F489799
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1087 | 626 | 2172 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100000411|Ga0068860_10000041148 |
| Length | 334 |
| Sequence | MTLETSLQRTRFTAPDGSGRIAPMIPVRGSGPSMEPSPSLQPSHDDVGPIRLAARDNLRTEPRAVRIAIIAAALSFLGVFVVLPLVLVFAEAFSKGIGAYLAALSDPEALSAIRLTLLVAAVSVSINLVFGLMAAWAIAKFEFSGKTFLTTLIDLPFSVSPVISGLVFVLLFGAQGYWGAWLRDHDIQVLFAVPGIALATTFVTFPFVARALIPLMQEQGTQEEEAAISLGASGLQTFFRVTLPNIKWGVLYGVLLCNARAMGEFGAVSVVSGHIRGETNTMPLLVEILYNEYQFVASFAIASLLAMXXXXTLVAKAFLERHLDEGQQEVSHDH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 88 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 89 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 221 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 222 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 244 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 247 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 248 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 335 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 336 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 379 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 380 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 381 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 382 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 385 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 388 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 389 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 390 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 394 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 395 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 396 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 399 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 401 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 403 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 404 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 407 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 410 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 411 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 412 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 413 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 414 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 415 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 416 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 417 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 418 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 419 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 420 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 421 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 422 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 423 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 424 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 425 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 426 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 427 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 428 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 429 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 430 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 431 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 432 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 433 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 434 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 435 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 436 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 437 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 438 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 439 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 440 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 441 | 2791355199 | |||
| 442 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 443 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 444 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 445 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 446 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 447 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 448 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 449 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 450 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 451 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 452 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 453 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 454 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 455 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 456 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 457 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 458 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 459 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 460 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 461 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 462 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 463 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 464 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 465 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 466 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 467 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 468 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 469 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 470 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 471 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 472 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 473 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 474 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 475 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 476 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 477 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 478 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 479 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 480 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 481 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 482 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 483 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 484 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 485 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 486 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 487 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 488 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 489 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 490 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 491 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 492 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 493 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 494 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 495 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 496 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 497 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 498 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 499 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 500 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 501 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 502 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 503 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 504 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 505 | 2904699407 | |||
| 506 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 507 | 2906610324 | |||
| 508 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 509 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 510 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 511 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 512 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 513 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 514 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 515 | 2922368715 | |||
| 516 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 517 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 518 | 2922425934 | |||
| 519 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 520 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 521 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 522 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 523 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 524 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 525 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 526 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 527 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 528 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 529 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 530 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 531 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 532 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 533 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 534 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 535 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 536 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 537 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 538 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 539 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 540 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 541 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 542 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 543 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 544 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 545 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 546 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 547 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 548 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 549 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 550 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 551 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 552 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 553 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 554 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 555 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 556 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 557 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 558 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 559 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 560 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 561 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 562 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 563 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 564 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 565 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 566 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 567 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 568 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 569 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 570 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 571 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 572 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 573 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 574 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 575 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 576 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 577 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 578 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 579 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 580 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 581 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 582 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 583 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 584 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 585 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 586 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 587 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 588 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 589 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 590 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 591 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 592 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 593 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 594 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 595 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 596 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 597 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 598 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 599 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 600 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 601 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 602 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 603 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 604 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 605 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 606 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 607 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 608 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 609 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 610 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 611 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 612 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 613 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 614 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 615 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 616 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 617 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 618 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 619 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 620 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 621 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 622 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 623 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 624 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 625 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 626 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.31 |
| Metatranscriptomes | 0 |
| Isolates | 19.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.94 |
| Nodule | 15.46 |
| Rhizoplane | 3.68 |
| Rhizosphere | 61.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068860_100000411 | 3300005843 | Bacteria | 55810 |
| 2 | LJQas_1003629 | 3300000549 | Bacteria | 2054 |
| 3 | JGI24740J21852_10010589 | 3300001979 | Bacteria | 3543 |
| 4 | JGI24735J21928_10038218 | 3300002067 | Bacteria | 1406 |
| 5 | JGI24750J21931_1003497 | 3300002070 | Bacteria | 1880 |
| 6 | JGI24744J21845_10006597 | 3300002077 | Bacteria | 2406 |
| 7 | JGI25153J46596_10000600 | 3300003215 | Bacteria | 22036 |
| 8 | JGI25153J46596_10001390 | 3300003215 | Bacteria | 14494 |
| 9 | JGI25153J46596_10002696 | 3300003215 | Bacteria | 10122 |
| 10 | JGI25160J50197_1001415 | 3300003354 | Bacteria | 12018 |
| 11 | JGI25404J52841_10000278 | 3300003659 | Bacteria | 6581 |
| 12 | JGI25404J52841_10009489 | 3300003659 | Bacteria | 2081 |
| 13 | JGI25404J52841_10011990 | 3300003659 | Bacteria | 1874 |
| 14 | Ga0055542_1006533 | 3300003762 | Bacteria | 2481 |
| 15 | Ga0055536_1008613 | 3300003781 | Bacteria | 4352 |
| 16 | Ga0055531_10031132 | 3300003794 | Bacteria | 1774 |
| 17 | Ga0065165_1002667 | 3300005262 | Bacteria | 14412 |
| 18 | Ga0065165_1013580 | 3300005262 | Bacteria | 3227 |
| 19 | Ga0070676_10016539 | 3300005328 | Bacteria | 4080 |
| 20 | Ga0070683_100025289 | 3300005329 | Bacteria | 5330 |
| 21 | Ga0070683_100130359 | 3300005329 | Bacteria | 2379 |
| 22 | Ga0070683_100215018 | 3300005329 | Bacteria | 1827 |
| 23 | Ga0070666_10243708 | 3300005335 | Bacteria | 1271 |
| 24 | Ga0070680_100010901 | 3300005336 | Bacteria | 7023 |
| 25 | Ga0070680_100350873 | 3300005336 | Bacteria | 1255 |
| 26 | Ga0070682_100174131 | 3300005337 | Bacteria | 1498 |
| 27 | Ga0070682_100284830 | 3300005337 | Bacteria | 1206 |
| 28 | Ga0070660_100004981 | 3300005339 | Bacteria | 9181 |
| 29 | Ga0070660_100311084 | 3300005339 | Bacteria | 1293 |
| 30 | Ga0070660_100323793 | 3300005339 | Bacteria | 1267 |
| 31 | Ga0070689_100027366 | 3300005340 | Bacteria | 4298 |
| 32 | Ga0070661_100135531 | 3300005344 | Bacteria | 1853 |
| 33 | Ga0070661_100311839 | 3300005344 | Bacteria | 1227 |
| 34 | Ga0070692_10032810 | 3300005345 | Bacteria | 2614 |
| 35 | Ga0070668_100003914 | 3300005347 | Bacteria | 10999 |
| 36 | Ga0070668_100076766 | 3300005347 | Bacteria | 2610 |
| 37 | Ga0070668_100209627 | 3300005347 | Bacteria | 1602 |
| 38 | Ga0070669_100000033 | 3300005353 | Bacteria | 144544 |
| 39 | Ga0070669_100000387 | 3300005353 | Bacteria | 33852 |
| 40 | Ga0070669_100037707 | 3300005353 | Bacteria | 3507 |
| 41 | Ga0070675_100061546 | 3300005354 | Bacteria | 3099 |
| 42 | Ga0070675_100589391 | 3300005354 | Bacteria | 1008 |
| 43 | Ga0070671_100000012 | 3300005355 | Bacteria | 196420 |
| 44 | Ga0070671_100017669 | 3300005355 | Bacteria | 5780 |
| 45 | Ga0070671_100109525 | 3300005355 | Bacteria | 2320 |
| 46 | Ga0070674_100020257 | 3300005356 | Bacteria | 4244 |
| 47 | Ga0070673_100076660 | 3300005364 | Bacteria | 2700 |
| 48 | Ga0070673_100233740 | 3300005364 | Bacteria | 1595 |
| 49 | Ga0070688_100004706 | 3300005365 | Bacteria | 7127 |
| 50 | Ga0070688_100017655 | 3300005365 | Bacteria | 4099 |
| 51 | Ga0070659_100072567 | 3300005366 | Bacteria | 2739 |
| 52 | Ga0070667_100000279 | 3300005367 | Bacteria | 58238 |
| 53 | Ga0070667_100136017 | 3300005367 | Bacteria | 2149 |
| 54 | Ga0070703_10067958 | 3300005406 | Bacteria | 1183 |
| 55 | Ga0070709_10000375 | 3300005434 | Bacteria | 27523 |
| 56 | Ga0070714_100212996 | 3300005435 | Bacteria | 1772 |
| 57 | Ga0070713_100041867 | 3300005436 | Bacteria | 3735 |
| 58 | Ga0070713_100089707 | 3300005436 | Bacteria | 2641 |
| 59 | Ga0070710_10000275 | 3300005437 | Bacteria | 24270 |
| 60 | Ga0070710_10017525 | 3300005437 | Bacteria | 3667 |
| 61 | Ga0070710_10040067 | 3300005437 | Bacteria | 2581 |
| 62 | Ga0070710_10228597 | 3300005437 | Bacteria | 1187 |
| 63 | Ga0070711_100006414 | 3300005439 | Bacteria | 7094 |
| 64 | Ga0070711_100020739 | 3300005439 | Bacteria | 4240 |
| 65 | Ga0070711_100022239 | 3300005439 | Bacteria | 4107 |
| 66 | Ga0070663_100018265 | 3300005455 | Bacteria | 4593 |
| 67 | Ga0070663_100161988 | 3300005455 | Bacteria | 1722 |
| 68 | Ga0070678_100106912 | 3300005456 | Bacteria | 2181 |
| 69 | Ga0070662_100134192 | 3300005457 | Bacteria | 1912 |
| 70 | Ga0070662_100140170 | 3300005457 | Bacteria | 1873 |
| 71 | Ga0070662_100391421 | 3300005457 | Bacteria | 1145 |
| 72 | Ga0070681_10061629 | 3300005458 | Bacteria | 3725 |
| 73 | Ga0070681_10216576 | 3300005458 | Bacteria | 1831 |
| 74 | Ga0070681_10308969 | 3300005458 | Bacteria | 1490 |
| 75 | Ga0068867_100029064 | 3300005459 | Bacteria | 3982 |
| 76 | Ga0070685_10000001 | 3300005466 | Bacteria | 349867 |
| 77 | Ga0070685_10049514 | 3300005466 | Bacteria | 2424 |
| 78 | Ga0070706_100219916 | 3300005467 | Bacteria | 1773 |
| 79 | Ga0070707_100083474 | 3300005468 | Bacteria | 3087 |
| 80 | Ga0070679_100034040 | 3300005530 | Bacteria | 5047 |
| 81 | Ga0070679_100053135 | 3300005530 | Bacteria | 4033 |
| 82 | Ga0070679_100075094 | 3300005530 | Bacteria | 3371 |
| 83 | Ga0070679_100076591 | 3300005530 | Bacteria | 3334 |
| 84 | Ga0070684_100001508 | 3300005535 | Bacteria | 16819 |
| 85 | Ga0070684_100028072 | 3300005535 | Bacteria | 4757 |
| 86 | Ga0070684_100053196 | 3300005535 | Bacteria | 3523 |
| 87 | Ga0070684_100168155 | 3300005535 | Bacteria | 1991 |
| 88 | Ga0070684_100398277 | 3300005535 | Bacteria | 1269 |
| 89 | Ga0068853_100000629 | 3300005539 | Bacteria | 24248 |
| 90 | Ga0068853_100086846 | 3300005539 | Bacteria | 2744 |
| 91 | Ga0068853_100296802 | 3300005539 | Bacteria | 1493 |
| 92 | Ga0070672_100005802 | 3300005543 | Bacteria | 8236 |
| 93 | Ga0070672_100147354 | 3300005543 | Bacteria | 1945 |
| 94 | Ga0070686_100014547 | 3300005544 | Bacteria | 4539 |
| 95 | Ga0070696_100024651 | 3300005546 | Bacteria | 4089 |
| 96 | Ga0070696_100313661 | 3300005546 | Bacteria | 1205 |
| 97 | Ga0070665_100078792 | 3300005548 | Bacteria | 3301 |
| 98 | Ga0070665_100102324 | 3300005548 | Bacteria | 2868 |
| 99 | Ga0070665_100135855 | 3300005548 | Bacteria | 2462 |
| 100 | Ga0070665_100313579 | 3300005548 | Bacteria | 1572 |
| 101 | Ga0070665_100326537 | 3300005548 | Bacteria | 1538 |
| 102 | Ga0070704_100044331 | 3300005549 | Bacteria | 3090 |
| 103 | Ga0070704_100110635 | 3300005549 | Bacteria | 2089 |
| 104 | Ga0068855_100029638 | 3300005563 | Bacteria | 6541 |
| 105 | Ga0068855_100034408 | 3300005563 | Bacteria | 6043 |
| 106 | Ga0068855_100058404 | 3300005563 | Bacteria | 4518 |
| 107 | Ga0068855_100094463 | 3300005563 | Bacteria | 3448 |
| 108 | Ga0068855_100098198 | 3300005563 | Bacteria | 3374 |
| 109 | Ga0068855_100237342 | 3300005563 | Bacteria | 2038 |
| 110 | Ga0068855_100250279 | 3300005563 | Bacteria | 1977 |
| 111 | Ga0068855_100582204 | 3300005563 | Bacteria | 1209 |
| 112 | Ga0070664_100096036 | 3300005564 | Bacteria | 2571 |
| 113 | Ga0070664_100387472 | 3300005564 | Bacteria | 1277 |
| 114 | Ga0068857_100036777 | 3300005577 | Bacteria | 4338 |
| 115 | Ga0068857_100064583 | 3300005577 | Bacteria | 3255 |
| 116 | Ga0068857_100066950 | 3300005577 | Bacteria | 3196 |
| 117 | Ga0068857_100084387 | 3300005577 | Bacteria | 2838 |
| 118 | Ga0068857_100274189 | 3300005577 | Bacteria | 1551 |
| 119 | Ga0068854_100026612 | 3300005578 | Bacteria | 3977 |
| 120 | Ga0068854_100043105 | 3300005578 | Bacteria | 3196 |
| 121 | Ga0068854_100150904 | 3300005578 | Bacteria | 1792 |
| 122 | Ga0068854_100354045 | 3300005578 | Bacteria | 1202 |
| 123 | Ga0068856_100003776 | 3300005614 | Bacteria | 15173 |
| 124 | Ga0068856_100062045 | 3300005614 | Bacteria | 3692 |
| 125 | Ga0068856_100338831 | 3300005614 | Bacteria | 1522 |
| 126 | Ga0070702_100215099 | 3300005615 | Bacteria | 1282 |
| 127 | Ga0068852_100005759 | 3300005616 | Bacteria | 8896 |
| 128 | Ga0068852_100064924 | 3300005616 | Bacteria | 3183 |
| 129 | Ga0068852_100064930 | 3300005616 | Bacteria | 3183 |
| 130 | Ga0068864_100000018 | 3300005618 | Bacteria | 277365 |
| 131 | Ga0068864_100047366 | 3300005618 | Bacteria | 3692 |
| 132 | Ga0068864_100055374 | 3300005618 | Bacteria | 3424 |
| 133 | Ga0068864_100248805 | 3300005618 | Bacteria | 1649 |
| 134 | Ga0068864_100261239 | 3300005618 | Bacteria | 1611 |
| 135 | Ga0068864_100663065 | 3300005618 | Bacteria | 1017 |
| 136 | Ga0068861_100010209 | 3300005719 | Bacteria | 6517 |
| 137 | Ga0068861_100136558 | 3300005719 | Bacteria | 1996 |
| 138 | Ga0068861_100176343 | 3300005719 | Bacteria | 1775 |
| 139 | Ga0068851_10017462 | 3300005834 | Bacteria | 3446 |
| 140 | Ga0068851_10054937 | 3300005834 | Bacteria | 2029 |
| 141 | Ga0068863_100630285 | 3300005841 | Bacteria | 1062 |
| 142 | Ga0068858_100004448 | 3300005842 | Bacteria | 13737 |
| 143 | Ga0068858_100136821 | 3300005842 | Bacteria | 2299 |
| 144 | Ga0068860_100000456 | 3300005843 | Bacteria | 51397 |
| 145 | Ga0068860_100012696 | 3300005843 | Bacteria | 8287 |
| 146 | Ga0068860_100044144 | 3300005843 | Bacteria | 4249 |
| 147 | Ga0068862_100002580 | 3300005844 | Bacteria | 15999 |
| 148 | Ga0068862_100006134 | 3300005844 | Bacteria | 10004 |
| 149 | Ga0068862_100270297 | 3300005844 | Bacteria | 1554 |
| 150 | Ga0068862_100526453 | 3300005844 | Bacteria | 1126 |
| 151 | Ga0081455_10002674 | 3300005937 | Bacteria | 21063 |
| 152 | Ga0081455_10016366 | 3300005937 | Bacteria | 7162 |
| 153 | Ga0081455_10052651 | 3300005937 | Bacteria | 3483 |
| 154 | Ga0081455_10092032 | 3300005937 | Bacteria | 2455 |
| 155 | Ga0081540_1000128 | 3300005983 | Bacteria | 80512 |
| 156 | Ga0081540_1001275 | 3300005983 | Bacteria | 21968 |
| 157 | Ga0081540_1001299 | 3300005983 | Bacteria | 21824 |
| 158 | Ga0081540_1005588 | 3300005983 | Bacteria | 9363 |
| 159 | Ga0081540_1006389 | 3300005983 | Bacteria | 8593 |
| 160 | Ga0081540_1012898 | 3300005983 | Bacteria | 5466 |
| 161 | Ga0081540_1016667 | 3300005983 | Bacteria | 4584 |
| 162 | Ga0081540_1028615 | 3300005983 | Bacteria | 3125 |
| 163 | Ga0081540_1028764 | 3300005983 | Bacteria | 3113 |
| 164 | Ga0081540_1041487 | 3300005983 | Bacteria | 2385 |
| 165 | Ga0081539_10074173 | 3300005985 | Bacteria | 1813 |
| 166 | Ga0081539_10105926 | 3300005985 | Bacteria | 1424 |
| 167 | Ga0081539_10120167 | 3300005985 | Bacteria | 1306 |
| 168 | Ga0070717_10069615 | 3300006028 | Bacteria | 2931 |
| 169 | Ga0070717_10073105 | 3300006028 | Bacteria | 2865 |
| 170 | Ga0075365_10060955 | 3300006038 | Bacteria | 2518 |
| 171 | Ga0075365_10082394 | 3300006038 | Bacteria | 2181 |
| 172 | Ga0075365_10136170 | 3300006038 | Bacteria | 1702 |
| 173 | Ga0075365_10179433 | 3300006038 | Bacteria | 1480 |
| 174 | Ga0075365_10228216 | 3300006038 | Bacteria | 1307 |
| 175 | Ga0075365_10269441 | 3300006038 | Bacteria | 1198 |
| 176 | Ga0075368_10001639 | 3300006042 | Bacteria | 7182 |
| 177 | Ga0075368_10048310 | 3300006042 | Bacteria | 1686 |
| 178 | Ga0075363_100002809 | 3300006048 | Bacteria | 7231 |
| 179 | Ga0075363_100017335 | 3300006048 | Bacteria | 3570 |
| 180 | Ga0075364_10085142 | 3300006051 | Bacteria | 2093 |
| 181 | Ga0075364_10221940 | 3300006051 | Bacteria | 1283 |
| 182 | Ga0070715_10024687 | 3300006163 | Bacteria | 2372 |
| 183 | Ga0070716_100013938 | 3300006173 | Bacteria | 4109 |
| 184 | Ga0070712_100005151 | 3300006175 | Bacteria | 8089 |
| 185 | Ga0070712_100005941 | 3300006175 | Bacteria | 7546 |
| 186 | Ga0070712_100045559 | 3300006175 | Bacteria | 3029 |
| 187 | Ga0070712_100070842 | 3300006175 | Bacteria | 2493 |
| 188 | Ga0070712_100434960 | 3300006175 | Bacteria | 1090 |
| 189 | Ga0075367_10042532 | 3300006178 | Bacteria | 2659 |
| 190 | Ga0075369_10044924 | 3300006186 | Bacteria | 1898 |
| 191 | Ga0075369_10089752 | 3300006186 | Bacteria | 1370 |
| 192 | Ga0097621_100033964 | 3300006237 | Bacteria | 4066 |
| 193 | Ga0097621_100122673 | 3300006237 | Bacteria | 2206 |
| 194 | Ga0075370_10034039 | 3300006353 | Bacteria | 2855 |
| 195 | Ga0075370_10194632 | 3300006353 | Bacteria | 1195 |
| 196 | Ga0068871_100081737 | 3300006358 | Bacteria | 2677 |
| 197 | Ga0068871_100195541 | 3300006358 | Bacteria | 1744 |
| 198 | Ga0075428_100155620 | 3300006844 | Bacteria | 2483 |
| 199 | Ga0075434_100359271 | 3300006871 | Bacteria | 1477 |
| 200 | Ga0068865_100070580 | 3300006881 | Bacteria | 2475 |
| 201 | Ga0075436_100009187 | 3300006914 | Bacteria | 6763 |
| 202 | Ga0099825_1032482 | 3300006941 | Bacteria | 2112 |
| 203 | Ga0099824_1014728 | 3300006942 | Bacteria | 7661 |
| 204 | Ga0099822_1000031 | 3300006943 | Bacteria | 62575 |
| 205 | Ga0099794_10102171 | 3300007265 | Bacteria | 1431 |
| 206 | Ga0099795_10009109 | 3300007788 | Bacteria | 2865 |
| 207 | Ga0099795_10042026 | 3300007788 | Bacteria | 1630 |
| 208 | Ga0105250_10048076 | 3300009092 | Bacteria | 1711 |
| 209 | Ga0105240_10005310 | 3300009093 | Bacteria | 19223 |
| 210 | Ga0105240_10008157 | 3300009093 | Bacteria | 15019 |
| 211 | Ga0105240_10020584 | 3300009093 | Bacteria | 8793 |
| 212 | Ga0105240_10020686 | 3300009093 | Bacteria | 8768 |
| 213 | Ga0105240_10194470 | 3300009093 | Bacteria | 2383 |
| 214 | Ga0105245_10233172 | 3300009098 | Bacteria | 1781 |
| 215 | Ga0105247_10037262 | 3300009101 | Bacteria | 2967 |
| 216 | Ga0105247_10085391 | 3300009101 | Bacteria | 1996 |
| 217 | Ga0105247_10101322 | 3300009101 | Bacteria | 1841 |
| 218 | Ga0105247_10153131 | 3300009101 | Bacteria | 1521 |
| 219 | Ga0105247_10178817 | 3300009101 | Bacteria | 1414 |
| 220 | Ga0105247_10290054 | 3300009101 | Bacteria | 1131 |
| 221 | Ga0114129_10085137 | 3300009147 | Bacteria | 4386 |
| 222 | Ga0105243_10181929 | 3300009148 | Bacteria | 1829 |
| 223 | Ga0105241_10001771 | 3300009174 | Bacteria | 16387 |
| 224 | Ga0105241_10104105 | 3300009174 | Bacteria | 2261 |
| 225 | Ga0105242_10086402 | 3300009176 | Bacteria | 2632 |
| 226 | Ga0105248_10042837 | 3300009177 | Bacteria | 5076 |
| 227 | Ga0105248_10082009 | 3300009177 | Bacteria | 3626 |
| 228 | Ga0105248_10095178 | 3300009177 | Bacteria | 3353 |
| 229 | Ga0105248_10400059 | 3300009177 | Bacteria | 1546 |
| 230 | Ga0105248_10512173 | 3300009177 | Bacteria | 1353 |
| 231 | Ga0105237_10008184 | 3300009545 | Bacteria | 11357 |
| 232 | Ga0105237_10045694 | 3300009545 | Bacteria | 4406 |
| 233 | Ga0105237_10046343 | 3300009545 | Bacteria | 4373 |
| 234 | Ga0105237_10113822 | 3300009545 | Bacteria | 2697 |
| 235 | Ga0105237_10146340 | 3300009545 | Bacteria | 2357 |
| 236 | Ga0105237_10361717 | 3300009545 | Bacteria | 1455 |
| 237 | Ga0105237_10385688 | 3300009545 | Bacteria | 1406 |
| 238 | Ga0105238_10000517 | 3300009551 | Bacteria | 40562 |
| 239 | Ga0105238_10022670 | 3300009551 | Bacteria | 6399 |
| 240 | Ga0105238_10026980 | 3300009551 | Bacteria | 5854 |
| 241 | Ga0105249_10471740 | 3300009553 | Bacteria | 1296 |
| 242 | Ga0099796_10009283 | 3300010159 | Bacteria | 2656 |
| 243 | Ga0099796_10021895 | 3300010159 | Bacteria | 1976 |
| 244 | Ga0099796_10023122 | 3300010159 | Bacteria | 1937 |
| 245 | Ga0099796_10033766 | 3300010159 | Bacteria | 1686 |
| 246 | Ga0105239_10002648 | 3300010375 | Bacteria | 22602 |
| 247 | Ga0105239_10017924 | 3300010375 | Bacteria | 7829 |
| 248 | Ga0105239_10021488 | 3300010375 | Bacteria | 7115 |
| 249 | Ga0105239_10031806 | 3300010375 | Bacteria | 5798 |
| 250 | Ga0105239_10065141 | 3300010375 | Bacteria | 4002 |
| 251 | Ga0105239_10072205 | 3300010375 | Bacteria | 3794 |
| 252 | Ga0105239_10134890 | 3300010375 | Bacteria | 2748 |
| 253 | Ga0105239_10234595 | 3300010375 | Bacteria | 2059 |
| 254 | Ga0105239_10391969 | 3300010375 | Bacteria | 1571 |
| 255 | Ga0105246_10116136 | 3300011119 | Bacteria | 1975 |
| 256 | Ga0105246_10191791 | 3300011119 | Bacteria | 1582 |
| 257 | Ga0105246_10220229 | 3300011119 | Bacteria | 1487 |
| 258 | Ga0157371_10021936 | 3300013102 | Bacteria | 4687 |
| 259 | Ga0157370_10014532 | 3300013104 | Bacteria | 8047 |
| 260 | Ga0157370_10124641 | 3300013104 | Bacteria | 2405 |
| 261 | Ga0157369_10003506 | 3300013105 | Bacteria | 18636 |
| 262 | Ga0157369_10006970 | 3300013105 | Bacteria | 13030 |
| 263 | Ga0157369_10014315 | 3300013105 | Bacteria | 8959 |
| 264 | Ga0157369_10052523 | 3300013105 | Bacteria | 4409 |
| 265 | Ga0157369_10496025 | 3300013105 | Bacteria | 1263 |
| 266 | Ga0157374_10061178 | 3300013296 | Bacteria | 3526 |
| 267 | Ga0157374_10077659 | 3300013296 | Bacteria | 3143 |
| 268 | Ga0157378_10063588 | 3300013297 | Bacteria | 3297 |
| 269 | Ga0157378_10293822 | 3300013297 | Bacteria | 1570 |
| 270 | Ga0157378_10454106 | 3300013297 | Bacteria | 1272 |
| 271 | Ga0163162_10382877 | 3300013306 | Bacteria | 1540 |
| 272 | Ga0157372_10023555 | 3300013307 | Bacteria | 6676 |
| 273 | Ga0157375_10055632 | 3300013308 | Bacteria | 3902 |
| 274 | Ga0157375_10073375 | 3300013308 | Bacteria | 3441 |
| 275 | Ga0163163_10000069 | 3300014325 | Bacteria | 114043 |
| 276 | Ga0157380_10210285 | 3300014326 | Bacteria | 1733 |
| 277 | Ga0157380_10338602 | 3300014326 | Bacteria | 1402 |
| 278 | Ga0157380_10448403 | 3300014326 | Bacteria | 1238 |
| 279 | Ga0157377_10060818 | 3300014745 | Bacteria | 2157 |
| 280 | Ga0157377_10090470 | 3300014745 | Bacteria | 1806 |
| 281 | Ga0157379_10051655 | 3300014968 | Bacteria | 3671 |
| 282 | Ga0157379_10355752 | 3300014968 | Bacteria | 1341 |
| 283 | Ga0157376_10325225 | 3300014969 | Bacteria | 1463 |
| 284 | Ga0157376_10419511 | 3300014969 | Bacteria | 1298 |
| 285 | Ga0213872_10022702 | 3300021361 | Bacteria | 2888 |
| 286 | Ga0213876_10000477 | 3300021384 | Bacteria | 31939 |
| 287 | Ga0209677_102608 | 3300025253 | Bacteria | 6582 |
| 288 | Ga0209148_1001000 | 3300025254 | Bacteria | 18034 |
| 289 | Ga0209233_1002990 | 3300025261 | Bacteria | 6023 |
| 290 | Ga0209233_1009100 | 3300025261 | Bacteria | 3038 |
| 291 | Ga0209455_1001389 | 3300025272 | Bacteria | 11022 |
| 292 | Ga0209455_1010687 | 3300025272 | Bacteria | 2315 |
| 293 | Ga0209455_1015147 | 3300025272 | Bacteria | 1709 |
| 294 | Ga0209675_1006021 | 3300025291 | Bacteria | 4960 |
| 295 | Ga0209676_1000284 | 3300025292 | Bacteria | 104999 |
| 296 | Ga0209564_1002110 | 3300025295 | Bacteria | 16929 |
| 297 | Ga0209564_1013028 | 3300025295 | Bacteria | 3566 |
| 298 | Ga0209758_1000206 | 3300025297 | Bacteria | 130177 |
| 299 | Ga0209758_1001267 | 3300025297 | Bacteria | 31294 |
| 300 | Ga0209758_1001347 | 3300025297 | Bacteria | 29637 |
| 301 | Ga0209758_1011263 | 3300025297 | Bacteria | 5206 |
| 302 | Ga0209758_1037256 | 3300025297 | Bacteria | 1882 |
| 303 | Ga0209050_1016402 | 3300025298 | Bacteria | 3033 |
| 304 | Ga0207426_1000799 | 3300025302 | Bacteria | 34123 |
| 305 | Ga0207426_1003234 | 3300025302 | Bacteria | 9138 |
| 306 | Ga0207426_1008081 | 3300025302 | Bacteria | 4310 |
| 307 | Ga0207426_1030869 | 3300025302 | Bacteria | 1753 |
| 308 | Ga0209257_1000394 | 3300025304 | Bacteria | 86654 |
| 309 | Ga0209257_1008387 | 3300025304 | Bacteria | 5892 |
| 310 | Ga0209257_1013507 | 3300025304 | Bacteria | 3621 |
| 311 | Ga0207697_10064088 | 3300025315 | Bacteria | 1532 |
| 312 | Ga0207656_10003517 | 3300025321 | Bacteria | 5390 |
| 313 | Ga0207692_10000229 | 3300025898 | Bacteria | 19004 |
| 314 | Ga0207692_10023181 | 3300025898 | Bacteria | 2868 |
| 315 | Ga0207710_10014586 | 3300025900 | Bacteria | 3317 |
| 316 | Ga0207710_10038836 | 3300025900 | Bacteria | 2105 |
| 317 | Ga0207710_10084508 | 3300025900 | Bacteria | 1477 |
| 318 | Ga0207688_10001503 | 3300025901 | Bacteria | 12239 |
| 319 | Ga0207688_10067444 | 3300025901 | Bacteria | 2025 |
| 320 | Ga0207688_10072127 | 3300025901 | Bacteria | 1961 |
| 321 | Ga0207680_10100912 | 3300025903 | Bacteria | 1854 |
| 322 | Ga0207685_10041278 | 3300025905 | Bacteria | 1725 |
| 323 | Ga0207699_10000242 | 3300025906 | Bacteria | 30591 |
| 324 | Ga0207645_10012744 | 3300025907 | Bacteria | 5699 |
| 325 | Ga0207645_10083437 | 3300025907 | Bacteria | 2050 |
| 326 | Ga0207645_10139770 | 3300025907 | Bacteria | 1578 |
| 327 | Ga0207654_10000248 | 3300025911 | Bacteria | 32761 |
| 328 | Ga0207654_10009059 | 3300025911 | Bacteria | 5050 |
| 329 | Ga0207654_10041873 | 3300025911 | Bacteria | 2589 |
| 330 | Ga0207654_10062044 | 3300025911 | Bacteria | 2189 |
| 331 | Ga0207707_10002685 | 3300025912 | Bacteria | 15895 |
| 332 | Ga0207707_10045342 | 3300025912 | Bacteria | 3831 |
| 333 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 334 | Ga0207695_10000343 | 3300025913 | Bacteria | 107739 |
| 335 | Ga0207695_10050510 | 3300025913 | Bacteria | 4374 |
| 336 | Ga0207695_10050929 | 3300025913 | Bacteria | 4352 |
| 337 | Ga0207695_10063575 | 3300025913 | Bacteria | 3804 |
| 338 | Ga0207695_10075958 | 3300025913 | Bacteria | 3417 |
| 339 | Ga0207671_10029138 | 3300025914 | Bacteria | 4124 |
| 340 | Ga0207671_10061668 | 3300025914 | Bacteria | 2783 |
| 341 | Ga0207693_10007398 | 3300025915 | Bacteria | 9032 |
| 342 | Ga0207693_10033852 | 3300025915 | Bacteria | 4031 |
| 343 | Ga0207693_10073908 | 3300025915 | Bacteria | 2669 |
| 344 | Ga0207693_10096274 | 3300025915 | Bacteria | 2320 |
| 345 | Ga0207663_10009571 | 3300025916 | Bacteria | 5126 |
| 346 | Ga0207663_10025694 | 3300025916 | Bacteria | 3408 |
| 347 | Ga0207663_10186331 | 3300025916 | Bacteria | 1486 |
| 348 | Ga0207660_10008346 | 3300025917 | Bacteria | 6698 |
| 349 | Ga0207660_10029917 | 3300025917 | Bacteria | 3741 |
| 350 | Ga0207660_10205430 | 3300025917 | Bacteria | 1540 |
| 351 | Ga0207660_10207998 | 3300025917 | Bacteria | 1531 |
| 352 | Ga0207660_10286956 | 3300025917 | Bacteria | 1308 |
| 353 | Ga0207657_10004349 | 3300025919 | Bacteria | 15004 |
| 354 | Ga0207657_10012048 | 3300025919 | Bacteria | 8553 |
| 355 | Ga0207657_10127903 | 3300025919 | Bacteria | 2085 |
| 356 | Ga0207657_10280914 | 3300025919 | Bacteria | 1322 |
| 357 | Ga0207649_10064731 | 3300025920 | Bacteria | 2312 |
| 358 | Ga0207652_10166910 | 3300025921 | Bacteria | 1974 |
| 359 | Ga0207652_10201178 | 3300025921 | Bacteria | 1792 |
| 360 | Ga0207646_10028422 | 3300025922 | Bacteria | 5091 |
| 361 | Ga0207681_10000011 | 3300025923 | Bacteria | 366878 |
| 362 | Ga0207681_10001220 | 3300025923 | Bacteria | 16562 |
| 363 | Ga0207681_10136657 | 3300025923 | Bacteria | 1820 |
| 364 | Ga0207694_10000136 | 3300025924 | Bacteria | 74908 |
| 365 | Ga0207694_10029183 | 3300025924 | Bacteria | 4207 |
| 366 | Ga0207694_10360648 | 3300025924 | Bacteria | 1204 |
| 367 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 368 | Ga0207659_10046382 | 3300025926 | Bacteria | 3068 |
| 369 | Ga0207687_10065440 | 3300025927 | Bacteria | 2581 |
| 370 | Ga0207700_10168867 | 3300025928 | Bacteria | 1823 |
| 371 | Ga0207700_10301374 | 3300025928 | Bacteria | 1384 |
| 372 | Ga0207664_10124695 | 3300025929 | Bacteria | 2161 |
| 373 | Ga0207644_10000036 | 3300025931 | Bacteria | 128383 |
| 374 | Ga0207644_10114097 | 3300025931 | Bacteria | 2047 |
| 375 | Ga0207690_10118641 | 3300025932 | Bacteria | 1918 |
| 376 | Ga0207690_10345481 | 3300025932 | Bacteria | 1175 |
| 377 | Ga0207706_10002700 | 3300025933 | Bacteria | 17297 |
| 378 | Ga0207706_10247650 | 3300025933 | Bacteria | 1557 |
| 379 | Ga0207709_10174233 | 3300025935 | Bacteria | 1513 |
| 380 | Ga0207669_10057536 | 3300025937 | Bacteria | 2367 |
| 381 | Ga0207665_10004541 | 3300025939 | Bacteria | 9211 |
| 382 | Ga0207665_10081743 | 3300025939 | Bacteria | 2225 |
| 383 | Ga0207691_10002238 | 3300025940 | Bacteria | 18948 |
| 384 | Ga0207691_10097989 | 3300025940 | Bacteria | 2620 |
| 385 | Ga0207691_10192500 | 3300025940 | Bacteria | 1778 |
| 386 | Ga0207691_10329244 | 3300025940 | Bacteria | 1309 |
| 387 | Ga0207711_10000469 | 3300025941 | Bacteria | 41584 |
| 388 | Ga0207689_10012288 | 3300025942 | Bacteria | 7326 |
| 389 | Ga0207661_10000613 | 3300025944 | Bacteria | 22875 |
| 390 | Ga0207661_10053399 | 3300025944 | Bacteria | 3233 |
| 391 | Ga0207661_10173608 | 3300025944 | Bacteria | 1878 |
| 392 | Ga0207679_10133539 | 3300025945 | Bacteria | 1995 |
| 393 | Ga0207667_10018828 | 3300025949 | Bacteria | 7731 |
| 394 | Ga0207667_10084423 | 3300025949 | Bacteria | 3287 |
| 395 | Ga0207667_10174101 | 3300025949 | Bacteria | 2211 |
| 396 | Ga0207667_10377599 | 3300025949 | Bacteria | 1444 |
| 397 | Ga0207712_10062581 | 3300025961 | Bacteria | 2646 |
| 398 | Ga0207668_10021332 | 3300025972 | Bacteria | 4130 |
| 399 | Ga0207668_10111939 | 3300025972 | Bacteria | 2050 |
| 400 | Ga0207668_10117302 | 3300025972 | Bacteria | 2009 |
| 401 | Ga0207668_10292653 | 3300025972 | Bacteria | 1340 |
| 402 | Ga0207668_10421735 | 3300025972 | Bacteria | 1133 |
| 403 | Ga0207640_10080475 | 3300025981 | Bacteria | 2224 |
| 404 | Ga0207640_10138490 | 3300025981 | Bacteria | 1770 |
| 405 | Ga0207658_10000007 | 3300025986 | Bacteria | 329651 |
| 406 | Ga0207658_10101121 | 3300025986 | Bacteria | 2258 |
| 407 | Ga0207677_10130335 | 3300026023 | Bacteria | 1908 |
| 408 | Ga0207703_10036999 | 3300026035 | Bacteria | 3887 |
| 409 | Ga0207639_10056591 | 3300026041 | Bacteria | 3006 |
| 410 | Ga0207639_10277079 | 3300026041 | Bacteria | 1474 |
| 411 | Ga0207678_10045082 | 3300026067 | Bacteria | 3813 |
| 412 | Ga0207678_10079165 | 3300026067 | Bacteria | 2814 |
| 413 | Ga0207678_10162783 | 3300026067 | Bacteria | 1905 |
| 414 | Ga0207678_10198830 | 3300026067 | Bacteria | 1713 |
| 415 | Ga0207678_10237184 | 3300026067 | Bacteria | 1562 |
| 416 | Ga0207708_10088913 | 3300026075 | Bacteria | 2380 |
| 417 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 418 | Ga0207702_10128736 | 3300026078 | Bacteria | 2276 |
| 419 | Ga0207641_10099781 | 3300026088 | Bacteria | 2555 |
| 420 | Ga0207648_10008717 | 3300026089 | Bacteria | 9778 |
| 421 | Ga0207648_10201861 | 3300026089 | Bacteria | 1763 |
| 422 | Ga0207648_10265156 | 3300026089 | Bacteria | 1533 |
| 423 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 424 | Ga0207676_10005493 | 3300026095 | Bacteria | 8974 |
| 425 | Ga0207676_10019688 | 3300026095 | Bacteria | 4928 |
| 426 | Ga0207676_10023076 | 3300026095 | Bacteria | 4584 |
| 427 | Ga0207674_10003449 | 3300026116 | Bacteria | 19336 |
| 428 | Ga0207674_10108458 | 3300026116 | Bacteria | 2753 |
| 429 | Ga0207674_10217126 | 3300026116 | Bacteria | 1861 |
| 430 | Ga0207674_10287903 | 3300026116 | Bacteria | 1591 |
| 431 | Ga0207675_100001986 | 3300026118 | Bacteria | 20396 |
| 432 | Ga0207683_10021982 | 3300026121 | Bacteria | 5472 |
| 433 | Ga0207683_10041690 | 3300026121 | Bacteria | 4009 |
| 434 | Ga0207683_10089991 | 3300026121 | Bacteria | 2732 |
| 435 | Ga0207683_10127715 | 3300026121 | Bacteria | 2286 |
| 436 | Ga0207698_10175307 | 3300026142 | Bacteria | 1893 |
| 437 | Ga0209389_1000039 | 3300027296 | Bacteria | 124545 |
| 438 | Ga0209589_1000025 | 3300027357 | Bacteria | 165546 |
| 439 | Ga0209489_100039 | 3300027361 | Bacteria | 165546 |
| 440 | Ga0209489_100087 | 3300027361 | Bacteria | 124545 |
| 441 | Ga0209700_100043 | 3300027363 | Bacteria | 167890 |
| 442 | Ga0209700_100090 | 3300027363 | Bacteria | 124545 |
| 443 | Ga0207428_10091011 | 3300027907 | Bacteria | 2368 |
| 444 | Ga0268266_10002576 | 3300028379 | Bacteria | 19238 |
| 445 | Ga0268266_10010607 | 3300028379 | Bacteria | 8030 |
| 446 | Ga0268266_10023222 | 3300028379 | Bacteria | 5281 |
| 447 | Ga0268266_10049211 | 3300028379 | Bacteria | 3614 |
| 448 | Ga0268266_10117706 | 3300028379 | Bacteria | 2361 |
| 449 | Ga0268266_10161996 | 3300028379 | Bacteria | 2024 |
| 450 | Ga0268266_10190963 | 3300028379 | Bacteria | 1870 |
| 451 | Ga0268266_10252527 | 3300028379 | Bacteria | 1631 |
| 452 | Ga0268266_10576138 | 3300028379 | Bacteria | 1080 |
| 453 | Ga0268265_10000404 | 3300028380 | Bacteria | 46221 |
| 454 | Ga0268265_10518300 | 3300028380 | Bacteria | 1126 |
| 455 | Ga0268264_10000009 | 3300028381 | Bacteria | 724972 |
| 456 | Ga0268264_10000194 | 3300028381 | Bacteria | 125395 |
| 457 | Ga0268264_10267649 | 3300028381 | Bacteria | 1595 |
| 458 | Ga0265337_1007418 | 3300028556 | Bacteria | 4104 |
| 459 | Ga0265326_10003492 | 3300028558 | Bacteria | 5140 |
| 460 | Ga0265334_10052977 | 3300028573 | Bacteria | 1551 |
| 461 | Ga0265318_10013434 | 3300028577 | Bacteria | 3461 |
| 462 | Ga0265323_10001501 | 3300028653 | Bacteria | 11409 |
| 463 | Ga0265336_10000238 | 3300028666 | Bacteria | 39366 |
| 464 | Ga0307517_10000460 | 3300028786 | Bacteria | 70026 |
| 465 | Ga0307515_10022467 | 3300028794 | Bacteria | 11113 |
| 466 | Ga0265338_10000278 | 3300028800 | Bacteria | 93010 |
| 467 | Ga0265338_10015741 | 3300028800 | Bacteria | 8284 |
| 468 | Ga0265324_10001755 | 3300029957 | Bacteria | 11922 |
| 469 | Ga0307511_10087368 | 3300030521 | Bacteria | 2140 |
| 470 | Ga0265328_10062648 | 3300031239 | Bacteria | 1366 |
| 471 | Ga0265325_10035604 | 3300031241 | Bacteria | 2642 |
| 472 | Ga0265339_10000080 | 3300031249 | Bacteria | 83570 |
| 473 | Ga0265331_10062111 | 3300031250 | Bacteria | 1763 |
| 474 | Ga0265327_10133407 | 3300031251 | Bacteria | 1166 |
| 475 | Ga0307513_10108928 | 3300031456 | Bacteria | 2769 |
| 476 | Ga0307509_10046806 | 3300031507 | Bacteria | 4654 |
| 477 | Ga0265313_10000948 | 3300031595 | Bacteria | 28784 |
| 478 | Ga0307508_10009068 | 3300031616 | Bacteria | 9164 |
| 479 | Ga0307508_10072172 | 3300031616 | Bacteria | 3026 |
| 480 | Ga0307508_10117091 | 3300031616 | Bacteria | 2266 |
| 481 | Ga0307508_10138745 | 3300031616 | Bacteria | 2035 |
| 482 | Ga0316576_10039580 | 3300031727 | Bacteria | 3385 |
| 483 | Ga0307516_10020275 | 3300031730 | Bacteria | 6870 |
| 484 | Ga0307516_10024100 | 3300031730 | Bacteria | 6220 |
| 485 | Ga0307516_10097455 | 3300031730 | Bacteria | 2760 |
| 486 | Ga0307413_10260066 | 3300031824 | Bacteria | 1293 |
| 487 | Ga0307507_10094534 | 3300033179 | Bacteria | 2540 |
| 488 | Ga0307510_10003787 | 3300033180 | Bacteria | 17693 |
| 489 | Ga0307510_10015985 | 3300033180 | Bacteria | 8867 |
| 490 | Ga0307510_10034065 | 3300033180 | Bacteria | 5709 |
| 491 | Ga0307510_10034602 | 3300033180 | Bacteria | 5655 |
| 492 | Ga0373934_0040432 | 3300035086 | Bacteria | 1839 |
| 493 | Ga0373934_0084520 | 3300035086 | Bacteria | 1277 |
| 494 | Ga0373923_0003366 | 3300035111 | Bacteria | 5114 |
| 495 | Ga0373936_0032224 | 3300035113 | Bacteria | 2072 |
| 496 | Ga0373954_0003572 | 3300035118 | Bacteria | 6607 |
| 497 | Ga0373943_0110063 | 3300035170 | Bacteria | 1452 |
| 498 | Ga0373946_0027530 | 3300035171 | Bacteria | 2249 |
| 499 | Ga0373924_0007531 | 3300035410 | Bacteria | 3934 |
| 500 | Ga0373931_0019668 | 3300035691 | Bacteria | 3372 |
| 501 | Ga0373935_0000718 | 3300035692 | Bacteria | 17605 |
| 502 | Ga0373927_0000666 | 3300035695 | Bacteria | 26107 |
| 503 | Ga0373927_0028210 | 3300035695 | Bacteria | 3662 |
| 504 | Ga0373927_0055244 | 3300035695 | Bacteria | 2568 |
| 505 | Ga0373927_0083230 | 3300035695 | Bacteria | 2074 |
| 506 | Ga0373927_0116554 | 3300035695 | Bacteria | 1742 |
| 507 | Ga0373933_0016974 | 3300035724 | Bacteria | 4080 |
| 508 | Ga0373947_0004761 | 3300035725 | Bacteria | 7952 |
| 509 | Ga0373947_0007585 | 3300035725 | Bacteria | 6278 |
| 510 | Ga0373937_0351720 | 3300036401 | Bacteria | 1396 |
| 511 | Ga0373925_0005280 | 3300037068 | Bacteria | 9642 |
| 512 | Ga0373925_0017463 | 3300037068 | Bacteria | 5201 |
| 513 | Ga0373925_0108934 | 3300037068 | Bacteria | 2138 |
| 514 | Ga0373925_0116855 | 3300037068 | Bacteria | 2067 |
| 515 | Ga0395899_0139018 | 3300037312 | Bacteria | 1729 |
| 516 | Ga0395900_0001340 | 3300037418 | Bacteria | 29756 |
| 517 | Ga0395900_0040887 | 3300037418 | Bacteria | 4779 |
| 518 | Ga0395900_0062560 | 3300037418 | Bacteria | 3826 |
| 519 | Ga0395900_0215928 | 3300037418 | Bacteria | 1935 |
| 520 | Ga0395898_0005324 | 3300037466 | Bacteria | 13909 |
| 521 | Ga0395898_0018293 | 3300037466 | Bacteria | 7145 |
| 522 | Ga0395905_0006516 | 3300037471 | Bacteria | 11740 |
| 523 | Ga0395905_0393524 | 3300037471 | Bacteria | 1280 |
| 524 | Ga0395901_0007542 | 3300038443 | Bacteria | 10989 |
| 525 | Ga0395901_0043404 | 3300038443 | Bacteria | 4664 |
| 526 | Ga0395901_0070968 | 3300038443 | Bacteria | 3629 |
| 527 | Ga0395901_0106088 | 3300038443 | Bacteria | 2949 |
| 528 | Ga0395901_0278347 | 3300038443 | Bacteria | 1739 |
| 529 | Ga0436365_0009505 | 3300039437 | Bacteria | 114283 |
| 530 | Ga0436365_0646338 | 3300039437 | Bacteria | 1288 |
| 531 | Ga0436365_1302408 | 3300039437 | Bacteria | 3201 |
| 532 | Ga0436362_0825075 | 3300039453 | Bacteria | 1455 |
| 533 | Ga0451837_0551018 | 3300041494 | Bacteria | 914 |
| 534 | Ga0439458_0010422 | 3300042157 | Bacteria | 2072 |
| 535 | Ga0451577_0002389 | 3300042876 | Bacteria | 22482 |
| 536 | Ga0453683_0008359 | 3300044673 | Bacteria | 6949 |
| 537 | Ga0453684_0002985 | 3300044712 | Bacteria | 39370 |
| 538 | Ga0453684_0004556 | 3300044712 | Bacteria | 29006 |
| 539 | Ga0453684_0029755 | 3300044712 | Bacteria | 7740 |
| 540 | Ga0453684_0434711 | 3300044712 | Bacteria | 1463 |
| 541 | Ga0466957_0024632 | 3300044842 | Bacteria | 3563 |
| 542 | Ga0466959_0065671 | 3300045049 | Bacteria | 2633 |
| 543 | Ga0451576_0181107 | 3300045051 | Bacteria | 2200 |
| 544 | Ga0451576_0551541 | 3300045051 | Bacteria | 1211 |
| 545 | Ga0466967_0113558 | 3300045976 | Bacteria | 2492 |
| 546 | Ga0466967_0127095 | 3300045976 | Bacteria | 2362 |
| 547 | Ga0495592_0034591 | 3300046454 | Bacteria | 3809 |
| 548 | Ga0495592_0142153 | 3300046454 | Bacteria | 1668 |
| 549 | Ga0495603_0000206 | 3300046455 | Bacteria | 30433 |
| 550 | Ga0495603_0069469 | 3300046455 | Bacteria | 2072 |
| 551 | Ga0495603_0146188 | 3300046455 | Bacteria | 1374 |
| 552 | Ga0495629_0000338 | 3300046459 | Bacteria | 40007 |
| 553 | Ga0495638_0003637 | 3300046460 | Bacteria | 12027 |
| 554 | Ga0495641_0005602 | 3300046461 | Bacteria | 8407 |
| 555 | Ga0495653_0183846 | 3300046463 | Bacteria | 1432 |
| 556 | Ga0495650_0048142 | 3300046471 | Bacteria | 1779 |
| 557 | Ga0495580_0003372 | 3300046472 | Bacteria | 13653 |
| 558 | Ga0495582_0000423 | 3300046473 | Bacteria | 23085 |
| 559 | Ga0495582_0034111 | 3300046473 | Bacteria | 2798 |
| 560 | Ga0495605_0034758 | 3300046474 | Bacteria | 2551 |
| 561 | Ga0495639_0000039 | 3300046475 | Bacteria | 57380 |
| 562 | Ga0495639_0026043 | 3300046475 | Bacteria | 2583 |
| 563 | Ga0495664_0000847 | 3300046477 | Bacteria | 15732 |
| 564 | Ga0495664_0009313 | 3300046477 | Bacteria | 5491 |
| 565 | Ga0495664_0082926 | 3300046477 | Bacteria | 1923 |
| 566 | Ga0495584_0054927 | 3300046491 | Bacteria | 2004 |
| 567 | Ga0495585_0058241 | 3300046492 | Bacteria | 2131 |
| 568 | Ga0495594_0006677 | 3300046499 | Bacteria | 5937 |
| 569 | Ga0495594_0122324 | 3300046499 | Bacteria | 1471 |
| 570 | Ga0495606_0001194 | 3300046507 | Bacteria | 36568 |
| 571 | Ga0495606_0036283 | 3300046507 | Bacteria | 3359 |
| 572 | Ga0495606_0073803 | 3300046507 | Bacteria | 2139 |
| 573 | Ga0495610_0109050 | 3300046512 | Bacteria | 1229 |
| 574 | Ga0495618_0003604 | 3300046514 | Bacteria | 9601 |
| 575 | Ga0495628_0048999 | 3300046516 | Bacteria | 3346 |
| 576 | Ga0495630_0024274 | 3300046517 | Bacteria | 4484 |
| 577 | Ga0495630_0132772 | 3300046517 | Bacteria | 1891 |
| 578 | Ga0495643_0008839 | 3300046522 | Bacteria | 6342 |
| 579 | Ga0495644_0043687 | 3300046523 | Bacteria | 1686 |
| 580 | Ga0495644_0044816 | 3300046523 | Bacteria | 1664 |
| 581 | Ga0495648_0000536 | 3300046524 | Bacteria | 40969 |
| 582 | Ga0495648_0012759 | 3300046524 | Bacteria | 6242 |
| 583 | Ga0495663_0052662 | 3300046525 | Bacteria | 1264 |
| 584 | Ga0495666_0007417 | 3300046526 | Bacteria | 5498 |
| 585 | Ga0495652_0085687 | 3300046529 | Bacteria | 2588 |
| 586 | Ga0495652_0113761 | 3300046529 | Bacteria | 2172 |
| 587 | Ga0495665_0000082 | 3300046531 | Bacteria | 41861 |
| 588 | Ga0495665_0084964 | 3300046531 | Bacteria | 1663 |
| 589 | Ga0495640_0177856 | 3300046533 | Bacteria | 1357 |
| 590 | Ga0495609_0077069 | 3300046538 | Bacteria | 1460 |
| 591 | Ga0495645_0017895 | 3300046543 | Bacteria | 5085 |
| 592 | Ga0495622_0011857 | 3300046557 | Bacteria | 4030 |
| 593 | Ga0495622_0024190 | 3300046557 | Bacteria | 2836 |
| 594 | Ga0495633_0015568 | 3300046558 | Bacteria | 3943 |
| 595 | Ga0495667_0043015 | 3300046559 | Bacteria | 2994 |
| 596 | Ga0495656_0007521 | 3300046615 | Bacteria | 3852 |
| 597 | Ga0495656_0074139 | 3300046615 | Bacteria | 1519 |
| 598 | Ga0495668_0116184 | 3300046616 | Bacteria | 1463 |
| 599 | Ga0495634_0000776 | 3300046642 | Bacteria | 30917 |
| 600 | Ga0495635_0009338 | 3300046663 | Bacteria | 6855 |
| 601 | Ga0495659_0002499 | 3300046664 | Bacteria | 5935 |
| 602 | Ga0495588_0033674 | 3300046674 | Bacteria | 2588 |
| 603 | Ga0495657_0025940 | 3300046675 | Bacteria | 4157 |
| 604 | Ga0495599_0012128 | 3300046678 | Bacteria | 5306 |
| 605 | Ga0495623_0149613 | 3300046679 | Bacteria | 1381 |
| 606 | Ga0495646_0137791 | 3300046680 | Bacteria | 1367 |
| 607 | Ga0495658_0003324 | 3300046683 | Bacteria | 7978 |
| 608 | Ga0495658_0004531 | 3300046683 | Bacteria | 6830 |
| 609 | Ga0495669_0031299 | 3300046684 | Bacteria | 2336 |
| 610 | Ga0495613_0016376 | 3300046689 | Bacteria | 5524 |
| 611 | Ga0495624_0159753 | 3300046690 | Bacteria | 1377 |
| 612 | Ga0495624_0165888 | 3300046690 | Bacteria | 1348 |
| 613 | Ga0495624_0209447 | 3300046690 | Bacteria | 1183 |
| 614 | Ga0495670_0068221 | 3300046691 | Bacteria | 1796 |
| 615 | Ga0495649_0111470 | 3300046694 | Bacteria | 1451 |
| 616 | Ga0495589_0202372 | 3300046794 | Bacteria | 937 |
| 617 | Ga0495600_0100275 | 3300046809 | Bacteria | 1887 |
| 618 | Ga0495581_0000006 | 3300047315 | Bacteria | 77433 |
| 619 | Ga0495581_0010765 | 3300047315 | Bacteria | 5290 |
| 620 | Ga0495604_0005606 | 3300047317 | Bacteria | 9957 |
| 621 | Ga0495604_0102161 | 3300047317 | Bacteria | 2105 |
| 622 | Ga0495636_0014126 | 3300047318 | Bacteria | 3175 |
| 623 | Ga0495674_0012193 | 3300047319 | Bacteria | 8099 |
| 624 | Ga0495672_0008439 | 3300047320 | Bacteria | 7604 |
| 625 | Ga0495672_0037381 | 3300047320 | Bacteria | 2971 |
| 626 | Ga0495680_0005494 | 3300047322 | Bacteria | 11908 |
| 627 | Ga0495683_0132631 | 3300047323 | Bacteria | 1173 |
| 628 | Ga0495675_0002994 | 3300047444 | Bacteria | 10142 |
| 629 | Ga0495684_0001984 | 3300047471 | Bacteria | 16445 |
| 630 | Ga0495684_0050956 | 3300047471 | Bacteria | 3160 |
| 631 | Ga0495684_0109343 | 3300047471 | Bacteria | 2088 |
| 632 | Ga0495593_0000032 | 3300047673 | Bacteria | 58862 |
| 633 | Ga0495602_0039658 | 3300048088 | Bacteria | 4333 |
| 634 | Ga0495614_0014894 | 3300048089 | Bacteria | 3397 |
| 635 | Ga0496100_0018954 | 3300048903 | Bacteria | 4096 |
| 636 | Ga0496101_0015301 | 3300048904 | Bacteria | 5167 |
| 637 | Ga0496101_0151395 | 3300048904 | Bacteria | 1775 |
| 638 | Ga0496101_0155163 | 3300048904 | Bacteria | 1753 |
| 639 | Ga0496101_0174929 | 3300048904 | Bacteria | 1651 |
| 640 | Ga0496102_0019308 | 3300048905 | Bacteria | 6005 |
| 641 | Ga0496102_0334042 | 3300048905 | Bacteria | 1427 |
| 642 | Ga0496103_0039846 | 3300048906 | Bacteria | 2887 |
| 643 | Ga0496104_0031856 | 3300048907 | Bacteria | 4905 |
| 644 | Ga0496104_0032721 | 3300048907 | Bacteria | 4840 |
| 645 | Ga0496104_0173868 | 3300048907 | Bacteria | 2064 |
| 646 | Ga0496104_0178162 | 3300048907 | Bacteria | 2036 |
| 647 | Ga0496105_0059106 | 3300048908 | Bacteria | 3163 |
| 648 | Ga0496106_0002364 | 3300048909 | Bacteria | 14037 |
| 649 | Ga0496106_0020140 | 3300048909 | Bacteria | 4948 |
| 650 | Ga0496106_0039179 | 3300048909 | Bacteria | 3549 |
| 651 | Ga0496106_0158596 | 3300048909 | Bacteria | 1788 |
| 652 | Ga0496106_0194625 | 3300048909 | Bacteria | 1612 |
| 653 | Ga0496108_0020520 | 3300048911 | Bacteria | 5432 |
| 654 | Ga0496108_0261238 | 3300048911 | Bacteria | 1507 |
| 655 | Ga0496109_0088902 | 3300048912 | Bacteria | 2855 |
| 656 | Ga0496109_0412342 | 3300048912 | Bacteria | 1276 |
| 657 | Ga0496110_0554298 | 3300048913 | Bacteria | 1044 |
| 658 | Ga0496111_0016061 | 3300048914 | Bacteria | 5153 |
| 659 | Ga0496111_0021658 | 3300048914 | Bacteria | 4492 |
| 660 | Ga0496111_0139669 | 3300048914 | Bacteria | 1795 |
| 661 | Ga0496111_0452783 | 3300048914 | Bacteria | 947 |
| 662 | Ga0496112_0000029 | 3300048915 | Bacteria | 122291 |
| 663 | Ga0496112_0108628 | 3300048915 | Bacteria | 2744 |
| 664 | Ga0496112_0440467 | 3300048915 | Bacteria | 1241 |
| 665 | Ga0496113_0060918 | 3300048916 | Bacteria | 2846 |
| 666 | Ga0496113_0068963 | 3300048916 | Bacteria | 2684 |
| 667 | Ga0496113_0116139 | 3300048916 | Bacteria | 2088 |
| 668 | Ga0496114_0042973 | 3300048917 | Bacteria | 3747 |
| 669 | Ga0496114_0056894 | 3300048917 | Bacteria | 3265 |
| 670 | Ga0496114_0269007 | 3300048917 | Bacteria | 1501 |
| 671 | Ga0496114_0527816 | 3300048917 | Bacteria | 1044 |
| 672 | Ga0496115_0006927 | 3300048918 | Bacteria | 8327 |
| 673 | Ga0496115_0052564 | 3300048918 | Bacteria | 3269 |
| 674 | Ga0496117_0016836 | 3300048920 | Bacteria | 6142 |
| 675 | Ga0496118_0002319 | 3300048921 | Bacteria | 25849 |
| 676 | Ga0496118_0032776 | 3300048921 | Bacteria | 4272 |
| 677 | Ga0496120_0022972 | 3300048923 | Bacteria | 3911 |
| 678 | Ga0496121_0000352 | 3300048924 | Bacteria | 95800 |
| 679 | Ga0496121_0003091 | 3300048924 | Bacteria | 24094 |
| 680 | Ga0496121_0018747 | 3300048924 | Bacteria | 6957 |
| 681 | Ga0496121_0019666 | 3300048924 | Bacteria | 6739 |
| 682 | Ga0496121_0085513 | 3300048924 | Bacteria | 2482 |
| 683 | Ga0496121_0091056 | 3300048924 | Bacteria | 2382 |
| 684 | Ga0496121_0120703 | 3300048924 | Bacteria | 1980 |
| 685 | Ga0496121_0158117 | 3300048924 | Bacteria | 1660 |
| 686 | Ga0496124_0001443 | 3300048927 | Bacteria | 35124 |
| 687 | Ga0496124_0054966 | 3300048927 | Bacteria | 3367 |
| 688 | Ga0496124_0107167 | 3300048927 | Bacteria | 2255 |
| 689 | Ga0496125_0008186 | 3300048928 | Bacteria | 11004 |
| 690 | Ga0496125_0026403 | 3300048928 | Bacteria | 5293 |
| 691 | Ga0496125_0029894 | 3300048928 | Bacteria | 4885 |
| 692 | Ga0496126_0003276 | 3300048929 | Bacteria | 20656 |
| 693 | Ga0496126_0005702 | 3300048929 | Bacteria | 14109 |
| 694 | Ga0496126_0013048 | 3300048929 | Bacteria | 8479 |
| 695 | Ga0496126_0014279 | 3300048929 | Bacteria | 8036 |
| 696 | Ga0496126_0016514 | 3300048929 | Bacteria | 7378 |
| 697 | Ga0496126_0042845 | 3300048929 | Bacteria | 4178 |
| 698 | Ga0496126_0051752 | 3300048929 | Bacteria | 3737 |
| 699 | Ga0496126_0065029 | 3300048929 | Bacteria | 3265 |
| 700 | Ga0496126_0206382 | 3300048929 | Bacteria | 1656 |
| 701 | Ga0501031_0002569 | 3300049568 | Bacteria | 11569 |
| 702 | Ga0501031_0008055 | 3300049568 | Bacteria | 6862 |
| 703 | Ga0501032_0000301 | 3300049569 | Bacteria | 41571 |
| 704 | Ga0501032_0005845 | 3300049569 | Bacteria | 9101 |
| 705 | Ga0501032_0017725 | 3300049569 | Bacteria | 4999 |
| 706 | Ga0501032_0030565 | 3300049569 | Bacteria | 3696 |
| 707 | Ga0501032_0097679 | 3300049569 | Bacteria | 1946 |
| 708 | Ga0501032_0282915 | 3300049569 | Bacteria | 1074 |
| 709 | Ga0501033_0000270 | 3300049570 | Bacteria | 50079 |
| 710 | Ga0501033_0001377 | 3300049570 | Bacteria | 21662 |
| 711 | Ga0501033_0010053 | 3300049570 | Bacteria | 7264 |
| 712 | Ga0501033_0080248 | 3300049570 | Bacteria | 2394 |
| 713 | Ga0501034_0000715 | 3300049571 | Bacteria | 50444 |
| 714 | Ga0501034_0030327 | 3300049571 | Bacteria | 5497 |
| 715 | Ga0501036_0000043 | 3300049572 | Bacteria | 79310 |
| 716 | Ga0501036_0000128 | 3300049572 | Bacteria | 48330 |
| 717 | Ga0501036_0006458 | 3300049572 | Bacteria | 9524 |
| 718 | Ga0501036_0007332 | 3300049572 | Bacteria | 8983 |
| 719 | Ga0501036_0063189 | 3300049572 | Bacteria | 3135 |
| 720 | Ga0501037_0000040 | 3300049573 | Bacteria | 119364 |
| 721 | Ga0501037_0006378 | 3300049573 | Bacteria | 8627 |
| 722 | Ga0501037_0006531 | 3300049573 | Bacteria | 8534 |
| 723 | Ga0501037_0009276 | 3300049573 | Bacteria | 7215 |
| 724 | Ga0501037_0051620 | 3300049573 | Bacteria | 3007 |
| 725 | Ga0501037_0097398 | 3300049573 | Bacteria | 2125 |
| 726 | Ga0501037_0247706 | 3300049573 | Bacteria | 1247 |
| 727 | Ga0501038_0000131 | 3300049574 | Bacteria | 63880 |
| 728 | Ga0501038_0000630 | 3300049574 | Bacteria | 31329 |
| 729 | Ga0501038_0038383 | 3300049574 | Bacteria | 4194 |
| 730 | Ga0501038_0198446 | 3300049574 | Bacteria | 1611 |
| 731 | Ga0501039_0000106 | 3300049575 | Bacteria | 56453 |
| 732 | Ga0501039_0006604 | 3300049575 | Bacteria | 8807 |
| 733 | Ga0501039_0096394 | 3300049575 | Bacteria | 2306 |
| 734 | Ga0501040_0068247 | 3300049576 | Bacteria | 2452 |
| 735 | Ga0501041_0018507 | 3300049577 | Bacteria | 4150 |
| 736 | Ga0501042_0159404 | 3300049578 | Bacteria | 1628 |
| 737 | Ga0501042_0170445 | 3300049578 | Bacteria | 1570 |
| 738 | Ga0501043_0000074 | 3300049579 | Bacteria | 87396 |
| 739 | Ga0501043_0005735 | 3300049579 | Bacteria | 10004 |
| 740 | Ga0501043_0036399 | 3300049579 | Bacteria | 3871 |
| 741 | Ga0501046_0000074 | 3300049580 | Bacteria | 104319 |
| 742 | Ga0501046_0005024 | 3300049580 | Bacteria | 11874 |
| 743 | Ga0501046_0013483 | 3300049580 | Bacteria | 6919 |
| 744 | Ga0501046_0014460 | 3300049580 | Bacteria | 6658 |
| 745 | Ga0501047_0000346 | 3300049581 | Bacteria | 52545 |
| 746 | Ga0501047_0020019 | 3300049581 | Bacteria | 6425 |
| 747 | Ga0501047_0057626 | 3300049581 | Bacteria | 3756 |
| 748 | Ga0501047_0078407 | 3300049581 | Bacteria | 3176 |
| 749 | Ga0501048_0000349 | 3300049582 | Bacteria | 31934 |
| 750 | Ga0501048_0000550 | 3300049582 | Bacteria | 26481 |
| 751 | Ga0501048_0009855 | 3300049582 | Bacteria | 7163 |
| 752 | Ga0501067_0007707 | 3300049583 | Bacteria | 5988 |
| 753 | Ga0501067_0037192 | 3300049583 | Bacteria | 2704 |
| 754 | Ga0501067_0118106 | 3300049583 | Bacteria | 1475 |
| 755 | Ga0501068_0006614 | 3300049584 | Bacteria | 6397 |
| 756 | Ga0501068_0021802 | 3300049584 | Bacteria | 3743 |
| 757 | Ga0501068_0071766 | 3300049584 | Bacteria | 2114 |
| 758 | Ga0501069_0003736 | 3300049585 | Bacteria | 7821 |
| 759 | Ga0501069_0003813 | 3300049585 | Bacteria | 7756 |
| 760 | Ga0501070_0005383 | 3300049586 | Bacteria | 10920 |
| 761 | Ga0501070_0022234 | 3300049586 | Bacteria | 5312 |
| 762 | Ga0501070_0046564 | 3300049586 | Bacteria | 3606 |
| 763 | Ga0501070_0068726 | 3300049586 | Bacteria | 2933 |
| 764 | Ga0501071_0220347 | 3300049587 | Bacteria | 1428 |
| 765 | Ga0501072_0001372 | 3300049588 | Bacteria | 18281 |
| 766 | Ga0501072_0002038 | 3300049588 | Bacteria | 15051 |
| 767 | Ga0501073_0000085 | 3300049589 | Bacteria | 59315 |
| 768 | Ga0501073_0004871 | 3300049589 | Bacteria | 10076 |
| 769 | Ga0501073_0026762 | 3300049589 | Bacteria | 4130 |
| 770 | Ga0501074_0000145 | 3300049590 | Bacteria | 36757 |
| 771 | Ga0501074_0159786 | 3300049590 | Bacteria | 1609 |
| 772 | Ga0501079_0001762 | 3300049741 | Bacteria | 15438 |
| 773 | Ga0501079_0012601 | 3300049741 | Bacteria | 6457 |
| 774 | Ga0501080_0005166 | 3300049742 | Bacteria | 11628 |
| 775 | Ga0501080_0005596 | 3300049742 | Bacteria | 11228 |
| 776 | Ga0501080_0093793 | 3300049742 | Bacteria | 2787 |
| 777 | Ga0501080_0195710 | 3300049742 | Bacteria | 1857 |
| 778 | Ga0501081_0228803 | 3300049743 | Bacteria | 1354 |
| 779 | Ga0501083_0015067 | 3300049744 | Bacteria | 5411 |
| 780 | Ga0501083_0015766 | 3300049744 | Bacteria | 5289 |
| 781 | Ga0501083_0099940 | 3300049744 | Bacteria | 1913 |
| 782 | Ga0501083_0117923 | 3300049744 | Bacteria | 1741 |
| 783 | Ga0501035_0001345 | 3300049822 | Bacteria | 25323 |
| 784 | Ga0501035_0002989 | 3300049822 | Bacteria | 16240 |
| 785 | Ga0501035_0008293 | 3300049822 | Bacteria | 9678 |
| 786 | Ga0501035_0013984 | 3300049822 | Bacteria | 7403 |
| 787 | Ga0501035_0054696 | 3300049822 | Bacteria | 3565 |
| 788 | Ga0501035_0301024 | 3300049822 | Bacteria | 1351 |
| 789 | Ga0501035_0418591 | 3300049822 | Bacteria | 1112 |
| 790 | Ga0501044_0000667 | 3300049823 | Bacteria | 41447 |
| 791 | Ga0501044_0027021 | 3300049823 | Bacteria | 6072 |
| 792 | Ga0501044_0032753 | 3300049823 | Bacteria | 5462 |
| 793 | Ga0501044_0081071 | 3300049823 | Bacteria | 3285 |
| 794 | Ga0501044_0083394 | 3300049823 | Bacteria | 3232 |
| 795 | Ga0501044_0109258 | 3300049823 | Bacteria | 2775 |
| 796 | Ga0501044_0165131 | 3300049823 | Bacteria | 2188 |
| 797 | Ga0501044_0209343 | 3300049823 | Bacteria | 1905 |
| 798 | Ga0501045_0003017 | 3300049824 | Bacteria | 11527 |
| 799 | Ga0501045_0012743 | 3300049824 | Bacteria | 5923 |
| 800 | Ga0501045_0137643 | 3300049824 | Bacteria | 1816 |
| 801 | nmdc:mga03n38_1891_c1 | 3300050490 | Bacteria | 6265 |
| 802 | nmdc:mga03n38_91863_c1 | 3300050490 | Bacteria | 1447 |
| 803 | nmdc:mga00v17_135430_c1 | 3300050491 | Bacteria | 1577 |
| 804 | nmdc:mga0yw44_134578_c1 | 3300050492 | Bacteria | 1603 |
| 805 | nmdc:mga0yw44_222728_c1 | 3300050492 | Bacteria | 1251 |
| 806 | nmdc:mga0yw44_63789_c1 | 3300050492 | Bacteria | 2266 |
| 807 | nmdc:mga0k408_157748_c1 | 3300050493 | Bacteria | 1351 |
| 808 | nmdc:mga0k408_35179_c1 | 3300050493 | Bacteria | 2872 |
| 809 | nmdc:mga0k408_60795_c1 | 3300050493 | Bacteria | 2196 |
| 810 | nmdc:mga0k408_65696_c1 | 3300050493 | Bacteria | 2112 |
| 811 | nmdc:mga06z11_27139_c1 | 3300050494 | Bacteria | 2735 |
| 812 | nmdc:mga06z11_54543_c1 | 3300050494 | Bacteria | 2061 |
| 813 | nmdc:mga04h51_3952_c1 | 3300050495 | Bacteria | 3649 |
| 814 | nmdc:mga08y16_382969_c1 | 3300050511 | Bacteria | 1441 |
| 815 | nmdc:mga0n895_227122_c1 | 3300050512 | Bacteria | 1895 |
| 816 | nmdc:mga0n895_357578_c1 | 3300050512 | Bacteria | 1479 |
| 817 | nmdc:mga0n895_4726_c1 | 3300050512 | Bacteria | 11245 |
| 818 | nmdc:mga08x19_67652_c1 | 3300050514 | Bacteria | 2324 |
| 819 | nmdc:mga0sz30_12669_c1 | 3300050516 | Bacteria | 3284 |
| 820 | nmdc:mga0sz30_18835_c1 | 3300050516 | Bacteria | 2767 |
| 821 | nmdc:mga0sz30_28201_c1 | 3300050516 | Bacteria | 2054 |
| 822 | Ga0495601_0085301 | 3300053077 | Bacteria | 2029 |
| 823 | Ga0500635_0012868 | 3300053080 | Bacteria | 2415 |
| 824 | Ga0500643_000443 | 3300053087 | Bacteria | 30999 |
| 825 | Ga0500647_0023852 | 3300053091 | Bacteria | 2874 |
| 826 | Ga0500566_0000270 | 3300053094 | Bacteria | 27957 |
| 827 | Ga0500566_0000780 | 3300053094 | Bacteria | 18033 |
| 828 | Ga0500566_0014575 | 3300053094 | Bacteria | 4619 |
| 829 | Ga0500641_0008048 | 3300053096 | Bacteria | 3758 |
| 830 | Ga0500641_0008602 | 3300053096 | Bacteria | 3648 |
| 831 | Ga0500641_0109731 | 3300053096 | Bacteria | 1187 |
| 832 | Ga0500555_023586 | 3300053103 | Bacteria | 1764 |
| 833 | Ga0500556_0004536 | 3300053104 | Bacteria | 3952 |
| 834 | Ga0500556_0099071 | 3300053104 | Bacteria | 1121 |
| 835 | Ga0500572_001115 | 3300053111 | Bacteria | 7839 |
| 836 | Ga0500594_0043603 | 3300053118 | Bacteria | 1238 |
| 837 | Ga0500595_000328 | 3300053119 | Bacteria | 31283 |
| 838 | Ga0500595_001866 | 3300053119 | Bacteria | 10887 |
| 839 | Ga0500595_012540 | 3300053119 | Bacteria | 3275 |
| 840 | Ga0500614_001182 | 3300053123 | Bacteria | 6395 |
| 841 | Ga0500617_115703 | 3300053124 | Bacteria | 1114 |
| 842 | Ga0500559_0001813 | 3300053136 | Bacteria | 11672 |
| 843 | Ga0500564_146053 | 3300053138 | Bacteria | 1011 |
| 844 | Ga0500568_0084481 | 3300053139 | Bacteria | 1202 |
| 845 | Ga0500573_0017246 | 3300053140 | Bacteria | 4109 |
| 846 | Ga0500577_0030140 | 3300053142 | Bacteria | 1885 |
| 847 | Ga0500588_0009801 | 3300053146 | Bacteria | 2291 |
| 848 | Ga0500603_000151 | 3300053150 | Bacteria | 17010 |
| 849 | Ga0500603_008750 | 3300053150 | Bacteria | 2255 |
| 850 | Ga0500616_0053704 | 3300053153 | Bacteria | 2113 |
| 851 | Ga0500622_0092915 | 3300053156 | Bacteria | 1494 |
| 852 | Ga0500638_057307 | 3300053162 | Bacteria | 1876 |
| 853 | Ga0500639_000065 | 3300053163 | Bacteria | 48250 |
| 854 | Ga0500636_0000584 | 3300053177 | Bacteria | 19957 |
| 855 | Ga0500636_0023297 | 3300053177 | Bacteria | 3661 |
| 856 | Ga0500637_0000413 | 3300053178 | Bacteria | 16315 |
| 857 | Ga0500637_0090652 | 3300053178 | Bacteria | 1770 |
| 858 | Ga0500637_0157770 | 3300053178 | Bacteria | 1308 |
| 859 | Ga0500645_025589 | 3300053730 | Bacteria | 1800 |
| 860 | Ga0500645_054165 | 3300053730 | Bacteria | 1167 |
| 861 | Ga0500596_000494 | 3300053735 | Bacteria | 7393 |
| 862 | Ga0500599_000161 | 3300053736 | Bacteria | 6110 |
| 863 | Ga0500601_000483 | 3300053737 | Bacteria | 6200 |
| 864 | Ga0501084_0002085 | 3300054114 | Bacteria | 15967 |
| 865 | Ga0501084_0003469 | 3300054114 | Bacteria | 12809 |
| 866 | Ga0501082_0018999 | 3300060353 | Bacteria | 5921 |
| 867 | Ga0501082_0033487 | 3300060353 | Bacteria | 4433 |
| 868 | Ga0501082_0087916 | 3300060353 | Bacteria | 2681 |
| 869 | 2507505999 | 2507262055 | Bacteria | 8048963 |
| 870 | 2508540187 | 2508501009 | Bacteria | 7784016 |
| 871 | 2508696261 | 2508501042 | Bacteria | 8719808 |
| 872 | 2509148190 | 2508501128 | Bacteria | 8613869 |
| 873 | 2511397326 | 2511231028 | Bacteria | 8046582 |
| 874 | 2513592443 | 2513237087 | Bacteria | 5817514 |
| 875 | 2513624910 | 2513237092 | Bacteria | 8341956 |
| 876 | 2513638257 | 2513237094 | Bacteria | 8789602 |
| 877 | 2513649095 | 2513237095 | Bacteria | 8976980 |
| 878 | 2513657558 | 2513237096 | Bacteria | 8722461 |
| 879 | 2513674944 | 2513237098 | Bacteria | 9902361 |
| 880 | 2513701556 | 2513237102 | Bacteria | 7703324 |
| 881 | 2513716261 | 2513237104 | Bacteria | 10034502 |
| 882 | 2513861114 | 2513237137 | Bacteria | 9558895 |
| 883 | 2513877170 | 2513237139 | Bacteria | 8737671 |
| 884 | 2513916811 | 2513237145 | Bacteria | 8979722 |
| 885 | 2514014539 | 2513237161 | Bacteria | 8871253 |
| 886 | 2517103189 | 2517093001 | Bacteria | 9002274 |
| 887 | 2517889721 | 2517572143 | Bacteria | 9484767 |
| 888 | 2524440757 | 2524023205 | Bacteria | 8918781 |
| 889 | 2524533113 | 2524023228 | Bacteria | 10118060 |
| 890 | 2528850764 | 2528768022 | Bacteria | 10457665 |
| 891 | 2617347882 | 2617270735 | Bacteria | 9163226 |
| 892 | 2617374804 | 2617270741 | Bacteria | 8201522 |
| 893 | 2644290425 | 2643221651 | Bacteria | 4798932 |
| 894 | 2671119571 | 2667528175 | Bacteria | 7532676 |
| 895 | 2723848926 | 2721755755 | Bacteria | 8322773 |
| 896 | 2728748933 | 2728368998 | Bacteria | 8720350 |
| 897 | 2745075998 | 2744054633 | Bacteria | 8678936 |
| 898 | 2758640684 | 2758568016 | Bacteria | 5645291 |
| 899 | 2793061467 | 2791355196 | Bacteria | 7323613 |
| 900 | 2793070299 | 2791355197 | Bacteria | 8420563 |
| 901 | 2793078930 | |||
| 902 | 2805916231 | 2802429603 | Bacteria | 8777136 |
| 903 | 2818240486 | 2816332527 | Bacteria | 8933356 |
| 904 | 2824603706 | 2824600985 | Bacteria | 8488197 |
| 905 | 2824610708 | 2824609381 | Bacteria | 8672835 |
| 906 | 2824624968 | 2824617872 | Bacteria | 8814715 |
| 907 | 2824630995 | 2824626560 | Bacteria | 8813858 |
| 908 | 2824641243 | 2824635225 | Bacteria | 8785348 |
| 909 | 2824649673 | 2824644064 | Bacteria | 8743947 |
| 910 | 2824657910 | 2824653114 | Bacteria | 8493680 |
| 911 | 2824666907 | 2824661429 | Bacteria | 9877870 |
| 912 | 2824674085 | 2824671348 | Bacteria | 8369588 |
| 913 | 2824690751 | 2824687955 | Bacteria | 8360029 |
| 914 | 2824703321 | 2824696289 | Bacteria | 8335049 |
| 915 | 2824710962 | 2824704595 | Bacteria | 9667483 |
| 916 | 2824719598 | 2824714736 | Bacteria | 8717648 |
| 917 | 2824728573 | 2824723954 | Bacteria | 8758240 |
| 918 | 2824737933 | 2824732956 | Bacteria | 7810675 |
| 919 | 2824752186 | 2824746037 | Bacteria | 7911610 |
| 920 | 2824760348 | 2824753945 | Bacteria | 9787441 |
| 921 | 2824772484 | 2824763712 | Bacteria | 9792355 |
| 922 | 2824776341 | 2824773399 | Bacteria | 8360218 |
| 923 | 2838125008 | 2838122688 | Bacteria | 8803140 |
| 924 | 2841945747 | 2841941048 | Bacteria | 8688029 |
| 925 | 2841956846 | 2841949485 | Bacteria | 8680857 |
| 926 | 2841964029 | 2841957949 | Bacteria | 8652217 |
| 927 | 2841973594 | 2841966195 | Bacteria | 8673214 |
| 928 | 2841981928 | 2841974524 | Bacteria | 8931498 |
| 929 | 2841989482 | 2841983080 | Bacteria | 8395090 |
| 930 | 2842044467 | 2842038055 | Bacteria | 8002051 |
| 931 | 2842051544 | 2842045827 | Bacteria | 8006841 |
| 932 | 2842778407 | 2842775625 | Bacteria | 5587290 |
| 933 | 2847939359 | 2847930680 | Bacteria | 9342022 |
| 934 | 2847941115 | 2847939898 | Bacteria | 8606328 |
| 935 | 2849082101 | 2849076700 | Bacteria | 7039503 |
| 936 | 2857513418 | 2857509624 | Bacteria | 7472071 |
| 937 | 2874130557 | 2874123672 | Bacteria | 7238285 |
| 938 | 2874596264 | 2874590934 | Bacteria | 8299676 |
| 939 | 2874610051 | 2874604998 | Bacteria | 7834745 |
| 940 | 2874616536 | 2874612657 | Bacteria | 8252029 |
| 941 | 2874622554 | 2874620515 | Bacteria | 8290088 |
| 942 | 2874633467 | 2874628541 | Bacteria | 8630250 |
| 943 | 2874650251 | 2874645413 | Bacteria | 8214782 |
| 944 | 2876763652 | 2876761206 | Bacteria | 10111113 |
| 945 | 2876776729 | 2876771140 | Bacteria | 8287509 |
| 946 | 2876824519 | 2876818435 | Bacteria | 8274608 |
| 947 | 2879080866 | 2879074833 | Bacteria | 8279565 |
| 948 | 2879087032 | 2879083081 | Bacteria | 8587928 |
| 949 | 2879104363 | 2879099564 | Bacteria | 10442239 |
| 950 | 2879116915 | 2879110137 | Bacteria | 8907982 |
| 951 | 2879133711 | 2879127579 | Bacteria | 8294491 |
| 952 | 2879148213 | 2879142872 | Bacteria | 8267021 |
| 953 | 2881369522 | 2881364244 | Bacteria | 7710352 |
| 954 | 2881669762 | 2881665667 | Bacteria | 8175609 |
| 955 | 2885367832 | 2885366525 | Bacteria | 8326213 |
| 956 | 2885378461 | 2885374607 | Bacteria | 8927485 |
| 957 | 2885386468 | 2885383462 | Bacteria | 9473874 |
| 958 | 2885412984 | 2885409591 | Bacteria | 9235467 |
| 959 | 2888387161 | 2888378607 | Bacteria | 9652610 |
| 960 | 2888421257 | 2888419890 | Bacteria | 7857137 |
| 961 | 2903750330 | 2903748898 | Bacteria | 9972761 |
| 962 | 2903775238 | 2903768456 | Bacteria | 9749579 |
| 963 | 2904671439 | 2904666416 | Bacteria | 8226587 |
| 964 | 2904691971 | 2904690495 | Bacteria | 9412302 |
| 965 | 2904707522 | |||
| 966 | 2904719731 | 2904711408 | Bacteria | 9771557 |
| 967 | 2906614697 | |||
| 968 | 2906631358 | 2906626472 | Bacteria | 8826946 |
| 969 | 2906636216 | 2906635258 | Bacteria | 8601019 |
| 970 | 2906646702 | 2906643746 | Bacteria | 8722424 |
| 971 | 2906661026 | 2906660503 | Bacteria | 8595048 |
| 972 | 2908746475 | 2908739725 | Bacteria | 8628932 |
| 973 | 2908757431 | 2908756301 | Bacteria | 8864324 |
| 974 | 2908777286 | 2908775508 | Bacteria | 8092255 |
| 975 | 2922377328 | |||
| 976 | 2922389453 | 2922386360 | Bacteria | 7017218 |
| 977 | 2922398430 | 2922393267 | Bacteria | 8285685 |
| 978 | 2922426559 | |||
| 979 | 2929622130 | 2929615660 | Bacteria | 9193770 |
| 980 | 2929630225 | 2929624759 | Bacteria | 9339455 |
| 981 | 2932787853 | 2932784394 | Bacteria | 9704911 |
| 982 | 2932795971 | 2932794094 | Bacteria | 7915132 |
| 983 | 2932807548 | 2932801729 | Bacteria | 7987968 |
| 984 | 2932817577 | 2932809354 | Bacteria | 9135765 |
| 985 | 2932826263 | 2932818245 | Bacteria | 9955613 |
| 986 | 2932835119 | 2932828146 | Bacteria | 9745859 |
| 987 | 2933584254 | 2933577622 | Bacteria | 9116884 |
| 988 | 2935614424 | 2935608549 | Bacteria | 8203142 |
| 989 | 2935620497 | 2935616580 | Bacteria | 9032984 |
| 990 | 2935632899 | 2935630451 | Bacteria | 8169952 |
| 991 | 2935640819 | 2935638405 | Bacteria | 10015038 |
| 992 | 2935649453 | 2935648319 | Bacteria | 8801166 |
| 993 | 2935657775 | 2935656913 | Bacteria | 8965014 |
| 994 | 2935670322 | 2935665750 | Bacteria | 9571747 |
| 995 | 2935679752 | 2935675223 | Bacteria | 9928132 |
| 996 | 2935687321 | 2935684952 | Bacteria | 9590419 |
| 997 | 2935696708 | 2935694250 | Bacteria | 9291695 |
| 998 | 2935709200 | 2935703347 | Bacteria | 10242284 |
| 999 | 2935718780 | 2935713505 | Bacteria | 9608509 |
| 1000 | 2935728432 | 2935722832 | Bacteria | 9608746 |
| 1001 | 2935736971 | 2935732158 | Bacteria | 9706831 |
| 1002 | 2935746026 | 2935741537 | Bacteria | 9707219 |
| 1003 | 2935753287 | 2935750917 | Bacteria | 9590372 |
| 1004 | 2935766320 | 2935760218 | Bacteria | 9817913 |
| 1005 | 2935770291 | 2935769743 | Bacteria | 7878163 |
| 1006 | 2935777682 | 2935777560 | Bacteria | 8077691 |
| 1007 | 2935786656 | 2935785616 | Bacteria | 7962367 |
| 1008 | 2935794710 | 2935793552 | Bacteria | 8012592 |
| 1009 | 2935809002 | 2935801545 | Bacteria | 9301974 |
| 1010 | 2935813819 | 2935810662 | Bacteria | 9401221 |
| 1011 | 2935826642 | 2935819856 | Bacteria | 8261050 |
| 1012 | 2935832326 | 2935827899 | Bacteria | 10038562 |
| 1013 | 2935844031 | 2935837841 | Bacteria | 9454360 |
| 1014 | 2935851064 | 2935847175 | Bacteria | 8228321 |
| 1015 | 2935862823 | 2935855204 | Bacteria | 9035059 |
| 1016 | 2935864566 | 2935864058 | Bacteria | 9784707 |
| 1017 | 2935875082 | 2935873716 | Bacteria | 9632195 |
| 1018 | 2935890238 | 2935883170 | Bacteria | 7964738 |
| 1019 | 2935913114 | 2935908558 | Bacteria | 8568796 |
| 1020 | 2935922536 | 2935916978 | Bacteria | 9113783 |
| 1021 | 2935930961 | 2935926038 | Bacteria | 8601059 |
| 1022 | 2935939705 | 2935934488 | Bacteria | 8602579 |
| 1023 | 2935946654 | 2935942939 | Bacteria | 8599779 |
| 1024 | 2935956145 | 2935951376 | Bacteria | 8602333 |
| 1025 | 2935965051 | 2935959822 | Bacteria | 7869783 |
| 1026 | 2935972938 | 2935967501 | Bacteria | 8603075 |
| 1027 | 2935978146 | 2935975950 | Bacteria | 8347125 |
| 1028 | 2935985730 | 2935984226 | Bacteria | 8302647 |
| 1029 | 2935999299 | 2935992306 | Bacteria | 9802711 |
| 1030 | 2936005854 | 2936002035 | Bacteria | 9362176 |
| 1031 | 2936011994 | 2936011229 | Bacteria | 8801034 |
| 1032 | 2936020925 | 2936019824 | Bacteria | 8804134 |
| 1033 | 2936029287 | 2936028420 | Bacteria | 8965941 |
| 1034 | 2936039375 | 2936037263 | Bacteria | 9446081 |
| 1035 | 2936048389 | 2936046547 | Bacteria | 8903709 |
| 1036 | 2936056500 | 2936055302 | Bacteria | 8785755 |
| 1037 | 2940559200 | 2940556831 | Bacteria | 9590747 |
| 1038 | 2941508436 | 2941507105 | Bacteria | 8166816 |
| 1039 | 2941516267 | 2941515067 | Bacteria | 8166720 |
| 1040 | 2941524717 | 2941523033 | Bacteria | 8169134 |
| 1041 | 2941541894 | 2941538514 | Bacteria | 9402094 |
| 1042 | 3005475905 | 3005474847 | Bacteria | 9259049 |
| 1043 | 3005491148 | 3005483717 | Bacteria | 7877331 |
| 1044 | 3005510989 | 3005506211 | Bacteria | 6943378 |
| 1045 | 3005591834 | 3005587118 | Bacteria | 7794411 |
| 1046 | 3005711890 | 3005710791 | Bacteria | 7622528 |
| 1047 | 8006931481 | 8006926726 | Bacteria | 6749210 |
| 1048 | 8006937217 | 8006933436 | Bacteria | 10410654 |
| 1049 | 8006966234 | 8006964411 | Bacteria | 8966052 |
| 1050 | 8006977228 | 8006973647 | Bacteria | 10679141 |
| 1051 | 8006993039 | 8006984368 | Bacteria | 9651211 |
| 1052 | 8006996899 | 8006994254 | Bacteria | 8309700 |
| 1053 | 8016517182 | 8016511872 | Bacteria | 9921665 |
| 1054 | 8016527062 | 8016522445 | Bacteria | 8156687 |
| 1055 | 8016532144 | 8016530956 | Bacteria | 8155261 |
| 1056 | 8016545354 | 8016539877 | Bacteria | 8155419 |
| 1057 | 8016556734 | 8016548790 | Bacteria | 8155074 |
| 1058 | 8016565091 | 8016557553 | Bacteria | 8154380 |
| 1059 | 8016570441 | 8016566248 | Bacteria | 8158151 |
| 1060 | 8016582973 | 8016575299 | Bacteria | 8154085 |
| 1061 | 8016585326 | 8016583857 | Bacteria | 10421953 |
| 1062 | 8016602739 | 8016595262 | Bacteria | 8149947 |
| 1063 | 8016605596 | 8016603502 | Bacteria | 8731218 |
| 1064 | 8016617514 | 8016613128 | Bacteria | 8794220 |
| 1065 | 8016624059 | 8016622563 | Bacteria | 7999408 |
| 1066 | 8016634809 | 8016630954 | Bacteria | 9217207 |
| 1067 | 8017059406 | 8017057580 | Bacteria | 10023680 |
| 1068 | 8019531962 | 8019530166 | Bacteria | 8155624 |
| 1069 | 8019539574 | 8019538911 | Bacteria | 7872763 |
| 1070 | 8019551081 | 8019547302 | Bacteria | 7996444 |
| 1071 | 8019571513 | 8019565922 | Bacteria | 9639779 |
| 1072 | 8019576212 | 8019576017 | Bacteria | 10049540 |
| 1073 | 8019594086 | 8019586578 | Bacteria | 10212056 |
| 1074 | 8019607476 | 8019597564 | Bacteria | 10041141 |
| 1075 | 8019621884 | 8019619141 | Bacteria | 9218857 |
| 1076 | 8019639171 | 8019638758 | Bacteria | 9062356 |
| 1077 | 8019651322 | 8019648815 | Bacteria | 10014479 |
| 1078 | 8019668254 | 8019659431 | Bacteria | 8577854 |
| 1079 | 8019677705 | 8019668869 | Bacteria | 8791617 |
| 1080 | 8019687237 | 8019678201 | Bacteria | 8863603 |
| 1081 | 8019693219 | 8019687851 | Bacteria | 8712826 |
| 1082 | 8055743619 | 8055742211 | Bacteria | 9226248 |
| 1083 | 8056675289 | 8056673599 | Bacteria | 7871253 |
| 1084 | 8056681593 | 8056681323 | Bacteria | 8472857 |
| 1085 | 8056692930 | 8056689827 | Bacteria | 6712655 |
| 1086 | 8056974074 | 8056967851 | Bacteria | 9038162 |
| 1087 | Ga0068860_100000411 | |||
| 1088 | LJQas_1003629 | |||
| 1089 | JGI24740J21852_10010589 | |||
| 1090 | JGI24735J21928_10038218 | |||
| 1091 | JGI24750J21931_1003497 | |||
| 1092 | JGI24744J21845_10006597 | |||
| 1093 | JGI25153J46596_10000600 | |||
| 1094 | JGI25153J46596_10001390 | |||
| 1095 | JGI25153J46596_10002696 | |||
| 1096 | JGI25160J50197_1001415 | |||
| 1097 | JGI25404J52841_10000278 | |||
| 1098 | JGI25404J52841_10009489 | |||
| 1099 | JGI25404J52841_10011990 | |||
| 1100 | Ga0055542_1006533 | |||
| 1101 | Ga0055536_1008613 | |||
| 1102 | Ga0055531_10031132 | |||
| 1103 | Ga0065165_1002667 | |||
| 1104 | Ga0065165_1013580 | |||
| 1105 | Ga0070676_10016539 | |||
| 1106 | Ga0070683_100025289 | |||
| 1107 | Ga0070683_100130359 | |||
| 1108 | Ga0070683_100215018 | |||
| 1109 | Ga0070666_10243708 | |||
| 1110 | Ga0070680_100010901 | |||
| 1111 | Ga0070680_100350873 | |||
| 1112 | Ga0070682_100174131 | |||
| 1113 | Ga0070682_100284830 | |||
| 1114 | Ga0070660_100004981 | |||
| 1115 | Ga0070660_100311084 | |||
| 1116 | Ga0070660_100323793 | |||
| 1117 | Ga0070689_100027366 | |||
| 1118 | Ga0070661_100135531 | |||
| 1119 | Ga0070661_100311839 | |||
| 1120 | Ga0070692_10032810 | |||
| 1121 | Ga0070668_100003914 | |||
| 1122 | Ga0070668_100076766 | |||
| 1123 | Ga0070668_100209627 | |||
| 1124 | Ga0070669_100000033 | |||
| 1125 | Ga0070669_100000387 | |||
| 1126 | Ga0070669_100037707 | |||
| 1127 | Ga0070675_100061546 | |||
| 1128 | Ga0070675_100589391 | |||
| 1129 | Ga0070671_100000012 | |||
| 1130 | Ga0070671_100017669 | |||
| 1131 | Ga0070671_100109525 | |||
| 1132 | Ga0070674_100020257 | |||
| 1133 | Ga0070673_100076660 | |||
| 1134 | Ga0070673_100233740 | |||
| 1135 | Ga0070688_100004706 | |||
| 1136 | Ga0070688_100017655 | |||
| 1137 | Ga0070659_100072567 | |||
| 1138 | Ga0070667_100000279 | |||
| 1139 | Ga0070667_100136017 | |||
| 1140 | Ga0070703_10067958 | |||
| 1141 | Ga0070709_10000375 | |||
| 1142 | Ga0070714_100212996 | |||
| 1143 | Ga0070713_100041867 | |||
| 1144 | Ga0070713_100089707 | |||
| 1145 | Ga0070710_10000275 | |||
| 1146 | Ga0070710_10017525 | |||
| 1147 | Ga0070710_10040067 | |||
| 1148 | Ga0070710_10228597 | |||
| 1149 | Ga0070711_100006414 | |||
| 1150 | Ga0070711_100020739 | |||
| 1151 | Ga0070711_100022239 | |||
| 1152 | Ga0070663_100018265 | |||
| 1153 | Ga0070663_100161988 | |||
| 1154 | Ga0070678_100106912 | |||
| 1155 | Ga0070662_100134192 | |||
| 1156 | Ga0070662_100140170 | |||
| 1157 | Ga0070662_100391421 | |||
| 1158 | Ga0070681_10061629 | |||
| 1159 | Ga0070681_10216576 | |||
| 1160 | Ga0070681_10308969 | |||
| 1161 | Ga0068867_100029064 | |||
| 1162 | Ga0070685_10000001 | |||
| 1163 | Ga0070685_10049514 | |||
| 1164 | Ga0070706_100219916 | |||
| 1165 | Ga0070707_100083474 | |||
| 1166 | Ga0070679_100034040 | |||
| 1167 | Ga0070679_100053135 | |||
| 1168 | Ga0070679_100075094 | |||
| 1169 | Ga0070679_100076591 | |||
| 1170 | Ga0070684_100001508 | |||
| 1171 | Ga0070684_100028072 | |||
| 1172 | Ga0070684_100053196 | |||
| 1173 | Ga0070684_100168155 | |||
| 1174 | Ga0070684_100398277 | |||
| 1175 | Ga0068853_100000629 | |||
| 1176 | Ga0068853_100086846 | |||
| 1177 | Ga0068853_100296802 | |||
| 1178 | Ga0070672_100005802 | |||
| 1179 | Ga0070672_100147354 | |||
| 1180 | Ga0070686_100014547 | |||
| 1181 | Ga0070696_100024651 | |||
| 1182 | Ga0070696_100313661 | |||
| 1183 | Ga0070665_100078792 | |||
| 1184 | Ga0070665_100102324 | |||
| 1185 | Ga0070665_100135855 | |||
| 1186 | Ga0070665_100313579 | |||
| 1187 | Ga0070665_100326537 | |||
| 1188 | Ga0070704_100044331 | |||
| 1189 | Ga0070704_100110635 | |||
| 1190 | Ga0068855_100029638 | |||
| 1191 | Ga0068855_100034408 | |||
| 1192 | Ga0068855_100058404 | |||
| 1193 | Ga0068855_100094463 | |||
| 1194 | Ga0068855_100098198 | |||
| 1195 | Ga0068855_100237342 | |||
| 1196 | Ga0068855_100250279 | |||
| 1197 | Ga0068855_100582204 | |||
| 1198 | Ga0070664_100096036 | |||
| 1199 | Ga0070664_100387472 | |||
| 1200 | Ga0068857_100036777 | |||
| 1201 | Ga0068857_100064583 | |||
| 1202 | Ga0068857_100066950 | |||
| 1203 | Ga0068857_100084387 | |||
| 1204 | Ga0068857_100274189 | |||
| 1205 | Ga0068854_100026612 | |||
| 1206 | Ga0068854_100043105 | |||
| 1207 | Ga0068854_100150904 | |||
| 1208 | Ga0068854_100354045 | |||
| 1209 | Ga0068856_100003776 | |||
| 1210 | Ga0068856_100062045 | |||
| 1211 | Ga0068856_100338831 | |||
| 1212 | Ga0070702_100215099 | |||
| 1213 | Ga0068852_100005759 | |||
| 1214 | Ga0068852_100064924 | |||
| 1215 | Ga0068852_100064930 | |||
| 1216 | Ga0068864_100000018 | |||
| 1217 | Ga0068864_100047366 | |||
| 1218 | Ga0068864_100055374 | |||
| 1219 | Ga0068864_100248805 | |||
| 1220 | Ga0068864_100261239 | |||
| 1221 | Ga0068864_100663065 | |||
| 1222 | Ga0068861_100010209 | |||
| 1223 | Ga0068861_100136558 | |||
| 1224 | Ga0068861_100176343 | |||
| 1225 | Ga0068851_10017462 | |||
| 1226 | Ga0068851_10054937 | |||
| 1227 | Ga0068863_100630285 | |||
| 1228 | Ga0068858_100004448 | |||
| 1229 | Ga0068858_100136821 | |||
| 1230 | Ga0068860_100000456 | |||
| 1231 | Ga0068860_100012696 | |||
| 1232 | Ga0068860_100044144 | |||
| 1233 | Ga0068862_100002580 | |||
| 1234 | Ga0068862_100006134 | |||
| 1235 | Ga0068862_100270297 | |||
| 1236 | Ga0068862_100526453 | |||
| 1237 | Ga0081455_10002674 | |||
| 1238 | Ga0081455_10016366 | |||
| 1239 | Ga0081455_10052651 | |||
| 1240 | Ga0081455_10092032 | |||
| 1241 | Ga0081540_1000128 | |||
| 1242 | Ga0081540_1001275 | |||
| 1243 | Ga0081540_1001299 | |||
| 1244 | Ga0081540_1005588 | |||
| 1245 | Ga0081540_1006389 | |||
| 1246 | Ga0081540_1012898 | |||
| 1247 | Ga0081540_1016667 | |||
| 1248 | Ga0081540_1028615 | |||
| 1249 | Ga0081540_1028764 | |||
| 1250 | Ga0081540_1041487 | |||
| 1251 | Ga0081539_10074173 | |||
| 1252 | Ga0081539_10105926 | |||
| 1253 | Ga0081539_10120167 | |||
| 1254 | Ga0070717_10069615 | |||
| 1255 | Ga0070717_10073105 | |||
| 1256 | Ga0075365_10060955 | |||
| 1257 | Ga0075365_10082394 | |||
| 1258 | Ga0075365_10136170 | |||
| 1259 | Ga0075365_10179433 | |||
| 1260 | Ga0075365_10228216 | |||
| 1261 | Ga0075365_10269441 | |||
| 1262 | Ga0075368_10001639 | |||
| 1263 | Ga0075368_10048310 | |||
| 1264 | Ga0075363_100002809 | |||
| 1265 | Ga0075363_100017335 | |||
| 1266 | Ga0075364_10085142 | |||
| 1267 | Ga0075364_10221940 | |||
| 1268 | Ga0070715_10024687 | |||
| 1269 | Ga0070716_100013938 | |||
| 1270 | Ga0070712_100005151 | |||
| 1271 | Ga0070712_100005941 | |||
| 1272 | Ga0070712_100045559 | |||
| 1273 | Ga0070712_100070842 | |||
| 1274 | Ga0070712_100434960 | |||
| 1275 | Ga0075367_10042532 | |||
| 1276 | Ga0075369_10044924 | |||
| 1277 | Ga0075369_10089752 | |||
| 1278 | Ga0097621_100033964 | |||
| 1279 | Ga0097621_100122673 | |||
| 1280 | Ga0075370_10034039 | |||
| 1281 | Ga0075370_10194632 | |||
| 1282 | Ga0068871_100081737 | |||
| 1283 | Ga0068871_100195541 | |||
| 1284 | Ga0075428_100155620 | |||
| 1285 | Ga0075434_100359271 | |||
| 1286 | Ga0068865_100070580 | |||
| 1287 | Ga0075436_100009187 | |||
| 1288 | Ga0099825_1032482 | |||
| 1289 | Ga0099824_1014728 | |||
| 1290 | Ga0099822_1000031 | |||
| 1291 | Ga0099794_10102171 | |||
| 1292 | Ga0099795_10009109 | |||
| 1293 | Ga0099795_10042026 | |||
| 1294 | Ga0105250_10048076 | |||
| 1295 | Ga0105240_10005310 | |||
| 1296 | Ga0105240_10008157 | |||
| 1297 | Ga0105240_10020584 | |||
| 1298 | Ga0105240_10020686 | |||
| 1299 | Ga0105240_10194470 | |||
| 1300 | Ga0105245_10233172 | |||
| 1301 | Ga0105247_10037262 | |||
| 1302 | Ga0105247_10085391 | |||
| 1303 | Ga0105247_10101322 | |||
| 1304 | Ga0105247_10153131 | |||
| 1305 | Ga0105247_10178817 | |||
| 1306 | Ga0105247_10290054 | |||
| 1307 | Ga0114129_10085137 | |||
| 1308 | Ga0105243_10181929 | |||
| 1309 | Ga0105241_10001771 | |||
| 1310 | Ga0105241_10104105 | |||
| 1311 | Ga0105242_10086402 | |||
| 1312 | Ga0105248_10042837 | |||
| 1313 | Ga0105248_10082009 | |||
| 1314 | Ga0105248_10095178 | |||
| 1315 | Ga0105248_10400059 | |||
| 1316 | Ga0105248_10512173 | |||
| 1317 | Ga0105237_10008184 | |||
| 1318 | Ga0105237_10045694 | |||
| 1319 | Ga0105237_10046343 | |||
| 1320 | Ga0105237_10113822 | |||
| 1321 | Ga0105237_10146340 | |||
| 1322 | Ga0105237_10361717 | |||
| 1323 | Ga0105237_10385688 | |||
| 1324 | Ga0105238_10000517 | |||
| 1325 | Ga0105238_10022670 | |||
| 1326 | Ga0105238_10026980 | |||
| 1327 | Ga0105249_10471740 | |||
| 1328 | Ga0099796_10009283 | |||
| 1329 | Ga0099796_10021895 | |||
| 1330 | Ga0099796_10023122 | |||
| 1331 | Ga0099796_10033766 | |||
| 1332 | Ga0105239_10002648 | |||
| 1333 | Ga0105239_10017924 | |||
| 1334 | Ga0105239_10021488 | |||
| 1335 | Ga0105239_10031806 | |||
| 1336 | Ga0105239_10065141 | |||
| 1337 | Ga0105239_10072205 | |||
| 1338 | Ga0105239_10134890 | |||
| 1339 | Ga0105239_10234595 | |||
| 1340 | Ga0105239_10391969 | |||
| 1341 | Ga0105246_10116136 | |||
| 1342 | Ga0105246_10191791 | |||
| 1343 | Ga0105246_10220229 | |||
| 1344 | Ga0157371_10021936 | |||
| 1345 | Ga0157370_10014532 | |||
| 1346 | Ga0157370_10124641 | |||
| 1347 | Ga0157369_10003506 | |||
| 1348 | Ga0157369_10006970 | |||
| 1349 | Ga0157369_10014315 | |||
| 1350 | Ga0157369_10052523 | |||
| 1351 | Ga0157369_10496025 | |||
| 1352 | Ga0157374_10061178 | |||
| 1353 | Ga0157374_10077659 | |||
| 1354 | Ga0157378_10063588 | |||
| 1355 | Ga0157378_10293822 | |||
| 1356 | Ga0157378_10454106 | |||
| 1357 | Ga0163162_10382877 | |||
| 1358 | Ga0157372_10023555 | |||
| 1359 | Ga0157375_10055632 | |||
| 1360 | Ga0157375_10073375 | |||
| 1361 | Ga0163163_10000069 | |||
| 1362 | Ga0157380_10210285 | |||
| 1363 | Ga0157380_10338602 | |||
| 1364 | Ga0157380_10448403 | |||
| 1365 | Ga0157377_10060818 | |||
| 1366 | Ga0157377_10090470 | |||
| 1367 | Ga0157379_10051655 | |||
| 1368 | Ga0157379_10355752 | |||
| 1369 | Ga0157376_10325225 | |||
| 1370 | Ga0157376_10419511 | |||
| 1371 | Ga0213872_10022702 | |||
| 1372 | Ga0213876_10000477 | |||
| 1373 | Ga0209677_102608 | |||
| 1374 | Ga0209148_1001000 | |||
| 1375 | Ga0209233_1002990 | |||
| 1376 | Ga0209233_1009100 | |||
| 1377 | Ga0209455_1001389 | |||
| 1378 | Ga0209455_1010687 | |||
| 1379 | Ga0209455_1015147 | |||
| 1380 | Ga0209675_1006021 | |||
| 1381 | Ga0209676_1000284 | |||
| 1382 | Ga0209564_1002110 | |||
| 1383 | Ga0209564_1013028 | |||
| 1384 | Ga0209758_1000206 | |||
| 1385 | Ga0209758_1001267 | |||
| 1386 | Ga0209758_1001347 | |||
| 1387 | Ga0209758_1011263 | |||
| 1388 | Ga0209758_1037256 | |||
| 1389 | Ga0209050_1016402 | |||
| 1390 | Ga0207426_1000799 | |||
| 1391 | Ga0207426_1003234 | |||
| 1392 | Ga0207426_1008081 | |||
| 1393 | Ga0207426_1030869 | |||
| 1394 | Ga0209257_1000394 | |||
| 1395 | Ga0209257_1008387 | |||
| 1396 | Ga0209257_1013507 | |||
| 1397 | Ga0207697_10064088 | |||
| 1398 | Ga0207656_10003517 | |||
| 1399 | Ga0207692_10000229 | |||
| 1400 | Ga0207692_10023181 | |||
| 1401 | Ga0207710_10014586 | |||
| 1402 | Ga0207710_10038836 | |||
| 1403 | Ga0207710_10084508 | |||
| 1404 | Ga0207688_10001503 | |||
| 1405 | Ga0207688_10067444 | |||
| 1406 | Ga0207688_10072127 | |||
| 1407 | Ga0207680_10100912 | |||
| 1408 | Ga0207685_10041278 | |||
| 1409 | Ga0207699_10000242 | |||
| 1410 | Ga0207645_10012744 | |||
| 1411 | Ga0207645_10083437 | |||
| 1412 | Ga0207645_10139770 | |||
| 1413 | Ga0207654_10000248 | |||
| 1414 | Ga0207654_10009059 | |||
| 1415 | Ga0207654_10041873 | |||
| 1416 | Ga0207654_10062044 | |||
| 1417 | Ga0207707_10002685 | |||
| 1418 | Ga0207707_10045342 | |||
| 1419 | Ga0207695_10000006 | |||
| 1420 | Ga0207695_10000343 | |||
| 1421 | Ga0207695_10050510 | |||
| 1422 | Ga0207695_10050929 | |||
| 1423 | Ga0207695_10063575 | |||
| 1424 | Ga0207695_10075958 | |||
| 1425 | Ga0207671_10029138 | |||
| 1426 | Ga0207671_10061668 | |||
| 1427 | Ga0207693_10007398 | |||
| 1428 | Ga0207693_10033852 | |||
| 1429 | Ga0207693_10073908 | |||
| 1430 | Ga0207693_10096274 | |||
| 1431 | Ga0207663_10009571 | |||
| 1432 | Ga0207663_10025694 | |||
| 1433 | Ga0207663_10186331 | |||
| 1434 | Ga0207660_10008346 | |||
| 1435 | Ga0207660_10029917 | |||
| 1436 | Ga0207660_10205430 | |||
| 1437 | Ga0207660_10207998 | |||
| 1438 | Ga0207660_10286956 | |||
| 1439 | Ga0207657_10004349 | |||
| 1440 | Ga0207657_10012048 | |||
| 1441 | Ga0207657_10127903 | |||
| 1442 | Ga0207657_10280914 | |||
| 1443 | Ga0207649_10064731 | |||
| 1444 | Ga0207652_10166910 | |||
| 1445 | Ga0207652_10201178 | |||
| 1446 | Ga0207646_10028422 | |||
| 1447 | Ga0207681_10000011 | |||
| 1448 | Ga0207681_10001220 | |||
| 1449 | Ga0207681_10136657 | |||
| 1450 | Ga0207694_10000136 | |||
| 1451 | Ga0207694_10029183 | |||
| 1452 | Ga0207694_10360648 | |||
| 1453 | Ga0207650_10000003 | |||
| 1454 | Ga0207659_10046382 | |||
| 1455 | Ga0207687_10065440 | |||
| 1456 | Ga0207700_10168867 | |||
| 1457 | Ga0207700_10301374 | |||
| 1458 | Ga0207664_10124695 | |||
| 1459 | Ga0207644_10000036 | |||
| 1460 | Ga0207644_10114097 | |||
| 1461 | Ga0207690_10118641 | |||
| 1462 | Ga0207690_10345481 | |||
| 1463 | Ga0207706_10002700 | |||
| 1464 | Ga0207706_10247650 | |||
| 1465 | Ga0207709_10174233 | |||
| 1466 | Ga0207669_10057536 | |||
| 1467 | Ga0207665_10004541 | |||
| 1468 | Ga0207665_10081743 | |||
| 1469 | Ga0207691_10002238 | |||
| 1470 | Ga0207691_10097989 | |||
| 1471 | Ga0207691_10192500 | |||
| 1472 | Ga0207691_10329244 | |||
| 1473 | Ga0207711_10000469 | |||
| 1474 | Ga0207689_10012288 | |||
| 1475 | Ga0207661_10000613 | |||
| 1476 | Ga0207661_10053399 | |||
| 1477 | Ga0207661_10173608 | |||
| 1478 | Ga0207679_10133539 | |||
| 1479 | Ga0207667_10018828 | |||
| 1480 | Ga0207667_10084423 | |||
| 1481 | Ga0207667_10174101 | |||
| 1482 | Ga0207667_10377599 | |||
| 1483 | Ga0207712_10062581 | |||
| 1484 | Ga0207668_10021332 | |||
| 1485 | Ga0207668_10111939 | |||
| 1486 | Ga0207668_10117302 | |||
| 1487 | Ga0207668_10292653 | |||
| 1488 | Ga0207668_10421735 | |||
| 1489 | Ga0207640_10080475 | |||
| 1490 | Ga0207640_10138490 | |||
| 1491 | Ga0207658_10000007 | |||
| 1492 | Ga0207658_10101121 | |||
| 1493 | Ga0207677_10130335 | |||
| 1494 | Ga0207703_10036999 | |||
| 1495 | Ga0207639_10056591 | |||
| 1496 | Ga0207639_10277079 | |||
| 1497 | Ga0207678_10045082 | |||
| 1498 | Ga0207678_10079165 | |||
| 1499 | Ga0207678_10162783 | |||
| 1500 | Ga0207678_10198830 | |||
| 1501 | Ga0207678_10237184 | |||
| 1502 | Ga0207708_10088913 | |||
| 1503 | Ga0207702_10000006 | |||
| 1504 | Ga0207702_10128736 | |||
| 1505 | Ga0207641_10099781 | |||
| 1506 | Ga0207648_10008717 | |||
| 1507 | Ga0207648_10201861 | |||
| 1508 | Ga0207648_10265156 | |||
| 1509 | Ga0207676_10000003 | |||
| 1510 | Ga0207676_10005493 | |||
| 1511 | Ga0207676_10019688 | |||
| 1512 | Ga0207676_10023076 | |||
| 1513 | Ga0207674_10003449 | |||
| 1514 | Ga0207674_10108458 | |||
| 1515 | Ga0207674_10217126 | |||
| 1516 | Ga0207674_10287903 | |||
| 1517 | Ga0207675_100001986 | |||
| 1518 | Ga0207683_10021982 | |||
| 1519 | Ga0207683_10041690 | |||
| 1520 | Ga0207683_10089991 | |||
| 1521 | Ga0207683_10127715 | |||
| 1522 | Ga0207698_10175307 | |||
| 1523 | Ga0209389_1000039 | |||
| 1524 | Ga0209589_1000025 | |||
| 1525 | Ga0209489_100039 | |||
| 1526 | Ga0209489_100087 | |||
| 1527 | Ga0209700_100043 | |||
| 1528 | Ga0209700_100090 | |||
| 1529 | Ga0207428_10091011 | |||
| 1530 | Ga0268266_10002576 | |||
| 1531 | Ga0268266_10010607 | |||
| 1532 | Ga0268266_10023222 | |||
| 1533 | Ga0268266_10049211 | |||
| 1534 | Ga0268266_10117706 | |||
| 1535 | Ga0268266_10161996 | |||
| 1536 | Ga0268266_10190963 | |||
| 1537 | Ga0268266_10252527 | |||
| 1538 | Ga0268266_10576138 | |||
| 1539 | Ga0268265_10000404 | |||
| 1540 | Ga0268265_10518300 | |||
| 1541 | Ga0268264_10000009 | |||
| 1542 | Ga0268264_10000194 | |||
| 1543 | Ga0268264_10267649 | |||
| 1544 | Ga0265337_1007418 | |||
| 1545 | Ga0265326_10003492 | |||
| 1546 | Ga0265334_10052977 | |||
| 1547 | Ga0265318_10013434 | |||
| 1548 | Ga0265323_10001501 | |||
| 1549 | Ga0265336_10000238 | |||
| 1550 | Ga0307517_10000460 | |||
| 1551 | Ga0307515_10022467 | |||
| 1552 | Ga0265338_10000278 | |||
| 1553 | Ga0265338_10015741 | |||
| 1554 | Ga0265324_10001755 | |||
| 1555 | Ga0307511_10087368 | |||
| 1556 | Ga0265328_10062648 | |||
| 1557 | Ga0265325_10035604 | |||
| 1558 | Ga0265339_10000080 | |||
| 1559 | Ga0265331_10062111 | |||
| 1560 | Ga0265327_10133407 | |||
| 1561 | Ga0307513_10108928 | |||
| 1562 | Ga0307509_10046806 | |||
| 1563 | Ga0265313_10000948 | |||
| 1564 | Ga0307508_10009068 | |||
| 1565 | Ga0307508_10072172 | |||
| 1566 | Ga0307508_10117091 | |||
| 1567 | Ga0307508_10138745 | |||
| 1568 | Ga0316576_10039580 | |||
| 1569 | Ga0307516_10020275 | |||
| 1570 | Ga0307516_10024100 | |||
| 1571 | Ga0307516_10097455 | |||
| 1572 | Ga0307413_10260066 | |||
| 1573 | Ga0307507_10094534 | |||
| 1574 | Ga0307510_10003787 | |||
| 1575 | Ga0307510_10015985 | |||
| 1576 | Ga0307510_10034065 | |||
| 1577 | Ga0307510_10034602 | |||
| 1578 | Ga0373934_0040432 | |||
| 1579 | Ga0373934_0084520 | |||
| 1580 | Ga0373923_0003366 | |||
| 1581 | Ga0373936_0032224 | |||
| 1582 | Ga0373954_0003572 | |||
| 1583 | Ga0373943_0110063 | |||
| 1584 | Ga0373946_0027530 | |||
| 1585 | Ga0373924_0007531 | |||
| 1586 | Ga0373931_0019668 | |||
| 1587 | Ga0373935_0000718 | |||
| 1588 | Ga0373927_0000666 | |||
| 1589 | Ga0373927_0028210 | |||
| 1590 | Ga0373927_0055244 | |||
| 1591 | Ga0373927_0083230 | |||
| 1592 | Ga0373927_0116554 | |||
| 1593 | Ga0373933_0016974 | |||
| 1594 | Ga0373947_0004761 | |||
| 1595 | Ga0373947_0007585 | |||
| 1596 | Ga0373937_0351720 | |||
| 1597 | Ga0373925_0005280 | |||
| 1598 | Ga0373925_0017463 | |||
| 1599 | Ga0373925_0108934 | |||
| 1600 | Ga0373925_0116855 | |||
| 1601 | Ga0395899_0139018 | |||
| 1602 | Ga0395900_0001340 | |||
| 1603 | Ga0395900_0040887 | |||
| 1604 | Ga0395900_0062560 | |||
| 1605 | Ga0395900_0215928 | |||
| 1606 | Ga0395898_0005324 | |||
| 1607 | Ga0395898_0018293 | |||
| 1608 | Ga0395905_0006516 | |||
| 1609 | Ga0395905_0393524 | |||
| 1610 | Ga0395901_0007542 | |||
| 1611 | Ga0395901_0043404 | |||
| 1612 | Ga0395901_0070968 | |||
| 1613 | Ga0395901_0106088 | |||
| 1614 | Ga0395901_0278347 | |||
| 1615 | Ga0436365_0009505 | |||
| 1616 | Ga0436365_0646338 | |||
| 1617 | Ga0436365_1302408 | |||
| 1618 | Ga0436362_0825075 | |||
| 1619 | Ga0451837_0551018 | |||
| 1620 | Ga0439458_0010422 | |||
| 1621 | Ga0451577_0002389 | |||
| 1622 | Ga0453683_0008359 | |||
| 1623 | Ga0453684_0002985 | |||
| 1624 | Ga0453684_0004556 | |||
| 1625 | Ga0453684_0029755 | |||
| 1626 | Ga0453684_0434711 | |||
| 1627 | Ga0466957_0024632 | |||
| 1628 | Ga0466959_0065671 | |||
| 1629 | Ga0451576_0181107 | |||
| 1630 | Ga0451576_0551541 | |||
| 1631 | Ga0466967_0113558 | |||
| 1632 | Ga0466967_0127095 | |||
| 1633 | Ga0495592_0034591 | |||
| 1634 | Ga0495592_0142153 | |||
| 1635 | Ga0495603_0000206 | |||
| 1636 | Ga0495603_0069469 | |||
| 1637 | Ga0495603_0146188 | |||
| 1638 | Ga0495629_0000338 | |||
| 1639 | Ga0495638_0003637 | |||
| 1640 | Ga0495641_0005602 | |||
| 1641 | Ga0495653_0183846 | |||
| 1642 | Ga0495650_0048142 | |||
| 1643 | Ga0495580_0003372 | |||
| 1644 | Ga0495582_0000423 | |||
| 1645 | Ga0495582_0034111 | |||
| 1646 | Ga0495605_0034758 | |||
| 1647 | Ga0495639_0000039 | |||
| 1648 | Ga0495639_0026043 | |||
| 1649 | Ga0495664_0000847 | |||
| 1650 | Ga0495664_0009313 | |||
| 1651 | Ga0495664_0082926 | |||
| 1652 | Ga0495584_0054927 | |||
| 1653 | Ga0495585_0058241 | |||
| 1654 | Ga0495594_0006677 | |||
| 1655 | Ga0495594_0122324 | |||
| 1656 | Ga0495606_0001194 | |||
| 1657 | Ga0495606_0036283 | |||
| 1658 | Ga0495606_0073803 | |||
| 1659 | Ga0495610_0109050 | |||
| 1660 | Ga0495618_0003604 | |||
| 1661 | Ga0495628_0048999 | |||
| 1662 | Ga0495630_0024274 | |||
| 1663 | Ga0495630_0132772 | |||
| 1664 | Ga0495643_0008839 | |||
| 1665 | Ga0495644_0043687 | |||
| 1666 | Ga0495644_0044816 | |||
| 1667 | Ga0495648_0000536 | |||
| 1668 | Ga0495648_0012759 | |||
| 1669 | Ga0495663_0052662 | |||
| 1670 | Ga0495666_0007417 | |||
| 1671 | Ga0495652_0085687 | |||
| 1672 | Ga0495652_0113761 | |||
| 1673 | Ga0495665_0000082 | |||
| 1674 | Ga0495665_0084964 | |||
| 1675 | Ga0495640_0177856 | |||
| 1676 | Ga0495609_0077069 | |||
| 1677 | Ga0495645_0017895 | |||
| 1678 | Ga0495622_0011857 | |||
| 1679 | Ga0495622_0024190 | |||
| 1680 | Ga0495633_0015568 | |||
| 1681 | Ga0495667_0043015 | |||
| 1682 | Ga0495656_0007521 | |||
| 1683 | Ga0495656_0074139 | |||
| 1684 | Ga0495668_0116184 | |||
| 1685 | Ga0495634_0000776 | |||
| 1686 | Ga0495635_0009338 | |||
| 1687 | Ga0495659_0002499 | |||
| 1688 | Ga0495588_0033674 | |||
| 1689 | Ga0495657_0025940 | |||
| 1690 | Ga0495599_0012128 | |||
| 1691 | Ga0495623_0149613 | |||
| 1692 | Ga0495646_0137791 | |||
| 1693 | Ga0495658_0003324 | |||
| 1694 | Ga0495658_0004531 | |||
| 1695 | Ga0495669_0031299 | |||
| 1696 | Ga0495613_0016376 | |||
| 1697 | Ga0495624_0159753 | |||
| 1698 | Ga0495624_0165888 | |||
| 1699 | Ga0495624_0209447 | |||
| 1700 | Ga0495670_0068221 | |||
| 1701 | Ga0495649_0111470 | |||
| 1702 | Ga0495589_0202372 | |||
| 1703 | Ga0495600_0100275 | |||
| 1704 | Ga0495581_0000006 | |||
| 1705 | Ga0495581_0010765 | |||
| 1706 | Ga0495604_0005606 | |||
| 1707 | Ga0495604_0102161 | |||
| 1708 | Ga0495636_0014126 | |||
| 1709 | Ga0495674_0012193 | |||
| 1710 | Ga0495672_0008439 | |||
| 1711 | Ga0495672_0037381 | |||
| 1712 | Ga0495680_0005494 | |||
| 1713 | Ga0495683_0132631 | |||
| 1714 | Ga0495675_0002994 | |||
| 1715 | Ga0495684_0001984 | |||
| 1716 | Ga0495684_0050956 | |||
| 1717 | Ga0495684_0109343 | |||
| 1718 | Ga0495593_0000032 | |||
| 1719 | Ga0495602_0039658 | |||
| 1720 | Ga0495614_0014894 | |||
| 1721 | Ga0496100_0018954 | |||
| 1722 | Ga0496101_0015301 | |||
| 1723 | Ga0496101_0151395 | |||
| 1724 | Ga0496101_0155163 | |||
| 1725 | Ga0496101_0174929 | |||
| 1726 | Ga0496102_0019308 | |||
| 1727 | Ga0496102_0334042 | |||
| 1728 | Ga0496103_0039846 | |||
| 1729 | Ga0496104_0031856 | |||
| 1730 | Ga0496104_0032721 | |||
| 1731 | Ga0496104_0173868 | |||
| 1732 | Ga0496104_0178162 | |||
| 1733 | Ga0496105_0059106 | |||
| 1734 | Ga0496106_0002364 | |||
| 1735 | Ga0496106_0020140 | |||
| 1736 | Ga0496106_0039179 | |||
| 1737 | Ga0496106_0158596 | |||
| 1738 | Ga0496106_0194625 | |||
| 1739 | Ga0496108_0020520 | |||
| 1740 | Ga0496108_0261238 | |||
| 1741 | Ga0496109_0088902 | |||
| 1742 | Ga0496109_0412342 | |||
| 1743 | Ga0496110_0554298 | |||
| 1744 | Ga0496111_0016061 | |||
| 1745 | Ga0496111_0021658 | |||
| 1746 | Ga0496111_0139669 | |||
| 1747 | Ga0496111_0452783 | |||
| 1748 | Ga0496112_0000029 | |||
| 1749 | Ga0496112_0108628 | |||
| 1750 | Ga0496112_0440467 | |||
| 1751 | Ga0496113_0060918 | |||
| 1752 | Ga0496113_0068963 | |||
| 1753 | Ga0496113_0116139 | |||
| 1754 | Ga0496114_0042973 | |||
| 1755 | Ga0496114_0056894 | |||
| 1756 | Ga0496114_0269007 | |||
| 1757 | Ga0496114_0527816 | |||
| 1758 | Ga0496115_0006927 | |||
| 1759 | Ga0496115_0052564 | |||
| 1760 | Ga0496117_0016836 | |||
| 1761 | Ga0496118_0002319 | |||
| 1762 | Ga0496118_0032776 | |||
| 1763 | Ga0496120_0022972 | |||
| 1764 | Ga0496121_0000352 | |||
| 1765 | Ga0496121_0003091 | |||
| 1766 | Ga0496121_0018747 | |||
| 1767 | Ga0496121_0019666 | |||
| 1768 | Ga0496121_0085513 | |||
| 1769 | Ga0496121_0091056 | |||
| 1770 | Ga0496121_0120703 | |||
| 1771 | Ga0496121_0158117 | |||
| 1772 | Ga0496124_0001443 | |||
| 1773 | Ga0496124_0054966 | |||
| 1774 | Ga0496124_0107167 | |||
| 1775 | Ga0496125_0008186 | |||
| 1776 | Ga0496125_0026403 | |||
| 1777 | Ga0496125_0029894 | |||
| 1778 | Ga0496126_0003276 | |||
| 1779 | Ga0496126_0005702 | |||
| 1780 | Ga0496126_0013048 | |||
| 1781 | Ga0496126_0014279 | |||
| 1782 | Ga0496126_0016514 | |||
| 1783 | Ga0496126_0042845 | |||
| 1784 | Ga0496126_0051752 | |||
| 1785 | Ga0496126_0065029 | |||
| 1786 | Ga0496126_0206382 | |||
| 1787 | Ga0501031_0002569 | |||
| 1788 | Ga0501031_0008055 | |||
| 1789 | Ga0501032_0000301 | |||
| 1790 | Ga0501032_0005845 | |||
| 1791 | Ga0501032_0017725 | |||
| 1792 | Ga0501032_0030565 | |||
| 1793 | Ga0501032_0097679 | |||
| 1794 | Ga0501032_0282915 | |||
| 1795 | Ga0501033_0000270 | |||
| 1796 | Ga0501033_0001377 | |||
| 1797 | Ga0501033_0010053 | |||
| 1798 | Ga0501033_0080248 | |||
| 1799 | Ga0501034_0000715 | |||
| 1800 | Ga0501034_0030327 | |||
| 1801 | Ga0501036_0000043 | |||
| 1802 | Ga0501036_0000128 | |||
| 1803 | Ga0501036_0006458 | |||
| 1804 | Ga0501036_0007332 | |||
| 1805 | Ga0501036_0063189 | |||
| 1806 | Ga0501037_0000040 | |||
| 1807 | Ga0501037_0006378 | |||
| 1808 | Ga0501037_0006531 | |||
| 1809 | Ga0501037_0009276 | |||
| 1810 | Ga0501037_0051620 | |||
| 1811 | Ga0501037_0097398 | |||
| 1812 | Ga0501037_0247706 | |||
| 1813 | Ga0501038_0000131 | |||
| 1814 | Ga0501038_0000630 | |||
| 1815 | Ga0501038_0038383 | |||
| 1816 | Ga0501038_0198446 | |||
| 1817 | Ga0501039_0000106 | |||
| 1818 | Ga0501039_0006604 | |||
| 1819 | Ga0501039_0096394 | |||
| 1820 | Ga0501040_0068247 | |||
| 1821 | Ga0501041_0018507 | |||
| 1822 | Ga0501042_0159404 | |||
| 1823 | Ga0501042_0170445 | |||
| 1824 | Ga0501043_0000074 | |||
| 1825 | Ga0501043_0005735 | |||
| 1826 | Ga0501043_0036399 | |||
| 1827 | Ga0501046_0000074 | |||
| 1828 | Ga0501046_0005024 | |||
| 1829 | Ga0501046_0013483 | |||
| 1830 | Ga0501046_0014460 | |||
| 1831 | Ga0501047_0000346 | |||
| 1832 | Ga0501047_0020019 | |||
| 1833 | Ga0501047_0057626 | |||
| 1834 | Ga0501047_0078407 | |||
| 1835 | Ga0501048_0000349 | |||
| 1836 | Ga0501048_0000550 | |||
| 1837 | Ga0501048_0009855 | |||
| 1838 | Ga0501067_0007707 | |||
| 1839 | Ga0501067_0037192 | |||
| 1840 | Ga0501067_0118106 | |||
| 1841 | Ga0501068_0006614 | |||
| 1842 | Ga0501068_0021802 | |||
| 1843 | Ga0501068_0071766 | |||
| 1844 | Ga0501069_0003736 | |||
| 1845 | Ga0501069_0003813 | |||
| 1846 | Ga0501070_0005383 | |||
| 1847 | Ga0501070_0022234 | |||
| 1848 | Ga0501070_0046564 | |||
| 1849 | Ga0501070_0068726 | |||
| 1850 | Ga0501071_0220347 | |||
| 1851 | Ga0501072_0001372 | |||
| 1852 | Ga0501072_0002038 | |||
| 1853 | Ga0501073_0000085 | |||
| 1854 | Ga0501073_0004871 | |||
| 1855 | Ga0501073_0026762 | |||
| 1856 | Ga0501074_0000145 | |||
| 1857 | Ga0501074_0159786 | |||
| 1858 | Ga0501079_0001762 | |||
| 1859 | Ga0501079_0012601 | |||
| 1860 | Ga0501080_0005166 | |||
| 1861 | Ga0501080_0005596 | |||
| 1862 | Ga0501080_0093793 | |||
| 1863 | Ga0501080_0195710 | |||
| 1864 | Ga0501081_0228803 | |||
| 1865 | Ga0501083_0015067 | |||
| 1866 | Ga0501083_0015766 | |||
| 1867 | Ga0501083_0099940 | |||
| 1868 | Ga0501083_0117923 | |||
| 1869 | Ga0501035_0001345 | |||
| 1870 | Ga0501035_0002989 | |||
| 1871 | Ga0501035_0008293 | |||
| 1872 | Ga0501035_0013984 | |||
| 1873 | Ga0501035_0054696 | |||
| 1874 | Ga0501035_0301024 | |||
| 1875 | Ga0501035_0418591 | |||
| 1876 | Ga0501044_0000667 | |||
| 1877 | Ga0501044_0027021 | |||
| 1878 | Ga0501044_0032753 | |||
| 1879 | Ga0501044_0081071 | |||
| 1880 | Ga0501044_0083394 | |||
| 1881 | Ga0501044_0109258 | |||
| 1882 | Ga0501044_0165131 | |||
| 1883 | Ga0501044_0209343 | |||
| 1884 | Ga0501045_0003017 | |||
| 1885 | Ga0501045_0012743 | |||
| 1886 | Ga0501045_0137643 | |||
| 1887 | nmdc:mga03n38_1891_c1 | |||
| 1888 | nmdc:mga03n38_91863_c1 | |||
| 1889 | nmdc:mga00v17_135430_c1 | |||
| 1890 | nmdc:mga0yw44_134578_c1 | |||
| 1891 | nmdc:mga0yw44_222728_c1 | |||
| 1892 | nmdc:mga0yw44_63789_c1 | |||
| 1893 | nmdc:mga0k408_157748_c1 | |||
| 1894 | nmdc:mga0k408_35179_c1 | |||
| 1895 | nmdc:mga0k408_60795_c1 | |||
| 1896 | nmdc:mga0k408_65696_c1 | |||
| 1897 | nmdc:mga06z11_27139_c1 | |||
| 1898 | nmdc:mga06z11_54543_c1 | |||
| 1899 | nmdc:mga04h51_3952_c1 | |||
| 1900 | nmdc:mga08y16_382969_c1 | |||
| 1901 | nmdc:mga0n895_227122_c1 | |||
| 1902 | nmdc:mga0n895_357578_c1 | |||
| 1903 | nmdc:mga0n895_4726_c1 | |||
| 1904 | nmdc:mga08x19_67652_c1 | |||
| 1905 | nmdc:mga0sz30_12669_c1 | |||
| 1906 | nmdc:mga0sz30_18835_c1 | |||
| 1907 | nmdc:mga0sz30_28201_c1 | |||
| 1908 | Ga0495601_0085301 | |||
| 1909 | Ga0500635_0012868 | |||
| 1910 | Ga0500643_000443 | |||
| 1911 | Ga0500647_0023852 | |||
| 1912 | Ga0500566_0000270 | |||
| 1913 | Ga0500566_0000780 | |||
| 1914 | Ga0500566_0014575 | |||
| 1915 | Ga0500641_0008048 | |||
| 1916 | Ga0500641_0008602 | |||
| 1917 | Ga0500641_0109731 | |||
| 1918 | Ga0500555_023586 | |||
| 1919 | Ga0500556_0004536 | |||
| 1920 | Ga0500556_0099071 | |||
| 1921 | Ga0500572_001115 | |||
| 1922 | Ga0500594_0043603 | |||
| 1923 | Ga0500595_000328 | |||
| 1924 | Ga0500595_001866 | |||
| 1925 | Ga0500595_012540 | |||
| 1926 | Ga0500614_001182 | |||
| 1927 | Ga0500617_115703 | |||
| 1928 | Ga0500559_0001813 | |||
| 1929 | Ga0500564_146053 | |||
| 1930 | Ga0500568_0084481 | |||
| 1931 | Ga0500573_0017246 | |||
| 1932 | Ga0500577_0030140 | |||
| 1933 | Ga0500588_0009801 | |||
| 1934 | Ga0500603_000151 | |||
| 1935 | Ga0500603_008750 | |||
| 1936 | Ga0500616_0053704 | |||
| 1937 | Ga0500622_0092915 | |||
| 1938 | Ga0500638_057307 | |||
| 1939 | Ga0500639_000065 | |||
| 1940 | Ga0500636_0000584 | |||
| 1941 | Ga0500636_0023297 | |||
| 1942 | Ga0500637_0000413 | |||
| 1943 | Ga0500637_0090652 | |||
| 1944 | Ga0500637_0157770 | |||
| 1945 | Ga0500645_025589 | |||
| 1946 | Ga0500645_054165 | |||
| 1947 | Ga0500596_000494 | |||
| 1948 | Ga0500599_000161 | |||
| 1949 | Ga0500601_000483 | |||
| 1950 | Ga0501084_0002085 | |||
| 1951 | Ga0501084_0003469 | |||
| 1952 | Ga0501082_0018999 | |||
| 1953 | Ga0501082_0033487 | |||
| 1954 | Ga0501082_0087916 | |||
| 1955 | 2507505999 | |||
| 1956 | 2508540187 | |||
| 1957 | 2508696261 | |||
| 1958 | 2509148190 | |||
| 1959 | 2511397326 | |||
| 1960 | 2513592443 | |||
| 1961 | 2513624910 | |||
| 1962 | 2513638257 | |||
| 1963 | 2513649095 | |||
| 1964 | 2513657558 | |||
| 1965 | 2513674944 | |||
| 1966 | 2513701556 | |||
| 1967 | 2513716261 | |||
| 1968 | 2513861114 | |||
| 1969 | 2513877170 | |||
| 1970 | 2513916811 | |||
| 1971 | 2514014539 | |||
| 1972 | 2517103189 | |||
| 1973 | 2517889721 | |||
| 1974 | 2524440757 | |||
| 1975 | 2524533113 | |||
| 1976 | 2528850764 | |||
| 1977 | 2617347882 | |||
| 1978 | 2617374804 | |||
| 1979 | 2644290425 | |||
| 1980 | 2671119571 | |||
| 1981 | 2723848926 | |||
| 1982 | 2728748933 | |||
| 1983 | 2745075998 | |||
| 1984 | 2758640684 | |||
| 1985 | 2793061467 | |||
| 1986 | 2793070299 | |||
| 1987 | 2793078930 | |||
| 1988 | 2805916231 | |||
| 1989 | 2818240486 | |||
| 1990 | 2824603706 | |||
| 1991 | 2824610708 | |||
| 1992 | 2824624968 | |||
| 1993 | 2824630995 | |||
| 1994 | 2824641243 | |||
| 1995 | 2824649673 | |||
| 1996 | 2824657910 | |||
| 1997 | 2824666907 | |||
| 1998 | 2824674085 | |||
| 1999 | 2824690751 | |||
| 2000 | 2824703321 | |||
| 2001 | 2824710962 | |||
| 2002 | 2824719598 | |||
| 2003 | 2824728573 | |||
| 2004 | 2824737933 | |||
| 2005 | 2824752186 | |||
| 2006 | 2824760348 | |||
| 2007 | 2824772484 | |||
| 2008 | 2824776341 | |||
| 2009 | 2838125008 | |||
| 2010 | 2841945747 | |||
| 2011 | 2841956846 | |||
| 2012 | 2841964029 | |||
| 2013 | 2841973594 | |||
| 2014 | 2841981928 | |||
| 2015 | 2841989482 | |||
| 2016 | 2842044467 | |||
| 2017 | 2842051544 | |||
| 2018 | 2842778407 | |||
| 2019 | 2847939359 | |||
| 2020 | 2847941115 | |||
| 2021 | 2849082101 | |||
| 2022 | 2857513418 | |||
| 2023 | 2874130557 | |||
| 2024 | 2874596264 | |||
| 2025 | 2874610051 | |||
| 2026 | 2874616536 | |||
| 2027 | 2874622554 | |||
| 2028 | 2874633467 | |||
| 2029 | 2874650251 | |||
| 2030 | 2876763652 | |||
| 2031 | 2876776729 | |||
| 2032 | 2876824519 | |||
| 2033 | 2879080866 | |||
| 2034 | 2879087032 | |||
| 2035 | 2879104363 | |||
| 2036 | 2879116915 | |||
| 2037 | 2879133711 | |||
| 2038 | 2879148213 | |||
| 2039 | 2881369522 | |||
| 2040 | 2881669762 | |||
| 2041 | 2885367832 | |||
| 2042 | 2885378461 | |||
| 2043 | 2885386468 | |||
| 2044 | 2885412984 | |||
| 2045 | 2888387161 | |||
| 2046 | 2888421257 | |||
| 2047 | 2903750330 | |||
| 2048 | 2903775238 | |||
| 2049 | 2904671439 | |||
| 2050 | 2904691971 | |||
| 2051 | 2904707522 | |||
| 2052 | 2904719731 | |||
| 2053 | 2906614697 | |||
| 2054 | 2906631358 | |||
| 2055 | 2906636216 | |||
| 2056 | 2906646702 | |||
| 2057 | 2906661026 | |||
| 2058 | 2908746475 | |||
| 2059 | 2908757431 | |||
| 2060 | 2908777286 | |||
| 2061 | 2922377328 | |||
| 2062 | 2922389453 | |||
| 2063 | 2922398430 | |||
| 2064 | 2922426559 | |||
| 2065 | 2929622130 | |||
| 2066 | 2929630225 | |||
| 2067 | 2932787853 | |||
| 2068 | 2932795971 | |||
| 2069 | 2932807548 | |||
| 2070 | 2932817577 | |||
| 2071 | 2932826263 | |||
| 2072 | 2932835119 | |||
| 2073 | 2933584254 | |||
| 2074 | 2935614424 | |||
| 2075 | 2935620497 | |||
| 2076 | 2935632899 | |||
| 2077 | 2935640819 | |||
| 2078 | 2935649453 | |||
| 2079 | 2935657775 | |||
| 2080 | 2935670322 | |||
| 2081 | 2935679752 | |||
| 2082 | 2935687321 | |||
| 2083 | 2935696708 | |||
| 2084 | 2935709200 | |||
| 2085 | 2935718780 | |||
| 2086 | 2935728432 | |||
| 2087 | 2935736971 | |||
| 2088 | 2935746026 | |||
| 2089 | 2935753287 | |||
| 2090 | 2935766320 | |||
| 2091 | 2935770291 | |||
| 2092 | 2935777682 | |||
| 2093 | 2935786656 | |||
| 2094 | 2935794710 | |||
| 2095 | 2935809002 | |||
| 2096 | 2935813819 | |||
| 2097 | 2935826642 | |||
| 2098 | 2935832326 | |||
| 2099 | 2935844031 | |||
| 2100 | 2935851064 | |||
| 2101 | 2935862823 | |||
| 2102 | 2935864566 | |||
| 2103 | 2935875082 | |||
| 2104 | 2935890238 | |||
| 2105 | 2935913114 | |||
| 2106 | 2935922536 | |||
| 2107 | 2935930961 | |||
| 2108 | 2935939705 | |||
| 2109 | 2935946654 | |||
| 2110 | 2935956145 | |||
| 2111 | 2935965051 | |||
| 2112 | 2935972938 | |||
| 2113 | 2935978146 | |||
| 2114 | 2935985730 | |||
| 2115 | 2935999299 | |||
| 2116 | 2936005854 | |||
| 2117 | 2936011994 | |||
| 2118 | 2936020925 | |||
| 2119 | 2936029287 | |||
| 2120 | 2936039375 | |||
| 2121 | 2936048389 | |||
| 2122 | 2936056500 | |||
| 2123 | 2940559200 | |||
| 2124 | 2941508436 | |||
| 2125 | 2941516267 | |||
| 2126 | 2941524717 | |||
| 2127 | 2941541894 | |||
| 2128 | 3005475905 | |||
| 2129 | 3005491148 | |||
| 2130 | 3005510989 | |||
| 2131 | 3005591834 | |||
| 2132 | 3005711890 | |||
| 2133 | 8006931481 | |||
| 2134 | 8006937217 | |||
| 2135 | 8006966234 | |||
| 2136 | 8006977228 | |||
| 2137 | 8006993039 | |||
| 2138 | 8006996899 | |||
| 2139 | 8016517182 | |||
| 2140 | 8016527062 | |||
| 2141 | 8016532144 | |||
| 2142 | 8016545354 | |||
| 2143 | 8016556734 | |||
| 2144 | 8016565091 | |||
| 2145 | 8016570441 | |||
| 2146 | 8016582973 | |||
| 2147 | 8016585326 | |||
| 2148 | 8016602739 | |||
| 2149 | 8016605596 | |||
| 2150 | 8016617514 | |||
| 2151 | 8016624059 | |||
| 2152 | 8016634809 | |||
| 2153 | 8017059406 | |||
| 2154 | 8019531962 | |||
| 2155 | 8019539574 | |||
| 2156 | 8019551081 | |||
| 2157 | 8019571513 | |||
| 2158 | 8019576212 | |||
| 2159 | 8019594086 | |||
| 2160 | 8019607476 | |||
| 2161 | 8019621884 | |||
| 2162 | 8019639171 | |||
| 2163 | 8019651322 | |||
| 2164 | 8019668254 | |||
| 2165 | 8019677705 | |||
| 2166 | 8019687237 | |||
| 2167 | 8019693219 | |||
| 2168 | 8055743619 | |||
| 2169 | 8056675289 | |||
| 2170 | 8056681593 | |||
| 2171 | 8056692930 | |||
| 2172 | 8056974074 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
127
324
0.81
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.6681 | 39 | 251 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.6558 | 44 | 255 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.6437 | 44 | 255 |
| 3fh6-assembly2.cif.gz_H | crystal structure of the resting state maltose transporter from e. coli | 0.6286 | 58 | 255 |
| 2r6g-assembly1.cif.gz_F | the crystal structure of the e. coli maltose transporter | 0.6268 | 39 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3puzF04 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7632 | 53 | 208 | 1.10.3720.10 |
| af_P0AEB0_20_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6882 | 24 | 260 | 1.10.3720.10 |
| af_P71745_27_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.669 | 22 | 259 | 1.10.3720.10 |
| af_P71746_10_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6665 | 22 | 265 | 1.10.3720.10 |
| af_Q2G2A9_6_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6649 | 21 | 263 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8KAJ4-F1-model_v4 | deleted | 0.8747 | 24 | 157 |
|
| AF-A0A351BIM1-F1-model_v4 | Sulfate/thiosulfate ABC transporter permease CysW | 0.8568 | 49 | 210 |
GO:0005886
GO:0015419 |
| AF-A0A351BIM1-F1-model_v4 | Sulfate/thiosulfate ABC transporter permease CysW | 0.8474 | 49 | 210 |
GO:0005886
GO:0015419 |
| AF-A0A1F7MUY6-F1-model_v4 | Molybdenum ABC transporter permease subunit | 0.844 | 53 | 203 |
GO:0005886
GO:0055085 |
| AF-A0A328V5M5-F1-model_v4 | deleted | 0.84 | 22 | 195 |
|