 Ga0395905_0003392 3300037471 Bacteria 17054
525 Ga0395905_0038107 3300037471 Bacteria 4510
526 Ga0395905_0040105 3300037471 Bacteria 4392
527 Ga0395905_0040306 3300037471 Bacteria 4381
528 Ga0395905_0117981 3300037471 Bacteria 2494
529 Ga0395905_0202542 3300037471 Bacteria 1860
530 Ga0395905_0230933 3300037471 Bacteria 1730
531 Ga0395905_0289069 3300037471 Bacteria 1526
532 Ga0395905_0329046 3300037471 Bacteria 1418
533 Ga0395905_0649200 3300037471 Bacteria 957
534 Ga0395905_0837641 3300037471 Bacteria 823
535 Ga0395905_0933621 3300037471 Bacteria 771
536 Ga0395901_0001841 3300038443 Bacteria 21913
537 Ga0395901_0002272 3300038443 Bacteria 19614
538 Ga0395901_0002650 3300038443 Bacteria 18087
539 Ga0395901_0014199 3300038443 Bacteria 8108
540 Ga0395901_0017797 3300038443 Bacteria 7251
541 Ga0395901_0018324 3300038443 Bacteria 7147
542 Ga0395901_0023342 3300038443 Bacteria 6339
543 Ga0395901_0056090 3300038443 Bacteria 4098
544 Ga0395901_0058107 3300038443 Bacteria 4023
545 Ga0395901_0107083 3300038443 Bacteria 2934
546 Ga0395901_0112838 3300038443 Bacteria 2854
547 Ga0395901_0117408 3300038443 Bacteria 2795
548 Ga0395901_0180390 3300038443 Bacteria 2215
549 Ga0395901_0204796 3300038443 Bacteria 2067
550 Ga0395901_0271614 3300038443 Bacteria 1763
551 Ga0395901_0312790 3300038443 Bacteria 1626
552 Ga0395901_0442277 3300038443 Bacteria 1331
553 Ga0395901_0445645 3300038443 Bacteria 1325
554 Ga0395901_0623347 3300038443 Bacteria 1085
555 Ga0395901_0751358 3300038443 Bacteria 968
556 Ga0395901_0777830 3300038443 Bacteria 948
557 Ga0395901_0902465 3300038443 Bacteria 865
558 Ga0395901_0935868 3300038443 Bacteria 846
559 Ga0395901_1485072 3300038443 Bacteria 634
560 Ga0395901_1819720 3300038443 Unclassified 558
561 Ga0436365_0560760 3300039437 Bacteria 691
562 Ga0436363_0012856 3300039450 Bacteria 1161
563 Ga0451789_0777155 3300041443 Bacteria 1049
564 Ga0451849_0524342 3300041505 Bacteria 677
565 Ga0451853_3721867 3300041512 Bacteria 1904
566 Ga0451853_3935337 3300041512 Unclassified 688
567 Ga0439448_0047021 3300042005 Bacteria 1407
568 Ga0439448_0116487 3300042005 Bacteria 915
569 Ga0466966_0004360 3300044684 Bacteria 9334
570 Ga0466966_0008955 3300044684 Bacteria 6632
571 Ga0466966_0023852 3300044684 Bacteria 4003
572 Ga0466966_0075341 3300044684 Bacteria 2108
573 Ga0466966_0115287 3300044684 Bacteria 1654
574 Ga0466961_0008109 3300044693 Bacteria 6687
575 Ga0466961_0016839 3300044693 Bacteria 4698
576 Ga0466961_0067875 3300044693 Bacteria 2265
577 Ga0466961_0273967 3300044693 Bacteria 1033
578 Ga0466963_0000095 3300044694 Bacteria 31064
579 Ga0466963_0008069 3300044694 Bacteria 6303
580 Ga0466963_0011499 3300044694 Bacteria 5390
581 Ga0466963_0028626 3300044694 Bacteria 3579
582 Ga0466963_0029189 3300044694 Bacteria 3548
583 Ga0466963_0030330 3300044694 Bacteria 3488
584 Ga0466963_0037276 3300044694 Bacteria 3173
585 Ga0466963_0042093 3300044694 Bacteria 2998
586 Ga0466963_0051935 3300044694 Bacteria 2718
587 Ga0466963_0101970 3300044694 Bacteria 1965
588 Ga0466963_0135942 3300044694 Bacteria 1700
589 Ga0466963_0158759 3300044694 Bacteria 1573
590 Ga0466963_0171082 3300044694 Bacteria 1514
591 Ga0466963_0178564 3300044694 Bacteria 1482
592 Ga0466963_0224269 3300044694 Bacteria 1317
593 Ga0466963_0248512 3300044694 Bacteria 1248
594 Ga0466963_0306751 3300044694 Bacteria 1116
595 Ga0466963_0348454 3300044694 Bacteria 1043
596 Ga0466963_0681771 3300044694 Bacteria 725
597 Ga0466963_0702819 3300044694 Bacteria 713
598 Ga0466964_0003701 3300044706 Bacteria 5599
599 Ga0466964_0010305 3300044706 Bacteria 3525
600 Ga0466964_0015210 3300044706 Bacteria 2929
601 Ga0466964_0219819 3300044706 Bacteria 922
602 Ga0466964_0552876 3300044706 Bacteria 625
603 Ga0466971_0016904 3300044719 Bacteria 3223
604 Ga0466971_0078349 3300044719 Bacteria 1505
605 Ga0466968_0006491 3300044735 Bacteria 4411
606 Ga0466968_0010769 3300044735 Bacteria 3553
607 Ga0466968_0011853 3300044735 Bacteria 3402
608 Ga0466968_0044769 3300044735 Bacteria 1876
609 Ga0466968_0050752 3300044735 Bacteria 1771
610 Ga0466968_0101534 3300044735 Bacteria 1284
611 Ga0466970_0056897 3300044765 Bacteria 2090
612 Ga0466970_0337445 3300044765 Bacteria 854
613 Ga0466957_0002974 3300044842 Bacteria 9202
614 Ga0466957_0007579 3300044842 Bacteria 6134
615 Ga0466957_0017807 3300044842 Bacteria 4168
616 Ga0466957_0033943 3300044842 Bacteria 3061
617 Ga0466957_0336303 3300044842 Bacteria 1022
618 Ga0466957_0588191 3300044842 Bacteria 778
619 Ga0466960_0071892 3300044901 Bacteria 1724
620 Ga0466960_0223136 3300044901 Bacteria 1038
621 Ga0466959_0005223 3300045049 Bacteria 8862
622 Ga0466959_0014268 3300045049 Bacteria 5766
623 Ga0466959_0024314 3300045049 Bacteria 4487
624 Ga0466959_0029877 3300045049 Bacteria 4036
625 Ga0466959_0343357 3300045049 Bacteria 1018
626 Ga0466959_0476347 3300045049 Bacteria 845
627 Ga0451576_0029648 3300045051 Bacteria 5853
628 Ga0466958_0007167 3300045836 Bacteria 6113
629 Ga0466958_0009418 3300045836 Bacteria 5443
630 Ga0466958_0011855 3300045836 Bacteria 4922
631 Ga0466958_0019375 3300045836 Bacteria 3960
632 Ga0466958_0045754 3300045836 Bacteria 2640
633 Ga0466958_0072191 3300045836 Bacteria 2113
634 Ga0466958_0077821 3300045836 Bacteria 2037
635 Ga0466958_0086108 3300045836 Bacteria 1939
636 Ga0466958_0223610 3300045836 Bacteria 1201
637 Ga0466958_0246864 3300045836 Bacteria 1141
638 Ga0466967_0002678 3300045976 Bacteria 11240
639 Ga0466967_0003018 3300045976 Bacteria 10796
640 Ga0466967_0007451 3300045976 Bacteria 7895
641 Ga0466967_0008435 3300045976 Bacteria 7550
642 Ga0466967_0012913 3300045976 Bacteria 6422
643 Ga0466967_0015896 3300045976 Bacteria 5915
644 Ga0466967_0020790 3300045976 Bacteria 5316
645 Ga0466967_0021061 3300045976 Bacteria 5283
646 Ga0466967_0025255 3300045976 Bacteria 4897
647 Ga0466967_0030792 3300045976 Bacteria 4507
648 Ga0466967_0037568 3300045976 Bacteria 4145
649 Ga0466967_0043946 3300045976 Bacteria 3871
650 Ga0466967_0056030 3300045976 Bacteria 3474
651 Ga0466967_0056509 3300045976 Bacteria 3461
652 Ga0466967_0072469 3300045976 Bacteria 3087
653 Ga0466967_0080098 3300045976 Bacteria 2946
654 Ga0466967_0086500 3300045976 Bacteria 2840
655 Ga0466967_0098860 3300045976 Bacteria 2664
656 Ga0466967_0155024 3300045976 Bacteria 2144
657 Ga0466967_0217489 3300045976 Bacteria 1814
658 Ga0466967_0471196 3300045976 Bacteria 1229
659 Ga0466967_0521829 3300045976 Bacteria 1167
660 Ga0466967_0599075 3300045976 Bacteria 1087
661 Ga0466967_0681788 3300045976 Bacteria 1017
662 Ga0466967_0752482 3300045976 Bacteria 966
663 Ga0466967_0796253 3300045976 Bacteria 938
664 Ga0466967_1039083 3300045976 Bacteria 816
665 Ga0466967_1309933 3300045976 Unclassified 721
666 Ga0466967_1801861 3300045976 Bacteria 609
667 Ga0495592_0027375 3300046454 Bacteria 4322
668 Ga0495592_0035705 3300046454 Bacteria 3745
669 Ga0495603_0005193 3300046455 Bacteria 7776
670 Ga0495603_0170669 3300046455 Bacteria 1260
671 Ga0495603_0620590 3300046455 Bacteria 619
672 Ga0495629_0020948 3300046459 Bacteria 4666
673 Ga0495629_0148369 3300046459 Bacteria 1630
674 Ga0495629_0281642 3300046459 Bacteria 1141
675 Ga0495629_0292700 3300046459 Bacteria 1116
676 Ga0495629_0425119 3300046459 Bacteria 901
677 Ga0495641_0005435 3300046461 Bacteria 8615
678 Ga0495641_0040762 3300046461 Bacteria 2158
679 Ga0495641_0043444 3300046461 Bacteria 2078
680 Ga0495641_0055399 3300046461 Bacteria 1800
681 Ga0495641_0066497 3300046461 Bacteria 1622
682 Ga0495641_0088610 3300046461 Bacteria 1384
683 Ga0495641_0143265 3300046461 Bacteria 1068
684 Ga0495651_0016426 3300046462 Bacteria 5732
685 Ga0495651_0723444 3300046462 Bacteria 619
686 Ga0495653_0009654 3300046463 Bacteria 7893
687 Ga0495653_0125920 3300046463 Bacteria 1819
688 Ga0495653_0126855 3300046463 Bacteria 1811
689 Ga0495653_0147014 3300046463 Bacteria 1650
690 Ga0495580_0035292 3300046472 Bacteria 3596
691 Ga0495582_0028580 3300046473 Bacteria 3060
692 Ga0495582_0057903 3300046473 Bacteria 2136
693 Ga0495582_0065794 3300046473 Bacteria 2003
694 Ga0495605_0105621 3300046474 Bacteria 1290
695 Ga0495605_0166512 3300046474 Bacteria 976
696 Ga0495639_0026021 3300046475 Bacteria 2583
697 Ga0495639_0066100 3300046475 Bacteria 1664
698 Ga0495662_0030188 3300046476 Bacteria 2616
699 Ga0495662_0264637 3300046476 Bacteria 846
700 Ga0495662_0339395 3300046476 Bacteria 739
701 Ga0495662_0396865 3300046476 Bacteria 677
702 Ga0495664_0038850 3300046477 Bacteria 2810
703 Ga0495664_0072644 3300046477 Bacteria 2056
704 Ga0495664_0438648 3300046477 Bacteria 782
705 Ga0495585_0292796 3300046492 Bacteria 802
706 Ga0495594_0591401 3300046499 Bacteria 629
707 Ga0495608_0006652 3300046511 Bacteria 8203
708 Ga0495608_0104873 3300046511 Bacteria 1820
709 Ga0495608_0360484 3300046511 Bacteria 893
710 Ga0495616_0037436 3300046513 Bacteria 2496
711 Ga0495618_0145624 3300046514 Bacteria 1514
712 Ga0495628_0162747 3300046516 Bacteria 1695
713 Ga0495628_0961850 3300046516 Bacteria 589
714 Ga0495630_0004280 3300046517 Bacteria 10013
715 Ga0495630_0011832 3300046517 Bacteria 6323
716 Ga0495630_0196422 3300046517 Bacteria 1539
717 Ga0495630_0558752 3300046517 Bacteria 877
718 Ga0495630_0558803 3300046517 Bacteria 877
719 Ga0495630_0593157 3300046517 Bacteria 849
720 Ga0495631_0070998 3300046518 Bacteria 1505
721 Ga0495637_0047484 3300046520 Bacteria 1812
722 Ga0495644_0009809 3300046523 Bacteria 3687
723 Ga0495644_0020525 3300046523 Bacteria 2521
724 Ga0495644_0122359 3300046523 Bacteria 990
725 Ga0495663_0008292 3300046525 Bacteria 2877
726 Ga0495666_0424299 3300046526 Bacteria 597
727 Ga0495642_0048785 3300046528 Bacteria 1738
728 Ga0495642_0074858 3300046528 Bacteria 1420
729 Ga0495652_0034234 3300046529 Bacteria 4428
730 Ga0495652_0052975 3300046529 Bacteria 3459
731 Ga0495652_0076047 3300046529 Bacteria 2786
732 Ga0495652_0254959 3300046529 Bacteria 1298
733 Ga0495652_0365454 3300046529 Bacteria 1030
734 Ga0495652_0468747 3300046529 Bacteria 878
735 Ga0495665_0004858 3300046531 Bacteria 7249
736 Ga0495665_0293796 3300046531 Bacteria 833
737 Ga0495640_0026151 3300046533 Bacteria 4221
738 Ga0495640_0065747 3300046533 Bacteria 2448
739 Ga0495640_0277394 3300046533 Bacteria 1044
740 Ga0495640_0336851 3300046533 Bacteria 932
741 Ga0495586_0083531 3300046535 Bacteria 1757
742 Ga0495586_0476871 3300046535 Bacteria 719
743 Ga0495587_0016542 3300046536 Bacteria 4587
744 Ga0495587_0065990 3300046536 Bacteria 2112
745 Ga0495587_0377947 3300046536 Bacteria 788
746 Ga0495609_0022728 3300046538 Bacteria 2889
747 Ga0495645_0056256 3300046543 Bacteria 2856
748 Ga0495645_0165391 3300046543 Bacteria 1526
749 Ga0495667_0029836 3300046559 Bacteria 3669
750 Ga0495667_0054717 3300046559 Bacteria 2625
751 Ga0495667_0067561 3300046559 Bacteria 2335
752 Ga0495667_0207401 3300046559 Bacteria 1253
753 Ga0495667_0311485 3300046559 Bacteria 997
754 Ga0495656_0003250 3300046615 Bacteria 5481
755 Ga0495656_0024202 3300046615 Bacteria 2396
756 Ga0495656_0209845 3300046615 Bacteria 970
757 Ga0495656_0429408 3300046615 Bacteria 694
758 Ga0495656_0439916 3300046615 Bacteria 686
759 Ga0495668_0062123 3300046616 Bacteria 2059
760 Ga0495634_0057539 3300046642 Bacteria 2594
761 Ga0495634_0062957 3300046642 Bacteria 2462
762 Ga0495634_0087685 3300046642 Bacteria 2025
763 Ga0495634_0101245 3300046642 Bacteria 1861
764 Ga0495634_0282036 3300046642 Bacteria 1009
765 Ga0495611_0083262 3300046648 Bacteria 1473
766 Ga0495611_0118349 3300046648 Bacteria 1235
767 Ga0495635_0011900 3300046663 Bacteria 6097
768 Ga0495635_0029948 3300046663 Bacteria 3784
769 Ga0495635_0050628 3300046663 Bacteria 2863
770 Ga0495635_0479215 3300046663 Bacteria 820
771 Ga0495635_0536263 3300046663 Bacteria 768
772 Ga0495635_0571063 3300046663 Bacteria 740
773 Ga0495635_0589517 3300046663 Bacteria 726
774 Ga0495657_0005166 3300046675 Bacteria 10339
775 Ga0495657_0013766 3300046675 Bacteria 5955
776 Ga0495657_0535420 3300046675 Bacteria 681
777 Ga0495599_0014803 3300046678 Bacteria 4830
778 Ga0495599_0058776 3300046678 Bacteria 2405
779 Ga0495599_0179970 3300046678 Bacteria 1303
780 Ga0495623_0009860 3300046679 Bacteria 6188
781 Ga0495646_0045703 3300046680 Bacteria 2673
782 Ga0495647_0004336 3300046681 Bacteria 4600
783 Ga0495647_0016354 3300046681 Bacteria 2611
784 Ga0495647_0106068 3300046681 Bacteria 1168
785 Ga0495658_0002872 3300046683 Bacteria 8655
786 Ga0495658_0047629 3300046683 Bacteria 2415
787 Ga0495658_0157646 3300046683 Bacteria 1398
788 Ga0495658_0165125 3300046683 Bacteria 1367
789 Ga0495613_0021823 3300046689 Bacteria 4772
790 Ga0495613_0051296 3300046689 Bacteria 3040
791 Ga0495613_0132438 3300046689 Bacteria 1785
792 Ga0495613_0201701 3300046689 Bacteria 1402
793 Ga0495624_0057267 3300046690 Bacteria 2450
794 Ga0495624_0200574 3300046690 Bacteria 1212
795 Ga0495670_0208706 3300046691 Bacteria 1036
796 Ga0495589_0038852 3300046794 Bacteria 2381
797 Ga0495600_0046445 3300046809 Bacteria 2833
798 Ga0495600_0056126 3300046809 Bacteria 2573
799 Ga0495600_0084751 3300046809 Bacteria 2068
800 Ga0495581_0000505 3300047315 Bacteria 19955
801 Ga0495581_0038759 3300047315 Bacteria 2758
802 Ga0495581_0110012 3300047315 Bacteria 1602
803 Ga0495581_0354633 3300047315 Bacteria 856
804 Ga0495604_0006659 3300047317 Bacteria 9154
805 Ga0495604_0107011 3300047317 Bacteria 2045
806 Ga0495604_0447809 3300047317 Bacteria 844
807 Ga0495604_0502504 3300047317 Bacteria 786
808 Ga0495636_0038751 3300047318 Bacteria 1973
809 Ga0495674_0011878 3300047319 Bacteria 8209
810 Ga0495674_0015466 3300047319 Bacteria 7130
811 Ga0495674_0021386 3300047319 Bacteria 5984
812 Ga0495674_0131801 3300047319 Bacteria 2106
813 Ga0495674_0307263 3300047319 Bacteria 1294
814 Ga0495674_0312627 3300047319 Bacteria 1281
815 Ga0495674_0410248 3300047319 Bacteria 1092
816 Ga0495676_0009864 3300047321 Bacteria 8676
817 Ga0495676_0068497 3300047321 Bacteria 2742
818 Ga0495676_0131440 3300047321 Bacteria 1806
819 Ga0495676_0140485 3300047321 Bacteria 1731
820 Ga0495676_0482453 3300047321 Bacteria 815
821 Ga0495676_0505593 3300047321 Bacteria 793
822 Ga0495676_0719522 3300047321 Bacteria 645
823 Ga0495680_0005532 3300047322 Bacteria 11858
824 Ga0495680_0022217 3300047322 Bacteria 5293
825 Ga0495680_0023897 3300047322 Bacteria 5078
826 Ga0495680_0042745 3300047322 Bacteria 3593
827 Ga0495680_0066240 3300047322 Bacteria 2765
828 Ga0495680_0350577 3300047322 Bacteria 1028
829 Ga0495675_0002014 3300047444 Bacteria 12134
830 Ga0495675_0149268 3300047444 Bacteria 1445
831 Ga0495684_0004528 3300047471 Bacteria 10857
832 Ga0495684_0009628 3300047471 Bacteria 7453
833 Ga0495684_0095741 3300047471 Bacteria 2247
834 Ga0495684_0191363 3300047471 Bacteria 1512
835 Ga0495684_0271229 3300047471 Bacteria 1227
836 Ga0495593_0004729 3300047673 Bacteria 8093
837 Ga0495602_0192523 3300048088 Bacteria 1562
838 Ga0495602_0208742 3300048088 Bacteria 1484
839 Ga0495602_0400929 3300048088 Bacteria 978
840 Ga0496100_0008560 3300048903 Bacteria 5709
841 Ga0496100_0009080 3300048903 Bacteria 5573
842 Ga0496101_0001024 3300048904 Bacteria 16471
843 Ga0496101_0035886 3300048904 Bacteria 3508
844 Ga0496101_0061970 3300048904 Bacteria 2718
845 Ga0496101_0112226 3300048904 Bacteria 2053
846 Ga0496101_0157292 3300048904 Bacteria 1742
847 Ga0496101_0323111 3300048904 Bacteria 1211
848 Ga0496101_0484527 3300048904 Bacteria 977
849 Ga0496102_0013068 3300048905 Bacteria 7189
850 Ga0496102_0022488 3300048905 Bacteria 5587
851 Ga0496102_0094431 3300048905 Bacteria 2771
852 Ga0496102_0121116 3300048905 Bacteria 2443
853 Ga0496102_0225966 3300048905 Bacteria 1765
854 Ga0496102_0796499 3300048905 Bacteria 867
855 Ga0496103_0004988 3300048906 Bacteria 8006
856 Ga0496103_0009793 3300048906 Bacteria 5674
857 Ga0496103_0010423 3300048906 Bacteria 5500
858 Ga0496103_0173891 3300048906 Bacteria 1383
859 Ga0496103_0290804 3300048906 Bacteria 1051
860 Ga0496103_0375431 3300048906 Bacteria 914
861 Ga0496104_0002338 3300048907 Bacteria 16381
862 Ga0496104_0016855 3300048907 Bacteria 6642
863 Ga0496104_0034005 3300048907 Bacteria 4752
864 Ga0496104_0236072 3300048907 Bacteria 1740
865 Ga0496104_0819664 3300048907 Bacteria 836
866 Ga0496105_0001042 3300048908 Bacteria 19175
867 Ga0496105_0002856 3300048908 Bacteria 12644
868 Ga0496105_0128886 3300048908 Bacteria 2086
869 Ga0496105_0357352 3300048908 Bacteria 1166
870 Ga0496105_0372799 3300048908 Bacteria 1137
871 Ga0496105_0428153 3300048908 Bacteria 1047
872 Ga0496106_0013216 3300048909 Bacteria 6092
873 Ga0496106_0057285 3300048909 Bacteria 2947
874 Ga0496106_0071687 3300048909 Bacteria 2648
875 Ga0496106_0478655 3300048909 Unclassified 1000
876 Ga0496106_0570484 3300048909 Bacteria 907
877 Ga0496107_0001734 3300048910 Bacteria 13705
878 Ga0496107_0002291 3300048910 Bacteria 12358
879 Ga0496107_0273087 3300048910 Bacteria 1258
880 Ga0496107_0398035 3300048910 Bacteria 1024
881 Ga0496107_0502277 3300048910 Bacteria 900
882 Ga0496107_0614025 3300048910 Bacteria 803
883 Ga0496108_0008931 3300048911 Bacteria 8122
884 Ga0496108_0027191 3300048911 Bacteria 4721
885 Ga0496108_0028356 3300048911 Bacteria 4631
886 Ga0496108_0264196 3300048911 Bacteria 1498
887 Ga0496108_0408869 3300048911 Bacteria 1185
888 Ga0496108_0695135 3300048911 Bacteria 882
889 Ga0496109_0018533 3300048912 Bacteria 6114
890 Ga0496109_0032272 3300048912 Bacteria 4707
891 Ga0496109_0041024 3300048912 Bacteria 4193
892 Ga0496109_0043230 3300048912 Bacteria 4084
893 Ga0496109_0056706 3300048912 Bacteria 3574
894 Ga0496109_0074982 3300048912 Bacteria 3110
895 Ga0496109_0199773 3300048912 Bacteria 1879
896 Ga0496109_0222834 3300048912 Bacteria 1774
897 Ga0496109_0322967 3300048912 Bacteria 1457
898 Ga0496109_0355118 3300048912 Bacteria 1385
899 Ga0496109_0440861 3300048912 Bacteria 1230
900 Ga0496109_0573132 3300048912 Bacteria 1064
901 Ga0496109_0612723 3300048912 Bacteria 1025
902 Ga0496109_1073613 3300048912 Bacteria 742
903 Ga0496110_0010243 3300048913 Bacteria 7615
904 Ga0496110_0069790 3300048913 Bacteria 3112
905 Ga0496110_0150910 3300048913 Bacteria 2104
906 Ga0496110_0163347 3300048913 Bacteria 2019
907 Ga0496110_0183011 3300048913 Bacteria 1903
908 Ga0496110_0388111 3300048913 Bacteria 1273
909 Ga0496110_0447940 3300048913 Bacteria 1177
910 Ga0496111_0021275 3300048914 Bacteria 4527
911 Ga0496111_0142501 3300048914 Bacteria 1776
912 Ga0496111_0243921 3300048914 Bacteria 1334
913 Ga0496111_0302603 3300048914 Bacteria 1185
914 Ga0496112_0000635 3300048915 Bacteria 24368
915 Ga0496112_0040922 3300048915 Bacteria 4533
916 Ga0496112_0197701 3300048915 Bacteria 1971
917 Ga0496112_0218477 3300048915 Bacteria 1862
918 Ga0496112_0256769 3300048915 Bacteria 1698
919 Ga0496112_0389948 3300048915 Bacteria 1333
920 Ga0496112_0570341 3300048915 Bacteria 1065
921 Ga0496113_0077332 3300048916 Bacteria 2544
922 Ga0496113_0280871 3300048916 Bacteria 1331
923 Ga0496113_0577503 3300048916 Bacteria 901
924 Ga0496114_0000892 3300048917 Bacteria 22279
925 Ga0496114_0008778 3300048917 Bacteria 8008
926 Ga0496114_0009938 3300048917 Bacteria 7562
927 Ga0496114_0018394 3300048917 Bacteria 5649
928 Ga0496114_0235057 3300048917 Bacteria 1610
929 Ga0496114_0277674 3300048917 Bacteria 1477
930 Ga0496114_0862023 3300048917 Bacteria 786
931 Ga0496115_0000701 3300048918 Bacteria 24832
932 Ga0496115_0013798 3300048918 Bacteria 6118
933 Ga0496115_0014516 3300048918 Bacteria 5964
934 Ga0496115_0022567 3300048918 Bacteria 4878
935 Ga0496115_0087109 3300048918 Bacteria 2548
936 Ga0496115_0797104 3300048918 Bacteria 735
937 Ga0501031_0012388 3300049568 Bacteria 5560
938 Ga0501032_0043883 3300049569 Bacteria 3027
939 Ga0501032_0059046 3300049569 Bacteria 2574
940 Ga0501033_0021378 3300049570 Bacteria 4881
941 Ga0501033_0026858 3300049570 Bacteria 4332
942 Ga0501034_0034567 3300049571 Bacteria 5124
943 Ga0501036_0009096 3300049572 Bacteria 8170
944 Ga0501036_0199588 3300049572 Bacteria 1682
945 Ga0501037_0001731 3300049573 Bacteria 15846
946 Ga0501037_0048511 3300049573 Bacteria 3111
947 Ga0501038_0015616 3300049574 Bacteria 6902
948 Ga0501038_0020426 3300049574 Bacteria 5953
949 Ga0501039_0053012 3300049575 Bacteria 3138
950 Ga0501039_0062951 3300049575 Bacteria 2874
951 Ga0501040_0016677 3300049576 Bacteria 4866
952 Ga0501040_0475713 3300049576 Bacteria 900
953 Ga0501041_0007506 3300049577 Bacteria 6398
954 Ga0501041_0016523 3300049577 Bacteria 4388
955 Ga0501042_0019636 3300049578 Bacteria 4696
956 Ga0501042_0045197 3300049578 Bacteria 3138
957 Ga0501042_0080671 3300049578 Bacteria 2331
958 Ga0501043_0001696 3300049579 Bacteria 19096
959 Ga0501043_0087251 3300049579 Bacteria 2452
960 Ga0501046_0011144 3300049580 Bacteria 7701
961 Ga0501046_0013699 3300049580 Bacteria 6856
962 Ga0501046_0639456 3300049580 Bacteria 753
963 Ga0501047_0030877 3300049581 Bacteria 5166
964 Ga0501047_0737549 3300049581 Bacteria 801
965 Ga0501048_0001796 3300049582 Bacteria 16311
966 Ga0501048_0042581 3300049582 Bacteria 3250
967 Ga0501048_1295328 3300049582 Bacteria 524
968 Ga0501067_0005193 3300049583 Bacteria 7236
969 Ga0501067_0026909 3300049583 Bacteria 3185
970 Ga0501067_0100339 3300049583 Bacteria 1608
971 Ga0501067_0221180 3300049583 Bacteria 1054
972 Ga0501068_0001541 3300049584 Bacteria 12248
973 Ga0501068_0011481 3300049584 Bacteria 5000
974 Ga0501068_0362784 3300049584 Bacteria 932
975 Ga0501069_0012964 3300049585 Bacteria 4439
976 Ga0501069_0032961 3300049585 Bacteria 2851
977 Ga0501069_0041060 3300049585 Bacteria 2556
978 Ga0501069_0059252 3300049585 Bacteria 2137
979 Ga0501069_0195433 3300049585 Bacteria 1171
980 Ga0501070_0007108 3300049586 Bacteria 9518
981 Ga0501070_0011141 3300049586 Bacteria 7590
982 Ga0501070_0014542 3300049586 Bacteria 6622
983 Ga0501070_0039570 3300049586 Bacteria 3933
984 Ga0501070_0192198 3300049586 Bacteria 1677
985 Ga0501070_0292216 3300049586 Bacteria 1328
986 Ga0501071_0001183 3300049587 Bacteria 14683
987 Ga0501071_0018706 3300049587 Bacteria 4802
988 Ga0501071_0573458 3300049587 Bacteria 867
989 Ga0501071_0748823 3300049587 Bacteria 753
990 Ga0501072_0003411 3300049588 Bacteria 11969
991 Ga0501072_0011384 3300049588 Bacteria 6798
992 Ga0501072_0020756 3300049588 Bacteria 5091
993 Ga0501072_0239786 3300049588 Bacteria 1444
994 Ga0501073_0009280 3300049589 Bacteria 7256
995 Ga0501073_0129586 3300049589 Bacteria 1748
996 Ga0501074_0000859 3300049590 Bacteria 19335
997 Ga0501074_0008458 3300049590 Bacteria 7460
998 Ga0501074_0039598 3300049590 Bacteria 3413
999 Ga0501074_0054359 3300049590 Bacteria 2887
1000 Ga0501074_0081022 3300049590 Bacteria 2328
1001 Ga0501075_0023721 3300049591 Bacteria 4492
1002 Ga0501075_1142177 3300049591 Bacteria 591
1003 Ga0501076_0033954 3300049592 Bacteria 3984
1004 Ga0501076_0240320 3300049592 Bacteria 1481
1005 Ga0501077_0026488 3300049593 Bacteria 3679
1006 Ga0501077_0028800 3300049593 Bacteria 3530
1007 Ga0501077_0087590 3300049593 Bacteria 1973
1008 Ga0501077_0107627 3300049593 Bacteria 1767
1009 Ga0501079_0009336 3300049741 Bacteria 7433
1010 Ga0501079_0014711 3300049741 Bacteria 5963
1011 Ga0501079_0024949 3300049741 Bacteria 4586
1012 Ga0501080_0008532 3300049742 Bacteria 9291
1013 Ga0501080_0015795 3300049742 Bacteria 6964
1014 Ga0501080_0031199 3300049742 Bacteria 4965
1015 Ga0501080_0247896 3300049742 Bacteria 1624
1016 Ga0501081_0031502 3300049743 Bacteria 3593
1017 Ga0501081_0077331 3300049743 Bacteria 2325
1018 Ga0501081_0095898 3300049743 Bacteria 2092
1019 Ga0501083_0002114 3300049744 Bacteria 13633
1020 Ga0501083_0007136 3300049744 Bacteria 7933
1021 Ga0501083_0026409 3300049744 Bacteria 4013
1022 Ga0501035_0008865 3300049822 Bacteria 9360
1023 Ga0501035_0379749 3300049822 Bacteria 1179
1024 Ga0501044_0011094 3300049823 Bacteria 9773
1025 Ga0501044_0101841 3300049823 Bacteria 2889
1026 Ga0501044_1053588 3300049823 Bacteria 684
1027 Ga0501045_0072285 3300049824 Bacteria 2539
1028 Ga0501045_0418753 3300049824 Bacteria 996
1029 nmdc:mga03n38_354518_c1 3300050490 Bacteria 799
1030 nmdc:mga0yw44_660246_c1 3300050492 Bacteria 710
1031 nmdc:mga0yw44_818358_c1 3300050492 Bacteria 632
1032 nmdc:mga05p37_141564_c1 3300050507 Bacteria 2947
1033 nmdc:mga05p37_202699_c1 3300050507 Bacteria 2402
1034 nmdc:mga09592_323962_c1 3300050508 Unclassified 1335
1035 nmdc:mga0qj67_216598_c1 3300050509 Bacteria 1555
1036 nmdc:mga0qj67_293319_c1 3300050509 Unclassified 1318
1037 nmdc:mga06r32_352063_c1 3300050510 Unclassified 1457
1038 nmdc:mga08y16_111271_c1 3300050511 Bacteria 2851
1039 nmdc:mga08y16_116643_c1 3300050511 Bacteria 2780
1040 nmdc:mga08y16_361421_c1 3300050511 Bacteria 1490
1041 nmdc:mga0n895_17051_c1 3300050512 Bacteria 6685
1042 nmdc:mga0n895_32525_c1 3300050512 Bacteria 5007
1043 nmdc:mga0n895_599025_c1 3300050512 Unclassified 1105
1044 nmdc:mga0rr50_118874_c1 3300050513 Bacteria 2101
1045 nmdc:mga0rr50_76794_c1 3300050513 Bacteria 2565
1046 nmdc:mga08x19_62383_c1 3300050514 Bacteria 2417
1047 nmdc:mga0a205_189643_c1 3300050515 Bacteria 1948
1048 nmdc:mga0a205_243814_c1 3300050515 Bacteria 1678
1049 nmdc:mga0a205_38578_c1 3300050515 Bacteria 4596
1050 Ga0495601_0037540 3300053077 Bacteria 3029
1051 Ga0495601_0199540 3300053077 Bacteria 1307
1052 Ga0495601_0213797 3300053077 Bacteria 1259
1053 Ga0495601_0490212 3300053077 Bacteria 793
1054 Ga0495601_0521044 3300053077 Bacteria 766
1055 Ga0495612_0007074 3300053078 Bacteria 4589
1056 Ga0495595_0013345 3300053084 Bacteria 3471
1057 Ga0495595_0030875 3300053084 Bacteria 2405
1058 Ga0495595_0032865 3300053084 Bacteria 2338
1059 Ga0495595_0087146 3300053084 Bacteria 1494
1060 Ga0495619_0004147 3300053085 Bacteria 9261
1061 Ga0495619_0066626 3300053085 Bacteria 2403
1062 Ga0495619_0080476 3300053085 Bacteria 2192
1063 Ga0495619_0083344 3300053085 Bacteria 2156
1064 Ga0495619_0102697 3300053085 Bacteria 1947
1065 Ga0495619_0160773 3300053085 Bacteria 1551
1066 Ga0495619_0339142 3300053085 Bacteria 1040
1067 Ga0495619_0406684 3300053085 Bacteria 940
1068 Ga0495619_0456096 3300053085 Bacteria 881
1069 Ga0500566_0054705 3300053094 Bacteria 2275
1070 Ga0501084_0028831 3300054114 Bacteria 4640
1071 Ga0501084_0030687 3300054114 Bacteria 4494
1072 Ga0501084_0041823 3300054114 Bacteria 3834
1073 Ga0501084_0504338 3300054114 Bacteria 1023
1074 Ga0501084_0811679 3300054114 Bacteria 788
1075 Ga0590075_070203 3300059424 Bacteria 905
1076 Ga0501082_0011837 3300060353 Bacteria 7499
1077 Ga0501082_0055589 3300060353 Bacteria 3409
1078 Ga0501082_0378231 3300060353 Bacteria 1235
1079 Ga0501082_0836552 3300060353 Bacteria 805
1080 Ga0466962_0000096 3300061719 Bacteria 35253
1081 Ga0466962_0001445 3300061719 Bacteria 11078
1082 Ga0466962_0086266 3300061719 Bacteria 1503
1083 Ga0530510_0003924 3300061734 Bacteria 10260
1084 Ga0530510_0047288 3300061734 Bacteria 3109
1085 Ga0530510_0082007 3300061734 Bacteria 2348
1086 Ga0530510_0155623 3300061734 Bacteria 1689
1087 Ga0530510_0365241 3300061734 Bacteria 1085
1088 Ga0070675_101415410
1089 JGI25406J46586_10054802
1090 Ga0070658_10012791
1091 Ga0070658_10037453
1092 Ga0070658_10059517
1093 Ga0070658_10337975
1094 Ga0070658_11318679
1095 Ga0070683_100051957
1096 Ga0070683_100061493
1097 Ga0070683_100088710
1098 Ga0070683_100097095
1099 Ga0070683_100896286
1100 Ga0070683_101022265
1101 Ga0070683_101034342
1102 Ga0070680_100006253
1103 Ga0070680_100169771
1104 Ga0070680_100219668
1105 Ga0070680_100232872
1106 Ga0070680_101028469
1107 Ga0070682_100805388
1108 Ga0068868_100662810
1109 Ga0070660_100001098
1110 Ga0070660_100046194
1111 Ga0070660_100052003
1112 Ga0070660_100080718
1113 Ga0070660_100103559
1114 Ga0070660_100128204
1115 Ga0070660_100722728
1116 Ga0070661_100012445
1117 Ga0070661_100065974
1118 Ga0070661_100108966
1119 Ga0070661_100202404
1120 Ga0070661_100223911
1121 Ga0070675_100161683
1122 Ga0070674_100062493
1123 Ga0070674_101164628
1124 Ga0070659_100031564
1125 Ga0070659_100118677
1126 Ga0070659_100150596
1127 Ga0070659_100762250
1128 Ga0070659_100981294
1129 Ga0070659_101333969
1130 Ga0070703_10109839
1131 Ga0070709_10028844
1132 Ga0070709_10606094
1133 Ga0070714_100025095
1134 Ga0070714_100078883
1135 Ga0070714_100210438
1136 Ga0070714_100245545
1137 Ga0070714_100384996
1138 Ga0070713_100001060
1139 Ga0070713_100243387
1140 Ga0070713_101855192
1141 Ga0070710_10057608
1142 Ga0070701_10214097
1143 Ga0070711_100013538
1144 Ga0070711_100021588
1145 Ga0070711_100328492
1146 Ga0070705_100599476
1147 Ga0070694_100063127
1148 Ga0070708_100034217
1149 Ga0070708_100762834
1150 Ga0070663_100520901
1151 Ga0070663_101347264
1152 Ga0070678_100711105
1153 Ga0070678_100931331
1154 Ga0070662_100509045
1155 Ga0070681_10002995
1156 Ga0070681_10013548
1157 Ga0070681_10017738
1158 Ga0070681_10065039
1159 Ga0070681_10083232
1160 Ga0070681_10141697
1161 Ga0070681_10164387
1162 Ga0070681_10257369
1163 Ga0070681_10334239
1164 Ga0070681_10421385
1165 Ga0070681_10627253
1166 Ga0068867_100384385
1167 Ga0070685_10302606
1168 Ga0070707_100002712
1169 Ga0070707_100100342
1170 Ga0070707_100177888
1171 Ga0070707_100345204
1172 Ga0070707_101179352
1173 Ga0070698_100015615
1174 Ga0070698_100190470
1175 Ga0070698_100223671
1176 Ga0070698_101389656
1177 Ga0070699_100851737
1178 Ga0070679_100032549
1179 Ga0070679_100042729
1180 Ga0070679_100156760
1181 Ga0070679_100158918
1182 Ga0070679_100587096
1183 Ga0070679_101377065
1184 Ga0070684_100001409
1185 Ga0070684_100029473
1186 Ga0070684_100033593
1187 Ga0070684_100040167
1188 Ga0070684_100081507
1189 Ga0070684_100090449
1190 Ga0070684_100119746
1191 Ga0070684_100223155
1192 Ga0070684_100401996
1193 Ga0070684_100469576
1194 Ga0070684_101031928
1195 Ga0070697_101416259
1196 Ga0068853_100179062
1197 Ga0068853_100344189
1198 Ga0070672_100841375
1199 Ga0070672_100876960
1200 Ga0070695_100000029
1201 Ga0070695_100496872
1202 Ga0070696_100073516
1203 Ga0070696_100699724
1204 Ga0070696_101142914
1205 Ga0070665_100607463
1206 Ga0068855_100034915
1207 Ga0068855_100036011
1208 Ga0068855_100038449
1209 Ga0068855_100152218
1210 Ga0068855_100366403
1211 Ga0068855_100495992
1212 Ga0070664_100096114
1213 Ga0070664_100104597
1214 Ga0068857_100074276
1215 Ga0068857_100090560
1216 Ga0068857_100278651
1217 Ga0068854_100829579
1218 Ga0068856_100026801
1219 Ga0068856_100185004
1220 Ga0068856_100187549
1221 Ga0068856_101974715
1222 Ga0070702_100432698
1223 Ga0068852_100031907
1224 Ga0068852_101113974
1225 Ga0068852_101828372
1226 Ga0068861_100954612
1227 Ga0068858_101349966
1228 Ga0081540_1003860
1229 Ga0081539_10001005
1230 Ga0081539_10008668
1231 Ga0070717_10159132
1232 Ga0075432_10018976
1233 Ga0070715_10001395
1234 Ga0070715_10324663
1235 Ga0070716_100005635
1236 Ga0070716_100012148
1237 Ga0070716_100812872
1238 Ga0070712_100054382
1239 Ga0070712_100096873
1240 Ga0097621_100105826
1241 Ga0075370_10425261
1242 Ga0068871_101496690
1243 Ga0075428_100188360
1244 Ga0075428_100314079
1245 Ga0075428_100346983
1246 Ga0075428_101456319
1247 Ga0075430_100058807
1248 Ga0075430_100362205
1249 Ga0075431_100002910
1250 Ga0075431_100088535
1251 Ga0075431_100425413
1252 Ga0075433_10005061
1253 Ga0075433_10287233
1254 Ga0075433_10515564
1255 Ga0075434_100001294
1256 Ga0075434_100005543
1257 Ga0075434_100678115
1258 Ga0075429_100115498
1259 Ga0075429_100351487
1260 Ga0075436_100122880
1261 Ga0075436_100593226
1262 Ga0075435_100020701
1263 Ga0075435_100325822
1264 Ga0075435_100457583
1265 Ga0075435_100476601
1266 Ga0099795_10027214
1267 Ga0105240_10017296
1268 Ga0105240_10106166
1269 Ga0105240_10180778
1270 Ga0111539_10031645
1271 Ga0111539_10275476
1272 Ga0111539_10288660
1273 Ga0111539_13098752
1274 Ga0105245_10130548
1275 Ga0105245_10146073
1276 Ga0105245_10158204
1277 Ga0105245_10340504
1278 Ga0105245_10434104
1279 Ga0105245_10944344
1280 Ga0114129_10017841
1281 Ga0114129_10229065
1282 Ga0114129_12353518
1283 Ga0105243_10709385
1284 Ga0105243_10958826
1285 Ga0105241_10332887
1286 Ga0105241_10391480
1287 Ga0105242_10027540
1288 Ga0105242_10074064
1289 Ga0105248_10645438
1290 Ga0105248_10791322
1291 Ga0105237_10008817
1292 Ga0105237_10522862
1293 Ga0105237_10817718
1294 Ga0105238_10064901
1295 Ga0105238_10253317
1296 Ga0105238_10339069
1297 Ga0105238_10686809
1298 Ga0099796_10069171
1299 Ga0105239_10261355
1300 Ga0105239_10509694
1301 Ga0105239_12051467
1302 Ga0157373_10151456
1303 Ga0157373_10332684
1304 Ga0157371_10264152
1305 Ga0157371_10460145
1306 Ga0157370_10086075
1307 Ga0157370_10096886
1308 Ga0157370_10155624
1309 Ga0157369_10002742
1310 Ga0157369_10014160
1311 Ga0157369_10028307
1312 Ga0157369_10035760
1313 Ga0157369_10087789
1314 Ga0157369_10091640
1315 Ga0157369_10149428
1316 Ga0157369_10259355
1317 Ga0157369_10267079
1318 Ga0157369_11183293
1319 Ga0157374_10033900
1320 Ga0157374_10085634
1321 Ga0157378_10110998
1322 Ga0163162_10641881
1323 Ga0157372_10104611
1324 Ga0157372_10238411
1325 Ga0157372_10377093
1326 Ga0157372_10507471
1327 Ga0157372_10532690
1328 Ga0157372_10689568
1329 Ga0157375_10278747
1330 Ga0163163_10184153
1331 Ga0163163_10205677
1332 Ga0163163_10235616
1333 Ga0163163_10426316
1334 Ga0157380_11247264
1335 Ga0182008_10000718
1336 Ga0182008_10027803
1337 Ga0182008_10108699
1338 Ga0182008_10140612
1339 Ga0157376_10061664
1340 Ga0157376_10752696
1341 Ga0182007_10017644
1342 Ga0197907_10472481
1343 Ga0197907_11274861
1344 Ga0197907_11434900
1345 Ga0206356_10116221
1346 Ga0206354_10772758
1347 Ga0206354_11139686
1348 Ga0206353_10417389
1349 Ga0206353_10633007
1350 Ga0206353_10862315
1351 Ga0206353_11689011
1352 Ga0206353_11755696
1353 Ga0213874_10090979
1354 Ga0224712_10006496
1355 Ga0207692_10043244
1356 Ga0207692_10145754
1357 Ga0207688_10065403
1358 Ga0207699_10018015
1359 Ga0207699_10357131
1360 Ga0207699_10751634
1361 Ga0207705_10079416
1362 Ga0207705_10257238
1363 Ga0207705_10333800
1364 Ga0207705_10358496
1365 Ga0207705_11044028
1366 Ga0207684_10423616
1367 Ga0207684_10883971
1368 Ga0207654_10062092
1369 Ga0207707_10020888
1370 Ga0207707_10051153
1371 Ga0207707_10091386
1372 Ga0207707_10322561
1373 Ga0207707_10336324
1374 Ga0207707_10410299
1375 Ga0207707_10571009
1376 Ga0207695_10052410
1377 Ga0207695_10348733
1378 Ga0207671_10113743
1379 Ga0207671_10247303
1380 Ga0207693_10007916
1381 Ga0207693_10015138
1382 Ga0207693_10069335
1383 Ga0207693_10071338
1384 Ga0207693_10441269
1385 Ga0207693_10538489
1386 Ga0207693_10662770
1387 Ga0207693_10693421
1388 Ga0207663_10057469
1389 Ga0207663_10101132
1390 Ga0207663_10145925
1391 Ga0207660_10039178
1392 Ga0207660_10359275
1393 Ga0207660_10437726
1394 Ga0207660_10650777
1395 Ga0207660_10676895
1396 Ga0207660_10862154
1397 Ga0207657_10000988
1398 Ga0207657_10001365
1399 Ga0207657_10006228
1400 Ga0207657_10015573
1401 Ga0207657_10034259
1402 Ga0207657_10060350
1403 Ga0207657_10069096
1404 Ga0207649_10024155
1405 Ga0207649_10141788
1406 Ga0207649_10256809
1407 Ga0207649_10327814
1408 Ga0207649_10755711
1409 Ga0207652_10007377
1410 Ga0207652_10080258
1411 Ga0207652_10090659
1412 Ga0207652_10625203
1413 Ga0207652_10998968
1414 Ga0207646_10001768
1415 Ga0207646_10353654
1416 Ga0207646_10580598
1417 Ga0207646_10734254
1418 Ga0207694_10064458
1419 Ga0207694_10097107
1420 Ga0207694_10166830
1421 Ga0207650_10339276
1422 Ga0207659_10079179
1423 Ga0207659_10428017
1424 Ga0207659_10655959
1425 Ga0207687_10050709
1426 Ga0207687_10084981
1427 Ga0207687_10284158
1428 Ga0207687_10391892
1429 Ga0207687_10555931
1430 Ga0207700_10094060
1431 Ga0207700_10252655
1432 Ga0207700_10788393
1433 Ga0207700_10877309
1434 Ga0207700_11118459
1435 Ga0207664_10022691
1436 Ga0207664_10072301
1437 Ga0207664_10126585
1438 Ga0207664_10178626
1439 Ga0207664_10284633
1440 Ga0207644_10051087
1441 Ga0207644_10151843
1442 Ga0207690_10118173
1443 Ga0207690_11304516
1444 Ga0207690_11305276
1445 Ga0207706_10650337
1446 Ga0207686_10263992
1447 Ga0207686_10555958
1448 Ga0207709_10942909
1449 Ga0207704_11397505
1450 Ga0207665_10002358
1451 Ga0207665_10071996
1452 Ga0207665_10576630
1453 Ga0207665_11188140
1454 Ga0207711_10537339
1455 Ga0207661_10003288
1456 Ga0207661_10009282
1457 Ga0207661_10088182
1458 Ga0207661_10193808
1459 Ga0207661_10203073
1460 Ga0207661_10377804
1461 Ga0207661_10580730
1462 Ga0207679_10704156
1463 Ga0207679_11455360
1464 Ga0207667_10070378
1465 Ga0207667_10160611
1466 Ga0207667_10281783
1467 Ga0207667_10370081
1468 Ga0207667_10381307
1469 Ga0207667_10554432
1470 Ga0207667_10624700
1471 Ga0207651_11031465
1472 Ga0207712_10302669
1473 Ga0207640_10692175
1474 Ga0207640_11336005
1475 Ga0207658_10868277
1476 Ga0207677_10358783
1477 Ga0207677_10740767
1478 Ga0207677_11031263
1479 Ga0207639_10234422
1480 Ga0207639_10468825
1481 Ga0207639_10691127
1482 Ga0207639_10903491
1483 Ga0207678_10629006
1484 Ga0207708_10747046
1485 Ga0207702_10136385
1486 Ga0207702_10542527
1487 Ga0207702_10559593
1488 Ga0207641_10238689
1489 Ga0207641_10396267
1490 Ga0207676_10643291
1491 Ga0207674_10003276
1492 Ga0207674_10122383
1493 Ga0207674_10137935
1494 Ga0207674_10216189
1495 Ga0207674_10269120
1496 Ga0207674_10857443
1497 Ga0207675_100403066
1498 Ga0207683_10254829
1499 Ga0207698_10122159
1500 Ga0207698_10255129
1501 Ga0207698_10304494
1502 Ga0207698_11303199
1503 Ga0207428_10009737
1504 Ga0207428_10012767
1505 Ga0207428_10079298
1506 Ga0268266_11007485
1507 Ga0265319_1029856
1508 Ga0265319_1039330
1509 Ga0265319_1043375
1510 Ga0265318_10003761
1511 Ga0265318_10097709
1512 Ga0265322_10060524
1513 Ga0265338_10045788
1514 Ga0265338_10145737
1515 Ga0265338_10394954
1516 Ga0265320_10160639
1517 Ga0265340_10185333
1518 Ga0265331_10056389
1519 Ga0265327_10022085
1520 Ga0307408_101886865
1521 Ga0307405_10284744
1522 Ga0307410_10176923
1523 Ga0307412_10291911
1524 Ga0307409_100176900
1525 Ga0307409_100450419
1526 Ga0307416_100100631
1527 Ga0307416_100502379
1528 Ga0307411_10468061
1529 Ga0307415_100037965
1530 Ga0307415_100062191
1531 Ga0373938_0040398
1532 Ga0373940_0086838
1533 Ga0373936_0191139
1534 Ga0373945_0014109
1535 Ga0373954_0134317
1536 Ga0373957_0048124
1537 Ga0373943_0007385
1538 Ga0373943_0057666
1539 Ga0373946_0010186
1540 Ga0373946_0053165
1541 Ga0373946_0266046
1542 Ga0373955_0022659
1543 Ga0373955_0426795
1544 Ga0373924_0097993
1545 Ga0373931_0007846
1546 Ga0373935_0003843
1547 Ga0373935_0088079
1548 Ga0373935_0147731
1549 Ga0373927_0182347
1550 Ga0373927_0515955
1551 Ga0373947_0017632
1552 Ga0373947_0018309
1553 Ga0373937_0046394
1554 Ga0373937_0410772
1555 Ga0373937_0570721
1556 Ga0373925_0002318
1557 Ga0373925_0080148
1558 Ga0395899_0003162
1559 Ga0395899_0004845
1560 Ga0395899_0007797
1561 Ga0395899_0025379
1562 Ga0395899_0145793
1563 Ga0395899_0223208
1564 Ga0395899_0244535
1565 Ga0395899_0292532
1566 Ga0395899_0343078
1567 Ga0395899_0429466
1568 Ga0395899_0526105
1569 Ga0395900_0001640
1570 Ga0395900_0003536
1571 Ga0395900_0011339
1572 Ga0395900_0014823
1573 Ga0395900_0023113
1574 Ga0395900_0027999
1575 Ga0395900_0030855
1576 Ga0395900_0083765
1577 Ga0395900_0097722
1578 Ga0395900_0117694
1579 Ga0395900_0132440
1580 Ga0395900_0257926
1581 Ga0395900_0262216
1582 Ga0395900_0276217
1583 Ga0395900_0432957
1584 Ga0395900_0568923
1585 Ga0395900_0582845
1586 Ga0395900_0806097
1587 Ga0395900_1130053
1588 Ga0395898_0003534
1589 Ga0395898_0019282
1590 Ga0395898_0019851
1591 Ga0395898_0029685
1592 Ga0395898_0047928
1593 Ga0395898_0058471
1594 Ga0395898_0083015
1595 Ga0395898_0097904
1596 Ga0395898_0125066
1597 Ga0395898_0129495
1598 Ga0395898_0150134
1599 Ga0395898_0306945
1600 Ga0395898_0373382
1601 Ga0395898_0390625
1602 Ga0395898_0492775
1603 Ga0395898_0809495
1604 Ga0395898_0837631
1605 Ga0395898_0975986
1606 Ga0395898_0983422
1607 Ga0395898_0995180
1608 Ga0395898_1249463
1609 Ga0395898_1698890
1610 Ga0395905_0003269
1611 Ga0395905_0003392
1612 Ga0395905_0038107
1613 Ga0395905_0040105
1614 Ga0395905_0040306
1615 Ga0395905_0117981
1616 Ga0395905_0202542
1617 Ga0395905_0230933
1618 Ga0395905_0289069
1619 Ga0395905_0329046
1620 Ga0395905_0649200
1621 Ga0395905_0837641
1622 Ga0395905_0933621
1623 Ga0395901_0001841
1624 Ga0395901_0002272
1625 Ga0395901_0002650
1626 Ga0395901_0014199
1627 Ga0395901_0017797
1628 Ga0395901_0018324
1629 Ga0395901_0023342
1630 Ga0395901_0056090
1631 Ga0395901_0058107
1632 Ga0395901_0107083
1633 Ga0395901_0112838
1634 Ga0395901_0117408
1635 Ga0395901_0180390
1636 Ga0395901_0204796
1637 Ga0395901_0271614
1638 Ga0395901_0312790
1639 Ga0395901_0442277
1640 Ga0395901_0445645
1641 Ga0395901_0623347
1642 Ga0395901_0751358
1643 Ga0395901_0777830
1644 Ga0395901_0902465
1645 Ga0395901_0935868
1646 Ga0395901_1485072
1647 Ga0395901_1819720
1648 Ga0436365_0560760
1649 Ga0436363_0012856
1650 Ga0451789_0777155
1651 Ga0451849_0524342
1652 Ga0451853_3721867
1653 Ga0451853_3935337
1654 Ga0439448_0047021
1655 Ga0439448_0116487
1656 Ga0466966_0004360
1657 Ga0466966_0008955
1658 Ga0466966_0023852
1659 Ga0466966_0075341
1660 Ga0466966_0115287
1661 Ga0466961_0008109
1662 Ga0466961_0016839
1663 Ga0466961_0067875
1664 Ga0466961_0273967
1665 Ga0466963_0000095
1666 Ga0466963_0008069
1667 Ga0466963_0011499
1668 Ga0466963_0028626
1669 Ga0466963_0029189
1670 Ga0466963_0030330
1671 Ga0466963_0037276
1672 Ga0466963_0042093
1673 Ga0466963_0051935
1674 Ga0466963_0101970
1675 Ga0466963_0135942
1676 Ga0466963_0158759
1677 Ga0466963_0171082
1678 Ga0466963_0178564
1679 Ga0466963_0224269
1680 Ga0466963_0248512
1681 Ga0466963_0306751
1682 Ga0466963_0348454
1683 Ga0466963_0681771
1684 Ga0466963_0702819
1685 Ga0466964_0003701
1686 Ga0466964_0010305
1687 Ga0466964_0015210
1688 Ga0466964_0219819
1689 Ga0466964_0552876
1690 Ga0466971_0016904
1691 Ga0466971_0078349
1692 Ga0466968_0006491
1693 Ga0466968_0010769
1694 Ga0466968_0011853
1695 Ga0466968_0044769
1696 Ga0466968_0050752
1697 Ga0466968_0101534
1698 Ga0466970_0056897
1699 Ga0466970_0337445
1700 Ga0466957_0002974
1701 Ga0466957_0007579
1702 Ga0466957_0017807
1703 Ga0466957_0033943
1704 Ga0466957_0336303
1705 Ga0466957_0588191
1706 Ga0466960_0071892
1707 Ga0466960_0223136
1708 Ga0466959_0005223
1709 Ga0466959_0014268
1710 Ga0466959_0024314
1711 Ga0466959_0029877
1712 Ga0466959_0343357
1713 Ga0466959_0476347
1714 Ga0451576_0029648
1715 Ga0466958_0007167
1716 Ga0466958_0009418
1717 Ga0466958_0011855
1718 Ga0466958_0019375
1719 Ga0466958_0045754
1720 Ga0466958_0072191
1721 Ga0466958_0077821
1722 Ga0466958_0086108
1723 Ga0466958_0223610
1724 Ga0466958_0246864
1725 Ga0466967_0002678
1726 Ga0466967_0003018
1727 Ga0466967_0007451
1728 Ga0466967_0008435
1729 Ga0466967_0012913
1730 Ga0466967_0015896
1731 Ga0466967_0020790
1732 Ga0466967_0021061
1733 Ga0466967_0025255
1734 Ga0466967_0030792
1735 Ga0466967_0037568
1736 Ga0466967_0043946
1737 Ga0466967_0056030
1738 Ga0466967_0056509
1739 Ga0466967_0072469
1740 Ga0466967_0080098
1741 Ga0466967_0086500
1742 Ga0466967_0098860
1743 Ga0466967_0155024
1744 Ga0466967_0217489
1745 Ga0466967_0471196
1746 Ga0466967_0521829
1747 Ga0466967_0599075
1748 Ga0466967_0681788
1749 Ga0466967_0752482
1750 Ga0466967_0796253
1751 Ga0466967_1039083
1752 Ga0466967_1309933
1753 Ga0466967_1801861
1754 Ga0495592_0027375
1755 Ga0495592_0035705
1756 Ga0495603_0005193
1757 Ga0495603_0170669
1758 Ga0495603_0620590
1759 Ga0495629_0020948
1760 Ga0495629_0148369
1761 Ga0495629_0281642
1762 Ga0495629_0292700
1763 Ga0495629_0425119
1764 Ga0495641_0005435
1765 Ga0495641_0040762
1766 Ga0495641_0043444
1767 Ga0495641_0055399
1768 Ga0495641_0066497
1769 Ga0495641_0088610
1770 Ga0495641_0143265
1771 Ga0495651_0016426
1772 Ga0495651_0723444
1773 Ga0495653_0009654
1774 Ga0495653_0125920
1775 Ga0495653_0126855
1776 Ga0495653_0147014
1777 Ga0495580_0035292
1778 Ga0495582_0028580
1779 Ga0495582_0057903
1780 Ga0495582_0065794
1781 Ga0495605_0105621
1782 Ga0495605_0166512
1783 Ga0495639_0026021
1784 Ga0495639_0066100
1785 Ga0495662_0030188
1786 Ga0495662_0264637
1787 Ga0495662_0339395
1788 Ga0495662_0396865
1789 Ga0495664_0038850
1790 Ga0495664_0072644
1791 Ga0495664_0438648
1792 Ga0495585_0292796
1793 Ga0495594_0591401
1794 Ga0495608_0006652
1795 Ga0495608_0104873
1796 Ga0495608_0360484
1797 Ga0495616_0037436
1798 Ga0495618_0145624
1799 Ga0495628_0162747
1800 Ga0495628_0961850
1801 Ga0495630_0004280
1802 Ga0495630_0011832
1803 Ga0495630_0196422
1804 Ga0495630_0558752
1805 Ga0495630_0558803
1806 Ga0495630_0593157
1807 Ga0495631_0070998
1808 Ga0495637_0047484
1809 Ga0495644_0009809
1810 Ga0495644_0020525
1811 Ga0495644_0122359
1812 Ga0495663_0008292
1813 Ga0495666_0424299
1814 Ga0495642_0048785
1815 Ga0495642_0074858
1816 Ga0495652_0034234
1817 Ga0495652_0052975
1818 Ga0495652_0076047
1819 Ga0495652_0254959
1820 Ga0495652_0365454
1821 Ga0495652_0468747
1822 Ga0495665_0004858
1823 Ga0495665_0293796
1824 Ga0495640_0026151
1825 Ga0495640_0065747
1826 Ga0495640_0277394
1827 Ga0495640_0336851
1828 Ga0495586_0083531
1829 Ga0495586_0476871
1830 Ga0495587_0016542
1831 Ga0495587_0065990
1832 Ga0495587_0377947
1833 Ga0495609_0022728
1834 Ga0495645_0056256
1835 Ga0495645_0165391
1836 Ga0495667_0029836
1837 Ga0495667_0054717
1838 Ga0495667_0067561
1839 Ga0495667_0207401
1840 Ga0495667_0311485
1841 Ga0495656_0003250
1842 Ga0495656_0024202
1843 Ga0495656_0209845
1844 Ga0495656_0429408
1845 Ga0495656_0439916
1846 Ga0495668_0062123
1847 Ga0495634_0057539
1848 Ga0495634_0062957
1849 Ga0495634_0087685
1850 Ga0495634_0101245
1851 Ga0495634_0282036
1852 Ga0495611_0083262
1853 Ga0495611_0118349
1854 Ga0495635_0011900
1855 Ga0495635_0029948
1856 Ga0495635_0050628
1857 Ga0495635_0479215
1858 Ga0495635_0536263
1859 Ga0495635_0571063
1860 Ga0495635_0589517
1861 Ga0495657_0005166
1862 Ga0495657_0013766
1863 Ga0495657_0535420
1864 Ga0495599_0014803
1865 Ga0495599_0058776
1866 Ga0495599_0179970
1867 Ga0495623_0009860
1868 Ga0495646_0045703
1869 Ga0495647_0004336
1870 Ga0495647_0016354
1871 Ga0495647_0106068
1872 Ga0495658_0002872
1873 Ga0495658_0047629
1874 Ga0495658_0157646
1875 Ga0495658_0165125
1876 Ga0495613_0021823
1877 Ga0495613_0051296
1878 Ga0495613_0132438
1879 Ga0495613_0201701
1880 Ga0495624_0057267
1881 Ga0495624_0200574
1882 Ga0495670_0208706
1883 Ga0495589_0038852
1884 Ga0495600_0046445
1885 Ga0495600_0056126
1886 Ga0495600_0084751
1887 Ga0495581_0000505
1888 Ga0495581_0038759
1889 Ga0495581_0110012
1890 Ga0495581_0354633
1891 Ga0495604_0006659
1892 Ga0495604_0107011
1893 Ga0495604_0447809
1894 Ga0495604_0502504
1895 Ga0495636_0038751
1896 Ga0495674_0011878
1897 Ga0495674_0015466
1898 Ga0495674_0021386
1899 Ga0495674_0131801
1900 Ga0495674_0307263
1901 Ga0495674_0312627
1902 Ga0495674_0410248
1903 Ga0495676_0009864
1904 Ga0495676_0068497
1905 Ga0495676_0131440
1906 Ga0495676_0140485
1907 Ga0495676_0482453
1908 Ga0495676_0505593
1909 Ga0495676_0719522
1910 Ga0495680_0005532
1911 Ga0495680_0022217
1912 Ga0495680_0023897
1913 Ga0495680_0042745
1914 Ga0495680_0066240
1915 Ga0495680_0350577
1916 Ga0495675_0002014
1917 Ga0495675_0149268
1918 Ga0495684_0004528
1919 Ga0495684_0009628
1920 Ga0495684_0095741
1921 Ga0495684_0191363
1922 Ga0495684_0271229
1923 Ga0495593_0004729
1924 Ga0495602_0192523
1925 Ga0495602_0208742
1926 Ga0495602_0400929
1927 Ga0496100_0008560
1928 Ga0496100_0009080
1929 Ga0496101_0001024
1930 Ga0496101_0035886
1931 Ga0496101_0061970
1932 Ga0496101_0112226
1933 Ga0496101_0157292
1934 Ga0496101_0323111
1935 Ga0496101_0484527
1936 Ga0496102_0013068
1937 Ga0496102_0022488
1938 Ga0496102_0094431
1939 Ga0496102_0121116
1940 Ga0496102_0225966
1941 Ga0496102_0796499
1942 Ga0496103_0004988
1943 Ga0496103_0009793
1944 Ga0496103_0010423
1945 Ga0496103_0173891
1946 Ga0496103_0290804
1947 Ga0496103_0375431
1948 Ga0496104_0002338
1949 Ga0496104_0016855
1950 Ga0496104_0034005
1951 Ga0496104_0236072
1952 Ga0496104_0819664
1953 Ga0496105_0001042
1954 Ga0496105_0002856
1955 Ga0496105_0128886
1956 Ga0496105_0357352
1957 Ga0496105_0372799
1958 Ga0496105_0428153
1959 Ga0496106_0013216
1960 Ga0496106_0057285
1961 Ga0496106_0071687
1962 Ga0496106_0478655
1963 Ga0496106_0570484
1964 Ga0496107_0001734
1965 Ga0496107_0002291
1966 Ga0496107_0273087
1967 Ga0496107_0398035
1968 Ga0496107_0502277
1969 Ga0496107_0614025
1970 Ga0496108_0008931
1971 Ga0496108_0027191
1972 Ga0496108_0028356
1973 Ga0496108_0264196
1974 Ga0496108_0408869
1975 Ga0496108_0695135
1976 Ga0496109_0018533
1977 Ga0496109_0032272
1978 Ga0496109_0041024
1979 Ga0496109_0043230
1980 Ga0496109_0056706
1981 Ga0496109_0074982
1982 Ga0496109_0199773
1983 Ga0496109_0222834
1984 Ga0496109_0322967
1985 Ga0496109_0355118
1986 Ga0496109_0440861
1987 Ga0496109_0573132
1988 Ga0496109_0612723
1989 Ga0496109_1073613
1990 Ga0496110_0010243
1991 Ga0496110_0069790
1992 Ga0496110_0150910
1993 Ga0496110_0163347
1994 Ga0496110_0183011
1995 Ga0496110_0388111
1996 Ga0496110_0447940
1997 Ga0496111_0021275
1998 Ga0496111_0142501
1999 Ga0496111_0243921
2000 Ga0496111_0302603
2001 Ga0496112_0000635
2002 Ga0496112_0040922
2003 Ga0496112_0197701
2004 Ga0496112_0218477
2005 Ga0496112_0256769
2006 Ga0496112_0389948
2007 Ga0496112_0570341
2008 Ga0496113_0077332
2009 Ga0496113_0280871
2010 Ga0496113_0577503
2011 Ga0496114_0000892
2012 Ga0496114_0008778
2013 Ga0496114_0009938
2014 Ga0496114_0018394
2015 Ga0496114_0235057
2016 Ga0496114_0277674
2017 Ga0496114_0862023
2018 Ga0496115_0000701
2019 Ga0496115_0013798
2020 Ga0496115_0014516
2021 Ga0496115_0022567
2022 Ga0496115_0087109
2023 Ga0496115_0797104
2024 Ga0501031_0012388
2025 Ga0501032_0043883
2026 Ga0501032_0059046
2027 Ga0501033_0021378
2028 Ga0501033_0026858
2029 Ga0501034_0034567
2030 Ga0501036_0009096
2031 Ga0501036_0199588
2032 Ga0501037_0001731
2033 Ga0501037_0048511
2034 Ga0501038_0015616
2035 Ga0501038_0020426
2036 Ga0501039_0053012
2037 Ga0501039_0062951
2038 Ga0501040_0016677
2039 Ga0501040_0475713
2040 Ga0501041_0007506
2041 Ga0501041_0016523
2042 Ga0501042_0019636
2043 Ga0501042_0045197
2044 Ga0501042_0080671
2045 Ga0501043_0001696
2046 Ga0501043_0087251
2047 Ga0501046_0011144
2048 Ga0501046_0013699
2049 Ga0501046_0639456
2050 Ga0501047_0030877
2051 Ga0501047_0737549
2052 Ga0501048_0001796
2053 Ga0501048_0042581
2054 Ga0501048_1295328
2055 Ga0501067_0005193
2056 Ga0501067_0026909
2057 Ga0501067_0100339
2058 Ga0501067_0221180
2059 Ga0501068_0001541
2060 Ga0501068_0011481
2061 Ga0501068_0362784
2062 Ga0501069_0012964
2063 Ga0501069_0032961
2064 Ga0501069_0041060
2065 Ga0501069_0059252
2066 Ga0501069_0195433
2067 Ga0501070_0007108
2068 Ga0501070_0011141
2069 Ga0501070_0014542
2070 Ga0501070_0039570
2071 Ga0501070_0192198
2072 Ga0501070_0292216
2073 Ga0501071_0001183
2074 Ga0501071_0018706
2075 Ga0501071_0573458
2076 Ga0501071_0748823
2077 Ga0501072_0003411
2078 Ga0501072_0011384
2079 Ga0501072_0020756
2080 Ga0501072_0239786
2081 Ga0501073_0009280
2082 Ga0501073_0129586
2083 Ga0501074_0000859
2084 Ga0501074_0008458
2085 Ga0501074_0039598
2086 Ga0501074_0054359
2087 Ga0501074_0081022
2088 Ga0501075_0023721
2089 Ga0501075_1142177
2090 Ga0501076_0033954
2091 Ga0501076_0240320
2092 Ga0501077_0026488
2093 Ga0501077_0028800
2094 Ga0501077_0087590
2095 Ga0501077_0107627
2096 Ga0501079_0009336
2097 Ga0501079_0014711
2098 Ga0501079_0024949
2099 Ga0501080_0008532
2100 Ga0501080_0015795
2101 Ga0501080_0031199
2102 Ga0501080_0247896
2103 Ga0501081_0031502
2104 Ga0501081_0077331
2105 Ga0501081_0095898
2106 Ga0501083_0002114
2107 Ga0501083_0007136
2108 Ga0501083_0026409
2109 Ga0501035_0008865
2110 Ga0501035_0379749
2111 Ga0501044_0011094
2112 Ga0501044_0101841
2113 Ga0501044_1053588
2114 Ga0501045_0072285
2115 Ga0501045_0418753
2116 nmdc:mga03n38_354518_c1
2117 nmdc:mga0yw44_660246_c1
2118 nmdc:mga0yw44_818358_c1
2119 nmdc:mga05p37_141564_c1
2120 nmdc:mga05p37_202699_c1
2121 nmdc:mga09592_323962_c1
2122 nmdc:mga0qj67_216598_c1
2123 nmdc:mga0qj67_293319_c1
2124 nmdc:mga06r32_352063_c1
2125 nmdc:mga08y16_111271_c1
2126 nmdc:mga08y16_116643_c1
2127 nmdc:mga08y16_361421_c1
2128 nmdc:mga0n895_17051_c1
2129 nmdc:mga0n895_32525_c1
2130 nmdc:mga0n895_599025_c1
2131 nmdc:mga0rr50_118874_c1
2132 nmdc:mga0rr50_76794_c1
2133 nmdc:mga08x19_62383_c1
2134 nmdc:mga0a205_189643_c1
2135 nmdc:mga0a205_243814_c1
2136 nmdc:mga0a205_38578_c1
2137 Ga0495601_0037540
2138 Ga0495601_0199540
2139 Ga0495601_0213797
2140 Ga0495601_0490212
2141 Ga0495601_0521044
2142 Ga0495612_0007074
2143 Ga0495595_0013345
2144 Ga0495595_0030875
2145 Ga0495595_0032865
2146 Ga0495595_0087146
2147 Ga0495619_0004147
2148 Ga0495619_0066626
2149 Ga0495619_0080476
2150 Ga0495619_0083344
2151 Ga0495619_0102697
2152 Ga0495619_0160773
2153 Ga0495619_0339142
2154 Ga0495619_0406684
2155 Ga0495619_0456096
2156 Ga0500566_0054705
2157 Ga0501084_0028831
2158 Ga0501084_0030687
2159 Ga0501084_0041823
2160 Ga0501084_0504338
2161 Ga0501084_0811679
2162 Ga0590075_070203
2163 Ga0501082_0011837
2164 Ga0501082_0055589
2165 Ga0501082_0378231
2166 Ga0501082_0836552
2167 Ga0466962_0000096
2168 Ga0466962_0001445
2169 Ga0466962_0086266
2170 Ga0530510_0003924
2171 Ga0530510_0047288
2172 Ga0530510_0082007
2173 Ga0530510_0155623
2174 Ga0530510_0365241

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

7

149

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ihc-assembly1.cif.gz_A x-ray structure of gephyrin n-terminal domain 0.9759 1 151
1o8q-assembly1.cif.gz_A the active site of the molybdenum cofactor biosenthetic protein domain cnx1g 0.9615 2 151
1o8n-assembly1.cif.gz_C the active site of the molybdenum cofactor biosynthetic protein domain cnx1g 0.9603 2 153
3mci-assembly1.cif.gz_A crystal structure of molybdenum cofactor biosynthesis (aq_061) from aquifex aeolicus vf5 0.9602 3 152
1o8o-assembly1.cif.gz_C the active site of the molybdenum cofactor biosynthetic protein domain cnx1g 0.9598 2 151
ID Description Score Start End Superfamily
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9791 2 153 3.40.980.10
af_Q39054_458_641_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9675 2 157 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9603 1 156 3.40.980.10
1o8nC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9542 2 154 3.40.980.10
af_A0A1D6DUY2_88_206_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9381 1 91 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A6I3BPQ4-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9894 1 153 GO:0006777
AF-A0A3C1YHM7-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9852 3 152 GO:0006777
AF-A0A1F9MFB7-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9849 2 153 GO:0006777
AF-A0A7V0IUH9-F1-model_v4 MogA/MoaB family molybdenum cofactor biosynthesis protein 0.9837 1 156 GO:0006777
AF-A0A7C7RVC4-F1-model_v4 deleted 0.9825 1 150

Map