F489795
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1087 | 333 | 2174 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300005354|Ga0070675_101415410|Ga0070675_1014154101 |
| Length | 166 |
| Sequence | VTARRAVVICASTRAATGVYPDRTGPLIVAALREWGYDVDDATVVPDGEAVSEALATALAASPDVVLTTGGTGISPTDATPEMTRRHLDREIPGIAEAIRAAGVEKGVPTAMLSRGLAGVAGHSLVVNLPGSTGGCRDGYAVLRPALGHALSLLADQPTRHQHTST |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 166 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 197 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 204 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 205 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 314 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 329 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.9 |
| Metatranscriptomes | 1.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.46 |
| Nodule | 0 |
| Rhizoplane | 9.02 |
| Rhizosphere | 89.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070675_101415410 | 3300005354 | Bacteria | 641 |
| 2 | JGI25406J46586_10054802 | 3300003203 | Bacteria | 1317 |
| 3 | Ga0070658_10012791 | 3300005327 | Bacteria | 6733 |
| 4 | Ga0070658_10037453 | 3300005327 | Bacteria | 3910 |
| 5 | Ga0070658_10059517 | 3300005327 | Bacteria | 3110 |
| 6 | Ga0070658_10337975 | 3300005327 | Bacteria | 1288 |
| 7 | Ga0070658_11318679 | 3300005327 | Unclassified | 627 |
| 8 | Ga0070683_100051957 | 3300005329 | Bacteria | 3796 |
| 9 | Ga0070683_100061493 | 3300005329 | Bacteria | 3492 |
| 10 | Ga0070683_100088710 | 3300005329 | Bacteria | 2902 |
| 11 | Ga0070683_100097095 | 3300005329 | Bacteria | 2771 |
| 12 | Ga0070683_100896286 | 3300005329 | Bacteria | 851 |
| 13 | Ga0070683_101022265 | 3300005329 | Bacteria | 794 |
| 14 | Ga0070683_101034342 | 3300005329 | Bacteria | 789 |
| 15 | Ga0070680_100006253 | 3300005336 | Bacteria | 9033 |
| 16 | Ga0070680_100169771 | 3300005336 | Bacteria | 1835 |
| 17 | Ga0070680_100219668 | 3300005336 | Bacteria | 1604 |
| 18 | Ga0070680_100232872 | 3300005336 | Bacteria | 1556 |
| 19 | Ga0070680_101028469 | 3300005336 | Bacteria | 712 |
| 20 | Ga0070682_100805388 | 3300005337 | Bacteria | 764 |
| 21 | Ga0068868_100662810 | 3300005338 | Bacteria | 930 |
| 22 | Ga0070660_100001098 | 3300005339 | Bacteria | 18183 |
| 23 | Ga0070660_100046194 | 3300005339 | Bacteria | 3337 |
| 24 | Ga0070660_100052003 | 3300005339 | Bacteria | 3156 |
| 25 | Ga0070660_100080718 | 3300005339 | Bacteria | 2553 |
| 26 | Ga0070660_100103559 | 3300005339 | Bacteria | 2257 |
| 27 | Ga0070660_100128204 | 3300005339 | Bacteria | 2029 |
| 28 | Ga0070660_100722728 | 3300005339 | Bacteria | 836 |
| 29 | Ga0070661_100012445 | 3300005344 | Bacteria | 5951 |
| 30 | Ga0070661_100065974 | 3300005344 | Bacteria | 2659 |
| 31 | Ga0070661_100108966 | 3300005344 | Bacteria | 2067 |
| 32 | Ga0070661_100202404 | 3300005344 | Bacteria | 1517 |
| 33 | Ga0070661_100223911 | 3300005344 | Bacteria | 1444 |
| 34 | Ga0070675_100161683 | 3300005354 | Bacteria | 1926 |
| 35 | Ga0070674_100062493 | 3300005356 | Bacteria | 2602 |
| 36 | Ga0070674_101164628 | 3300005356 | Bacteria | 683 |
| 37 | Ga0070659_100031564 | 3300005366 | Bacteria | 4104 |
| 38 | Ga0070659_100118677 | 3300005366 | Bacteria | 2140 |
| 39 | Ga0070659_100150596 | 3300005366 | Bacteria | 1898 |
| 40 | Ga0070659_100762250 | 3300005366 | Bacteria | 840 |
| 41 | Ga0070659_100981294 | 3300005366 | Bacteria | 741 |
| 42 | Ga0070659_101333969 | 3300005366 | Bacteria | 637 |
| 43 | Ga0070703_10109839 | 3300005406 | Bacteria | 985 |
| 44 | Ga0070709_10028844 | 3300005434 | Bacteria | 3313 |
| 45 | Ga0070709_10606094 | 3300005434 | Bacteria | 843 |
| 46 | Ga0070714_100025095 | 3300005435 | Bacteria | 4917 |
| 47 | Ga0070714_100078883 | 3300005435 | Bacteria | 2862 |
| 48 | Ga0070714_100210438 | 3300005435 | Bacteria | 1782 |
| 49 | Ga0070714_100245545 | 3300005435 | Bacteria | 1654 |
| 50 | Ga0070714_100384996 | 3300005435 | Bacteria | 1323 |
| 51 | Ga0070713_100001060 | 3300005436 | Bacteria | 17565 |
| 52 | Ga0070713_100243387 | 3300005436 | Bacteria | 1639 |
| 53 | Ga0070713_101855192 | 3300005436 | Bacteria | 585 |
| 54 | Ga0070710_10057608 | 3300005437 | Bacteria | 2202 |
| 55 | Ga0070701_10214097 | 3300005438 | Bacteria | 1146 |
| 56 | Ga0070711_100013538 | 3300005439 | Bacteria | 5122 |
| 57 | Ga0070711_100021588 | 3300005439 | Bacteria | 4165 |
| 58 | Ga0070711_100328492 | 3300005439 | Bacteria | 1224 |
| 59 | Ga0070705_100599476 | 3300005440 | Bacteria | 852 |
| 60 | Ga0070694_100063127 | 3300005444 | Bacteria | 2532 |
| 61 | Ga0070708_100034217 | 3300005445 | Bacteria | 4420 |
| 62 | Ga0070708_100762834 | 3300005445 | Bacteria | 910 |
| 63 | Ga0070663_100520901 | 3300005455 | Bacteria | 990 |
| 64 | Ga0070663_101347264 | 3300005455 | Bacteria | 631 |
| 65 | Ga0070678_100711105 | 3300005456 | Bacteria | 906 |
| 66 | Ga0070678_100931331 | 3300005456 | Bacteria | 796 |
| 67 | Ga0070662_100509045 | 3300005457 | Bacteria | 1005 |
| 68 | Ga0070681_10002995 | 3300005458 | Bacteria | 15675 |
| 69 | Ga0070681_10013548 | 3300005458 | Bacteria | 8109 |
| 70 | Ga0070681_10017738 | 3300005458 | Bacteria | 7114 |
| 71 | Ga0070681_10065039 | 3300005458 | Bacteria | 3616 |
| 72 | Ga0070681_10083232 | 3300005458 | Bacteria | 3153 |
| 73 | Ga0070681_10141697 | 3300005458 | Bacteria | 2333 |
| 74 | Ga0070681_10164387 | 3300005458 | Bacteria | 2142 |
| 75 | Ga0070681_10257369 | 3300005458 | Bacteria | 1658 |
| 76 | Ga0070681_10334239 | 3300005458 | Bacteria | 1424 |
| 77 | Ga0070681_10421385 | 3300005458 | Bacteria | 1247 |
| 78 | Ga0070681_10627253 | 3300005458 | Bacteria | 990 |
| 79 | Ga0068867_100384385 | 3300005459 | Bacteria | 1180 |
| 80 | Ga0070685_10302606 | 3300005466 | Bacteria | 1078 |
| 81 | Ga0070707_100002712 | 3300005468 | Bacteria | 16848 |
| 82 | Ga0070707_100100342 | 3300005468 | Bacteria | 2805 |
| 83 | Ga0070707_100177888 | 3300005468 | Bacteria | 2074 |
| 84 | Ga0070707_100345204 | 3300005468 | Bacteria | 1446 |
| 85 | Ga0070707_101179352 | 3300005468 | Bacteria | 732 |
| 86 | Ga0070698_100015615 | 3300005471 | Bacteria | 8020 |
| 87 | Ga0070698_100190470 | 3300005471 | Bacteria | 1989 |
| 88 | Ga0070698_100223671 | 3300005471 | Bacteria | 1815 |
| 89 | Ga0070698_101389656 | 3300005471 | Unclassified | 653 |
| 90 | Ga0070699_100851737 | 3300005518 | Bacteria | 834 |
| 91 | Ga0070679_100032549 | 3300005530 | Bacteria | 5158 |
| 92 | Ga0070679_100042729 | 3300005530 | Bacteria | 4515 |
| 93 | Ga0070679_100156760 | 3300005530 | Bacteria | 2251 |
| 94 | Ga0070679_100158918 | 3300005530 | Bacteria | 2234 |
| 95 | Ga0070679_100587096 | 3300005530 | Bacteria | 1057 |
| 96 | Ga0070679_101377065 | 3300005530 | Bacteria | 651 |
| 97 | Ga0070684_100001409 | 3300005535 | Bacteria | 17288 |
| 98 | Ga0070684_100029473 | 3300005535 | Bacteria | 4651 |
| 99 | Ga0070684_100033593 | 3300005535 | Bacteria | 4382 |
| 100 | Ga0070684_100040167 | 3300005535 | Bacteria | 4027 |
| 101 | Ga0070684_100081507 | 3300005535 | Bacteria | 2863 |
| 102 | Ga0070684_100090449 | 3300005535 | Bacteria | 2722 |
| 103 | Ga0070684_100119746 | 3300005535 | Bacteria | 2368 |
| 104 | Ga0070684_100223155 | 3300005535 | Bacteria | 1719 |
| 105 | Ga0070684_100401996 | 3300005535 | Bacteria | 1263 |
| 106 | Ga0070684_100469576 | 3300005535 | Bacteria | 1164 |
| 107 | Ga0070684_101031928 | 3300005535 | Bacteria | 772 |
| 108 | Ga0070697_101416259 | 3300005536 | Bacteria | 621 |
| 109 | Ga0068853_100179062 | 3300005539 | Bacteria | 1922 |
| 110 | Ga0068853_100344189 | 3300005539 | Bacteria | 1386 |
| 111 | Ga0070672_100841375 | 3300005543 | Bacteria | 809 |
| 112 | Ga0070672_100876960 | 3300005543 | Bacteria | 792 |
| 113 | Ga0070695_100000029 | 3300005545 | Bacteria | 53859 |
| 114 | Ga0070695_100496872 | 3300005545 | Bacteria | 943 |
| 115 | Ga0070696_100073516 | 3300005546 | Bacteria | 2409 |
| 116 | Ga0070696_100699724 | 3300005546 | Bacteria | 826 |
| 117 | Ga0070696_101142914 | 3300005546 | Bacteria | 656 |
| 118 | Ga0070665_100607463 | 3300005548 | Bacteria | 1107 |
| 119 | Ga0068855_100034915 | 3300005563 | Bacteria | 5992 |
| 120 | Ga0068855_100036011 | 3300005563 | Bacteria | 5892 |
| 121 | Ga0068855_100038449 | 3300005563 | Bacteria | 5686 |
| 122 | Ga0068855_100152218 | 3300005563 | Bacteria | 2630 |
| 123 | Ga0068855_100366403 | 3300005563 | Bacteria | 1585 |
| 124 | Ga0068855_100495992 | 3300005563 | Bacteria | 1327 |
| 125 | Ga0070664_100096114 | 3300005564 | Bacteria | 2570 |
| 126 | Ga0070664_100104597 | 3300005564 | Bacteria | 2465 |
| 127 | Ga0068857_100074276 | 3300005577 | Bacteria | 3030 |
| 128 | Ga0068857_100090560 | 3300005577 | Bacteria | 2737 |
| 129 | Ga0068857_100278651 | 3300005577 | Bacteria | 1538 |
| 130 | Ga0068854_100829579 | 3300005578 | Bacteria | 808 |
| 131 | Ga0068856_100026801 | 3300005614 | Bacteria | 5620 |
| 132 | Ga0068856_100185004 | 3300005614 | Bacteria | 2097 |
| 133 | Ga0068856_100187549 | 3300005614 | Bacteria | 2082 |
| 134 | Ga0068856_101974715 | 3300005614 | Bacteria | 594 |
| 135 | Ga0070702_100432698 | 3300005615 | Bacteria | 950 |
| 136 | Ga0068852_100031907 | 3300005616 | Bacteria | 4355 |
| 137 | Ga0068852_101113974 | 3300005616 | Bacteria | 810 |
| 138 | Ga0068852_101828372 | 3300005616 | Bacteria | 630 |
| 139 | Ga0068861_100954612 | 3300005719 | Bacteria | 816 |
| 140 | Ga0068858_101349966 | 3300005842 | Bacteria | 702 |
| 141 | Ga0081540_1003860 | 3300005983 | Bacteria | 11698 |
| 142 | Ga0081539_10001005 | 3300005985 | Bacteria | 52334 |
| 143 | Ga0081539_10008668 | 3300005985 | Bacteria | 8758 |
| 144 | Ga0070717_10159132 | 3300006028 | Bacteria | 1958 |
| 145 | Ga0075432_10018976 | 3300006058 | Bacteria | 2348 |
| 146 | Ga0070715_10001395 | 3300006163 | Bacteria | 6980 |
| 147 | Ga0070715_10324663 | 3300006163 | Bacteria | 832 |
| 148 | Ga0070716_100005635 | 3300006173 | Bacteria | 6082 |
| 149 | Ga0070716_100012148 | 3300006173 | Bacteria | 4357 |
| 150 | Ga0070716_100812872 | 3300006173 | Bacteria | 725 |
| 151 | Ga0070712_100054382 | 3300006175 | Bacteria | 2799 |
| 152 | Ga0070712_100096873 | 3300006175 | Bacteria | 2173 |
| 153 | Ga0097621_100105826 | 3300006237 | Bacteria | 2372 |
| 154 | Ga0075370_10425261 | 3300006353 | Bacteria | 798 |
| 155 | Ga0068871_101496690 | 3300006358 | Bacteria | 638 |
| 156 | Ga0075428_100188360 | 3300006844 | Bacteria | 2232 |
| 157 | Ga0075428_100314079 | 3300006844 | Bacteria | 1684 |
| 158 | Ga0075428_100346983 | 3300006844 | Bacteria | 1593 |
| 159 | Ga0075428_101456319 | 3300006844 | Bacteria | 718 |
| 160 | Ga0075430_100058807 | 3300006846 | Bacteria | 3231 |
| 161 | Ga0075430_100362205 | 3300006846 | Unclassified | 1197 |
| 162 | Ga0075431_100002910 | 3300006847 | Bacteria | 16568 |
| 163 | Ga0075431_100088535 | 3300006847 | Bacteria | 3195 |
| 164 | Ga0075431_100425413 | 3300006847 | Bacteria | 1327 |
| 165 | Ga0075433_10005061 | 3300006852 | Bacteria | 10334 |
| 166 | Ga0075433_10287233 | 3300006852 | Bacteria | 1457 |
| 167 | Ga0075433_10515564 | 3300006852 | Bacteria | 1052 |
| 168 | Ga0075434_100001294 | 3300006871 | Bacteria | 20866 |
| 169 | Ga0075434_100005543 | 3300006871 | Bacteria | 11499 |
| 170 | Ga0075434_100678115 | 3300006871 | Bacteria | 1048 |
| 171 | Ga0075429_100115498 | 3300006880 | Bacteria | 2346 |
| 172 | Ga0075429_100351487 | 3300006880 | Bacteria | 1290 |
| 173 | Ga0075436_100122880 | 3300006914 | Bacteria | 1817 |
| 174 | Ga0075436_100593226 | 3300006914 | Bacteria | 816 |
| 175 | Ga0075435_100020701 | 3300007076 | Bacteria | 5048 |
| 176 | Ga0075435_100325822 | 3300007076 | Bacteria | 1315 |
| 177 | Ga0075435_100457583 | 3300007076 | Bacteria | 1101 |
| 178 | Ga0075435_100476601 | 3300007076 | Bacteria | 1078 |
| 179 | Ga0099795_10027214 | 3300007788 | Bacteria | 1933 |
| 180 | Ga0105240_10017296 | 3300009093 | Bacteria | 9720 |
| 181 | Ga0105240_10106166 | 3300009093 | Bacteria | 3407 |
| 182 | Ga0105240_10180778 | 3300009093 | Bacteria | 2489 |
| 183 | Ga0111539_10031645 | 3300009094 | Bacteria | 6427 |
| 184 | Ga0111539_10275476 | 3300009094 | Bacteria | 1958 |
| 185 | Ga0111539_10288660 | 3300009094 | Bacteria | 1909 |
| 186 | Ga0111539_13098752 | 3300009094 | Bacteria | 536 |
| 187 | Ga0105245_10130548 | 3300009098 | Bacteria | 2356 |
| 188 | Ga0105245_10146073 | 3300009098 | Bacteria | 2231 |
| 189 | Ga0105245_10158204 | 3300009098 | Bacteria | 2148 |
| 190 | Ga0105245_10340504 | 3300009098 | Bacteria | 1483 |
| 191 | Ga0105245_10434104 | 3300009098 | Bacteria | 1319 |
| 192 | Ga0105245_10944344 | 3300009098 | Bacteria | 905 |
| 193 | Ga0114129_10017841 | 3300009147 | Bacteria | 10107 |
| 194 | Ga0114129_10229065 | 3300009147 | Unclassified | 2503 |
| 195 | Ga0114129_12353518 | 3300009147 | Bacteria | 639 |
| 196 | Ga0105243_10709385 | 3300009148 | Bacteria | 981 |
| 197 | Ga0105243_10958826 | 3300009148 | Bacteria | 855 |
| 198 | Ga0105241_10332887 | 3300009174 | Bacteria | 1313 |
| 199 | Ga0105241_10391480 | 3300009174 | Bacteria | 1217 |
| 200 | Ga0105242_10027540 | 3300009176 | Bacteria | 4514 |
| 201 | Ga0105242_10074064 | 3300009176 | Bacteria | 2832 |
| 202 | Ga0105248_10645438 | 3300009177 | Bacteria | 1194 |
| 203 | Ga0105248_10791322 | 3300009177 | Bacteria | 1070 |
| 204 | Ga0105237_10008817 | 3300009545 | Bacteria | 10876 |
| 205 | Ga0105237_10522862 | 3300009545 | Bacteria | 1193 |
| 206 | Ga0105237_10817718 | 3300009545 | Bacteria | 939 |
| 207 | Ga0105238_10064901 | 3300009551 | Bacteria | 3651 |
| 208 | Ga0105238_10253317 | 3300009551 | Bacteria | 1739 |
| 209 | Ga0105238_10339069 | 3300009551 | Bacteria | 1491 |
| 210 | Ga0105238_10686809 | 3300009551 | Bacteria | 1035 |
| 211 | Ga0099796_10069171 | 3300010159 | Bacteria | 1270 |
| 212 | Ga0105239_10261355 | 3300010375 | Bacteria | 1945 |
| 213 | Ga0105239_10509694 | 3300010375 | Unclassified | 1368 |
| 214 | Ga0105239_12051467 | 3300010375 | Bacteria | 664 |
| 215 | Ga0157373_10151456 | 3300013100 | Bacteria | 1631 |
| 216 | Ga0157373_10332684 | 3300013100 | Bacteria | 1082 |
| 217 | Ga0157371_10264152 | 3300013102 | Bacteria | 1241 |
| 218 | Ga0157371_10460145 | 3300013102 | Bacteria | 936 |
| 219 | Ga0157370_10086075 | 3300013104 | Bacteria | 2953 |
| 220 | Ga0157370_10096886 | 3300013104 | Bacteria | 2767 |
| 221 | Ga0157370_10155624 | 3300013104 | Bacteria | 2127 |
| 222 | Ga0157369_10002742 | 3300013105 | Bacteria | 21036 |
| 223 | Ga0157369_10014160 | 3300013105 | Bacteria | 9011 |
| 224 | Ga0157369_10028307 | 3300013105 | Bacteria | 6203 |
| 225 | Ga0157369_10035760 | 3300013105 | Bacteria | 5445 |
| 226 | Ga0157369_10087789 | 3300013105 | Bacteria | 3321 |
| 227 | Ga0157369_10091640 | 3300013105 | Bacteria | 3244 |
| 228 | Ga0157369_10149428 | 3300013105 | Bacteria | 2469 |
| 229 | Ga0157369_10259355 | 3300013105 | Bacteria | 1813 |
| 230 | Ga0157369_10267079 | 3300013105 | Bacteria | 1784 |
| 231 | Ga0157369_11183293 | 3300013105 | Bacteria | 780 |
| 232 | Ga0157374_10033900 | 3300013296 | Bacteria | 4661 |
| 233 | Ga0157374_10085634 | 3300013296 | Bacteria | 2997 |
| 234 | Ga0157378_10110998 | 3300013297 | Bacteria | 2514 |
| 235 | Ga0163162_10641881 | 3300013306 | Bacteria | 1186 |
| 236 | Ga0157372_10104611 | 3300013307 | Bacteria | 3236 |
| 237 | Ga0157372_10238411 | 3300013307 | Bacteria | 2110 |
| 238 | Ga0157372_10377093 | 3300013307 | Bacteria | 1653 |
| 239 | Ga0157372_10507471 | 3300013307 | Bacteria | 1406 |
| 240 | Ga0157372_10532690 | 3300013307 | Bacteria | 1369 |
| 241 | Ga0157372_10689568 | 3300013307 | Bacteria | 1189 |
| 242 | Ga0157375_10278747 | 3300013308 | Bacteria | 1835 |
| 243 | Ga0163163_10184153 | 3300014325 | Bacteria | 2136 |
| 244 | Ga0163163_10205677 | 3300014325 | Bacteria | 2017 |
| 245 | Ga0163163_10235616 | 3300014325 | Bacteria | 1880 |
| 246 | Ga0163163_10426316 | 3300014325 | Unclassified | 1385 |
| 247 | Ga0157380_11247264 | 3300014326 | Bacteria | 789 |
| 248 | Ga0182008_10000718 | 3300014497 | Bacteria | 23655 |
| 249 | Ga0182008_10027803 | 3300014497 | Bacteria | 2862 |
| 250 | Ga0182008_10108699 | 3300014497 | Bacteria | 1373 |
| 251 | Ga0182008_10140612 | 3300014497 | Bacteria | 1207 |
| 252 | Ga0157376_10061664 | 3300014969 | Bacteria | 3153 |
| 253 | Ga0157376_10752696 | 3300014969 | Bacteria | 984 |
| 254 | Ga0182007_10017644 | 3300015262 | Bacteria | 2602 |
| 255 | Ga0197907_10472481 | 3300020069 | Bacteria | 765 |
| 256 | Ga0197907_11274861 | 3300020069 | Unclassified | 530 |
| 257 | Ga0197907_11434900 | 3300020069 | Bacteria | 4175 |
| 258 | Ga0206356_10116221 | 3300020070 | Bacteria | 6173 |
| 259 | Ga0206354_10772758 | 3300020081 | Bacteria | 1171 |
| 260 | Ga0206354_11139686 | 3300020081 | Bacteria | 3303 |
| 261 | Ga0206353_10417389 | 3300020082 | Bacteria | 1397 |
| 262 | Ga0206353_10633007 | 3300020082 | Bacteria | 1757 |
| 263 | Ga0206353_10862315 | 3300020082 | Bacteria | 1780 |
| 264 | Ga0206353_11689011 | 3300020082 | Bacteria | 14322 |
| 265 | Ga0206353_11755696 | 3300020082 | Bacteria | 4689 |
| 266 | Ga0213874_10090979 | 3300021377 | Bacteria | 1002 |
| 267 | Ga0224712_10006496 | 3300022467 | Bacteria | 3339 |
| 268 | Ga0207692_10043244 | 3300025898 | Bacteria | 2240 |
| 269 | Ga0207692_10145754 | 3300025898 | Bacteria | 1351 |
| 270 | Ga0207688_10065403 | 3300025901 | Bacteria | 2055 |
| 271 | Ga0207699_10018015 | 3300025906 | Bacteria | 3733 |
| 272 | Ga0207699_10357131 | 3300025906 | Bacteria | 1033 |
| 273 | Ga0207699_10751634 | 3300025906 | Bacteria | 715 |
| 274 | Ga0207705_10079416 | 3300025909 | Bacteria | 2389 |
| 275 | Ga0207705_10257238 | 3300025909 | Bacteria | 1332 |
| 276 | Ga0207705_10333800 | 3300025909 | Bacteria | 1166 |
| 277 | Ga0207705_10358496 | 3300025909 | Bacteria | 1124 |
| 278 | Ga0207705_11044028 | 3300025909 | Bacteria | 631 |
| 279 | Ga0207684_10423616 | 3300025910 | Bacteria | 1143 |
| 280 | Ga0207684_10883971 | 3300025910 | Bacteria | 752 |
| 281 | Ga0207654_10062092 | 3300025911 | Bacteria | 2188 |
| 282 | Ga0207707_10020888 | 3300025912 | Bacteria | 5719 |
| 283 | Ga0207707_10051153 | 3300025912 | Bacteria | 3598 |
| 284 | Ga0207707_10091386 | 3300025912 | Bacteria | 2660 |
| 285 | Ga0207707_10322561 | 3300025912 | Bacteria | 1333 |
| 286 | Ga0207707_10336324 | 3300025912 | Bacteria | 1302 |
| 287 | Ga0207707_10410299 | 3300025912 | Bacteria | 1162 |
| 288 | Ga0207707_10571009 | 3300025912 | Bacteria | 959 |
| 289 | Ga0207695_10052410 | 3300025913 | Bacteria | 4275 |
| 290 | Ga0207695_10348733 | 3300025913 | Bacteria | 1368 |
| 291 | Ga0207671_10113743 | 3300025914 | Bacteria | 2062 |
| 292 | Ga0207671_10247303 | 3300025914 | Bacteria | 1402 |
| 293 | Ga0207693_10007916 | 3300025915 | Bacteria | 8730 |
| 294 | Ga0207693_10015138 | 3300025915 | Bacteria | 6191 |
| 295 | Ga0207693_10069335 | 3300025915 | Bacteria | 2759 |
| 296 | Ga0207693_10071338 | 3300025915 | Bacteria | 2718 |
| 297 | Ga0207693_10441269 | 3300025915 | Bacteria | 1017 |
| 298 | Ga0207693_10538489 | 3300025915 | Bacteria | 911 |
| 299 | Ga0207693_10662770 | 3300025915 | Bacteria | 810 |
| 300 | Ga0207693_10693421 | 3300025915 | Bacteria | 789 |
| 301 | Ga0207663_10057469 | 3300025916 | Bacteria | 2451 |
| 302 | Ga0207663_10101132 | 3300025916 | Bacteria | 1936 |
| 303 | Ga0207663_10145925 | 3300025916 | Bacteria | 1654 |
| 304 | Ga0207660_10039178 | 3300025917 | Bacteria | 3312 |
| 305 | Ga0207660_10359275 | 3300025917 | Bacteria | 1168 |
| 306 | Ga0207660_10437726 | 3300025917 | Bacteria | 1056 |
| 307 | Ga0207660_10650777 | 3300025917 | Bacteria | 859 |
| 308 | Ga0207660_10676895 | 3300025917 | Bacteria | 841 |
| 309 | Ga0207660_10862154 | 3300025917 | Bacteria | 739 |
| 310 | Ga0207657_10000988 | 3300025919 | Bacteria | 30190 |
| 311 | Ga0207657_10001365 | 3300025919 | Bacteria | 26019 |
| 312 | Ga0207657_10006228 | 3300025919 | Bacteria | 12402 |
| 313 | Ga0207657_10015573 | 3300025919 | Bacteria | 7360 |
| 314 | Ga0207657_10034259 | 3300025919 | Bacteria | 4569 |
| 315 | Ga0207657_10060350 | 3300025919 | Bacteria | 3255 |
| 316 | Ga0207657_10069096 | 3300025919 | Bacteria | 2999 |
| 317 | Ga0207649_10024155 | 3300025920 | Bacteria | 3530 |
| 318 | Ga0207649_10141788 | 3300025920 | Bacteria | 1645 |
| 319 | Ga0207649_10256809 | 3300025920 | Bacteria | 1261 |
| 320 | Ga0207649_10327814 | 3300025920 | Bacteria | 1127 |
| 321 | Ga0207649_10755711 | 3300025920 | Bacteria | 757 |
| 322 | Ga0207652_10007377 | 3300025921 | Bacteria | 8865 |
| 323 | Ga0207652_10080258 | 3300025921 | Bacteria | 2852 |
| 324 | Ga0207652_10090659 | 3300025921 | Bacteria | 2687 |
| 325 | Ga0207652_10625203 | 3300025921 | Bacteria | 964 |
| 326 | Ga0207652_10998968 | 3300025921 | Bacteria | 735 |
| 327 | Ga0207646_10001768 | 3300025922 | Bacteria | 26172 |
| 328 | Ga0207646_10353654 | 3300025922 | Bacteria | 1327 |
| 329 | Ga0207646_10580598 | 3300025922 | Bacteria | 1007 |
| 330 | Ga0207646_10734254 | 3300025922 | Bacteria | 882 |
| 331 | Ga0207694_10064458 | 3300025924 | Bacteria | 2856 |
| 332 | Ga0207694_10097107 | 3300025924 | Bacteria | 2331 |
| 333 | Ga0207694_10166830 | 3300025924 | Bacteria | 1781 |
| 334 | Ga0207650_10339276 | 3300025925 | Bacteria | 1234 |
| 335 | Ga0207659_10079179 | 3300025926 | Bacteria | 2424 |
| 336 | Ga0207659_10428017 | 3300025926 | Bacteria | 1111 |
| 337 | Ga0207659_10655959 | 3300025926 | Bacteria | 897 |
| 338 | Ga0207687_10050709 | 3300025927 | Bacteria | 2890 |
| 339 | Ga0207687_10084981 | 3300025927 | Bacteria | 2295 |
| 340 | Ga0207687_10284158 | 3300025927 | Bacteria | 1327 |
| 341 | Ga0207687_10391892 | 3300025927 | Bacteria | 1140 |
| 342 | Ga0207687_10555931 | 3300025927 | Bacteria | 963 |
| 343 | Ga0207700_10094060 | 3300025928 | Bacteria | 2374 |
| 344 | Ga0207700_10252655 | 3300025928 | Bacteria | 1506 |
| 345 | Ga0207700_10788393 | 3300025928 | Bacteria | 850 |
| 346 | Ga0207700_10877309 | 3300025928 | Bacteria | 803 |
| 347 | Ga0207700_11118459 | 3300025928 | Bacteria | 704 |
| 348 | Ga0207664_10022691 | 3300025929 | Bacteria | 4692 |
| 349 | Ga0207664_10072301 | 3300025929 | Bacteria | 2780 |
| 350 | Ga0207664_10126585 | 3300025929 | Bacteria | 2146 |
| 351 | Ga0207664_10178626 | 3300025929 | Bacteria | 1821 |
| 352 | Ga0207664_10284633 | 3300025929 | Bacteria | 1451 |
| 353 | Ga0207644_10051087 | 3300025931 | Bacteria | 2966 |
| 354 | Ga0207644_10151843 | 3300025931 | Bacteria | 1793 |
| 355 | Ga0207690_10118173 | 3300025932 | Bacteria | 1921 |
| 356 | Ga0207690_11304516 | 3300025932 | Bacteria | 607 |
| 357 | Ga0207690_11305276 | 3300025932 | Bacteria | 606 |
| 358 | Ga0207706_10650337 | 3300025933 | Bacteria | 903 |
| 359 | Ga0207686_10263992 | 3300025934 | Bacteria | 1263 |
| 360 | Ga0207686_10555958 | 3300025934 | Bacteria | 898 |
| 361 | Ga0207709_10942909 | 3300025935 | Bacteria | 703 |
| 362 | Ga0207704_11397505 | 3300025938 | Bacteria | 600 |
| 363 | Ga0207665_10002358 | 3300025939 | Bacteria | 12754 |
| 364 | Ga0207665_10071996 | 3300025939 | Bacteria | 2360 |
| 365 | Ga0207665_10576630 | 3300025939 | Bacteria | 876 |
| 366 | Ga0207665_11188140 | 3300025939 | Bacteria | 608 |
| 367 | Ga0207711_10537339 | 3300025941 | Bacteria | 1090 |
| 368 | Ga0207661_10003288 | 3300025944 | Bacteria | 11218 |
| 369 | Ga0207661_10009282 | 3300025944 | Bacteria | 7050 |
| 370 | Ga0207661_10088182 | 3300025944 | Bacteria | 2578 |
| 371 | Ga0207661_10193808 | 3300025944 | Bacteria | 1783 |
| 372 | Ga0207661_10203073 | 3300025944 | Bacteria | 1743 |
| 373 | Ga0207661_10377804 | 3300025944 | Bacteria | 1282 |
| 374 | Ga0207661_10580730 | 3300025944 | Bacteria | 1028 |
| 375 | Ga0207679_10704156 | 3300025945 | Bacteria | 917 |
| 376 | Ga0207679_11455360 | 3300025945 | Bacteria | 628 |
| 377 | Ga0207667_10070378 | 3300025949 | Bacteria | 3641 |
| 378 | Ga0207667_10160611 | 3300025949 | Bacteria | 2311 |
| 379 | Ga0207667_10281783 | 3300025949 | Bacteria | 1698 |
| 380 | Ga0207667_10370081 | 3300025949 | Bacteria | 1460 |
| 381 | Ga0207667_10381307 | 3300025949 | Bacteria | 1436 |
| 382 | Ga0207667_10554432 | 3300025949 | Bacteria | 1162 |
| 383 | Ga0207667_10624700 | 3300025949 | Bacteria | 1085 |
| 384 | Ga0207651_11031465 | 3300025960 | Bacteria | 736 |
| 385 | Ga0207712_10302669 | 3300025961 | Bacteria | 1313 |
| 386 | Ga0207640_10692175 | 3300025981 | Bacteria | 873 |
| 387 | Ga0207640_11336005 | 3300025981 | Bacteria | 641 |
| 388 | Ga0207658_10868277 | 3300025986 | Bacteria | 821 |
| 389 | Ga0207677_10358783 | 3300026023 | Bacteria | 1224 |
| 390 | Ga0207677_10740767 | 3300026023 | Bacteria | 875 |
| 391 | Ga0207677_11031263 | 3300026023 | Bacteria | 747 |
| 392 | Ga0207639_10234422 | 3300026041 | Bacteria | 1593 |
| 393 | Ga0207639_10468825 | 3300026041 | Bacteria | 1146 |
| 394 | Ga0207639_10691127 | 3300026041 | Bacteria | 946 |
| 395 | Ga0207639_10903491 | 3300026041 | Bacteria | 825 |
| 396 | Ga0207678_10629006 | 3300026067 | Bacteria | 942 |
| 397 | Ga0207708_10747046 | 3300026075 | Unclassified | 839 |
| 398 | Ga0207702_10136385 | 3300026078 | Bacteria | 2215 |
| 399 | Ga0207702_10542527 | 3300026078 | Bacteria | 1137 |
| 400 | Ga0207702_10559593 | 3300026078 | Bacteria | 1119 |
| 401 | Ga0207641_10238689 | 3300026088 | Bacteria | 1693 |
| 402 | Ga0207641_10396267 | 3300026088 | Bacteria | 1325 |
| 403 | Ga0207676_10643291 | 3300026095 | Bacteria | 1023 |
| 404 | Ga0207674_10003276 | 3300026116 | Bacteria | 19914 |
| 405 | Ga0207674_10122383 | 3300026116 | Bacteria | 2568 |
| 406 | Ga0207674_10137935 | 3300026116 | Bacteria | 2400 |
| 407 | Ga0207674_10216189 | 3300026116 | Bacteria | 1865 |
| 408 | Ga0207674_10269120 | 3300026116 | Bacteria | 1651 |
| 409 | Ga0207674_10857443 | 3300026116 | Bacteria | 876 |
| 410 | Ga0207675_100403066 | 3300026118 | Bacteria | 1348 |
| 411 | Ga0207683_10254829 | 3300026121 | Bacteria | 1602 |
| 412 | Ga0207698_10122159 | 3300026142 | Bacteria | 2206 |
| 413 | Ga0207698_10255129 | 3300026142 | Bacteria | 1607 |
| 414 | Ga0207698_10304494 | 3300026142 | Bacteria | 1485 |
| 415 | Ga0207698_11303199 | 3300026142 | Bacteria | 741 |
| 416 | Ga0207428_10009737 | 3300027907 | Bacteria | 8612 |
| 417 | Ga0207428_10012767 | 3300027907 | Bacteria | 7368 |
| 418 | Ga0207428_10079298 | 3300027907 | Bacteria | 2567 |
| 419 | Ga0268266_11007485 | 3300028379 | Bacteria | 806 |
| 420 | Ga0265319_1029856 | 3300028563 | Bacteria | 1911 |
| 421 | Ga0265319_1039330 | 3300028563 | Bacteria | 1604 |
| 422 | Ga0265319_1043375 | 3300028563 | Bacteria | 1511 |
| 423 | Ga0265318_10003761 | 3300028577 | Bacteria | 7549 |
| 424 | Ga0265318_10097709 | 3300028577 | Bacteria | 1081 |
| 425 | Ga0265322_10060524 | 3300028654 | Bacteria | 1074 |
| 426 | Ga0265338_10045788 | 3300028800 | Bacteria | 4018 |
| 427 | Ga0265338_10145737 | 3300028800 | Bacteria | 1847 |
| 428 | Ga0265338_10394954 | 3300028800 | Bacteria | 987 |
| 429 | Ga0265320_10160639 | 3300031240 | Bacteria | 1012 |
| 430 | Ga0265340_10185333 | 3300031247 | Bacteria | 940 |
| 431 | Ga0265331_10056389 | 3300031250 | Bacteria | 1866 |
| 432 | Ga0265327_10022085 | 3300031251 | Bacteria | 3819 |
| 433 | Ga0307408_101886865 | 3300031548 | Bacteria | 573 |
| 434 | Ga0307405_10284744 | 3300031731 | Bacteria | 1246 |
| 435 | Ga0307410_10176923 | 3300031852 | Bacteria | 1612 |
| 436 | Ga0307412_10291911 | 3300031911 | Bacteria | 1285 |
| 437 | Ga0307409_100176900 | 3300031995 | Bacteria | 1884 |
| 438 | Ga0307409_100450419 | 3300031995 | Bacteria | 1242 |
| 439 | Ga0307416_100100631 | 3300032002 | Bacteria | 2514 |
| 440 | Ga0307416_100502379 | 3300032002 | Bacteria | 1277 |
| 441 | Ga0307411_10468061 | 3300032005 | Bacteria | 1058 |
| 442 | Ga0307415_100037965 | 3300032126 | Bacteria | 3171 |
| 443 | Ga0307415_100062191 | 3300032126 | Bacteria | 2588 |
| 444 | Ga0373938_0040398 | 3300034957 | Bacteria | 1035 |
| 445 | Ga0373940_0086838 | 3300035088 | Bacteria | 932 |
| 446 | Ga0373936_0191139 | 3300035113 | Bacteria | 901 |
| 447 | Ga0373945_0014109 | 3300035116 | Bacteria | 2673 |
| 448 | Ga0373954_0134317 | 3300035118 | Bacteria | 1205 |
| 449 | Ga0373957_0048124 | 3300035120 | Bacteria | 1624 |
| 450 | Ga0373943_0007385 | 3300035170 | Bacteria | 4935 |
| 451 | Ga0373943_0057666 | 3300035170 | Bacteria | 1930 |
| 452 | Ga0373946_0010186 | 3300035171 | Bacteria | 3476 |
| 453 | Ga0373946_0053165 | 3300035171 | Bacteria | 1700 |
| 454 | Ga0373946_0266046 | 3300035171 | Unclassified | 840 |
| 455 | Ga0373955_0022659 | 3300035172 | Bacteria | 3189 |
| 456 | Ga0373955_0426795 | 3300035172 | Bacteria | 807 |
| 457 | Ga0373924_0097993 | 3300035410 | Bacteria | 1259 |
| 458 | Ga0373931_0007846 | 3300035691 | Bacteria | 5046 |
| 459 | Ga0373935_0003843 | 3300035692 | Bacteria | 8762 |
| 460 | Ga0373935_0088079 | 3300035692 | Bacteria | 2028 |
| 461 | Ga0373935_0147731 | 3300035692 | Bacteria | 1593 |
| 462 | Ga0373927_0182347 | 3300035695 | Bacteria | 1377 |
| 463 | Ga0373927_0515955 | 3300035695 | Bacteria | 790 |
| 464 | Ga0373947_0017632 | 3300035725 | Bacteria | 4108 |
| 465 | Ga0373947_0018309 | 3300035725 | Bacteria | 4031 |
| 466 | Ga0373937_0046394 | 3300036401 | Bacteria | 3973 |
| 467 | Ga0373937_0410772 | 3300036401 | Bacteria | 1284 |
| 468 | Ga0373937_0570721 | 3300036401 | Bacteria | 1075 |
| 469 | Ga0373925_0002318 | 3300037068 | Bacteria | 15306 |
| 470 | Ga0373925_0080148 | 3300037068 | Bacteria | 2481 |
| 471 | Ga0395899_0003162 | 3300037312 | Bacteria | 13077 |
| 472 | Ga0395899_0004845 | 3300037312 | Bacteria | 10480 |
| 473 | Ga0395899_0007797 | 3300037312 | Bacteria | 8256 |
| 474 | Ga0395899_0025379 | 3300037312 | Bacteria | 4474 |
| 475 | Ga0395899_0145793 | 3300037312 | Bacteria | 1681 |
| 476 | Ga0395899_0223208 | 3300037312 | Bacteria | 1304 |
| 477 | Ga0395899_0244535 | 3300037312 | Bacteria | 1233 |
| 478 | Ga0395899_0292532 | 3300037312 | Bacteria | 1105 |
| 479 | Ga0395899_0343078 | 3300037312 | Bacteria | 1001 |
| 480 | Ga0395899_0429466 | 3300037312 | Bacteria | 869 |
| 481 | Ga0395899_0526105 | 3300037312 | Bacteria | 763 |
| 482 | Ga0395900_0001640 | 3300037418 | Bacteria | 26256 |
| 483 | Ga0395900_0003536 | 3300037418 | Bacteria | 16810 |
| 484 | Ga0395900_0011339 | 3300037418 | Bacteria | 9119 |
| 485 | Ga0395900_0014823 | 3300037418 | Bacteria | 7941 |
| 486 | Ga0395900_0023113 | 3300037418 | Bacteria | 6362 |
| 487 | Ga0395900_0027999 | 3300037418 | Bacteria | 5770 |
| 488 | Ga0395900_0030855 | 3300037418 | Bacteria | 5504 |
| 489 | Ga0395900_0083765 | 3300037418 | Bacteria | 3276 |
| 490 | Ga0395900_0097722 | 3300037418 | Bacteria | 3017 |
| 491 | Ga0395900_0117694 | 3300037418 | Bacteria | 2726 |
| 492 | Ga0395900_0132440 | 3300037418 | Bacteria | 2554 |
| 493 | Ga0395900_0257926 | 3300037418 | Bacteria | 1742 |
| 494 | Ga0395900_0262216 | 3300037418 | Bacteria | 1725 |
| 495 | Ga0395900_0276217 | 3300037418 | Bacteria | 1673 |
| 496 | Ga0395900_0432957 | 3300037418 | Bacteria | 1274 |
| 497 | Ga0395900_0568923 | 3300037418 | Bacteria | 1076 |
| 498 | Ga0395900_0582845 | 3300037418 | Bacteria | 1060 |
| 499 | Ga0395900_0806097 | 3300037418 | Bacteria | 867 |
| 500 | Ga0395900_1130053 | 3300037418 | Bacteria | 700 |
| 501 | Ga0395898_0003534 | 3300037466 | Bacteria | 17426 |
| 502 | Ga0395898_0019282 | 3300037466 | Bacteria | 6944 |
| 503 | Ga0395898_0019851 | 3300037466 | Bacteria | 6835 |
| 504 | Ga0395898_0029685 | 3300037466 | Bacteria | 5473 |
| 505 | Ga0395898_0047928 | 3300037466 | Bacteria | 4191 |
| 506 | Ga0395898_0058471 | 3300037466 | Bacteria | 3753 |
| 507 | Ga0395898_0083015 | 3300037466 | Bacteria | 3088 |
| 508 | Ga0395898_0097904 | 3300037466 | Bacteria | 2816 |
| 509 | Ga0395898_0125066 | 3300037466 | Bacteria | 2463 |
| 510 | Ga0395898_0129495 | 3300037466 | Bacteria | 2418 |
| 511 | Ga0395898_0150134 | 3300037466 | Bacteria | 2230 |
| 512 | Ga0395898_0306945 | 3300037466 | Bacteria | 1513 |
| 513 | Ga0395898_0373382 | 3300037466 | Bacteria | 1360 |
| 514 | Ga0395898_0390625 | 3300037466 | Bacteria | 1327 |
| 515 | Ga0395898_0492775 | 3300037466 | Bacteria | 1166 |
| 516 | Ga0395898_0809495 | 3300037466 | Bacteria | 877 |
| 517 | Ga0395898_0837631 | 3300037466 | Bacteria | 859 |
| 518 | Ga0395898_0975986 | 3300037466 | Bacteria | 784 |
| 519 | Ga0395898_0983422 | 3300037466 | Bacteria | 780 |
| 520 | Ga0395898_0995180 | 3300037466 | Unclassified | 774 |
| 521 | Ga0395898_1249463 | 3300037466 | Bacteria | 673 |
| 522 | Ga0395898_1698890 | 3300037466 | Bacteria | 554 |
| 523 | Ga0395905_0003269 | 3300037471 | Bacteria | 17422 |
| 524 | Ga0395905_0003392 | 3300037471 | Bacteria | 17054 |
| 525 | Ga0395905_0038107 | 3300037471 | Bacteria | 4510 |
| 526 | Ga0395905_0040105 | 3300037471 | Bacteria | 4392 |
| 527 | Ga0395905_0040306 | 3300037471 | Bacteria | 4381 |
| 528 | Ga0395905_0117981 | 3300037471 | Bacteria | 2494 |
| 529 | Ga0395905_0202542 | 3300037471 | Bacteria | 1860 |
| 530 | Ga0395905_0230933 | 3300037471 | Bacteria | 1730 |
| 531 | Ga0395905_0289069 | 3300037471 | Bacteria | 1526 |
| 532 | Ga0395905_0329046 | 3300037471 | Bacteria | 1418 |
| 533 | Ga0395905_0649200 | 3300037471 | Bacteria | 957 |
| 534 | Ga0395905_0837641 | 3300037471 | Bacteria | 823 |
| 535 | Ga0395905_0933621 | 3300037471 | Bacteria | 771 |
| 536 | Ga0395901_0001841 | 3300038443 | Bacteria | 21913 |
| 537 | Ga0395901_0002272 | 3300038443 | Bacteria | 19614 |
| 538 | Ga0395901_0002650 | 3300038443 | Bacteria | 18087 |
| 539 | Ga0395901_0014199 | 3300038443 | Bacteria | 8108 |
| 540 | Ga0395901_0017797 | 3300038443 | Bacteria | 7251 |
| 541 | Ga0395901_0018324 | 3300038443 | Bacteria | 7147 |
| 542 | Ga0395901_0023342 | 3300038443 | Bacteria | 6339 |
| 543 | Ga0395901_0056090 | 3300038443 | Bacteria | 4098 |
| 544 | Ga0395901_0058107 | 3300038443 | Bacteria | 4023 |
| 545 | Ga0395901_0107083 | 3300038443 | Bacteria | 2934 |
| 546 | Ga0395901_0112838 | 3300038443 | Bacteria | 2854 |
| 547 | Ga0395901_0117408 | 3300038443 | Bacteria | 2795 |
| 548 | Ga0395901_0180390 | 3300038443 | Bacteria | 2215 |
| 549 | Ga0395901_0204796 | 3300038443 | Bacteria | 2067 |
| 550 | Ga0395901_0271614 | 3300038443 | Bacteria | 1763 |
| 551 | Ga0395901_0312790 | 3300038443 | Bacteria | 1626 |
| 552 | Ga0395901_0442277 | 3300038443 | Bacteria | 1331 |
| 553 | Ga0395901_0445645 | 3300038443 | Bacteria | 1325 |
| 554 | Ga0395901_0623347 | 3300038443 | Bacteria | 1085 |
| 555 | Ga0395901_0751358 | 3300038443 | Bacteria | 968 |
| 556 | Ga0395901_0777830 | 3300038443 | Bacteria | 948 |
| 557 | Ga0395901_0902465 | 3300038443 | Bacteria | 865 |
| 558 | Ga0395901_0935868 | 3300038443 | Bacteria | 846 |
| 559 | Ga0395901_1485072 | 3300038443 | Bacteria | 634 |
| 560 | Ga0395901_1819720 | 3300038443 | Unclassified | 558 |
| 561 | Ga0436365_0560760 | 3300039437 | Bacteria | 691 |
| 562 | Ga0436363_0012856 | 3300039450 | Bacteria | 1161 |
| 563 | Ga0451789_0777155 | 3300041443 | Bacteria | 1049 |
| 564 | Ga0451849_0524342 | 3300041505 | Bacteria | 677 |
| 565 | Ga0451853_3721867 | 3300041512 | Bacteria | 1904 |
| 566 | Ga0451853_3935337 | 3300041512 | Unclassified | 688 |
| 567 | Ga0439448_0047021 | 3300042005 | Bacteria | 1407 |
| 568 | Ga0439448_0116487 | 3300042005 | Bacteria | 915 |
| 569 | Ga0466966_0004360 | 3300044684 | Bacteria | 9334 |
| 570 | Ga0466966_0008955 | 3300044684 | Bacteria | 6632 |
| 571 | Ga0466966_0023852 | 3300044684 | Bacteria | 4003 |
| 572 | Ga0466966_0075341 | 3300044684 | Bacteria | 2108 |
| 573 | Ga0466966_0115287 | 3300044684 | Bacteria | 1654 |
| 574 | Ga0466961_0008109 | 3300044693 | Bacteria | 6687 |
| 575 | Ga0466961_0016839 | 3300044693 | Bacteria | 4698 |
| 576 | Ga0466961_0067875 | 3300044693 | Bacteria | 2265 |
| 577 | Ga0466961_0273967 | 3300044693 | Bacteria | 1033 |
| 578 | Ga0466963_0000095 | 3300044694 | Bacteria | 31064 |
| 579 | Ga0466963_0008069 | 3300044694 | Bacteria | 6303 |
| 580 | Ga0466963_0011499 | 3300044694 | Bacteria | 5390 |
| 581 | Ga0466963_0028626 | 3300044694 | Bacteria | 3579 |
| 582 | Ga0466963_0029189 | 3300044694 | Bacteria | 3548 |
| 583 | Ga0466963_0030330 | 3300044694 | Bacteria | 3488 |
| 584 | Ga0466963_0037276 | 3300044694 | Bacteria | 3173 |
| 585 | Ga0466963_0042093 | 3300044694 | Bacteria | 2998 |
| 586 | Ga0466963_0051935 | 3300044694 | Bacteria | 2718 |
| 587 | Ga0466963_0101970 | 3300044694 | Bacteria | 1965 |
| 588 | Ga0466963_0135942 | 3300044694 | Bacteria | 1700 |
| 589 | Ga0466963_0158759 | 3300044694 | Bacteria | 1573 |
| 590 | Ga0466963_0171082 | 3300044694 | Bacteria | 1514 |
| 591 | Ga0466963_0178564 | 3300044694 | Bacteria | 1482 |
| 592 | Ga0466963_0224269 | 3300044694 | Bacteria | 1317 |
| 593 | Ga0466963_0248512 | 3300044694 | Bacteria | 1248 |
| 594 | Ga0466963_0306751 | 3300044694 | Bacteria | 1116 |
| 595 | Ga0466963_0348454 | 3300044694 | Bacteria | 1043 |
| 596 | Ga0466963_0681771 | 3300044694 | Bacteria | 725 |
| 597 | Ga0466963_0702819 | 3300044694 | Bacteria | 713 |
| 598 | Ga0466964_0003701 | 3300044706 | Bacteria | 5599 |
| 599 | Ga0466964_0010305 | 3300044706 | Bacteria | 3525 |
| 600 | Ga0466964_0015210 | 3300044706 | Bacteria | 2929 |
| 601 | Ga0466964_0219819 | 3300044706 | Bacteria | 922 |
| 602 | Ga0466964_0552876 | 3300044706 | Bacteria | 625 |
| 603 | Ga0466971_0016904 | 3300044719 | Bacteria | 3223 |
| 604 | Ga0466971_0078349 | 3300044719 | Bacteria | 1505 |
| 605 | Ga0466968_0006491 | 3300044735 | Bacteria | 4411 |
| 606 | Ga0466968_0010769 | 3300044735 | Bacteria | 3553 |
| 607 | Ga0466968_0011853 | 3300044735 | Bacteria | 3402 |
| 608 | Ga0466968_0044769 | 3300044735 | Bacteria | 1876 |
| 609 | Ga0466968_0050752 | 3300044735 | Bacteria | 1771 |
| 610 | Ga0466968_0101534 | 3300044735 | Bacteria | 1284 |
| 611 | Ga0466970_0056897 | 3300044765 | Bacteria | 2090 |
| 612 | Ga0466970_0337445 | 3300044765 | Bacteria | 854 |
| 613 | Ga0466957_0002974 | 3300044842 | Bacteria | 9202 |
| 614 | Ga0466957_0007579 | 3300044842 | Bacteria | 6134 |
| 615 | Ga0466957_0017807 | 3300044842 | Bacteria | 4168 |
| 616 | Ga0466957_0033943 | 3300044842 | Bacteria | 3061 |
| 617 | Ga0466957_0336303 | 3300044842 | Bacteria | 1022 |
| 618 | Ga0466957_0588191 | 3300044842 | Bacteria | 778 |
| 619 | Ga0466960_0071892 | 3300044901 | Bacteria | 1724 |
| 620 | Ga0466960_0223136 | 3300044901 | Bacteria | 1038 |
| 621 | Ga0466959_0005223 | 3300045049 | Bacteria | 8862 |
| 622 | Ga0466959_0014268 | 3300045049 | Bacteria | 5766 |
| 623 | Ga0466959_0024314 | 3300045049 | Bacteria | 4487 |
| 624 | Ga0466959_0029877 | 3300045049 | Bacteria | 4036 |
| 625 | Ga0466959_0343357 | 3300045049 | Bacteria | 1018 |
| 626 | Ga0466959_0476347 | 3300045049 | Bacteria | 845 |
| 627 | Ga0451576_0029648 | 3300045051 | Bacteria | 5853 |
| 628 | Ga0466958_0007167 | 3300045836 | Bacteria | 6113 |
| 629 | Ga0466958_0009418 | 3300045836 | Bacteria | 5443 |
| 630 | Ga0466958_0011855 | 3300045836 | Bacteria | 4922 |
| 631 | Ga0466958_0019375 | 3300045836 | Bacteria | 3960 |
| 632 | Ga0466958_0045754 | 3300045836 | Bacteria | 2640 |
| 633 | Ga0466958_0072191 | 3300045836 | Bacteria | 2113 |
| 634 | Ga0466958_0077821 | 3300045836 | Bacteria | 2037 |
| 635 | Ga0466958_0086108 | 3300045836 | Bacteria | 1939 |
| 636 | Ga0466958_0223610 | 3300045836 | Bacteria | 1201 |
| 637 | Ga0466958_0246864 | 3300045836 | Bacteria | 1141 |
| 638 | Ga0466967_0002678 | 3300045976 | Bacteria | 11240 |
| 639 | Ga0466967_0003018 | 3300045976 | Bacteria | 10796 |
| 640 | Ga0466967_0007451 | 3300045976 | Bacteria | 7895 |
| 641 | Ga0466967_0008435 | 3300045976 | Bacteria | 7550 |
| 642 | Ga0466967_0012913 | 3300045976 | Bacteria | 6422 |
| 643 | Ga0466967_0015896 | 3300045976 | Bacteria | 5915 |
| 644 | Ga0466967_0020790 | 3300045976 | Bacteria | 5316 |
| 645 | Ga0466967_0021061 | 3300045976 | Bacteria | 5283 |
| 646 | Ga0466967_0025255 | 3300045976 | Bacteria | 4897 |
| 647 | Ga0466967_0030792 | 3300045976 | Bacteria | 4507 |
| 648 | Ga0466967_0037568 | 3300045976 | Bacteria | 4145 |
| 649 | Ga0466967_0043946 | 3300045976 | Bacteria | 3871 |
| 650 | Ga0466967_0056030 | 3300045976 | Bacteria | 3474 |
| 651 | Ga0466967_0056509 | 3300045976 | Bacteria | 3461 |
| 652 | Ga0466967_0072469 | 3300045976 | Bacteria | 3087 |
| 653 | Ga0466967_0080098 | 3300045976 | Bacteria | 2946 |
| 654 | Ga0466967_0086500 | 3300045976 | Bacteria | 2840 |
| 655 | Ga0466967_0098860 | 3300045976 | Bacteria | 2664 |
| 656 | Ga0466967_0155024 | 3300045976 | Bacteria | 2144 |
| 657 | Ga0466967_0217489 | 3300045976 | Bacteria | 1814 |
| 658 | Ga0466967_0471196 | 3300045976 | Bacteria | 1229 |
| 659 | Ga0466967_0521829 | 3300045976 | Bacteria | 1167 |
| 660 | Ga0466967_0599075 | 3300045976 | Bacteria | 1087 |
| 661 | Ga0466967_0681788 | 3300045976 | Bacteria | 1017 |
| 662 | Ga0466967_0752482 | 3300045976 | Bacteria | 966 |
| 663 | Ga0466967_0796253 | 3300045976 | Bacteria | 938 |
| 664 | Ga0466967_1039083 | 3300045976 | Bacteria | 816 |
| 665 | Ga0466967_1309933 | 3300045976 | Unclassified | 721 |
| 666 | Ga0466967_1801861 | 3300045976 | Bacteria | 609 |
| 667 | Ga0495592_0027375 | 3300046454 | Bacteria | 4322 |
| 668 | Ga0495592_0035705 | 3300046454 | Bacteria | 3745 |
| 669 | Ga0495603_0005193 | 3300046455 | Bacteria | 7776 |
| 670 | Ga0495603_0170669 | 3300046455 | Bacteria | 1260 |
| 671 | Ga0495603_0620590 | 3300046455 | Bacteria | 619 |
| 672 | Ga0495629_0020948 | 3300046459 | Bacteria | 4666 |
| 673 | Ga0495629_0148369 | 3300046459 | Bacteria | 1630 |
| 674 | Ga0495629_0281642 | 3300046459 | Bacteria | 1141 |
| 675 | Ga0495629_0292700 | 3300046459 | Bacteria | 1116 |
| 676 | Ga0495629_0425119 | 3300046459 | Bacteria | 901 |
| 677 | Ga0495641_0005435 | 3300046461 | Bacteria | 8615 |
| 678 | Ga0495641_0040762 | 3300046461 | Bacteria | 2158 |
| 679 | Ga0495641_0043444 | 3300046461 | Bacteria | 2078 |
| 680 | Ga0495641_0055399 | 3300046461 | Bacteria | 1800 |
| 681 | Ga0495641_0066497 | 3300046461 | Bacteria | 1622 |
| 682 | Ga0495641_0088610 | 3300046461 | Bacteria | 1384 |
| 683 | Ga0495641_0143265 | 3300046461 | Bacteria | 1068 |
| 684 | Ga0495651_0016426 | 3300046462 | Bacteria | 5732 |
| 685 | Ga0495651_0723444 | 3300046462 | Bacteria | 619 |
| 686 | Ga0495653_0009654 | 3300046463 | Bacteria | 7893 |
| 687 | Ga0495653_0125920 | 3300046463 | Bacteria | 1819 |
| 688 | Ga0495653_0126855 | 3300046463 | Bacteria | 1811 |
| 689 | Ga0495653_0147014 | 3300046463 | Bacteria | 1650 |
| 690 | Ga0495580_0035292 | 3300046472 | Bacteria | 3596 |
| 691 | Ga0495582_0028580 | 3300046473 | Bacteria | 3060 |
| 692 | Ga0495582_0057903 | 3300046473 | Bacteria | 2136 |
| 693 | Ga0495582_0065794 | 3300046473 | Bacteria | 2003 |
| 694 | Ga0495605_0105621 | 3300046474 | Bacteria | 1290 |
| 695 | Ga0495605_0166512 | 3300046474 | Bacteria | 976 |
| 696 | Ga0495639_0026021 | 3300046475 | Bacteria | 2583 |
| 697 | Ga0495639_0066100 | 3300046475 | Bacteria | 1664 |
| 698 | Ga0495662_0030188 | 3300046476 | Bacteria | 2616 |
| 699 | Ga0495662_0264637 | 3300046476 | Bacteria | 846 |
| 700 | Ga0495662_0339395 | 3300046476 | Bacteria | 739 |
| 701 | Ga0495662_0396865 | 3300046476 | Bacteria | 677 |
| 702 | Ga0495664_0038850 | 3300046477 | Bacteria | 2810 |
| 703 | Ga0495664_0072644 | 3300046477 | Bacteria | 2056 |
| 704 | Ga0495664_0438648 | 3300046477 | Bacteria | 782 |
| 705 | Ga0495585_0292796 | 3300046492 | Bacteria | 802 |
| 706 | Ga0495594_0591401 | 3300046499 | Bacteria | 629 |
| 707 | Ga0495608_0006652 | 3300046511 | Bacteria | 8203 |
| 708 | Ga0495608_0104873 | 3300046511 | Bacteria | 1820 |
| 709 | Ga0495608_0360484 | 3300046511 | Bacteria | 893 |
| 710 | Ga0495616_0037436 | 3300046513 | Bacteria | 2496 |
| 711 | Ga0495618_0145624 | 3300046514 | Bacteria | 1514 |
| 712 | Ga0495628_0162747 | 3300046516 | Bacteria | 1695 |
| 713 | Ga0495628_0961850 | 3300046516 | Bacteria | 589 |
| 714 | Ga0495630_0004280 | 3300046517 | Bacteria | 10013 |
| 715 | Ga0495630_0011832 | 3300046517 | Bacteria | 6323 |
| 716 | Ga0495630_0196422 | 3300046517 | Bacteria | 1539 |
| 717 | Ga0495630_0558752 | 3300046517 | Bacteria | 877 |
| 718 | Ga0495630_0558803 | 3300046517 | Bacteria | 877 |
| 719 | Ga0495630_0593157 | 3300046517 | Bacteria | 849 |
| 720 | Ga0495631_0070998 | 3300046518 | Bacteria | 1505 |
| 721 | Ga0495637_0047484 | 3300046520 | Bacteria | 1812 |
| 722 | Ga0495644_0009809 | 3300046523 | Bacteria | 3687 |
| 723 | Ga0495644_0020525 | 3300046523 | Bacteria | 2521 |
| 724 | Ga0495644_0122359 | 3300046523 | Bacteria | 990 |
| 725 | Ga0495663_0008292 | 3300046525 | Bacteria | 2877 |
| 726 | Ga0495666_0424299 | 3300046526 | Bacteria | 597 |
| 727 | Ga0495642_0048785 | 3300046528 | Bacteria | 1738 |
| 728 | Ga0495642_0074858 | 3300046528 | Bacteria | 1420 |
| 729 | Ga0495652_0034234 | 3300046529 | Bacteria | 4428 |
| 730 | Ga0495652_0052975 | 3300046529 | Bacteria | 3459 |
| 731 | Ga0495652_0076047 | 3300046529 | Bacteria | 2786 |
| 732 | Ga0495652_0254959 | 3300046529 | Bacteria | 1298 |
| 733 | Ga0495652_0365454 | 3300046529 | Bacteria | 1030 |
| 734 | Ga0495652_0468747 | 3300046529 | Bacteria | 878 |
| 735 | Ga0495665_0004858 | 3300046531 | Bacteria | 7249 |
| 736 | Ga0495665_0293796 | 3300046531 | Bacteria | 833 |
| 737 | Ga0495640_0026151 | 3300046533 | Bacteria | 4221 |
| 738 | Ga0495640_0065747 | 3300046533 | Bacteria | 2448 |
| 739 | Ga0495640_0277394 | 3300046533 | Bacteria | 1044 |
| 740 | Ga0495640_0336851 | 3300046533 | Bacteria | 932 |
| 741 | Ga0495586_0083531 | 3300046535 | Bacteria | 1757 |
| 742 | Ga0495586_0476871 | 3300046535 | Bacteria | 719 |
| 743 | Ga0495587_0016542 | 3300046536 | Bacteria | 4587 |
| 744 | Ga0495587_0065990 | 3300046536 | Bacteria | 2112 |
| 745 | Ga0495587_0377947 | 3300046536 | Bacteria | 788 |
| 746 | Ga0495609_0022728 | 3300046538 | Bacteria | 2889 |
| 747 | Ga0495645_0056256 | 3300046543 | Bacteria | 2856 |
| 748 | Ga0495645_0165391 | 3300046543 | Bacteria | 1526 |
| 749 | Ga0495667_0029836 | 3300046559 | Bacteria | 3669 |
| 750 | Ga0495667_0054717 | 3300046559 | Bacteria | 2625 |
| 751 | Ga0495667_0067561 | 3300046559 | Bacteria | 2335 |
| 752 | Ga0495667_0207401 | 3300046559 | Bacteria | 1253 |
| 753 | Ga0495667_0311485 | 3300046559 | Bacteria | 997 |
| 754 | Ga0495656_0003250 | 3300046615 | Bacteria | 5481 |
| 755 | Ga0495656_0024202 | 3300046615 | Bacteria | 2396 |
| 756 | Ga0495656_0209845 | 3300046615 | Bacteria | 970 |
| 757 | Ga0495656_0429408 | 3300046615 | Bacteria | 694 |
| 758 | Ga0495656_0439916 | 3300046615 | Bacteria | 686 |
| 759 | Ga0495668_0062123 | 3300046616 | Bacteria | 2059 |
| 760 | Ga0495634_0057539 | 3300046642 | Bacteria | 2594 |
| 761 | Ga0495634_0062957 | 3300046642 | Bacteria | 2462 |
| 762 | Ga0495634_0087685 | 3300046642 | Bacteria | 2025 |
| 763 | Ga0495634_0101245 | 3300046642 | Bacteria | 1861 |
| 764 | Ga0495634_0282036 | 3300046642 | Bacteria | 1009 |
| 765 | Ga0495611_0083262 | 3300046648 | Bacteria | 1473 |
| 766 | Ga0495611_0118349 | 3300046648 | Bacteria | 1235 |
| 767 | Ga0495635_0011900 | 3300046663 | Bacteria | 6097 |
| 768 | Ga0495635_0029948 | 3300046663 | Bacteria | 3784 |
| 769 | Ga0495635_0050628 | 3300046663 | Bacteria | 2863 |
| 770 | Ga0495635_0479215 | 3300046663 | Bacteria | 820 |
| 771 | Ga0495635_0536263 | 3300046663 | Bacteria | 768 |
| 772 | Ga0495635_0571063 | 3300046663 | Bacteria | 740 |
| 773 | Ga0495635_0589517 | 3300046663 | Bacteria | 726 |
| 774 | Ga0495657_0005166 | 3300046675 | Bacteria | 10339 |
| 775 | Ga0495657_0013766 | 3300046675 | Bacteria | 5955 |
| 776 | Ga0495657_0535420 | 3300046675 | Bacteria | 681 |
| 777 | Ga0495599_0014803 | 3300046678 | Bacteria | 4830 |
| 778 | Ga0495599_0058776 | 3300046678 | Bacteria | 2405 |
| 779 | Ga0495599_0179970 | 3300046678 | Bacteria | 1303 |
| 780 | Ga0495623_0009860 | 3300046679 | Bacteria | 6188 |
| 781 | Ga0495646_0045703 | 3300046680 | Bacteria | 2673 |
| 782 | Ga0495647_0004336 | 3300046681 | Bacteria | 4600 |
| 783 | Ga0495647_0016354 | 3300046681 | Bacteria | 2611 |
| 784 | Ga0495647_0106068 | 3300046681 | Bacteria | 1168 |
| 785 | Ga0495658_0002872 | 3300046683 | Bacteria | 8655 |
| 786 | Ga0495658_0047629 | 3300046683 | Bacteria | 2415 |
| 787 | Ga0495658_0157646 | 3300046683 | Bacteria | 1398 |
| 788 | Ga0495658_0165125 | 3300046683 | Bacteria | 1367 |
| 789 | Ga0495613_0021823 | 3300046689 | Bacteria | 4772 |
| 790 | Ga0495613_0051296 | 3300046689 | Bacteria | 3040 |
| 791 | Ga0495613_0132438 | 3300046689 | Bacteria | 1785 |
| 792 | Ga0495613_0201701 | 3300046689 | Bacteria | 1402 |
| 793 | Ga0495624_0057267 | 3300046690 | Bacteria | 2450 |
| 794 | Ga0495624_0200574 | 3300046690 | Bacteria | 1212 |
| 795 | Ga0495670_0208706 | 3300046691 | Bacteria | 1036 |
| 796 | Ga0495589_0038852 | 3300046794 | Bacteria | 2381 |
| 797 | Ga0495600_0046445 | 3300046809 | Bacteria | 2833 |
| 798 | Ga0495600_0056126 | 3300046809 | Bacteria | 2573 |
| 799 | Ga0495600_0084751 | 3300046809 | Bacteria | 2068 |
| 800 | Ga0495581_0000505 | 3300047315 | Bacteria | 19955 |
| 801 | Ga0495581_0038759 | 3300047315 | Bacteria | 2758 |
| 802 | Ga0495581_0110012 | 3300047315 | Bacteria | 1602 |
| 803 | Ga0495581_0354633 | 3300047315 | Bacteria | 856 |
| 804 | Ga0495604_0006659 | 3300047317 | Bacteria | 9154 |
| 805 | Ga0495604_0107011 | 3300047317 | Bacteria | 2045 |
| 806 | Ga0495604_0447809 | 3300047317 | Bacteria | 844 |
| 807 | Ga0495604_0502504 | 3300047317 | Bacteria | 786 |
| 808 | Ga0495636_0038751 | 3300047318 | Bacteria | 1973 |
| 809 | Ga0495674_0011878 | 3300047319 | Bacteria | 8209 |
| 810 | Ga0495674_0015466 | 3300047319 | Bacteria | 7130 |
| 811 | Ga0495674_0021386 | 3300047319 | Bacteria | 5984 |
| 812 | Ga0495674_0131801 | 3300047319 | Bacteria | 2106 |
| 813 | Ga0495674_0307263 | 3300047319 | Bacteria | 1294 |
| 814 | Ga0495674_0312627 | 3300047319 | Bacteria | 1281 |
| 815 | Ga0495674_0410248 | 3300047319 | Bacteria | 1092 |
| 816 | Ga0495676_0009864 | 3300047321 | Bacteria | 8676 |
| 817 | Ga0495676_0068497 | 3300047321 | Bacteria | 2742 |
| 818 | Ga0495676_0131440 | 3300047321 | Bacteria | 1806 |
| 819 | Ga0495676_0140485 | 3300047321 | Bacteria | 1731 |
| 820 | Ga0495676_0482453 | 3300047321 | Bacteria | 815 |
| 821 | Ga0495676_0505593 | 3300047321 | Bacteria | 793 |
| 822 | Ga0495676_0719522 | 3300047321 | Bacteria | 645 |
| 823 | Ga0495680_0005532 | 3300047322 | Bacteria | 11858 |
| 824 | Ga0495680_0022217 | 3300047322 | Bacteria | 5293 |
| 825 | Ga0495680_0023897 | 3300047322 | Bacteria | 5078 |
| 826 | Ga0495680_0042745 | 3300047322 | Bacteria | 3593 |
| 827 | Ga0495680_0066240 | 3300047322 | Bacteria | 2765 |
| 828 | Ga0495680_0350577 | 3300047322 | Bacteria | 1028 |
| 829 | Ga0495675_0002014 | 3300047444 | Bacteria | 12134 |
| 830 | Ga0495675_0149268 | 3300047444 | Bacteria | 1445 |
| 831 | Ga0495684_0004528 | 3300047471 | Bacteria | 10857 |
| 832 | Ga0495684_0009628 | 3300047471 | Bacteria | 7453 |
| 833 | Ga0495684_0095741 | 3300047471 | Bacteria | 2247 |
| 834 | Ga0495684_0191363 | 3300047471 | Bacteria | 1512 |
| 835 | Ga0495684_0271229 | 3300047471 | Bacteria | 1227 |
| 836 | Ga0495593_0004729 | 3300047673 | Bacteria | 8093 |
| 837 | Ga0495602_0192523 | 3300048088 | Bacteria | 1562 |
| 838 | Ga0495602_0208742 | 3300048088 | Bacteria | 1484 |
| 839 | Ga0495602_0400929 | 3300048088 | Bacteria | 978 |
| 840 | Ga0496100_0008560 | 3300048903 | Bacteria | 5709 |
| 841 | Ga0496100_0009080 | 3300048903 | Bacteria | 5573 |
| 842 | Ga0496101_0001024 | 3300048904 | Bacteria | 16471 |
| 843 | Ga0496101_0035886 | 3300048904 | Bacteria | 3508 |
| 844 | Ga0496101_0061970 | 3300048904 | Bacteria | 2718 |
| 845 | Ga0496101_0112226 | 3300048904 | Bacteria | 2053 |
| 846 | Ga0496101_0157292 | 3300048904 | Bacteria | 1742 |
| 847 | Ga0496101_0323111 | 3300048904 | Bacteria | 1211 |
| 848 | Ga0496101_0484527 | 3300048904 | Bacteria | 977 |
| 849 | Ga0496102_0013068 | 3300048905 | Bacteria | 7189 |
| 850 | Ga0496102_0022488 | 3300048905 | Bacteria | 5587 |
| 851 | Ga0496102_0094431 | 3300048905 | Bacteria | 2771 |
| 852 | Ga0496102_0121116 | 3300048905 | Bacteria | 2443 |
| 853 | Ga0496102_0225966 | 3300048905 | Bacteria | 1765 |
| 854 | Ga0496102_0796499 | 3300048905 | Bacteria | 867 |
| 855 | Ga0496103_0004988 | 3300048906 | Bacteria | 8006 |
| 856 | Ga0496103_0009793 | 3300048906 | Bacteria | 5674 |
| 857 | Ga0496103_0010423 | 3300048906 | Bacteria | 5500 |
| 858 | Ga0496103_0173891 | 3300048906 | Bacteria | 1383 |
| 859 | Ga0496103_0290804 | 3300048906 | Bacteria | 1051 |
| 860 | Ga0496103_0375431 | 3300048906 | Bacteria | 914 |
| 861 | Ga0496104_0002338 | 3300048907 | Bacteria | 16381 |
| 862 | Ga0496104_0016855 | 3300048907 | Bacteria | 6642 |
| 863 | Ga0496104_0034005 | 3300048907 | Bacteria | 4752 |
| 864 | Ga0496104_0236072 | 3300048907 | Bacteria | 1740 |
| 865 | Ga0496104_0819664 | 3300048907 | Bacteria | 836 |
| 866 | Ga0496105_0001042 | 3300048908 | Bacteria | 19175 |
| 867 | Ga0496105_0002856 | 3300048908 | Bacteria | 12644 |
| 868 | Ga0496105_0128886 | 3300048908 | Bacteria | 2086 |
| 869 | Ga0496105_0357352 | 3300048908 | Bacteria | 1166 |
| 870 | Ga0496105_0372799 | 3300048908 | Bacteria | 1137 |
| 871 | Ga0496105_0428153 | 3300048908 | Bacteria | 1047 |
| 872 | Ga0496106_0013216 | 3300048909 | Bacteria | 6092 |
| 873 | Ga0496106_0057285 | 3300048909 | Bacteria | 2947 |
| 874 | Ga0496106_0071687 | 3300048909 | Bacteria | 2648 |
| 875 | Ga0496106_0478655 | 3300048909 | Unclassified | 1000 |
| 876 | Ga0496106_0570484 | 3300048909 | Bacteria | 907 |
| 877 | Ga0496107_0001734 | 3300048910 | Bacteria | 13705 |
| 878 | Ga0496107_0002291 | 3300048910 | Bacteria | 12358 |
| 879 | Ga0496107_0273087 | 3300048910 | Bacteria | 1258 |
| 880 | Ga0496107_0398035 | 3300048910 | Bacteria | 1024 |
| 881 | Ga0496107_0502277 | 3300048910 | Bacteria | 900 |
| 882 | Ga0496107_0614025 | 3300048910 | Bacteria | 803 |
| 883 | Ga0496108_0008931 | 3300048911 | Bacteria | 8122 |
| 884 | Ga0496108_0027191 | 3300048911 | Bacteria | 4721 |
| 885 | Ga0496108_0028356 | 3300048911 | Bacteria | 4631 |
| 886 | Ga0496108_0264196 | 3300048911 | Bacteria | 1498 |
| 887 | Ga0496108_0408869 | 3300048911 | Bacteria | 1185 |
| 888 | Ga0496108_0695135 | 3300048911 | Bacteria | 882 |
| 889 | Ga0496109_0018533 | 3300048912 | Bacteria | 6114 |
| 890 | Ga0496109_0032272 | 3300048912 | Bacteria | 4707 |
| 891 | Ga0496109_0041024 | 3300048912 | Bacteria | 4193 |
| 892 | Ga0496109_0043230 | 3300048912 | Bacteria | 4084 |
| 893 | Ga0496109_0056706 | 3300048912 | Bacteria | 3574 |
| 894 | Ga0496109_0074982 | 3300048912 | Bacteria | 3110 |
| 895 | Ga0496109_0199773 | 3300048912 | Bacteria | 1879 |
| 896 | Ga0496109_0222834 | 3300048912 | Bacteria | 1774 |
| 897 | Ga0496109_0322967 | 3300048912 | Bacteria | 1457 |
| 898 | Ga0496109_0355118 | 3300048912 | Bacteria | 1385 |
| 899 | Ga0496109_0440861 | 3300048912 | Bacteria | 1230 |
| 900 | Ga0496109_0573132 | 3300048912 | Bacteria | 1064 |
| 901 | Ga0496109_0612723 | 3300048912 | Bacteria | 1025 |
| 902 | Ga0496109_1073613 | 3300048912 | Bacteria | 742 |
| 903 | Ga0496110_0010243 | 3300048913 | Bacteria | 7615 |
| 904 | Ga0496110_0069790 | 3300048913 | Bacteria | 3112 |
| 905 | Ga0496110_0150910 | 3300048913 | Bacteria | 2104 |
| 906 | Ga0496110_0163347 | 3300048913 | Bacteria | 2019 |
| 907 | Ga0496110_0183011 | 3300048913 | Bacteria | 1903 |
| 908 | Ga0496110_0388111 | 3300048913 | Bacteria | 1273 |
| 909 | Ga0496110_0447940 | 3300048913 | Bacteria | 1177 |
| 910 | Ga0496111_0021275 | 3300048914 | Bacteria | 4527 |
| 911 | Ga0496111_0142501 | 3300048914 | Bacteria | 1776 |
| 912 | Ga0496111_0243921 | 3300048914 | Bacteria | 1334 |
| 913 | Ga0496111_0302603 | 3300048914 | Bacteria | 1185 |
| 914 | Ga0496112_0000635 | 3300048915 | Bacteria | 24368 |
| 915 | Ga0496112_0040922 | 3300048915 | Bacteria | 4533 |
| 916 | Ga0496112_0197701 | 3300048915 | Bacteria | 1971 |
| 917 | Ga0496112_0218477 | 3300048915 | Bacteria | 1862 |
| 918 | Ga0496112_0256769 | 3300048915 | Bacteria | 1698 |
| 919 | Ga0496112_0389948 | 3300048915 | Bacteria | 1333 |
| 920 | Ga0496112_0570341 | 3300048915 | Bacteria | 1065 |
| 921 | Ga0496113_0077332 | 3300048916 | Bacteria | 2544 |
| 922 | Ga0496113_0280871 | 3300048916 | Bacteria | 1331 |
| 923 | Ga0496113_0577503 | 3300048916 | Bacteria | 901 |
| 924 | Ga0496114_0000892 | 3300048917 | Bacteria | 22279 |
| 925 | Ga0496114_0008778 | 3300048917 | Bacteria | 8008 |
| 926 | Ga0496114_0009938 | 3300048917 | Bacteria | 7562 |
| 927 | Ga0496114_0018394 | 3300048917 | Bacteria | 5649 |
| 928 | Ga0496114_0235057 | 3300048917 | Bacteria | 1610 |
| 929 | Ga0496114_0277674 | 3300048917 | Bacteria | 1477 |
| 930 | Ga0496114_0862023 | 3300048917 | Bacteria | 786 |
| 931 | Ga0496115_0000701 | 3300048918 | Bacteria | 24832 |
| 932 | Ga0496115_0013798 | 3300048918 | Bacteria | 6118 |
| 933 | Ga0496115_0014516 | 3300048918 | Bacteria | 5964 |
| 934 | Ga0496115_0022567 | 3300048918 | Bacteria | 4878 |
| 935 | Ga0496115_0087109 | 3300048918 | Bacteria | 2548 |
| 936 | Ga0496115_0797104 | 3300048918 | Bacteria | 735 |
| 937 | Ga0501031_0012388 | 3300049568 | Bacteria | 5560 |
| 938 | Ga0501032_0043883 | 3300049569 | Bacteria | 3027 |
| 939 | Ga0501032_0059046 | 3300049569 | Bacteria | 2574 |
| 940 | Ga0501033_0021378 | 3300049570 | Bacteria | 4881 |
| 941 | Ga0501033_0026858 | 3300049570 | Bacteria | 4332 |
| 942 | Ga0501034_0034567 | 3300049571 | Bacteria | 5124 |
| 943 | Ga0501036_0009096 | 3300049572 | Bacteria | 8170 |
| 944 | Ga0501036_0199588 | 3300049572 | Bacteria | 1682 |
| 945 | Ga0501037_0001731 | 3300049573 | Bacteria | 15846 |
| 946 | Ga0501037_0048511 | 3300049573 | Bacteria | 3111 |
| 947 | Ga0501038_0015616 | 3300049574 | Bacteria | 6902 |
| 948 | Ga0501038_0020426 | 3300049574 | Bacteria | 5953 |
| 949 | Ga0501039_0053012 | 3300049575 | Bacteria | 3138 |
| 950 | Ga0501039_0062951 | 3300049575 | Bacteria | 2874 |
| 951 | Ga0501040_0016677 | 3300049576 | Bacteria | 4866 |
| 952 | Ga0501040_0475713 | 3300049576 | Bacteria | 900 |
| 953 | Ga0501041_0007506 | 3300049577 | Bacteria | 6398 |
| 954 | Ga0501041_0016523 | 3300049577 | Bacteria | 4388 |
| 955 | Ga0501042_0019636 | 3300049578 | Bacteria | 4696 |
| 956 | Ga0501042_0045197 | 3300049578 | Bacteria | 3138 |
| 957 | Ga0501042_0080671 | 3300049578 | Bacteria | 2331 |
| 958 | Ga0501043_0001696 | 3300049579 | Bacteria | 19096 |
| 959 | Ga0501043_0087251 | 3300049579 | Bacteria | 2452 |
| 960 | Ga0501046_0011144 | 3300049580 | Bacteria | 7701 |
| 961 | Ga0501046_0013699 | 3300049580 | Bacteria | 6856 |
| 962 | Ga0501046_0639456 | 3300049580 | Bacteria | 753 |
| 963 | Ga0501047_0030877 | 3300049581 | Bacteria | 5166 |
| 964 | Ga0501047_0737549 | 3300049581 | Bacteria | 801 |
| 965 | Ga0501048_0001796 | 3300049582 | Bacteria | 16311 |
| 966 | Ga0501048_0042581 | 3300049582 | Bacteria | 3250 |
| 967 | Ga0501048_1295328 | 3300049582 | Bacteria | 524 |
| 968 | Ga0501067_0005193 | 3300049583 | Bacteria | 7236 |
| 969 | Ga0501067_0026909 | 3300049583 | Bacteria | 3185 |
| 970 | Ga0501067_0100339 | 3300049583 | Bacteria | 1608 |
| 971 | Ga0501067_0221180 | 3300049583 | Bacteria | 1054 |
| 972 | Ga0501068_0001541 | 3300049584 | Bacteria | 12248 |
| 973 | Ga0501068_0011481 | 3300049584 | Bacteria | 5000 |
| 974 | Ga0501068_0362784 | 3300049584 | Bacteria | 932 |
| 975 | Ga0501069_0012964 | 3300049585 | Bacteria | 4439 |
| 976 | Ga0501069_0032961 | 3300049585 | Bacteria | 2851 |
| 977 | Ga0501069_0041060 | 3300049585 | Bacteria | 2556 |
| 978 | Ga0501069_0059252 | 3300049585 | Bacteria | 2137 |
| 979 | Ga0501069_0195433 | 3300049585 | Bacteria | 1171 |
| 980 | Ga0501070_0007108 | 3300049586 | Bacteria | 9518 |
| 981 | Ga0501070_0011141 | 3300049586 | Bacteria | 7590 |
| 982 | Ga0501070_0014542 | 3300049586 | Bacteria | 6622 |
| 983 | Ga0501070_0039570 | 3300049586 | Bacteria | 3933 |
| 984 | Ga0501070_0192198 | 3300049586 | Bacteria | 1677 |
| 985 | Ga0501070_0292216 | 3300049586 | Bacteria | 1328 |
| 986 | Ga0501071_0001183 | 3300049587 | Bacteria | 14683 |
| 987 | Ga0501071_0018706 | 3300049587 | Bacteria | 4802 |
| 988 | Ga0501071_0573458 | 3300049587 | Bacteria | 867 |
| 989 | Ga0501071_0748823 | 3300049587 | Bacteria | 753 |
| 990 | Ga0501072_0003411 | 3300049588 | Bacteria | 11969 |
| 991 | Ga0501072_0011384 | 3300049588 | Bacteria | 6798 |
| 992 | Ga0501072_0020756 | 3300049588 | Bacteria | 5091 |
| 993 | Ga0501072_0239786 | 3300049588 | Bacteria | 1444 |
| 994 | Ga0501073_0009280 | 3300049589 | Bacteria | 7256 |
| 995 | Ga0501073_0129586 | 3300049589 | Bacteria | 1748 |
| 996 | Ga0501074_0000859 | 3300049590 | Bacteria | 19335 |
| 997 | Ga0501074_0008458 | 3300049590 | Bacteria | 7460 |
| 998 | Ga0501074_0039598 | 3300049590 | Bacteria | 3413 |
| 999 | Ga0501074_0054359 | 3300049590 | Bacteria | 2887 |
| 1000 | Ga0501074_0081022 | 3300049590 | Bacteria | 2328 |
| 1001 | Ga0501075_0023721 | 3300049591 | Bacteria | 4492 |
| 1002 | Ga0501075_1142177 | 3300049591 | Bacteria | 591 |
| 1003 | Ga0501076_0033954 | 3300049592 | Bacteria | 3984 |
| 1004 | Ga0501076_0240320 | 3300049592 | Bacteria | 1481 |
| 1005 | Ga0501077_0026488 | 3300049593 | Bacteria | 3679 |
| 1006 | Ga0501077_0028800 | 3300049593 | Bacteria | 3530 |
| 1007 | Ga0501077_0087590 | 3300049593 | Bacteria | 1973 |
| 1008 | Ga0501077_0107627 | 3300049593 | Bacteria | 1767 |
| 1009 | Ga0501079_0009336 | 3300049741 | Bacteria | 7433 |
| 1010 | Ga0501079_0014711 | 3300049741 | Bacteria | 5963 |
| 1011 | Ga0501079_0024949 | 3300049741 | Bacteria | 4586 |
| 1012 | Ga0501080_0008532 | 3300049742 | Bacteria | 9291 |
| 1013 | Ga0501080_0015795 | 3300049742 | Bacteria | 6964 |
| 1014 | Ga0501080_0031199 | 3300049742 | Bacteria | 4965 |
| 1015 | Ga0501080_0247896 | 3300049742 | Bacteria | 1624 |
| 1016 | Ga0501081_0031502 | 3300049743 | Bacteria | 3593 |
| 1017 | Ga0501081_0077331 | 3300049743 | Bacteria | 2325 |
| 1018 | Ga0501081_0095898 | 3300049743 | Bacteria | 2092 |
| 1019 | Ga0501083_0002114 | 3300049744 | Bacteria | 13633 |
| 1020 | Ga0501083_0007136 | 3300049744 | Bacteria | 7933 |
| 1021 | Ga0501083_0026409 | 3300049744 | Bacteria | 4013 |
| 1022 | Ga0501035_0008865 | 3300049822 | Bacteria | 9360 |
| 1023 | Ga0501035_0379749 | 3300049822 | Bacteria | 1179 |
| 1024 | Ga0501044_0011094 | 3300049823 | Bacteria | 9773 |
| 1025 | Ga0501044_0101841 | 3300049823 | Bacteria | 2889 |
| 1026 | Ga0501044_1053588 | 3300049823 | Bacteria | 684 |
| 1027 | Ga0501045_0072285 | 3300049824 | Bacteria | 2539 |
| 1028 | Ga0501045_0418753 | 3300049824 | Bacteria | 996 |
| 1029 | nmdc:mga03n38_354518_c1 | 3300050490 | Bacteria | 799 |
| 1030 | nmdc:mga0yw44_660246_c1 | 3300050492 | Bacteria | 710 |
| 1031 | nmdc:mga0yw44_818358_c1 | 3300050492 | Bacteria | 632 |
| 1032 | nmdc:mga05p37_141564_c1 | 3300050507 | Bacteria | 2947 |
| 1033 | nmdc:mga05p37_202699_c1 | 3300050507 | Bacteria | 2402 |
| 1034 | nmdc:mga09592_323962_c1 | 3300050508 | Unclassified | 1335 |
| 1035 | nmdc:mga0qj67_216598_c1 | 3300050509 | Bacteria | 1555 |
| 1036 | nmdc:mga0qj67_293319_c1 | 3300050509 | Unclassified | 1318 |
| 1037 | nmdc:mga06r32_352063_c1 | 3300050510 | Unclassified | 1457 |
| 1038 | nmdc:mga08y16_111271_c1 | 3300050511 | Bacteria | 2851 |
| 1039 | nmdc:mga08y16_116643_c1 | 3300050511 | Bacteria | 2780 |
| 1040 | nmdc:mga08y16_361421_c1 | 3300050511 | Bacteria | 1490 |
| 1041 | nmdc:mga0n895_17051_c1 | 3300050512 | Bacteria | 6685 |
| 1042 | nmdc:mga0n895_32525_c1 | 3300050512 | Bacteria | 5007 |
| 1043 | nmdc:mga0n895_599025_c1 | 3300050512 | Unclassified | 1105 |
| 1044 | nmdc:mga0rr50_118874_c1 | 3300050513 | Bacteria | 2101 |
| 1045 | nmdc:mga0rr50_76794_c1 | 3300050513 | Bacteria | 2565 |
| 1046 | nmdc:mga08x19_62383_c1 | 3300050514 | Bacteria | 2417 |
| 1047 | nmdc:mga0a205_189643_c1 | 3300050515 | Bacteria | 1948 |
| 1048 | nmdc:mga0a205_243814_c1 | 3300050515 | Bacteria | 1678 |
| 1049 | nmdc:mga0a205_38578_c1 | 3300050515 | Bacteria | 4596 |
| 1050 | Ga0495601_0037540 | 3300053077 | Bacteria | 3029 |
| 1051 | Ga0495601_0199540 | 3300053077 | Bacteria | 1307 |
| 1052 | Ga0495601_0213797 | 3300053077 | Bacteria | 1259 |
| 1053 | Ga0495601_0490212 | 3300053077 | Bacteria | 793 |
| 1054 | Ga0495601_0521044 | 3300053077 | Bacteria | 766 |
| 1055 | Ga0495612_0007074 | 3300053078 | Bacteria | 4589 |
| 1056 | Ga0495595_0013345 | 3300053084 | Bacteria | 3471 |
| 1057 | Ga0495595_0030875 | 3300053084 | Bacteria | 2405 |
| 1058 | Ga0495595_0032865 | 3300053084 | Bacteria | 2338 |
| 1059 | Ga0495595_0087146 | 3300053084 | Bacteria | 1494 |
| 1060 | Ga0495619_0004147 | 3300053085 | Bacteria | 9261 |
| 1061 | Ga0495619_0066626 | 3300053085 | Bacteria | 2403 |
| 1062 | Ga0495619_0080476 | 3300053085 | Bacteria | 2192 |
| 1063 | Ga0495619_0083344 | 3300053085 | Bacteria | 2156 |
| 1064 | Ga0495619_0102697 | 3300053085 | Bacteria | 1947 |
| 1065 | Ga0495619_0160773 | 3300053085 | Bacteria | 1551 |
| 1066 | Ga0495619_0339142 | 3300053085 | Bacteria | 1040 |
| 1067 | Ga0495619_0406684 | 3300053085 | Bacteria | 940 |
| 1068 | Ga0495619_0456096 | 3300053085 | Bacteria | 881 |
| 1069 | Ga0500566_0054705 | 3300053094 | Bacteria | 2275 |
| 1070 | Ga0501084_0028831 | 3300054114 | Bacteria | 4640 |
| 1071 | Ga0501084_0030687 | 3300054114 | Bacteria | 4494 |
| 1072 | Ga0501084_0041823 | 3300054114 | Bacteria | 3834 |
| 1073 | Ga0501084_0504338 | 3300054114 | Bacteria | 1023 |
| 1074 | Ga0501084_0811679 | 3300054114 | Bacteria | 788 |
| 1075 | Ga0590075_070203 | 3300059424 | Bacteria | 905 |
| 1076 | Ga0501082_0011837 | 3300060353 | Bacteria | 7499 |
| 1077 | Ga0501082_0055589 | 3300060353 | Bacteria | 3409 |
| 1078 | Ga0501082_0378231 | 3300060353 | Bacteria | 1235 |
| 1079 | Ga0501082_0836552 | 3300060353 | Bacteria | 805 |
| 1080 | Ga0466962_0000096 | 3300061719 | Bacteria | 35253 |
| 1081 | Ga0466962_0001445 | 3300061719 | Bacteria | 11078 |
| 1082 | Ga0466962_0086266 | 3300061719 | Bacteria | 1503 |
| 1083 | Ga0530510_0003924 | 3300061734 | Bacteria | 10260 |
| 1084 | Ga0530510_0047288 | 3300061734 | Bacteria | 3109 |
| 1085 | Ga0530510_0082007 | 3300061734 | Bacteria | 2348 |
| 1086 | Ga0530510_0155623 | 3300061734 | Bacteria | 1689 |
| 1087 | Ga0530510_0365241 | 3300061734 | Bacteria | 1085 |
| 1088 | Ga0070675_101415410 | |||
| 1089 | JGI25406J46586_10054802 | |||
| 1090 | Ga0070658_10012791 | |||
| 1091 | Ga0070658_10037453 | |||
| 1092 | Ga0070658_10059517 | |||
| 1093 | Ga0070658_10337975 | |||
| 1094 | Ga0070658_11318679 | |||
| 1095 | Ga0070683_100051957 | |||
| 1096 | Ga0070683_100061493 | |||
| 1097 | Ga0070683_100088710 | |||
| 1098 | Ga0070683_100097095 | |||
| 1099 | Ga0070683_100896286 | |||
| 1100 | Ga0070683_101022265 | |||
| 1101 | Ga0070683_101034342 | |||
| 1102 | Ga0070680_100006253 | |||
| 1103 | Ga0070680_100169771 | |||
| 1104 | Ga0070680_100219668 | |||
| 1105 | Ga0070680_100232872 | |||
| 1106 | Ga0070680_101028469 | |||
| 1107 | Ga0070682_100805388 | |||
| 1108 | Ga0068868_100662810 | |||
| 1109 | Ga0070660_100001098 | |||
| 1110 | Ga0070660_100046194 | |||
| 1111 | Ga0070660_100052003 | |||
| 1112 | Ga0070660_100080718 | |||
| 1113 | Ga0070660_100103559 | |||
| 1114 | Ga0070660_100128204 | |||
| 1115 | Ga0070660_100722728 | |||
| 1116 | Ga0070661_100012445 | |||
| 1117 | Ga0070661_100065974 | |||
| 1118 | Ga0070661_100108966 | |||
| 1119 | Ga0070661_100202404 | |||
| 1120 | Ga0070661_100223911 | |||
| 1121 | Ga0070675_100161683 | |||
| 1122 | Ga0070674_100062493 | |||
| 1123 | Ga0070674_101164628 | |||
| 1124 | Ga0070659_100031564 | |||
| 1125 | Ga0070659_100118677 | |||
| 1126 | Ga0070659_100150596 | |||
| 1127 | Ga0070659_100762250 | |||
| 1128 | Ga0070659_100981294 | |||
| 1129 | Ga0070659_101333969 | |||
| 1130 | Ga0070703_10109839 | |||
| 1131 | Ga0070709_10028844 | |||
| 1132 | Ga0070709_10606094 | |||
| 1133 | Ga0070714_100025095 | |||
| 1134 | Ga0070714_100078883 | |||
| 1135 | Ga0070714_100210438 | |||
| 1136 | Ga0070714_100245545 | |||
| 1137 | Ga0070714_100384996 | |||
| 1138 | Ga0070713_100001060 | |||
| 1139 | Ga0070713_100243387 | |||
| 1140 | Ga0070713_101855192 | |||
| 1141 | Ga0070710_10057608 | |||
| 1142 | Ga0070701_10214097 | |||
| 1143 | Ga0070711_100013538 | |||
| 1144 | Ga0070711_100021588 | |||
| 1145 | Ga0070711_100328492 | |||
| 1146 | Ga0070705_100599476 | |||
| 1147 | Ga0070694_100063127 | |||
| 1148 | Ga0070708_100034217 | |||
| 1149 | Ga0070708_100762834 | |||
| 1150 | Ga0070663_100520901 | |||
| 1151 | Ga0070663_101347264 | |||
| 1152 | Ga0070678_100711105 | |||
| 1153 | Ga0070678_100931331 | |||
| 1154 | Ga0070662_100509045 | |||
| 1155 | Ga0070681_10002995 | |||
| 1156 | Ga0070681_10013548 | |||
| 1157 | Ga0070681_10017738 | |||
| 1158 | Ga0070681_10065039 | |||
| 1159 | Ga0070681_10083232 | |||
| 1160 | Ga0070681_10141697 | |||
| 1161 | Ga0070681_10164387 | |||
| 1162 | Ga0070681_10257369 | |||
| 1163 | Ga0070681_10334239 | |||
| 1164 | Ga0070681_10421385 | |||
| 1165 | Ga0070681_10627253 | |||
| 1166 | Ga0068867_100384385 | |||
| 1167 | Ga0070685_10302606 | |||
| 1168 | Ga0070707_100002712 | |||
| 1169 | Ga0070707_100100342 | |||
| 1170 | Ga0070707_100177888 | |||
| 1171 | Ga0070707_100345204 | |||
| 1172 | Ga0070707_101179352 | |||
| 1173 | Ga0070698_100015615 | |||
| 1174 | Ga0070698_100190470 | |||
| 1175 | Ga0070698_100223671 | |||
| 1176 | Ga0070698_101389656 | |||
| 1177 | Ga0070699_100851737 | |||
| 1178 | Ga0070679_100032549 | |||
| 1179 | Ga0070679_100042729 | |||
| 1180 | Ga0070679_100156760 | |||
| 1181 | Ga0070679_100158918 | |||
| 1182 | Ga0070679_100587096 | |||
| 1183 | Ga0070679_101377065 | |||
| 1184 | Ga0070684_100001409 | |||
| 1185 | Ga0070684_100029473 | |||
| 1186 | Ga0070684_100033593 | |||
| 1187 | Ga0070684_100040167 | |||
| 1188 | Ga0070684_100081507 | |||
| 1189 | Ga0070684_100090449 | |||
| 1190 | Ga0070684_100119746 | |||
| 1191 | Ga0070684_100223155 | |||
| 1192 | Ga0070684_100401996 | |||
| 1193 | Ga0070684_100469576 | |||
| 1194 | Ga0070684_101031928 | |||
| 1195 | Ga0070697_101416259 | |||
| 1196 | Ga0068853_100179062 | |||
| 1197 | Ga0068853_100344189 | |||
| 1198 | Ga0070672_100841375 | |||
| 1199 | Ga0070672_100876960 | |||
| 1200 | Ga0070695_100000029 | |||
| 1201 | Ga0070695_100496872 | |||
| 1202 | Ga0070696_100073516 | |||
| 1203 | Ga0070696_100699724 | |||
| 1204 | Ga0070696_101142914 | |||
| 1205 | Ga0070665_100607463 | |||
| 1206 | Ga0068855_100034915 | |||
| 1207 | Ga0068855_100036011 | |||
| 1208 | Ga0068855_100038449 | |||
| 1209 | Ga0068855_100152218 | |||
| 1210 | Ga0068855_100366403 | |||
| 1211 | Ga0068855_100495992 | |||
| 1212 | Ga0070664_100096114 | |||
| 1213 | Ga0070664_100104597 | |||
| 1214 | Ga0068857_100074276 | |||
| 1215 | Ga0068857_100090560 | |||
| 1216 | Ga0068857_100278651 | |||
| 1217 | Ga0068854_100829579 | |||
| 1218 | Ga0068856_100026801 | |||
| 1219 | Ga0068856_100185004 | |||
| 1220 | Ga0068856_100187549 | |||
| 1221 | Ga0068856_101974715 | |||
| 1222 | Ga0070702_100432698 | |||
| 1223 | Ga0068852_100031907 | |||
| 1224 | Ga0068852_101113974 | |||
| 1225 | Ga0068852_101828372 | |||
| 1226 | Ga0068861_100954612 | |||
| 1227 | Ga0068858_101349966 | |||
| 1228 | Ga0081540_1003860 | |||
| 1229 | Ga0081539_10001005 | |||
| 1230 | Ga0081539_10008668 | |||
| 1231 | Ga0070717_10159132 | |||
| 1232 | Ga0075432_10018976 | |||
| 1233 | Ga0070715_10001395 | |||
| 1234 | Ga0070715_10324663 | |||
| 1235 | Ga0070716_100005635 | |||
| 1236 | Ga0070716_100012148 | |||
| 1237 | Ga0070716_100812872 | |||
| 1238 | Ga0070712_100054382 | |||
| 1239 | Ga0070712_100096873 | |||
| 1240 | Ga0097621_100105826 | |||
| 1241 | Ga0075370_10425261 | |||
| 1242 | Ga0068871_101496690 | |||
| 1243 | Ga0075428_100188360 | |||
| 1244 | Ga0075428_100314079 | |||
| 1245 | Ga0075428_100346983 | |||
| 1246 | Ga0075428_101456319 | |||
| 1247 | Ga0075430_100058807 | |||
| 1248 | Ga0075430_100362205 | |||
| 1249 | Ga0075431_100002910 | |||
| 1250 | Ga0075431_100088535 | |||
| 1251 | Ga0075431_100425413 | |||
| 1252 | Ga0075433_10005061 | |||
| 1253 | Ga0075433_10287233 | |||
| 1254 | Ga0075433_10515564 | |||
| 1255 | Ga0075434_100001294 | |||
| 1256 | Ga0075434_100005543 | |||
| 1257 | Ga0075434_100678115 | |||
| 1258 | Ga0075429_100115498 | |||
| 1259 | Ga0075429_100351487 | |||
| 1260 | Ga0075436_100122880 | |||
| 1261 | Ga0075436_100593226 | |||
| 1262 | Ga0075435_100020701 | |||
| 1263 | Ga0075435_100325822 | |||
| 1264 | Ga0075435_100457583 | |||
| 1265 | Ga0075435_100476601 | |||
| 1266 | Ga0099795_10027214 | |||
| 1267 | Ga0105240_10017296 | |||
| 1268 | Ga0105240_10106166 | |||
| 1269 | Ga0105240_10180778 | |||
| 1270 | Ga0111539_10031645 | |||
| 1271 | Ga0111539_10275476 | |||
| 1272 | Ga0111539_10288660 | |||
| 1273 | Ga0111539_13098752 | |||
| 1274 | Ga0105245_10130548 | |||
| 1275 | Ga0105245_10146073 | |||
| 1276 | Ga0105245_10158204 | |||
| 1277 | Ga0105245_10340504 | |||
| 1278 | Ga0105245_10434104 | |||
| 1279 | Ga0105245_10944344 | |||
| 1280 | Ga0114129_10017841 | |||
| 1281 | Ga0114129_10229065 | |||
| 1282 | Ga0114129_12353518 | |||
| 1283 | Ga0105243_10709385 | |||
| 1284 | Ga0105243_10958826 | |||
| 1285 | Ga0105241_10332887 | |||
| 1286 | Ga0105241_10391480 | |||
| 1287 | Ga0105242_10027540 | |||
| 1288 | Ga0105242_10074064 | |||
| 1289 | Ga0105248_10645438 | |||
| 1290 | Ga0105248_10791322 | |||
| 1291 | Ga0105237_10008817 | |||
| 1292 | Ga0105237_10522862 | |||
| 1293 | Ga0105237_10817718 | |||
| 1294 | Ga0105238_10064901 | |||
| 1295 | Ga0105238_10253317 | |||
| 1296 | Ga0105238_10339069 | |||
| 1297 | Ga0105238_10686809 | |||
| 1298 | Ga0099796_10069171 | |||
| 1299 | Ga0105239_10261355 | |||
| 1300 | Ga0105239_10509694 | |||
| 1301 | Ga0105239_12051467 | |||
| 1302 | Ga0157373_10151456 | |||
| 1303 | Ga0157373_10332684 | |||
| 1304 | Ga0157371_10264152 | |||
| 1305 | Ga0157371_10460145 | |||
| 1306 | Ga0157370_10086075 | |||
| 1307 | Ga0157370_10096886 | |||
| 1308 | Ga0157370_10155624 | |||
| 1309 | Ga0157369_10002742 | |||
| 1310 | Ga0157369_10014160 | |||
| 1311 | Ga0157369_10028307 | |||
| 1312 | Ga0157369_10035760 | |||
| 1313 | Ga0157369_10087789 | |||
| 1314 | Ga0157369_10091640 | |||
| 1315 | Ga0157369_10149428 | |||
| 1316 | Ga0157369_10259355 | |||
| 1317 | Ga0157369_10267079 | |||
| 1318 | Ga0157369_11183293 | |||
| 1319 | Ga0157374_10033900 | |||
| 1320 | Ga0157374_10085634 | |||
| 1321 | Ga0157378_10110998 | |||
| 1322 | Ga0163162_10641881 | |||
| 1323 | Ga0157372_10104611 | |||
| 1324 | Ga0157372_10238411 | |||
| 1325 | Ga0157372_10377093 | |||
| 1326 | Ga0157372_10507471 | |||
| 1327 | Ga0157372_10532690 | |||
| 1328 | Ga0157372_10689568 | |||
| 1329 | Ga0157375_10278747 | |||
| 1330 | Ga0163163_10184153 | |||
| 1331 | Ga0163163_10205677 | |||
| 1332 | Ga0163163_10235616 | |||
| 1333 | Ga0163163_10426316 | |||
| 1334 | Ga0157380_11247264 | |||
| 1335 | Ga0182008_10000718 | |||
| 1336 | Ga0182008_10027803 | |||
| 1337 | Ga0182008_10108699 | |||
| 1338 | Ga0182008_10140612 | |||
| 1339 | Ga0157376_10061664 | |||
| 1340 | Ga0157376_10752696 | |||
| 1341 | Ga0182007_10017644 | |||
| 1342 | Ga0197907_10472481 | |||
| 1343 | Ga0197907_11274861 | |||
| 1344 | Ga0197907_11434900 | |||
| 1345 | Ga0206356_10116221 | |||
| 1346 | Ga0206354_10772758 | |||
| 1347 | Ga0206354_11139686 | |||
| 1348 | Ga0206353_10417389 | |||
| 1349 | Ga0206353_10633007 | |||
| 1350 | Ga0206353_10862315 | |||
| 1351 | Ga0206353_11689011 | |||
| 1352 | Ga0206353_11755696 | |||
| 1353 | Ga0213874_10090979 | |||
| 1354 | Ga0224712_10006496 | |||
| 1355 | Ga0207692_10043244 | |||
| 1356 | Ga0207692_10145754 | |||
| 1357 | Ga0207688_10065403 | |||
| 1358 | Ga0207699_10018015 | |||
| 1359 | Ga0207699_10357131 | |||
| 1360 | Ga0207699_10751634 | |||
| 1361 | Ga0207705_10079416 | |||
| 1362 | Ga0207705_10257238 | |||
| 1363 | Ga0207705_10333800 | |||
| 1364 | Ga0207705_10358496 | |||
| 1365 | Ga0207705_11044028 | |||
| 1366 | Ga0207684_10423616 | |||
| 1367 | Ga0207684_10883971 | |||
| 1368 | Ga0207654_10062092 | |||
| 1369 | Ga0207707_10020888 | |||
| 1370 | Ga0207707_10051153 | |||
| 1371 | Ga0207707_10091386 | |||
| 1372 | Ga0207707_10322561 | |||
| 1373 | Ga0207707_10336324 | |||
| 1374 | Ga0207707_10410299 | |||
| 1375 | Ga0207707_10571009 | |||
| 1376 | Ga0207695_10052410 | |||
| 1377 | Ga0207695_10348733 | |||
| 1378 | Ga0207671_10113743 | |||
| 1379 | Ga0207671_10247303 | |||
| 1380 | Ga0207693_10007916 | |||
| 1381 | Ga0207693_10015138 | |||
| 1382 | Ga0207693_10069335 | |||
| 1383 | Ga0207693_10071338 | |||
| 1384 | Ga0207693_10441269 | |||
| 1385 | Ga0207693_10538489 | |||
| 1386 | Ga0207693_10662770 | |||
| 1387 | Ga0207693_10693421 | |||
| 1388 | Ga0207663_10057469 | |||
| 1389 | Ga0207663_10101132 | |||
| 1390 | Ga0207663_10145925 | |||
| 1391 | Ga0207660_10039178 | |||
| 1392 | Ga0207660_10359275 | |||
| 1393 | Ga0207660_10437726 | |||
| 1394 | Ga0207660_10650777 | |||
| 1395 | Ga0207660_10676895 | |||
| 1396 | Ga0207660_10862154 | |||
| 1397 | Ga0207657_10000988 | |||
| 1398 | Ga0207657_10001365 | |||
| 1399 | Ga0207657_10006228 | |||
| 1400 | Ga0207657_10015573 | |||
| 1401 | Ga0207657_10034259 | |||
| 1402 | Ga0207657_10060350 | |||
| 1403 | Ga0207657_10069096 | |||
| 1404 | Ga0207649_10024155 | |||
| 1405 | Ga0207649_10141788 | |||
| 1406 | Ga0207649_10256809 | |||
| 1407 | Ga0207649_10327814 | |||
| 1408 | Ga0207649_10755711 | |||
| 1409 | Ga0207652_10007377 | |||
| 1410 | Ga0207652_10080258 | |||
| 1411 | Ga0207652_10090659 | |||
| 1412 | Ga0207652_10625203 | |||
| 1413 | Ga0207652_10998968 | |||
| 1414 | Ga0207646_10001768 | |||
| 1415 | Ga0207646_10353654 | |||
| 1416 | Ga0207646_10580598 | |||
| 1417 | Ga0207646_10734254 | |||
| 1418 | Ga0207694_10064458 | |||
| 1419 | Ga0207694_10097107 | |||
| 1420 | Ga0207694_10166830 | |||
| 1421 | Ga0207650_10339276 | |||
| 1422 | Ga0207659_10079179 | |||
| 1423 | Ga0207659_10428017 | |||
| 1424 | Ga0207659_10655959 | |||
| 1425 | Ga0207687_10050709 | |||
| 1426 | Ga0207687_10084981 | |||
| 1427 | Ga0207687_10284158 | |||
| 1428 | Ga0207687_10391892 | |||
| 1429 | Ga0207687_10555931 | |||
| 1430 | Ga0207700_10094060 | |||
| 1431 | Ga0207700_10252655 | |||
| 1432 | Ga0207700_10788393 | |||
| 1433 | Ga0207700_10877309 | |||
| 1434 | Ga0207700_11118459 | |||
| 1435 | Ga0207664_10022691 | |||
| 1436 | Ga0207664_10072301 | |||
| 1437 | Ga0207664_10126585 | |||
| 1438 | Ga0207664_10178626 | |||
| 1439 | Ga0207664_10284633 | |||
| 1440 | Ga0207644_10051087 | |||
| 1441 | Ga0207644_10151843 | |||
| 1442 | Ga0207690_10118173 | |||
| 1443 | Ga0207690_11304516 | |||
| 1444 | Ga0207690_11305276 | |||
| 1445 | Ga0207706_10650337 | |||
| 1446 | Ga0207686_10263992 | |||
| 1447 | Ga0207686_10555958 | |||
| 1448 | Ga0207709_10942909 | |||
| 1449 | Ga0207704_11397505 | |||
| 1450 | Ga0207665_10002358 | |||
| 1451 | Ga0207665_10071996 | |||
| 1452 | Ga0207665_10576630 | |||
| 1453 | Ga0207665_11188140 | |||
| 1454 | Ga0207711_10537339 | |||
| 1455 | Ga0207661_10003288 | |||
| 1456 | Ga0207661_10009282 | |||
| 1457 | Ga0207661_10088182 | |||
| 1458 | Ga0207661_10193808 | |||
| 1459 | Ga0207661_10203073 | |||
| 1460 | Ga0207661_10377804 | |||
| 1461 | Ga0207661_10580730 | |||
| 1462 | Ga0207679_10704156 | |||
| 1463 | Ga0207679_11455360 | |||
| 1464 | Ga0207667_10070378 | |||
| 1465 | Ga0207667_10160611 | |||
| 1466 | Ga0207667_10281783 | |||
| 1467 | Ga0207667_10370081 | |||
| 1468 | Ga0207667_10381307 | |||
| 1469 | Ga0207667_10554432 | |||
| 1470 | Ga0207667_10624700 | |||
| 1471 | Ga0207651_11031465 | |||
| 1472 | Ga0207712_10302669 | |||
| 1473 | Ga0207640_10692175 | |||
| 1474 | Ga0207640_11336005 | |||
| 1475 | Ga0207658_10868277 | |||
| 1476 | Ga0207677_10358783 | |||
| 1477 | Ga0207677_10740767 | |||
| 1478 | Ga0207677_11031263 | |||
| 1479 | Ga0207639_10234422 | |||
| 1480 | Ga0207639_10468825 | |||
| 1481 | Ga0207639_10691127 | |||
| 1482 | Ga0207639_10903491 | |||
| 1483 | Ga0207678_10629006 | |||
| 1484 | Ga0207708_10747046 | |||
| 1485 | Ga0207702_10136385 | |||
| 1486 | Ga0207702_10542527 | |||
| 1487 | Ga0207702_10559593 | |||
| 1488 | Ga0207641_10238689 | |||
| 1489 | Ga0207641_10396267 | |||
| 1490 | Ga0207676_10643291 | |||
| 1491 | Ga0207674_10003276 | |||
| 1492 | Ga0207674_10122383 | |||
| 1493 | Ga0207674_10137935 | |||
| 1494 | Ga0207674_10216189 | |||
| 1495 | Ga0207674_10269120 | |||
| 1496 | Ga0207674_10857443 | |||
| 1497 | Ga0207675_100403066 | |||
| 1498 | Ga0207683_10254829 | |||
| 1499 | Ga0207698_10122159 | |||
| 1500 | Ga0207698_10255129 | |||
| 1501 | Ga0207698_10304494 | |||
| 1502 | Ga0207698_11303199 | |||
| 1503 | Ga0207428_10009737 | |||
| 1504 | Ga0207428_10012767 | |||
| 1505 | Ga0207428_10079298 | |||
| 1506 | Ga0268266_11007485 | |||
| 1507 | Ga0265319_1029856 | |||
| 1508 | Ga0265319_1039330 | |||
| 1509 | Ga0265319_1043375 | |||
| 1510 | Ga0265318_10003761 | |||
| 1511 | Ga0265318_10097709 | |||
| 1512 | Ga0265322_10060524 | |||
| 1513 | Ga0265338_10045788 | |||
| 1514 | Ga0265338_10145737 | |||
| 1515 | Ga0265338_10394954 | |||
| 1516 | Ga0265320_10160639 | |||
| 1517 | Ga0265340_10185333 | |||
| 1518 | Ga0265331_10056389 | |||
| 1519 | Ga0265327_10022085 | |||
| 1520 | Ga0307408_101886865 | |||
| 1521 | Ga0307405_10284744 | |||
| 1522 | Ga0307410_10176923 | |||
| 1523 | Ga0307412_10291911 | |||
| 1524 | Ga0307409_100176900 | |||
| 1525 | Ga0307409_100450419 | |||
| 1526 | Ga0307416_100100631 | |||
| 1527 | Ga0307416_100502379 | |||
| 1528 | Ga0307411_10468061 | |||
| 1529 | Ga0307415_100037965 | |||
| 1530 | Ga0307415_100062191 | |||
| 1531 | Ga0373938_0040398 | |||
| 1532 | Ga0373940_0086838 | |||
| 1533 | Ga0373936_0191139 | |||
| 1534 | Ga0373945_0014109 | |||
| 1535 | Ga0373954_0134317 | |||
| 1536 | Ga0373957_0048124 | |||
| 1537 | Ga0373943_0007385 | |||
| 1538 | Ga0373943_0057666 | |||
| 1539 | Ga0373946_0010186 | |||
| 1540 | Ga0373946_0053165 | |||
| 1541 | Ga0373946_0266046 | |||
| 1542 | Ga0373955_0022659 | |||
| 1543 | Ga0373955_0426795 | |||
| 1544 | Ga0373924_0097993 | |||
| 1545 | Ga0373931_0007846 | |||
| 1546 | Ga0373935_0003843 | |||
| 1547 | Ga0373935_0088079 | |||
| 1548 | Ga0373935_0147731 | |||
| 1549 | Ga0373927_0182347 | |||
| 1550 | Ga0373927_0515955 | |||
| 1551 | Ga0373947_0017632 | |||
| 1552 | Ga0373947_0018309 | |||
| 1553 | Ga0373937_0046394 | |||
| 1554 | Ga0373937_0410772 | |||
| 1555 | Ga0373937_0570721 | |||
| 1556 | Ga0373925_0002318 | |||
| 1557 | Ga0373925_0080148 | |||
| 1558 | Ga0395899_0003162 | |||
| 1559 | Ga0395899_0004845 | |||
| 1560 | Ga0395899_0007797 | |||
| 1561 | Ga0395899_0025379 | |||
| 1562 | Ga0395899_0145793 | |||
| 1563 | Ga0395899_0223208 | |||
| 1564 | Ga0395899_0244535 | |||
| 1565 | Ga0395899_0292532 | |||
| 1566 | Ga0395899_0343078 | |||
| 1567 | Ga0395899_0429466 | |||
| 1568 | Ga0395899_0526105 | |||
| 1569 | Ga0395900_0001640 | |||
| 1570 | Ga0395900_0003536 | |||
| 1571 | Ga0395900_0011339 | |||
| 1572 | Ga0395900_0014823 | |||
| 1573 | Ga0395900_0023113 | |||
| 1574 | Ga0395900_0027999 | |||
| 1575 | Ga0395900_0030855 | |||
| 1576 | Ga0395900_0083765 | |||
| 1577 | Ga0395900_0097722 | |||
| 1578 | Ga0395900_0117694 | |||
| 1579 | Ga0395900_0132440 | |||
| 1580 | Ga0395900_0257926 | |||
| 1581 | Ga0395900_0262216 | |||
| 1582 | Ga0395900_0276217 | |||
| 1583 | Ga0395900_0432957 | |||
| 1584 | Ga0395900_0568923 | |||
| 1585 | Ga0395900_0582845 | |||
| 1586 | Ga0395900_0806097 | |||
| 1587 | Ga0395900_1130053 | |||
| 1588 | Ga0395898_0003534 | |||
| 1589 | Ga0395898_0019282 | |||
| 1590 | Ga0395898_0019851 | |||
| 1591 | Ga0395898_0029685 | |||
| 1592 | Ga0395898_0047928 | |||
| 1593 | Ga0395898_0058471 | |||
| 1594 | Ga0395898_0083015 | |||
| 1595 | Ga0395898_0097904 | |||
| 1596 | Ga0395898_0125066 | |||
| 1597 | Ga0395898_0129495 | |||
| 1598 | Ga0395898_0150134 | |||
| 1599 | Ga0395898_0306945 | |||
| 1600 | Ga0395898_0373382 | |||
| 1601 | Ga0395898_0390625 | |||
| 1602 | Ga0395898_0492775 | |||
| 1603 | Ga0395898_0809495 | |||
| 1604 | Ga0395898_0837631 | |||
| 1605 | Ga0395898_0975986 | |||
| 1606 | Ga0395898_0983422 | |||
| 1607 | Ga0395898_0995180 | |||
| 1608 | Ga0395898_1249463 | |||
| 1609 | Ga0395898_1698890 | |||
| 1610 | Ga0395905_0003269 | |||
| 1611 | Ga0395905_0003392 | |||
| 1612 | Ga0395905_0038107 | |||
| 1613 | Ga0395905_0040105 | |||
| 1614 | Ga0395905_0040306 | |||
| 1615 | Ga0395905_0117981 | |||
| 1616 | Ga0395905_0202542 | |||
| 1617 | Ga0395905_0230933 | |||
| 1618 | Ga0395905_0289069 | |||
| 1619 | Ga0395905_0329046 | |||
| 1620 | Ga0395905_0649200 | |||
| 1621 | Ga0395905_0837641 | |||
| 1622 | Ga0395905_0933621 | |||
| 1623 | Ga0395901_0001841 | |||
| 1624 | Ga0395901_0002272 | |||
| 1625 | Ga0395901_0002650 | |||
| 1626 | Ga0395901_0014199 | |||
| 1627 | Ga0395901_0017797 | |||
| 1628 | Ga0395901_0018324 | |||
| 1629 | Ga0395901_0023342 | |||
| 1630 | Ga0395901_0056090 | |||
| 1631 | Ga0395901_0058107 | |||
| 1632 | Ga0395901_0107083 | |||
| 1633 | Ga0395901_0112838 | |||
| 1634 | Ga0395901_0117408 | |||
| 1635 | Ga0395901_0180390 | |||
| 1636 | Ga0395901_0204796 | |||
| 1637 | Ga0395901_0271614 | |||
| 1638 | Ga0395901_0312790 | |||
| 1639 | Ga0395901_0442277 | |||
| 1640 | Ga0395901_0445645 | |||
| 1641 | Ga0395901_0623347 | |||
| 1642 | Ga0395901_0751358 | |||
| 1643 | Ga0395901_0777830 | |||
| 1644 | Ga0395901_0902465 | |||
| 1645 | Ga0395901_0935868 | |||
| 1646 | Ga0395901_1485072 | |||
| 1647 | Ga0395901_1819720 | |||
| 1648 | Ga0436365_0560760 | |||
| 1649 | Ga0436363_0012856 | |||
| 1650 | Ga0451789_0777155 | |||
| 1651 | Ga0451849_0524342 | |||
| 1652 | Ga0451853_3721867 | |||
| 1653 | Ga0451853_3935337 | |||
| 1654 | Ga0439448_0047021 | |||
| 1655 | Ga0439448_0116487 | |||
| 1656 | Ga0466966_0004360 | |||
| 1657 | Ga0466966_0008955 | |||
| 1658 | Ga0466966_0023852 | |||
| 1659 | Ga0466966_0075341 | |||
| 1660 | Ga0466966_0115287 | |||
| 1661 | Ga0466961_0008109 | |||
| 1662 | Ga0466961_0016839 | |||
| 1663 | Ga0466961_0067875 | |||
| 1664 | Ga0466961_0273967 | |||
| 1665 | Ga0466963_0000095 | |||
| 1666 | Ga0466963_0008069 | |||
| 1667 | Ga0466963_0011499 | |||
| 1668 | Ga0466963_0028626 | |||
| 1669 | Ga0466963_0029189 | |||
| 1670 | Ga0466963_0030330 | |||
| 1671 | Ga0466963_0037276 | |||
| 1672 | Ga0466963_0042093 | |||
| 1673 | Ga0466963_0051935 | |||
| 1674 | Ga0466963_0101970 | |||
| 1675 | Ga0466963_0135942 | |||
| 1676 | Ga0466963_0158759 | |||
| 1677 | Ga0466963_0171082 | |||
| 1678 | Ga0466963_0178564 | |||
| 1679 | Ga0466963_0224269 | |||
| 1680 | Ga0466963_0248512 | |||
| 1681 | Ga0466963_0306751 | |||
| 1682 | Ga0466963_0348454 | |||
| 1683 | Ga0466963_0681771 | |||
| 1684 | Ga0466963_0702819 | |||
| 1685 | Ga0466964_0003701 | |||
| 1686 | Ga0466964_0010305 | |||
| 1687 | Ga0466964_0015210 | |||
| 1688 | Ga0466964_0219819 | |||
| 1689 | Ga0466964_0552876 | |||
| 1690 | Ga0466971_0016904 | |||
| 1691 | Ga0466971_0078349 | |||
| 1692 | Ga0466968_0006491 | |||
| 1693 | Ga0466968_0010769 | |||
| 1694 | Ga0466968_0011853 | |||
| 1695 | Ga0466968_0044769 | |||
| 1696 | Ga0466968_0050752 | |||
| 1697 | Ga0466968_0101534 | |||
| 1698 | Ga0466970_0056897 | |||
| 1699 | Ga0466970_0337445 | |||
| 1700 | Ga0466957_0002974 | |||
| 1701 | Ga0466957_0007579 | |||
| 1702 | Ga0466957_0017807 | |||
| 1703 | Ga0466957_0033943 | |||
| 1704 | Ga0466957_0336303 | |||
| 1705 | Ga0466957_0588191 | |||
| 1706 | Ga0466960_0071892 | |||
| 1707 | Ga0466960_0223136 | |||
| 1708 | Ga0466959_0005223 | |||
| 1709 | Ga0466959_0014268 | |||
| 1710 | Ga0466959_0024314 | |||
| 1711 | Ga0466959_0029877 | |||
| 1712 | Ga0466959_0343357 | |||
| 1713 | Ga0466959_0476347 | |||
| 1714 | Ga0451576_0029648 | |||
| 1715 | Ga0466958_0007167 | |||
| 1716 | Ga0466958_0009418 | |||
| 1717 | Ga0466958_0011855 | |||
| 1718 | Ga0466958_0019375 | |||
| 1719 | Ga0466958_0045754 | |||
| 1720 | Ga0466958_0072191 | |||
| 1721 | Ga0466958_0077821 | |||
| 1722 | Ga0466958_0086108 | |||
| 1723 | Ga0466958_0223610 | |||
| 1724 | Ga0466958_0246864 | |||
| 1725 | Ga0466967_0002678 | |||
| 1726 | Ga0466967_0003018 | |||
| 1727 | Ga0466967_0007451 | |||
| 1728 | Ga0466967_0008435 | |||
| 1729 | Ga0466967_0012913 | |||
| 1730 | Ga0466967_0015896 | |||
| 1731 | Ga0466967_0020790 | |||
| 1732 | Ga0466967_0021061 | |||
| 1733 | Ga0466967_0025255 | |||
| 1734 | Ga0466967_0030792 | |||
| 1735 | Ga0466967_0037568 | |||
| 1736 | Ga0466967_0043946 | |||
| 1737 | Ga0466967_0056030 | |||
| 1738 | Ga0466967_0056509 | |||
| 1739 | Ga0466967_0072469 | |||
| 1740 | Ga0466967_0080098 | |||
| 1741 | Ga0466967_0086500 | |||
| 1742 | Ga0466967_0098860 | |||
| 1743 | Ga0466967_0155024 | |||
| 1744 | Ga0466967_0217489 | |||
| 1745 | Ga0466967_0471196 | |||
| 1746 | Ga0466967_0521829 | |||
| 1747 | Ga0466967_0599075 | |||
| 1748 | Ga0466967_0681788 | |||
| 1749 | Ga0466967_0752482 | |||
| 1750 | Ga0466967_0796253 | |||
| 1751 | Ga0466967_1039083 | |||
| 1752 | Ga0466967_1309933 | |||
| 1753 | Ga0466967_1801861 | |||
| 1754 | Ga0495592_0027375 | |||
| 1755 | Ga0495592_0035705 | |||
| 1756 | Ga0495603_0005193 | |||
| 1757 | Ga0495603_0170669 | |||
| 1758 | Ga0495603_0620590 | |||
| 1759 | Ga0495629_0020948 | |||
| 1760 | Ga0495629_0148369 | |||
| 1761 | Ga0495629_0281642 | |||
| 1762 | Ga0495629_0292700 | |||
| 1763 | Ga0495629_0425119 | |||
| 1764 | Ga0495641_0005435 | |||
| 1765 | Ga0495641_0040762 | |||
| 1766 | Ga0495641_0043444 | |||
| 1767 | Ga0495641_0055399 | |||
| 1768 | Ga0495641_0066497 | |||
| 1769 | Ga0495641_0088610 | |||
| 1770 | Ga0495641_0143265 | |||
| 1771 | Ga0495651_0016426 | |||
| 1772 | Ga0495651_0723444 | |||
| 1773 | Ga0495653_0009654 | |||
| 1774 | Ga0495653_0125920 | |||
| 1775 | Ga0495653_0126855 | |||
| 1776 | Ga0495653_0147014 | |||
| 1777 | Ga0495580_0035292 | |||
| 1778 | Ga0495582_0028580 | |||
| 1779 | Ga0495582_0057903 | |||
| 1780 | Ga0495582_0065794 | |||
| 1781 | Ga0495605_0105621 | |||
| 1782 | Ga0495605_0166512 | |||
| 1783 | Ga0495639_0026021 | |||
| 1784 | Ga0495639_0066100 | |||
| 1785 | Ga0495662_0030188 | |||
| 1786 | Ga0495662_0264637 | |||
| 1787 | Ga0495662_0339395 | |||
| 1788 | Ga0495662_0396865 | |||
| 1789 | Ga0495664_0038850 | |||
| 1790 | Ga0495664_0072644 | |||
| 1791 | Ga0495664_0438648 | |||
| 1792 | Ga0495585_0292796 | |||
| 1793 | Ga0495594_0591401 | |||
| 1794 | Ga0495608_0006652 | |||
| 1795 | Ga0495608_0104873 | |||
| 1796 | Ga0495608_0360484 | |||
| 1797 | Ga0495616_0037436 | |||
| 1798 | Ga0495618_0145624 | |||
| 1799 | Ga0495628_0162747 | |||
| 1800 | Ga0495628_0961850 | |||
| 1801 | Ga0495630_0004280 | |||
| 1802 | Ga0495630_0011832 | |||
| 1803 | Ga0495630_0196422 | |||
| 1804 | Ga0495630_0558752 | |||
| 1805 | Ga0495630_0558803 | |||
| 1806 | Ga0495630_0593157 | |||
| 1807 | Ga0495631_0070998 | |||
| 1808 | Ga0495637_0047484 | |||
| 1809 | Ga0495644_0009809 | |||
| 1810 | Ga0495644_0020525 | |||
| 1811 | Ga0495644_0122359 | |||
| 1812 | Ga0495663_0008292 | |||
| 1813 | Ga0495666_0424299 | |||
| 1814 | Ga0495642_0048785 | |||
| 1815 | Ga0495642_0074858 | |||
| 1816 | Ga0495652_0034234 | |||
| 1817 | Ga0495652_0052975 | |||
| 1818 | Ga0495652_0076047 | |||
| 1819 | Ga0495652_0254959 | |||
| 1820 | Ga0495652_0365454 | |||
| 1821 | Ga0495652_0468747 | |||
| 1822 | Ga0495665_0004858 | |||
| 1823 | Ga0495665_0293796 | |||
| 1824 | Ga0495640_0026151 | |||
| 1825 | Ga0495640_0065747 | |||
| 1826 | Ga0495640_0277394 | |||
| 1827 | Ga0495640_0336851 | |||
| 1828 | Ga0495586_0083531 | |||
| 1829 | Ga0495586_0476871 | |||
| 1830 | Ga0495587_0016542 | |||
| 1831 | Ga0495587_0065990 | |||
| 1832 | Ga0495587_0377947 | |||
| 1833 | Ga0495609_0022728 | |||
| 1834 | Ga0495645_0056256 | |||
| 1835 | Ga0495645_0165391 | |||
| 1836 | Ga0495667_0029836 | |||
| 1837 | Ga0495667_0054717 | |||
| 1838 | Ga0495667_0067561 | |||
| 1839 | Ga0495667_0207401 | |||
| 1840 | Ga0495667_0311485 | |||
| 1841 | Ga0495656_0003250 | |||
| 1842 | Ga0495656_0024202 | |||
| 1843 | Ga0495656_0209845 | |||
| 1844 | Ga0495656_0429408 | |||
| 1845 | Ga0495656_0439916 | |||
| 1846 | Ga0495668_0062123 | |||
| 1847 | Ga0495634_0057539 | |||
| 1848 | Ga0495634_0062957 | |||
| 1849 | Ga0495634_0087685 | |||
| 1850 | Ga0495634_0101245 | |||
| 1851 | Ga0495634_0282036 | |||
| 1852 | Ga0495611_0083262 | |||
| 1853 | Ga0495611_0118349 | |||
| 1854 | Ga0495635_0011900 | |||
| 1855 | Ga0495635_0029948 | |||
| 1856 | Ga0495635_0050628 | |||
| 1857 | Ga0495635_0479215 | |||
| 1858 | Ga0495635_0536263 | |||
| 1859 | Ga0495635_0571063 | |||
| 1860 | Ga0495635_0589517 | |||
| 1861 | Ga0495657_0005166 | |||
| 1862 | Ga0495657_0013766 | |||
| 1863 | Ga0495657_0535420 | |||
| 1864 | Ga0495599_0014803 | |||
| 1865 | Ga0495599_0058776 | |||
| 1866 | Ga0495599_0179970 | |||
| 1867 | Ga0495623_0009860 | |||
| 1868 | Ga0495646_0045703 | |||
| 1869 | Ga0495647_0004336 | |||
| 1870 | Ga0495647_0016354 | |||
| 1871 | Ga0495647_0106068 | |||
| 1872 | Ga0495658_0002872 | |||
| 1873 | Ga0495658_0047629 | |||
| 1874 | Ga0495658_0157646 | |||
| 1875 | Ga0495658_0165125 | |||
| 1876 | Ga0495613_0021823 | |||
| 1877 | Ga0495613_0051296 | |||
| 1878 | Ga0495613_0132438 | |||
| 1879 | Ga0495613_0201701 | |||
| 1880 | Ga0495624_0057267 | |||
| 1881 | Ga0495624_0200574 | |||
| 1882 | Ga0495670_0208706 | |||
| 1883 | Ga0495589_0038852 | |||
| 1884 | Ga0495600_0046445 | |||
| 1885 | Ga0495600_0056126 | |||
| 1886 | Ga0495600_0084751 | |||
| 1887 | Ga0495581_0000505 | |||
| 1888 | Ga0495581_0038759 | |||
| 1889 | Ga0495581_0110012 | |||
| 1890 | Ga0495581_0354633 | |||
| 1891 | Ga0495604_0006659 | |||
| 1892 | Ga0495604_0107011 | |||
| 1893 | Ga0495604_0447809 | |||
| 1894 | Ga0495604_0502504 | |||
| 1895 | Ga0495636_0038751 | |||
| 1896 | Ga0495674_0011878 | |||
| 1897 | Ga0495674_0015466 | |||
| 1898 | Ga0495674_0021386 | |||
| 1899 | Ga0495674_0131801 | |||
| 1900 | Ga0495674_0307263 | |||
| 1901 | Ga0495674_0312627 | |||
| 1902 | Ga0495674_0410248 | |||
| 1903 | Ga0495676_0009864 | |||
| 1904 | Ga0495676_0068497 | |||
| 1905 | Ga0495676_0131440 | |||
| 1906 | Ga0495676_0140485 | |||
| 1907 | Ga0495676_0482453 | |||
| 1908 | Ga0495676_0505593 | |||
| 1909 | Ga0495676_0719522 | |||
| 1910 | Ga0495680_0005532 | |||
| 1911 | Ga0495680_0022217 | |||
| 1912 | Ga0495680_0023897 | |||
| 1913 | Ga0495680_0042745 | |||
| 1914 | Ga0495680_0066240 | |||
| 1915 | Ga0495680_0350577 | |||
| 1916 | Ga0495675_0002014 | |||
| 1917 | Ga0495675_0149268 | |||
| 1918 | Ga0495684_0004528 | |||
| 1919 | Ga0495684_0009628 | |||
| 1920 | Ga0495684_0095741 | |||
| 1921 | Ga0495684_0191363 | |||
| 1922 | Ga0495684_0271229 | |||
| 1923 | Ga0495593_0004729 | |||
| 1924 | Ga0495602_0192523 | |||
| 1925 | Ga0495602_0208742 | |||
| 1926 | Ga0495602_0400929 | |||
| 1927 | Ga0496100_0008560 | |||
| 1928 | Ga0496100_0009080 | |||
| 1929 | Ga0496101_0001024 | |||
| 1930 | Ga0496101_0035886 | |||
| 1931 | Ga0496101_0061970 | |||
| 1932 | Ga0496101_0112226 | |||
| 1933 | Ga0496101_0157292 | |||
| 1934 | Ga0496101_0323111 | |||
| 1935 | Ga0496101_0484527 | |||
| 1936 | Ga0496102_0013068 | |||
| 1937 | Ga0496102_0022488 | |||
| 1938 | Ga0496102_0094431 | |||
| 1939 | Ga0496102_0121116 | |||
| 1940 | Ga0496102_0225966 | |||
| 1941 | Ga0496102_0796499 | |||
| 1942 | Ga0496103_0004988 | |||
| 1943 | Ga0496103_0009793 | |||
| 1944 | Ga0496103_0010423 | |||
| 1945 | Ga0496103_0173891 | |||
| 1946 | Ga0496103_0290804 | |||
| 1947 | Ga0496103_0375431 | |||
| 1948 | Ga0496104_0002338 | |||
| 1949 | Ga0496104_0016855 | |||
| 1950 | Ga0496104_0034005 | |||
| 1951 | Ga0496104_0236072 | |||
| 1952 | Ga0496104_0819664 | |||
| 1953 | Ga0496105_0001042 | |||
| 1954 | Ga0496105_0002856 | |||
| 1955 | Ga0496105_0128886 | |||
| 1956 | Ga0496105_0357352 | |||
| 1957 | Ga0496105_0372799 | |||
| 1958 | Ga0496105_0428153 | |||
| 1959 | Ga0496106_0013216 | |||
| 1960 | Ga0496106_0057285 | |||
| 1961 | Ga0496106_0071687 | |||
| 1962 | Ga0496106_0478655 | |||
| 1963 | Ga0496106_0570484 | |||
| 1964 | Ga0496107_0001734 | |||
| 1965 | Ga0496107_0002291 | |||
| 1966 | Ga0496107_0273087 | |||
| 1967 | Ga0496107_0398035 | |||
| 1968 | Ga0496107_0502277 | |||
| 1969 | Ga0496107_0614025 | |||
| 1970 | Ga0496108_0008931 | |||
| 1971 | Ga0496108_0027191 | |||
| 1972 | Ga0496108_0028356 | |||
| 1973 | Ga0496108_0264196 | |||
| 1974 | Ga0496108_0408869 | |||
| 1975 | Ga0496108_0695135 | |||
| 1976 | Ga0496109_0018533 | |||
| 1977 | Ga0496109_0032272 | |||
| 1978 | Ga0496109_0041024 | |||
| 1979 | Ga0496109_0043230 | |||
| 1980 | Ga0496109_0056706 | |||
| 1981 | Ga0496109_0074982 | |||
| 1982 | Ga0496109_0199773 | |||
| 1983 | Ga0496109_0222834 | |||
| 1984 | Ga0496109_0322967 | |||
| 1985 | Ga0496109_0355118 | |||
| 1986 | Ga0496109_0440861 | |||
| 1987 | Ga0496109_0573132 | |||
| 1988 | Ga0496109_0612723 | |||
| 1989 | Ga0496109_1073613 | |||
| 1990 | Ga0496110_0010243 | |||
| 1991 | Ga0496110_0069790 | |||
| 1992 | Ga0496110_0150910 | |||
| 1993 | Ga0496110_0163347 | |||
| 1994 | Ga0496110_0183011 | |||
| 1995 | Ga0496110_0388111 | |||
| 1996 | Ga0496110_0447940 | |||
| 1997 | Ga0496111_0021275 | |||
| 1998 | Ga0496111_0142501 | |||
| 1999 | Ga0496111_0243921 | |||
| 2000 | Ga0496111_0302603 | |||
| 2001 | Ga0496112_0000635 | |||
| 2002 | Ga0496112_0040922 | |||
| 2003 | Ga0496112_0197701 | |||
| 2004 | Ga0496112_0218477 | |||
| 2005 | Ga0496112_0256769 | |||
| 2006 | Ga0496112_0389948 | |||
| 2007 | Ga0496112_0570341 | |||
| 2008 | Ga0496113_0077332 | |||
| 2009 | Ga0496113_0280871 | |||
| 2010 | Ga0496113_0577503 | |||
| 2011 | Ga0496114_0000892 | |||
| 2012 | Ga0496114_0008778 | |||
| 2013 | Ga0496114_0009938 | |||
| 2014 | Ga0496114_0018394 | |||
| 2015 | Ga0496114_0235057 | |||
| 2016 | Ga0496114_0277674 | |||
| 2017 | Ga0496114_0862023 | |||
| 2018 | Ga0496115_0000701 | |||
| 2019 | Ga0496115_0013798 | |||
| 2020 | Ga0496115_0014516 | |||
| 2021 | Ga0496115_0022567 | |||
| 2022 | Ga0496115_0087109 | |||
| 2023 | Ga0496115_0797104 | |||
| 2024 | Ga0501031_0012388 | |||
| 2025 | Ga0501032_0043883 | |||
| 2026 | Ga0501032_0059046 | |||
| 2027 | Ga0501033_0021378 | |||
| 2028 | Ga0501033_0026858 | |||
| 2029 | Ga0501034_0034567 | |||
| 2030 | Ga0501036_0009096 | |||
| 2031 | Ga0501036_0199588 | |||
| 2032 | Ga0501037_0001731 | |||
| 2033 | Ga0501037_0048511 | |||
| 2034 | Ga0501038_0015616 | |||
| 2035 | Ga0501038_0020426 | |||
| 2036 | Ga0501039_0053012 | |||
| 2037 | Ga0501039_0062951 | |||
| 2038 | Ga0501040_0016677 | |||
| 2039 | Ga0501040_0475713 | |||
| 2040 | Ga0501041_0007506 | |||
| 2041 | Ga0501041_0016523 | |||
| 2042 | Ga0501042_0019636 | |||
| 2043 | Ga0501042_0045197 | |||
| 2044 | Ga0501042_0080671 | |||
| 2045 | Ga0501043_0001696 | |||
| 2046 | Ga0501043_0087251 | |||
| 2047 | Ga0501046_0011144 | |||
| 2048 | Ga0501046_0013699 | |||
| 2049 | Ga0501046_0639456 | |||
| 2050 | Ga0501047_0030877 | |||
| 2051 | Ga0501047_0737549 | |||
| 2052 | Ga0501048_0001796 | |||
| 2053 | Ga0501048_0042581 | |||
| 2054 | Ga0501048_1295328 | |||
| 2055 | Ga0501067_0005193 | |||
| 2056 | Ga0501067_0026909 | |||
| 2057 | Ga0501067_0100339 | |||
| 2058 | Ga0501067_0221180 | |||
| 2059 | Ga0501068_0001541 | |||
| 2060 | Ga0501068_0011481 | |||
| 2061 | Ga0501068_0362784 | |||
| 2062 | Ga0501069_0012964 | |||
| 2063 | Ga0501069_0032961 | |||
| 2064 | Ga0501069_0041060 | |||
| 2065 | Ga0501069_0059252 | |||
| 2066 | Ga0501069_0195433 | |||
| 2067 | Ga0501070_0007108 | |||
| 2068 | Ga0501070_0011141 | |||
| 2069 | Ga0501070_0014542 | |||
| 2070 | Ga0501070_0039570 | |||
| 2071 | Ga0501070_0192198 | |||
| 2072 | Ga0501070_0292216 | |||
| 2073 | Ga0501071_0001183 | |||
| 2074 | Ga0501071_0018706 | |||
| 2075 | Ga0501071_0573458 | |||
| 2076 | Ga0501071_0748823 | |||
| 2077 | Ga0501072_0003411 | |||
| 2078 | Ga0501072_0011384 | |||
| 2079 | Ga0501072_0020756 | |||
| 2080 | Ga0501072_0239786 | |||
| 2081 | Ga0501073_0009280 | |||
| 2082 | Ga0501073_0129586 | |||
| 2083 | Ga0501074_0000859 | |||
| 2084 | Ga0501074_0008458 | |||
| 2085 | Ga0501074_0039598 | |||
| 2086 | Ga0501074_0054359 | |||
| 2087 | Ga0501074_0081022 | |||
| 2088 | Ga0501075_0023721 | |||
| 2089 | Ga0501075_1142177 | |||
| 2090 | Ga0501076_0033954 | |||
| 2091 | Ga0501076_0240320 | |||
| 2092 | Ga0501077_0026488 | |||
| 2093 | Ga0501077_0028800 | |||
| 2094 | Ga0501077_0087590 | |||
| 2095 | Ga0501077_0107627 | |||
| 2096 | Ga0501079_0009336 | |||
| 2097 | Ga0501079_0014711 | |||
| 2098 | Ga0501079_0024949 | |||
| 2099 | Ga0501080_0008532 | |||
| 2100 | Ga0501080_0015795 | |||
| 2101 | Ga0501080_0031199 | |||
| 2102 | Ga0501080_0247896 | |||
| 2103 | Ga0501081_0031502 | |||
| 2104 | Ga0501081_0077331 | |||
| 2105 | Ga0501081_0095898 | |||
| 2106 | Ga0501083_0002114 | |||
| 2107 | Ga0501083_0007136 | |||
| 2108 | Ga0501083_0026409 | |||
| 2109 | Ga0501035_0008865 | |||
| 2110 | Ga0501035_0379749 | |||
| 2111 | Ga0501044_0011094 | |||
| 2112 | Ga0501044_0101841 | |||
| 2113 | Ga0501044_1053588 | |||
| 2114 | Ga0501045_0072285 | |||
| 2115 | Ga0501045_0418753 | |||
| 2116 | nmdc:mga03n38_354518_c1 | |||
| 2117 | nmdc:mga0yw44_660246_c1 | |||
| 2118 | nmdc:mga0yw44_818358_c1 | |||
| 2119 | nmdc:mga05p37_141564_c1 | |||
| 2120 | nmdc:mga05p37_202699_c1 | |||
| 2121 | nmdc:mga09592_323962_c1 | |||
| 2122 | nmdc:mga0qj67_216598_c1 | |||
| 2123 | nmdc:mga0qj67_293319_c1 | |||
| 2124 | nmdc:mga06r32_352063_c1 | |||
| 2125 | nmdc:mga08y16_111271_c1 | |||
| 2126 | nmdc:mga08y16_116643_c1 | |||
| 2127 | nmdc:mga08y16_361421_c1 | |||
| 2128 | nmdc:mga0n895_17051_c1 | |||
| 2129 | nmdc:mga0n895_32525_c1 | |||
| 2130 | nmdc:mga0n895_599025_c1 | |||
| 2131 | nmdc:mga0rr50_118874_c1 | |||
| 2132 | nmdc:mga0rr50_76794_c1 | |||
| 2133 | nmdc:mga08x19_62383_c1 | |||
| 2134 | nmdc:mga0a205_189643_c1 | |||
| 2135 | nmdc:mga0a205_243814_c1 | |||
| 2136 | nmdc:mga0a205_38578_c1 | |||
| 2137 | Ga0495601_0037540 | |||
| 2138 | Ga0495601_0199540 | |||
| 2139 | Ga0495601_0213797 | |||
| 2140 | Ga0495601_0490212 | |||
| 2141 | Ga0495601_0521044 | |||
| 2142 | Ga0495612_0007074 | |||
| 2143 | Ga0495595_0013345 | |||
| 2144 | Ga0495595_0030875 | |||
| 2145 | Ga0495595_0032865 | |||
| 2146 | Ga0495595_0087146 | |||
| 2147 | Ga0495619_0004147 | |||
| 2148 | Ga0495619_0066626 | |||
| 2149 | Ga0495619_0080476 | |||
| 2150 | Ga0495619_0083344 | |||
| 2151 | Ga0495619_0102697 | |||
| 2152 | Ga0495619_0160773 | |||
| 2153 | Ga0495619_0339142 | |||
| 2154 | Ga0495619_0406684 | |||
| 2155 | Ga0495619_0456096 | |||
| 2156 | Ga0500566_0054705 | |||
| 2157 | Ga0501084_0028831 | |||
| 2158 | Ga0501084_0030687 | |||
| 2159 | Ga0501084_0041823 | |||
| 2160 | Ga0501084_0504338 | |||
| 2161 | Ga0501084_0811679 | |||
| 2162 | Ga0590075_070203 | |||
| 2163 | Ga0501082_0011837 | |||
| 2164 | Ga0501082_0055589 | |||
| 2165 | Ga0501082_0378231 | |||
| 2166 | Ga0501082_0836552 | |||
| 2167 | Ga0466962_0000096 | |||
| 2168 | Ga0466962_0001445 | |||
| 2169 | Ga0466962_0086266 | |||
| 2170 | Ga0530510_0003924 | |||
| 2171 | Ga0530510_0047288 | |||
| 2172 | Ga0530510_0082007 | |||
| 2173 | Ga0530510_0155623 | |||
| 2174 | Ga0530510_0365241 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ihc-assembly1.cif.gz_A | x-ray structure of gephyrin n-terminal domain | 0.9759 | 1 | 151 |
| 1o8q-assembly1.cif.gz_A | the active site of the molybdenum cofactor biosenthetic protein domain cnx1g | 0.9615 | 2 | 151 |
| 1o8n-assembly1.cif.gz_C | the active site of the molybdenum cofactor biosynthetic protein domain cnx1g | 0.9603 | 2 | 153 |
| 3mci-assembly1.cif.gz_A | crystal structure of molybdenum cofactor biosynthesis (aq_061) from aquifex aeolicus vf5 | 0.9602 | 3 | 152 |
| 1o8o-assembly1.cif.gz_C | the active site of the molybdenum cofactor biosynthetic protein domain cnx1g | 0.9598 | 2 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8BUV3_1_191_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9791 | 2 | 153 | 3.40.980.10 |
| af_Q39054_458_641_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9675 | 2 | 157 | 3.40.980.10 |
| af_P39205_1_179_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9603 | 1 | 156 | 3.40.980.10 |
| 1o8nC00 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9542 | 2 | 154 | 3.40.980.10 |
| af_A0A1D6DUY2_88_206_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9381 | 1 | 91 | 3.40.980.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3BPQ4-F1-model_v4 | Molybdenum cofactor biosynthesis protein | 0.9894 | 1 | 153 |
GO:0006777
|
| AF-A0A3C1YHM7-F1-model_v4 | Molybdenum cofactor biosynthesis protein | 0.9852 | 3 | 152 |
GO:0006777
|
| AF-A0A1F9MFB7-F1-model_v4 | Molybdenum cofactor biosynthesis protein B | 0.9849 | 2 | 153 |
GO:0006777
|
| AF-A0A7V0IUH9-F1-model_v4 | MogA/MoaB family molybdenum cofactor biosynthesis protein | 0.9837 | 1 | 156 |
GO:0006777
|
| AF-A0A7C7RVC4-F1-model_v4 | deleted | 0.9825 | 1 | 150 |
|