F489799

General Info

Members Datasets Scaffolds Average Seq Length
1087 626 2172 295

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100000411|Ga0068860_10000041148
Length 334
Sequence MTLETSLQRTRFTAPDGSGRIAPMIPVRGSGPSMEPSPSLQPSHDDVGPIRLAARDNLRTEPRAVRIAIIAAALSFLGVFVVLPLVLVFAEAFSKGIGAYLAALSDPEALSAIRLTLLVAAVSVSINLVFGLMAAWAIAKFEFSGKTFLTTLIDLPFSVSPVISGLVFVLLFGAQGYWGAWLRDHDIQVLFAVPGIALATTFVTFPFVARALIPLMQEQGTQEEEAAISLGASGLQTFFRVTLPNIKWGVLYGVLLCNARAMGEFGAVSVVSGHIRGETNTMPLLVEILYNEYQFVASFAIASLLAMXXXXTLVAKAFLERHLDEGQQEVSHDH

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
88 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
89 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
190 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
191 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
192 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
198 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
201 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
202 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
203 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
211 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
212 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
244 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
363 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
379 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
380 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
381 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
382 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
383 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
384 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
385 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
386 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
387 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
388 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
389 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
390 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
391 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
394 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
395 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
396 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
397 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
398 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
399 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
400 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
401 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
402 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
403 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
404 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
405 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
406 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
407 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
408 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
409 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
410 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
411 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
412 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
413 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
414 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
415 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
416 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
417 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
418 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
419 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
420 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
421 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
422 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
423 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
424 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
425 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
426 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
427 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
428 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
429 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
430 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
431 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
432 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
433 2643221651 Afipia sp. Root123D2 Isolate Unclassified
434 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
435 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
436 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
437 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
438 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
439 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
440 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
441 2791355199
442 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
443 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
444 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
445 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
446 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
447 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
448 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
449 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
450 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
451 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
452 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
453 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
454 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
455 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
456 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
457 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
458 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
459 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
460 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
461 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
462 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
463 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
464 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
465 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
466 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
467 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
468 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
469 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
470 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
471 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
472 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
473 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
474 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
475 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
476 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
477 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
478 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
479 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
480 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
481 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
482 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
483 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
484 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
485 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
486 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
487 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
488 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
489 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
490 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
491 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
492 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
493 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
494 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
495 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
496 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
497 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
498 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
499 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
500 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
501 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
502 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
503 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
504 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
505 2904699407
506 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
507 2906610324
508 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
509 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
510 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
511 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
512 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
513 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
514 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
515 2922368715
516 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
517 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
518 2922425934
519 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
520 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
521 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
522 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
523 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
524 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
525 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
526 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
527 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
528 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
529 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
530 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
531 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
532 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
533 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
534 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
535 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
536 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
537 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
538 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
539 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
540 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
541 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
542 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
543 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
544 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
545 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
546 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
547 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
548 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
549 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
550 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
551 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
552 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
553 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
554 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
555 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
556 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
557 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
558 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
559 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
560 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
561 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
562 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
563 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
564 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
565 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
566 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
567 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
568 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
569 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
570 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
571 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
572 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
573 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
574 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
575 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
576 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
577 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
578 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
579 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
580 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
581 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
582 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
583 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
584 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
585 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
586 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
587 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
588 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
589 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
590 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
591 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
592 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
593 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
594 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
595 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
596 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
597 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
598 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
599 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
600 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
601 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
602 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
603 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
604 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
605 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
606 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
607 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
608 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
609 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
610 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
611 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
612 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
613 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
614 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
615 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
616 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
617 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
618 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
619 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
620 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
621 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
622 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
623 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
624 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
625 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
626 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.31
Metatranscriptomes 0
Isolates 19.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.94
Nodule 15.46
Rhizoplane 3.68
Rhizosphere 61.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100000411 3300005843 Bacteria 55810
2 LJQas_1003629 3300000549 Bacteria 2054
3 JGI24740J21852_10010589 3300001979 Bacteria 3543
4 JGI24735J21928_10038218 3300002067 Bacteria 1406
5 JGI24750J21931_1003497 3300002070 Bacteria 1880
6 JGI24744J21845_10006597 3300002077 Bacteria 2406
7 JGI25153J46596_10000600 3300003215 Bacteria 22036
8 JGI25153J46596_10001390 3300003215 Bacteria 14494
9 JGI25153J46596_10002696 3300003215 Bacteria 10122
10 JGI25160J50197_1001415 3300003354 Bacteria 12018
11 JGI25404J52841_10000278 3300003659 Bacteria 6581
12 JGI25404J52841_10009489 3300003659 Bacteria 2081
13 JGI25404J52841_10011990 3300003659 Bacteria 1874
14 Ga0055542_1006533 3300003762 Bacteria 2481
15 Ga0055536_1008613 3300003781 Bacteria 4352
16 Ga0055531_10031132 3300003794 Bacteria 1774
17 Ga0065165_1002667 3300005262 Bacteria 14412
18 Ga0065165_1013580 3300005262 Bacteria 3227
19 Ga0070676_10016539 3300005328 Bacteria 4080
20 Ga0070683_100025289 3300005329 Bacteria 5330
21 Ga0070683_100130359 3300005329 Bacteria 2379
22 Ga0070683_100215018 3300005329 Bacteria 1827
23 Ga0070666_10243708 3300005335 Bacteria 1271
24 Ga0070680_100010901 3300005336 Bacteria 7023
25 Ga0070680_100350873 3300005336 Bacteria 1255
26 Ga0070682_100174131 3300005337 Bacteria 1498
27 Ga0070682_100284830 3300005337 Bacteria 1206
28 Ga0070660_100004981 3300005339 Bacteria 9181
29 Ga0070660_100311084 3300005339 Bacteria 1293
30 Ga0070660_100323793 3300005339 Bacteria 1267
31 Ga0070689_100027366 3300005340 Bacteria 4298
32 Ga0070661_100135531 3300005344 Bacteria 1853
33 Ga0070661_100311839 3300005344 Bacteria 1227
34 Ga0070692_10032810 3300005345 Bacteria 2614
35 Ga0070668_100003914 3300005347 Bacteria 10999
36 Ga0070668_100076766 3300005347 Bacteria 2610
37 Ga0070668_100209627 3300005347 Bacteria 1602
38 Ga0070669_100000033 3300005353 Bacteria 144544
39 Ga0070669_100000387 3300005353 Bacteria 33852
40 Ga0070669_100037707 3300005353 Bacteria 3507
41 Ga0070675_100061546 3300005354 Bacteria 3099
42 Ga0070675_100589391 3300005354 Bacteria 1008
43 Ga0070671_100000012 3300005355 Bacteria 196420
44 Ga0070671_100017669 3300005355 Bacteria 5780
45 Ga0070671_100109525 3300005355 Bacteria 2320
46 Ga0070674_100020257 3300005356 Bacteria 4244
47 Ga0070673_100076660 3300005364 Bacteria 2700
48 Ga0070673_100233740 3300005364 Bacteria 1595
49 Ga0070688_100004706 3300005365 Bacteria 7127
50 Ga0070688_100017655 3300005365 Bacteria 4099
51 Ga0070659_100072567 3300005366 Bacteria 2739
52 Ga0070667_100000279 3300005367 Bacteria 58238
53 Ga0070667_100136017 3300005367 Bacteria 2149
54 Ga0070703_10067958 3300005406 Bacteria 1183
55 Ga0070709_10000375 3300005434 Bacteria 27523
56 Ga0070714_100212996 3300005435 Bacteria 1772
57 Ga0070713_100041867 3300005436 Bacteria 3735
58 Ga0070713_100089707 3300005436 Bacteria 2641
59 Ga0070710_10000275 3300005437 Bacteria 24270
60 Ga0070710_10017525 3300005437 Bacteria 3667
61 Ga0070710_10040067 3300005437 Bacteria 2581
62 Ga0070710_10228597 3300005437 Bacteria 1187
63 Ga0070711_100006414 3300005439 Bacteria 7094
64 Ga0070711_100020739 3300005439 Bacteria 4240
65 Ga0070711_100022239 3300005439 Bacteria 4107
66 Ga0070663_100018265 3300005455 Bacteria 4593
67 Ga0070663_100161988 3300005455 Bacteria 1722
68 Ga0070678_100106912 3300005456 Bacteria 2181
69 Ga0070662_100134192 3300005457 Bacteria 1912
70 Ga0070662_100140170 3300005457 Bacteria 1873
71 Ga0070662_100391421 3300005457 Bacteria 1145
72 Ga0070681_10061629 3300005458 Bacteria 3725
73 Ga0070681_10216576 3300005458 Bacteria 1831
74 Ga0070681_10308969 3300005458 Bacteria 1490
75 Ga0068867_100029064 3300005459 Bacteria 3982
76 Ga0070685_10000001 3300005466 Bacteria 349867
77 Ga0070685_10049514 3300005466 Bacteria 2424
78 Ga0070706_100219916 3300005467 Bacteria 1773
79 Ga0070707_100083474 3300005468 Bacteria 3087
80 Ga0070679_100034040 3300005530 Bacteria 5047
81 Ga0070679_100053135 3300005530 Bacteria 4033
82 Ga0070679_100075094 3300005530 Bacteria 3371
83 Ga0070679_100076591 3300005530 Bacteria 3334
84 Ga0070684_100001508 3300005535 Bacteria 16819
85 Ga0070684_100028072 3300005535 Bacteria 4757
86 Ga0070684_100053196 3300005535 Bacteria 3523
87 Ga0070684_100168155 3300005535 Bacteria 1991
88 Ga0070684_100398277 3300005535 Bacteria 1269
89 Ga0068853_100000629 3300005539 Bacteria 24248
90 Ga0068853_100086846 3300005539 Bacteria 2744
91 Ga0068853_100296802 3300005539 Bacteria 1493
92 Ga0070672_100005802 3300005543 Bacteria 8236
93 Ga0070672_100147354 3300005543 Bacteria 1945
94 Ga0070686_100014547 3300005544 Bacteria 4539
95 Ga0070696_100024651 3300005546 Bacteria 4089
96 Ga0070696_100313661 3300005546 Bacteria 1205
97 Ga0070665_100078792 3300005548 Bacteria 3301
98 Ga0070665_100102324 3300005548 Bacteria 2868
99 Ga0070665_100135855 3300005548 Bacteria 2462
100 Ga0070665_100313579 3300005548 Bacteria 1572
101 Ga0070665_100326537 3300005548 Bacteria 1538
102 Ga0070704_100044331 3300005549 Bacteria 3090
103 Ga0070704_100110635 3300005549 Bacteria 2089
104 Ga0068855_100029638 3300005563 Bacteria 6541
105 Ga0068855_100034408 3300005563 Bacteria 6043
106 Ga0068855_100058404 3300005563 Bacteria 4518
107 Ga0068855_100094463 3300005563 Bacteria 3448
108 Ga0068855_100098198 3300005563 Bacteria 3374
109 Ga0068855_100237342 3300005563 Bacteria 2038
110 Ga0068855_100250279 3300005563 Bacteria 1977
111 Ga0068855_100582204 3300005563 Bacteria 1209
112 Ga0070664_100096036 3300005564 Bacteria 2571
113 Ga0070664_100387472 3300005564 Bacteria 1277
114 Ga0068857_100036777 3300005577 Bacteria 4338
115 Ga0068857_100064583 3300005577 Bacteria 3255
116 Ga0068857_100066950 3300005577 Bacteria 3196
117 Ga0068857_100084387 3300005577 Bacteria 2838
118 Ga0068857_100274189 3300005577 Bacteria 1551
119 Ga0068854_100026612 3300005578 Bacteria 3977
120 Ga0068854_100043105 3300005578 Bacteria 3196
121 Ga0068854_100150904 3300005578 Bacteria 1792
122 Ga0068854_100354045 3300005578 Bacteria 1202
123 Ga0068856_100003776 3300005614 Bacteria 15173
124 Ga0068856_100062045 3300005614 Bacteria 3692
125 Ga0068856_100338831 3300005614 Bacteria 1522
126 Ga0070702_100215099 3300005615 Bacteria 1282
127 Ga0068852_100005759 3300005616 Bacteria 8896
128 Ga0068852_100064924 3300005616 Bacteria 3183
129 Ga0068852_100064930 3300005616 Bacteria 3183
130 Ga0068864_100000018 3300005618 Bacteria 277365
131 Ga0068864_100047366 3300005618 Bacteria 3692
132 Ga0068864_100055374 3300005618 Bacteria 3424
133 Ga0068864_100248805 3300005618 Bacteria 1649
134 Ga0068864_100261239 3300005618 Bacteria 1611
135 Ga0068864_100663065 3300005618 Bacteria 1017
136 Ga0068861_100010209 3300005719 Bacteria 6517
137 Ga0068861_100136558 3300005719 Bacteria 1996
138 Ga0068861_100176343 3300005719 Bacteria 1775
139 Ga0068851_10017462 3300005834 Bacteria 3446
140 Ga0068851_10054937 3300005834 Bacteria 2029
141 Ga0068863_100630285 3300005841 Bacteria 1062
142 Ga0068858_100004448 3300005842 Bacteria 13737
143 Ga0068858_100136821 3300005842 Bacteria 2299
144 Ga0068860_100000456 3300005843 Bacteria 51397
145 Ga0068860_100012696 3300005843 Bacteria 8287
146 Ga0068860_100044144 3300005843 Bacteria 4249
147 Ga0068862_100002580 3300005844 Bacteria 15999
148 Ga0068862_100006134 3300005844 Bacteria 10004
149 Ga0068862_100270297 3300005844 Bacteria 1554
150 Ga0068862_100526453 3300005844 Bacteria 1126
151 Ga0081455_10002674 3300005937 Bacteria 21063
152 Ga0081455_10016366 3300005937 Bacteria 7162
153 Ga0081455_10052651 3300005937 Bacteria 3483
154 Ga0081455_10092032 3300005937 Bacteria 2455
155 Ga0081540_1000128 3300005983 Bacteria 80512
156 Ga0081540_1001275 3300005983 Bacteria 21968
157 Ga0081540_1001299 3300005983 Bacteria 21824
158 Ga0081540_1005588 3300005983 Bacteria 9363
159 Ga0081540_1006389 3300005983 Bacteria 8593
160 Ga0081540_1012898 3300005983 Bacteria 5466
161 Ga0081540_1016667 3300005983 Bacteria 4584
162 Ga0081540_1028615 3300005983 Bacteria 3125
163 Ga0081540_1028764 3300005983 Bacteria 3113
164 Ga0081540_1041487 3300005983 Bacteria 2385
165 Ga0081539_10074173 3300005985 Bacteria 1813
166 Ga0081539_10105926 3300005985 Bacteria 1424
167 Ga0081539_10120167 3300005985 Bacteria 1306
168 Ga0070717_10069615 3300006028 Bacteria 2931
169 Ga0070717_10073105 3300006028 Bacteria 2865
170 Ga0075365_10060955 3300006038 Bacteria 2518
171 Ga0075365_10082394 3300006038 Bacteria 2181
172 Ga0075365_10136170 3300006038 Bacteria 1702
173 Ga0075365_10179433 3300006038 Bacteria 1480
174 Ga0075365_10228216 3300006038 Bacteria 1307
175 Ga0075365_10269441 3300006038 Bacteria 1198
176 Ga0075368_10001639 3300006042 Bacteria 7182
177 Ga0075368_10048310 3300006042 Bacteria 1686
178 Ga0075363_100002809 3300006048 Bacteria 7231
179 Ga0075363_100017335 3300006048 Bacteria 3570
180 Ga0075364_10085142 3300006051 Bacteria 2093
181 Ga0075364_10221940 3300006051 Bacteria 1283
182 Ga0070715_10024687 3300006163 Bacteria 2372
183 Ga0070716_100013938 3300006173 Bacteria 4109
184 Ga0070712_100005151 3300006175 Bacteria 8089
185 Ga0070712_100005941 3300006175 Bacteria 7546
186 Ga0070712_100045559 3300006175 Bacteria 3029
187 Ga0070712_100070842 3300006175 Bacteria 2493
188 Ga0070712_100434960 3300006175 Bacteria 1090
189 Ga0075367_10042532 3300006178 Bacteria 2659
190 Ga0075369_10044924 3300006186 Bacteria 1898
191 Ga0075369_10089752 3300006186 Bacteria 1370
192 Ga0097621_100033964 3300006237 Bacteria 4066
193 Ga0097621_100122673 3300006237 Bacteria 2206
194 Ga0075370_10034039 3300006353 Bacteria 2855
195 Ga0075370_10194632 3300006353 Bacteria 1195
196 Ga0068871_100081737 3300006358 Bacteria 2677
197 Ga0068871_100195541 3300006358 Bacteria 1744
198 Ga0075428_100155620 3300006844 Bacteria 2483
199 Ga0075434_100359271 3300006871 Bacteria 1477
200 Ga0068865_100070580 3300006881 Bacteria 2475
201 Ga0075436_100009187 3300006914 Bacteria 6763
202 Ga0099825_1032482 3300006941 Bacteria 2112
203 Ga0099824_1014728 3300006942 Bacteria 7661
204 Ga0099822_1000031 3300006943 Bacteria 62575
205 Ga0099794_10102171 3300007265 Bacteria 1431
206 Ga0099795_10009109 3300007788 Bacteria 2865
207 Ga0099795_10042026 3300007788 Bacteria 1630
208 Ga0105250_10048076 3300009092 Bacteria 1711
209 Ga0105240_10005310 3300009093 Bacteria 19223
210 Ga0105240_10008157 3300009093 Bacteria 15019
211 Ga0105240_10020584 3300009093 Bacteria 8793
212 Ga0105240_10020686 3300009093 Bacteria 8768
213 Ga0105240_10194470 3300009093 Bacteria 2383
214 Ga0105245_10233172 3300009098 Bacteria 1781
215 Ga0105247_10037262 3300009101 Bacteria 2967
216 Ga0105247_10085391 3300009101 Bacteria 1996
217 Ga0105247_10101322 3300009101 Bacteria 1841
218 Ga0105247_10153131 3300009101 Bacteria 1521
219 Ga0105247_10178817 3300009101 Bacteria 1414
220 Ga0105247_10290054 3300009101 Bacteria 1131
221 Ga0114129_10085137 3300009147 Bacteria 4386
222 Ga0105243_10181929 3300009148 Bacteria 1829
223 Ga0105241_10001771 3300009174 Bacteria 16387
224 Ga0105241_10104105 3300009174 Bacteria 2261
225 Ga0105242_10086402 3300009176 Bacteria 2632
226 Ga0105248_10042837 3300009177 Bacteria 5076
227 Ga0105248_10082009 3300009177 Bacteria 3626
228 Ga0105248_10095178 3300009177 Bacteria 3353
229 Ga0105248_10400059 3300009177 Bacteria 1546
230 Ga0105248_10512173 3300009177 Bacteria 1353
231 Ga0105237_10008184 3300009545 Bacteria 11357
232 Ga0105237_10045694 3300009545 Bacteria 4406
233 Ga0105237_10046343 3300009545 Bacteria 4373
234 Ga0105237_10113822 3300009545 Bacteria 2697
235 Ga0105237_10146340 3300009545 Bacteria 2357
236 Ga0105237_10361717 3300009545 Bacteria 1455
237 Ga0105237_10385688 3300009545 Bacteria 1406
238 Ga0105238_10000517 3300009551 Bacteria 40562
239 Ga0105238_10022670 3300009551 Bacteria 6399
240 Ga0105238_10026980 3300009551 Bacteria 5854
241 Ga0105249_10471740 3300009553 Bacteria 1296
242 Ga0099796_10009283 3300010159 Bacteria 2656
243 Ga0099796_10021895 3300010159 Bacteria 1976
244 Ga0099796_10023122 3300010159 Bacteria 1937
245 Ga0099796_10033766 3300010159 Bacteria 1686
246 Ga0105239_10002648 3300010375 Bacteria 22602
247 Ga0105239_10017924 3300010375 Bacteria 7829
248 Ga0105239_10021488 3300010375 Bacteria 7115
249 Ga0105239_10031806 3300010375 Bacteria 5798
250 Ga0105239_10065141 3300010375 Bacteria 4002
251 Ga0105239_10072205 3300010375 Bacteria 3794
252 Ga0105239_10134890 3300010375 Bacteria 2748
253 Ga0105239_10234595 3300010375 Bacteria 2059
254 Ga0105239_10391969 3300010375 Bacteria 1571
255 Ga0105246_10116136 3300011119 Bacteria 1975
256 Ga0105246_10191791 3300011119 Bacteria 1582
257 Ga0105246_10220229 3300011119 Bacteria 1487
258 Ga0157371_10021936 3300013102 Bacteria 4687
259 Ga0157370_10014532 3300013104 Bacteria 8047
260 Ga0157370_10124641 3300013104 Bacteria 2405
261 Ga0157369_10003506 3300013105 Bacteria 18636
262 Ga0157369_10006970 3300013105 Bacteria 13030
263 Ga0157369_10014315 3300013105 Bacteria 8959
264 Ga0157369_10052523 3300013105 Bacteria 4409
265 Ga0157369_10496025 3300013105 Bacteria 1263
266 Ga0157374_10061178 3300013296 Bacteria 3526
267 Ga0157374_10077659 3300013296 Bacteria 3143
268 Ga0157378_10063588 3300013297 Bacteria 3297
269 Ga0157378_10293822 3300013297 Bacteria 1570
270 Ga0157378_10454106 3300013297 Bacteria 1272
271 Ga0163162_10382877 3300013306 Bacteria 1540
272 Ga0157372_10023555 3300013307 Bacteria 6676
273 Ga0157375_10055632 3300013308 Bacteria 3902
274 Ga0157375_10073375 3300013308 Bacteria 3441
275 Ga0163163_10000069 3300014325 Bacteria 114043
276 Ga0157380_10210285 3300014326 Bacteria 1733
277 Ga0157380_10338602 3300014326 Bacteria 1402
278 Ga0157380_10448403 3300014326 Bacteria 1238
279 Ga0157377_10060818 3300014745 Bacteria 2157
280 Ga0157377_10090470 3300014745 Bacteria 1806
281 Ga0157379_10051655 3300014968 Bacteria 3671
282 Ga0157379_10355752 3300014968 Bacteria 1341
283 Ga0157376_10325225 3300014969 Bacteria 1463
284 Ga0157376_10419511 3300014969 Bacteria 1298
285 Ga0213872_10022702 3300021361 Bacteria 2888
286 Ga0213876_10000477 3300021384 Bacteria 31939
287 Ga0209677_102608 3300025253 Bacteria 6582
288 Ga0209148_1001000 3300025254 Bacteria 18034
289 Ga0209233_1002990 3300025261 Bacteria 6023
290 Ga0209233_1009100 3300025261 Bacteria 3038
291 Ga0209455_1001389 3300025272 Bacteria 11022
292 Ga0209455_1010687 3300025272 Bacteria 2315
293 Ga0209455_1015147 3300025272 Bacteria 1709
294 Ga0209675_1006021 3300025291 Bacteria 4960
295 Ga0209676_1000284 3300025292 Bacteria 104999
296 Ga0209564_1002110 3300025295 Bacteria 16929
297 Ga0209564_1013028 3300025295 Bacteria 3566
298 Ga0209758_1000206 3300025297 Bacteria 130177
299 Ga0209758_1001267 3300025297 Bacteria 31294
300 Ga0209758_1001347 3300025297 Bacteria 29637
301 Ga0209758_1011263 3300025297 Bacteria 5206
302 Ga0209758_1037256 3300025297 Bacteria 1882
303 Ga0209050_1016402 3300025298 Bacteria 3033
304 Ga0207426_1000799 3300025302 Bacteria 34123
305 Ga0207426_1003234 3300025302 Bacteria 9138
306 Ga0207426_1008081 3300025302 Bacteria 4310
307 Ga0207426_1030869 3300025302 Bacteria 1753
308 Ga0209257_1000394 3300025304 Bacteria 86654
309 Ga0209257_1008387 3300025304 Bacteria 5892
310 Ga0209257_1013507 3300025304 Bacteria 3621
311 Ga0207697_10064088 3300025315 Bacteria 1532
312 Ga0207656_10003517 3300025321 Bacteria 5390
313 Ga0207692_10000229 3300025898 Bacteria 19004
314 Ga0207692_10023181 3300025898 Bacteria 2868
315 Ga0207710_10014586 3300025900 Bacteria 3317
316 Ga0207710_10038836 3300025900 Bacteria 2105
317 Ga0207710_10084508 3300025900 Bacteria 1477
318 Ga0207688_10001503 3300025901 Bacteria 12239
319 Ga0207688_10067444 3300025901 Bacteria 2025
320 Ga0207688_10072127 3300025901 Bacteria 1961
321 Ga0207680_10100912 3300025903 Bacteria 1854
322 Ga0207685_10041278 3300025905 Bacteria 1725
323 Ga0207699_10000242 3300025906 Bacteria 30591
324 Ga0207645_10012744 3300025907 Bacteria 5699
325 Ga0207645_10083437 3300025907 Bacteria 2050
326 Ga0207645_10139770 3300025907 Bacteria 1578
327 Ga0207654_10000248 3300025911 Bacteria 32761
328 Ga0207654_10009059 3300025911 Bacteria 5050
329 Ga0207654_10041873 3300025911 Bacteria 2589
330 Ga0207654_10062044 3300025911 Bacteria 2189
331 Ga0207707_10002685 3300025912 Bacteria 15895
332 Ga0207707_10045342 3300025912 Bacteria 3831
333 Ga0207695_10000006 3300025913 Bacteria 1135309
334 Ga0207695_10000343 3300025913 Bacteria 107739
335 Ga0207695_10050510 3300025913 Bacteria 4374
336 Ga0207695_10050929 3300025913 Bacteria 4352
337 Ga0207695_10063575 3300025913 Bacteria 3804
338 Ga0207695_10075958 3300025913 Bacteria 3417
339 Ga0207671_10029138 3300025914 Bacteria 4124
340 Ga0207671_10061668 3300025914 Bacteria 2783
341 Ga0207693_10007398 3300025915 Bacteria 9032
342 Ga0207693_10033852 3300025915 Bacteria 4031
343 Ga0207693_10073908 3300025915 Bacteria 2669
344 Ga0207693_10096274 3300025915 Bacteria 2320
345 Ga0207663_10009571 3300025916 Bacteria 5126
346 Ga0207663_10025694 3300025916 Bacteria 3408
347 Ga0207663_10186331 3300025916 Bacteria 1486
348 Ga0207660_10008346 3300025917 Bacteria 6698
349 Ga0207660_10029917 3300025917 Bacteria 3741
350 Ga0207660_10205430 3300025917 Bacteria 1540
351 Ga0207660_10207998 3300025917 Bacteria 1531
352 Ga0207660_10286956 3300025917 Bacteria 1308
353 Ga0207657_10004349 3300025919 Bacteria 15004
354 Ga0207657_10012048 3300025919 Bacteria 8553
355 Ga0207657_10127903 3300025919 Bacteria 2085
356 Ga0207657_10280914 3300025919 Bacteria 1322
357 Ga0207649_10064731 3300025920 Bacteria 2312
358 Ga0207652_10166910 3300025921 Bacteria 1974
359 Ga0207652_10201178 3300025921 Bacteria 1792
360 Ga0207646_10028422 3300025922 Bacteria 5091
361 Ga0207681_10000011 3300025923 Bacteria 366878
362 Ga0207681_10001220 3300025923 Bacteria 16562
363 Ga0207681_10136657 3300025923 Bacteria 1820
364 Ga0207694_10000136 3300025924 Bacteria 74908
365 Ga0207694_10029183 3300025924 Bacteria 4207
366 Ga0207694_10360648 3300025924 Bacteria 1204
367 Ga0207650_10000003 3300025925 Bacteria 1123235
368 Ga0207659_10046382 3300025926 Bacteria 3068
369 Ga0207687_10065440 3300025927 Bacteria 2581
370 Ga0207700_10168867 3300025928 Bacteria 1823
371 Ga0207700_10301374 3300025928 Bacteria 1384
372 Ga0207664_10124695 3300025929 Bacteria 2161
373 Ga0207644_10000036 3300025931 Bacteria 128383
374 Ga0207644_10114097 3300025931 Bacteria 2047
375 Ga0207690_10118641 3300025932 Bacteria 1918
376 Ga0207690_10345481 3300025932 Bacteria 1175
377 Ga0207706_10002700 3300025933 Bacteria 17297
378 Ga0207706_10247650 3300025933 Bacteria 1557
379 Ga0207709_10174233 3300025935 Bacteria 1513
380 Ga0207669_10057536 3300025937 Bacteria 2367
381 Ga0207665_10004541 3300025939 Bacteria 9211
382 Ga0207665_10081743 3300025939 Bacteria 2225
383 Ga0207691_10002238 3300025940 Bacteria 18948
384 Ga0207691_10097989 3300025940 Bacteria 2620
385 Ga0207691_10192500 3300025940 Bacteria 1778
386 Ga0207691_10329244 3300025940 Bacteria 1309
387 Ga0207711_10000469 3300025941 Bacteria 41584
388 Ga0207689_10012288 3300025942 Bacteria 7326
389 Ga0207661_10000613 3300025944 Bacteria 22875
390 Ga0207661_10053399 3300025944 Bacteria 3233
391 Ga0207661_10173608 3300025944 Bacteria 1878
392 Ga0207679_10133539 3300025945 Bacteria 1995
393 Ga0207667_10018828 3300025949 Bacteria 7731
394 Ga0207667_10084423 3300025949 Bacteria 3287
395 Ga0207667_10174101 3300025949 Bacteria 2211
396 Ga0207667_10377599 3300025949 Bacteria 1444
397 Ga0207712_10062581 3300025961 Bacteria 2646
398 Ga0207668_10021332 3300025972 Bacteria 4130
399 Ga0207668_10111939 3300025972 Bacteria 2050
400 Ga0207668_10117302 3300025972 Bacteria 2009
401 Ga0207668_10292653 3300025972 Bacteria 1340
402 Ga0207668_10421735 3300025972 Bacteria 1133
403 Ga0207640_10080475 3300025981 Bacteria 2224
404 Ga0207640_10138490 3300025981 Bacteria 1770
405 Ga0207658_10000007 3300025986 Bacteria 329651
406 Ga0207658_10101121 3300025986 Bacteria 2258
407 Ga0207677_10130335 3300026023 Bacteria 1908
408 Ga0207703_10036999 3300026035 Bacteria 3887
409 Ga0207639_10056591 3300026041 Bacteria 3006
410 Ga0207639_10277079 3300026041 Bacteria 1474
411 Ga0207678_10045082 3300026067 Bacteria 3813
412 Ga0207678_10079165 3300026067 Bacteria 2814
413 Ga0207678_10162783 3300026067 Bacteria 1905
414 Ga0207678_10198830 3300026067 Bacteria 1713
415 Ga0207678_10237184 3300026067 Bacteria 1562
416 Ga0207708_10088913 3300026075 Bacteria 2380
417 Ga0207702_10000006 3300026078 Bacteria 346370
418 Ga0207702_10128736 3300026078 Bacteria 2276
419 Ga0207641_10099781 3300026088 Bacteria 2555
420 Ga0207648_10008717 3300026089 Bacteria 9778
421 Ga0207648_10201861 3300026089 Bacteria 1763
422 Ga0207648_10265156 3300026089 Bacteria 1533
423 Ga0207676_10000003 3300026095 Bacteria 1123235
424 Ga0207676_10005493 3300026095 Bacteria 8974
425 Ga0207676_10019688 3300026095 Bacteria 4928
426 Ga0207676_10023076 3300026095 Bacteria 4584
427 Ga0207674_10003449 3300026116 Bacteria 19336
428 Ga0207674_10108458 3300026116 Bacteria 2753
429 Ga0207674_10217126 3300026116 Bacteria 1861
430 Ga0207674_10287903 3300026116 Bacteria 1591
431 Ga0207675_100001986 3300026118 Bacteria 20396
432 Ga0207683_10021982 3300026121 Bacteria 5472
433 Ga0207683_10041690 3300026121 Bacteria 4009
434 Ga0207683_10089991 3300026121 Bacteria 2732
435 Ga0207683_10127715 3300026121 Bacteria 2286
436 Ga0207698_10175307 3300026142 Bacteria 1893
437 Ga0209389_1000039 3300027296 Bacteria 124545
438 Ga0209589_1000025 3300027357 Bacteria 165546
439 Ga0209489_100039 3300027361 Bacteria 165546
440 Ga0209489_100087 3300027361 Bacteria 124545
441 Ga0209700_100043 3300027363 Bacteria 167890
442 Ga0209700_100090 3300027363 Bacteria 124545
443 Ga0207428_10091011 3300027907 Bacteria 2368
444 Ga0268266_10002576 3300028379 Bacteria 19238
445 Ga0268266_10010607 3300028379 Bacteria 8030
446 Ga0268266_10023222 3300028379 Bacteria 5281
447 Ga0268266_10049211 3300028379 Bacteria 3614
448 Ga0268266_10117706 3300028379 Bacteria 2361
449 Ga0268266_10161996 3300028379 Bacteria 2024
450 Ga0268266_10190963 3300028379 Bacteria 1870
451 Ga0268266_10252527 3300028379 Bacteria 1631
452 Ga0268266_10576138 3300028379 Bacteria 1080
453 Ga0268265_10000404 3300028380 Bacteria 46221
454 Ga0268265_10518300 3300028380 Bacteria 1126
455 Ga0268264_10000009 3300028381 Bacteria 724972
456 Ga0268264_10000194 3300028381 Bacteria 125395
457 Ga0268264_10267649 3300028381 Bacteria 1595
458 Ga0265337_1007418 3300028556 Bacteria 4104
459 Ga0265326_10003492 3300028558 Bacteria 5140
460 Ga0265334_10052977 3300028573 Bacteria 1551
461 Ga0265318_10013434 3300028577 Bacteria 3461
462 Ga0265323_10001501 3300028653 Bacteria 11409
463 Ga0265336_10000238 3300028666 Bacteria 39366
464 Ga0307517_10000460 3300028786 Bacteria 70026
465 Ga0307515_10022467 3300028794 Bacteria 11113
466 Ga0265338_10000278 3300028800 Bacteria 93010
467 Ga0265338_10015741 3300028800 Bacteria 8284
468 Ga0265324_10001755 3300029957 Bacteria 11922
469 Ga0307511_10087368 3300030521 Bacteria 2140
470 Ga0265328_10062648 3300031239 Bacteria 1366
471 Ga0265325_10035604 3300031241 Bacteria 2642
472 Ga0265339_10000080 3300031249 Bacteria 83570
473 Ga0265331_10062111 3300031250 Bacteria 1763
474 Ga0265327_10133407 3300031251 Bacteria 1166
475 Ga0307513_10108928 3300031456 Bacteria 2769
476 Ga0307509_10046806 3300031507 Bacteria 4654
477 Ga0265313_10000948 3300031595 Bacteria 28784
478 Ga0307508_10009068 3300031616 Bacteria 9164
479 Ga0307508_10072172 3300031616 Bacteria 3026
480 Ga0307508_10117091 3300031616 Bacteria 2266
481 Ga0307508_10138745 3300031616 Bacteria 2035
482 Ga0316576_10039580 3300031727 Bacteria 3385
483 Ga0307516_10020275 3300031730 Bacteria 6870
484 Ga0307516_10024100 3300031730 Bacteria 6220
485 Ga0307516_10097455 3300031730 Bacteria 2760
486 Ga0307413_10260066 3300031824 Bacteria 1293
487 Ga0307507_10094534 3300033179 Bacteria 2540
488 Ga0307510_10003787 3300033180 Bacteria 17693
489 Ga0307510_10015985 3300033180 Bacteria 8867
490 Ga0307510_10034065 3300033180 Bacteria 5709
491 Ga0307510_10034602 3300033180 Bacteria 5655
492 Ga0373934_0040432 3300035086 Bacteria 1839
493 Ga0373934_0084520 3300035086 Bacteria 1277
494 Ga0373923_0003366 3300035111 Bacteria 5114
495 Ga0373936_0032224 3300035113 Bacteria 2072
496 Ga0373954_0003572 3300035118 Bacteria 6607
497 Ga0373943_0110063 3300035170 Bacteria 1452
498 Ga0373946_0027530 3300035171 Bacteria 2249
499 Ga0373924_0007531 3300035410 Bacteria 3934
500 Ga0373931_0019668 3300035691 Bacteria 3372
501 Ga0373935_0000718 3300035692 Bacteria 17605
502 Ga0373927_0000666 3300035695 Bacteria 26107
503 Ga0373927_0028210 3300035695 Bacteria 3662
504 Ga0373927_0055244 3300035695 Bacteria 2568
505 Ga0373927_0083230 3300035695 Bacteria 2074
506 Ga0373927_0116554 3300035695 Bacteria 1742
507 Ga0373933_0016974 3300035724 Bacteria 4080
508 Ga0373947_0004761 3300035725 Bacteria 7952
509 Ga0373947_0007585 3300035725 Bacteria 6278
510 Ga0373937_0351720 3300036401 Bacteria 1396
511 Ga0373925_0005280 3300037068 Bacteria 9642
512 Ga0373925_0017463 3300037068 Bacteria 5201
513 Ga0373925_0108934 3300037068 Bacteria 2138
514 Ga0373925_0116855 3300037068 Bacteria 2067
515 Ga0395899_0139018 3300037312 Bacteria 1729
516 Ga0395900_0001340 3300037418 Bacteria 29756
517 Ga0395900_0040887 3300037418 Bacteria 4779
518 Ga0395900_0062560 3300037418 Bacteria 3826
519 Ga0395900_0215928 3300037418 Bacteria 1935
520 Ga0395898_0005324 3300037466 Bacteria 13909
521 Ga0395898_0018293 3300037466 Bacteria 7145
522 Ga0395905_0006516 3300037471 Bacteria 11740
523 Ga0395905_0393524 3300037471 Bacteria 1280
524 Ga0395901_0007542 3300038443 Bacteria 10989
525 Ga0395901_0043404 3300038443 Bacteria 4664
526 Ga0395901_0070968 3300038443 Bacteria 3629
527 Ga0395901_0106088 3300038443 Bacteria 2949
528 Ga0395901_0278347 3300038443 Bacteria 1739
529 Ga0436365_0009505 3300039437 Bacteria 114283
530 Ga0436365_0646338 3300039437 Bacteria 1288
531 Ga0436365_1302408 3300039437 Bacteria 3201
532 Ga0436362_0825075 3300039453 Bacteria 1455
533 Ga0451837_0551018 3300041494 Bacteria 914
534 Ga0439458_0010422 3300042157 Bacteria 2072
535 Ga0451577_0002389 3300042876 Bacteria 22482
536 Ga0453683_0008359 3300044673 Bacteria 6949
537 Ga0453684_0002985 3300044712 Bacteria 39370
538 Ga0453684_0004556 3300044712 Bacteria 29006
539 Ga0453684_0029755 3300044712 Bacteria 7740
540 Ga0453684_0434711 3300044712 Bacteria 1463
541 Ga0466957_0024632 3300044842 Bacteria 3563
542 Ga0466959_0065671 3300045049 Bacteria 2633
543 Ga0451576_0181107 3300045051 Bacteria 2200
544 Ga0451576_0551541 3300045051 Bacteria 1211
545 Ga0466967_0113558 3300045976 Bacteria 2492
546 Ga0466967_0127095 3300045976 Bacteria 2362
547 Ga0495592_0034591 3300046454 Bacteria 3809
548 Ga0495592_0142153 3300046454 Bacteria 1668
549 Ga0495603_0000206 3300046455 Bacteria 30433
550 Ga0495603_0069469 3300046455 Bacteria 2072
551 Ga0495603_0146188 3300046455 Bacteria 1374
552 Ga0495629_0000338 3300046459 Bacteria 40007
553 Ga0495638_0003637 3300046460 Bacteria 12027
554 Ga0495641_0005602 3300046461 Bacteria 8407
555 Ga0495653_0183846 3300046463 Bacteria 1432
556 Ga0495650_0048142 3300046471 Bacteria 1779
557 Ga0495580_0003372 3300046472 Bacteria 13653
558 Ga0495582_0000423 3300046473 Bacteria 23085
559 Ga0495582_0034111 3300046473 Bacteria 2798
560 Ga0495605_0034758 3300046474 Bacteria 2551
561 Ga0495639_0000039 3300046475 Bacteria 57380
562 Ga0495639_0026043 3300046475 Bacteria 2583
563 Ga0495664_0000847 3300046477 Bacteria 15732
564 Ga0495664_0009313 3300046477 Bacteria 5491
565 Ga0495664_0082926 3300046477 Bacteria 1923
566 Ga0495584_0054927 3300046491 Bacteria 2004
567 Ga0495585_0058241 3300046492 Bacteria 2131
568 Ga0495594_0006677 3300046499 Bacteria 5937
569 Ga0495594_0122324 3300046499 Bacteria 1471
570 Ga0495606_0001194 3300046507 Bacteria 36568
571 Ga0495606_0036283 3300046507 Bacteria 3359
572 Ga0495606_0073803 3300046507 Bacteria 2139
573 Ga0495610_0109050 3300046512 Bacteria 1229
574 Ga0495618_0003604 3300046514 Bacteria 9601
575 Ga0495628_0048999 3300046516 Bacteria 3346
576 Ga0495630_0024274 3300046517 Bacteria 4484
577 Ga0495630_0132772 3300046517 Bacteria 1891
578 Ga0495643_0008839 3300046522 Bacteria 6342
579 Ga0495644_0043687 3300046523 Bacteria 1686
580 Ga0495644_0044816 3300046523 Bacteria 1664
581 Ga0495648_0000536 3300046524 Bacteria 40969
582 Ga0495648_0012759 3300046524 Bacteria 6242
583 Ga0495663_0052662 3300046525 Bacteria 1264
584 Ga0495666_0007417 3300046526 Bacteria 5498
585 Ga0495652_0085687 3300046529 Bacteria 2588
586 Ga0495652_0113761 3300046529 Bacteria 2172
587 Ga0495665_0000082 3300046531 Bacteria 41861
588 Ga0495665_0084964 3300046531 Bacteria 1663
589 Ga0495640_0177856 3300046533 Bacteria 1357
590 Ga0495609_0077069 3300046538 Bacteria 1460
591 Ga0495645_0017895 3300046543 Bacteria 5085
592 Ga0495622_0011857 3300046557 Bacteria 4030
593 Ga0495622_0024190 3300046557 Bacteria 2836
594 Ga0495633_0015568 3300046558 Bacteria 3943
595 Ga0495667_0043015 3300046559 Bacteria 2994
596 Ga0495656_0007521 3300046615 Bacteria 3852
597 Ga0495656_0074139 3300046615 Bacteria 1519
598 Ga0495668_0116184 3300046616 Bacteria 1463
599 Ga0495634_0000776 3300046642 Bacteria 30917
600 Ga0495635_0009338 3300046663 Bacteria 6855
601 Ga0495659_0002499 3300046664 Bacteria 5935
602 Ga0495588_0033674 3300046674 Bacteria 2588
603 Ga0495657_0025940 3300046675 Bacteria 4157
604 Ga0495599_0012128 3300046678 Bacteria 5306
605 Ga0495623_0149613 3300046679 Bacteria 1381
606 Ga0495646_0137791 3300046680 Bacteria 1367
607 Ga0495658_0003324 3300046683 Bacteria 7978
608 Ga0495658_0004531 3300046683 Bacteria 6830
609 Ga0495669_0031299 3300046684 Bacteria 2336
610 Ga0495613_0016376 3300046689 Bacteria 5524
611 Ga0495624_0159753 3300046690 Bacteria 1377
612 Ga0495624_0165888 3300046690 Bacteria 1348
613 Ga0495624_0209447 3300046690 Bacteria 1183
614 Ga0495670_0068221 3300046691 Bacteria 1796
615 Ga0495649_0111470 3300046694 Bacteria 1451
616 Ga0495589_0202372 3300046794 Bacteria 937
617 Ga0495600_0100275 3300046809 Bacteria 1887
618 Ga0495581_0000006 3300047315 Bacteria 77433
619 Ga0495581_0010765 3300047315 Bacteria 5290
620 Ga0495604_0005606 3300047317 Bacteria 9957
621 Ga0495604_0102161 3300047317 Bacteria 2105
622 Ga0495636_0014126 3300047318 Bacteria 3175
623 Ga0495674_0012193 3300047319 Bacteria 8099
624 Ga0495672_0008439 3300047320 Bacteria 7604
625 Ga0495672_0037381 3300047320 Bacteria 2971
626 Ga0495680_0005494 3300047322 Bacteria 11908
627 Ga0495683_0132631 3300047323 Bacteria 1173
628 Ga0495675_0002994 3300047444 Bacteria 10142
629 Ga0495684_0001984 3300047471 Bacteria 16445
630 Ga0495684_0050956 3300047471 Bacteria 3160
631 Ga0495684_0109343 3300047471 Bacteria 2088
632 Ga0495593_0000032 3300047673 Bacteria 58862
633 Ga0495602_0039658 3300048088 Bacteria 4333
634 Ga0495614_0014894 3300048089 Bacteria 3397
635 Ga0496100_0018954 3300048903 Bacteria 4096
636 Ga0496101_0015301 3300048904 Bacteria 5167
637 Ga0496101_0151395 3300048904 Bacteria 1775
638 Ga0496101_0155163 3300048904 Bacteria 1753
639 Ga0496101_0174929 3300048904 Bacteria 1651
640 Ga0496102_0019308 3300048905 Bacteria 6005
641 Ga0496102_0334042 3300048905 Bacteria 1427
642 Ga0496103_0039846 3300048906 Bacteria 2887
643 Ga0496104_0031856 3300048907 Bacteria 4905
644 Ga0496104_0032721 3300048907 Bacteria 4840
645 Ga0496104_0173868 3300048907 Bacteria 2064
646 Ga0496104_0178162 3300048907 Bacteria 2036
647 Ga0496105_0059106 3300048908 Bacteria 3163
648 Ga0496106_0002364 3300048909 Bacteria 14037
649 Ga0496106_0020140 3300048909 Bacteria 4948
650 Ga0496106_0039179 3300048909 Bacteria 3549
651 Ga0496106_0158596 3300048909 Bacteria 1788
652 Ga0496106_0194625 3300048909 Bacteria 1612
653 Ga0496108_0020520 3300048911 Bacteria 5432
654 Ga0496108_0261238 3300048911 Bacteria 1507
655 Ga0496109_0088902 3300048912 Bacteria 2855
656 Ga0496109_0412342 3300048912 Bacteria 1276
657 Ga0496110_0554298 3300048913 Bacteria 1044
658 Ga0496111_0016061 3300048914 Bacteria 5153
659 Ga0496111_0021658 3300048914 Bacteria 4492
660 Ga0496111_0139669 3300048914 Bacteria 1795
661 Ga0496111_0452783 3300048914 Bacteria 947
662 Ga0496112_0000029 3300048915 Bacteria 122291
663 Ga0496112_0108628 3300048915 Bacteria 2744
664 Ga0496112_0440467 3300048915 Bacteria 1241
665 Ga0496113_0060918 3300048916 Bacteria 2846
666 Ga0496113_0068963 3300048916 Bacteria 2684
667 Ga0496113_0116139 3300048916 Bacteria 2088
668 Ga0496114_0042973 3300048917 Bacteria 3747
669 Ga0496114_0056894 3300048917 Bacteria 3265
670 Ga0496114_0269007 3300048917 Bacteria 1501
671 Ga0496114_0527816 3300048917 Bacteria 1044
672 Ga0496115_0006927 3300048918 Bacteria 8327
673 Ga0496115_0052564 3300048918 Bacteria 3269
674 Ga0496117_0016836 3300048920 Bacteria 6142
675 Ga0496118_0002319 3300048921 Bacteria 25849
676 Ga0496118_0032776 3300048921 Bacteria 4272
677 Ga0496120_0022972 3300048923 Bacteria 3911
678 Ga0496121_0000352 3300048924 Bacteria 95800
679 Ga0496121_0003091 3300048924 Bacteria 24094
680 Ga0496121_0018747 3300048924 Bacteria 6957
681 Ga0496121_0019666 3300048924 Bacteria 6739
682 Ga0496121_0085513 3300048924 Bacteria 2482
683 Ga0496121_0091056 3300048924 Bacteria 2382
684 Ga0496121_0120703 3300048924 Bacteria 1980
685 Ga0496121_0158117 3300048924 Bacteria 1660
686 Ga0496124_0001443 3300048927 Bacteria 35124
687 Ga0496124_0054966 3300048927 Bacteria 3367
688 Ga0496124_0107167 3300048927 Bacteria 2255
689 Ga0496125_0008186 3300048928 Bacteria 11004
690 Ga0496125_0026403 3300048928 Bacteria 5293
691 Ga0496125_0029894 3300048928 Bacteria 4885
692 Ga0496126_0003276 3300048929 Bacteria 20656
693 Ga0496126_0005702 3300048929 Bacteria 14109
694 Ga0496126_0013048 3300048929 Bacteria 8479
695 Ga0496126_0014279 3300048929 Bacteria 8036
696 Ga0496126_0016514 3300048929 Bacteria 7378
697 Ga0496126_0042845 3300048929 Bacteria 4178
698 Ga0496126_0051752 3300048929 Bacteria 3737
699 Ga0496126_0065029 3300048929 Bacteria 3265
700 Ga0496126_0206382 3300048929 Bacteria 1656
701 Ga0501031_0002569 3300049568 Bacteria 11569
702 Ga0501031_0008055 3300049568 Bacteria 6862
703 Ga0501032_0000301 3300049569 Bacteria 41571
704 Ga0501032_0005845 3300049569 Bacteria 9101
705 Ga0501032_0017725 3300049569 Bacteria 4999
706 Ga0501032_0030565 3300049569 Bacteria 3696
707 Ga0501032_0097679 3300049569 Bacteria 1946
708 Ga0501032_0282915 3300049569 Bacteria 1074
709 Ga0501033_0000270 3300049570 Bacteria 50079
710 Ga0501033_0001377 3300049570 Bacteria 21662
711 Ga0501033_0010053 3300049570 Bacteria 7264
712 Ga0501033_0080248 3300049570 Bacteria 2394
713 Ga0501034_0000715 3300049571 Bacteria 50444
714 Ga0501034_0030327 3300049571 Bacteria 5497
715 Ga0501036_0000043 3300049572 Bacteria 79310
716 Ga0501036_0000128 3300049572 Bacteria 48330
717 Ga0501036_0006458 3300049572 Bacteria 9524
718 Ga0501036_0007332 3300049572 Bacteria 8983
719 Ga0501036_0063189 3300049572 Bacteria 3135
720 Ga0501037_0000040 3300049573 Bacteria 119364
721 Ga0501037_0006378 3300049573 Bacteria 8627
722 Ga0501037_0006531 3300049573 Bacteria 8534
723 Ga0501037_0009276 3300049573 Bacteria 7215
724 Ga0501037_0051620 3300049573 Bacteria 3007
725 Ga0501037_0097398 3300049573 Bacteria 2125
726 Ga0501037_0247706 3300049573 Bacteria 1247
727 Ga0501038_0000131 3300049574 Bacteria 63880
728 Ga0501038_0000630 3300049574 Bacteria 31329
729 Ga0501038_0038383 3300049574 Bacteria 4194
730 Ga0501038_0198446 3300049574 Bacteria 1611
731 Ga0501039_0000106 3300049575 Bacteria 56453
732 Ga0501039_0006604 3300049575 Bacteria 8807
733 Ga0501039_0096394 3300049575 Bacteria 2306
734 Ga0501040_0068247 3300049576 Bacteria 2452
735 Ga0501041_0018507 3300049577 Bacteria 4150
736 Ga0501042_0159404 3300049578 Bacteria 1628
737 Ga0501042_0170445 3300049578 Bacteria 1570
738 Ga0501043_0000074 3300049579 Bacteria 87396
739 Ga0501043_0005735 3300049579 Bacteria 10004
740 Ga0501043_0036399 3300049579 Bacteria 3871
741 Ga0501046_0000074 3300049580 Bacteria 104319
742 Ga0501046_0005024 3300049580 Bacteria 11874
743 Ga0501046_0013483 3300049580 Bacteria 6919
744 Ga0501046_0014460 3300049580 Bacteria 6658
745 Ga0501047_0000346 3300049581 Bacteria 52545
746 Ga0501047_0020019 3300049581 Bacteria 6425
747 Ga0501047_0057626 3300049581 Bacteria 3756
748 Ga0501047_0078407 3300049581 Bacteria 3176
749 Ga0501048_0000349 3300049582 Bacteria 31934
750 Ga0501048_0000550 3300049582 Bacteria 26481
751 Ga0501048_0009855 3300049582 Bacteria 7163
752 Ga0501067_0007707 3300049583 Bacteria 5988
753 Ga0501067_0037192 3300049583 Bacteria 2704
754 Ga0501067_0118106 3300049583 Bacteria 1475
755 Ga0501068_0006614 3300049584 Bacteria 6397
756 Ga0501068_0021802 3300049584 Bacteria 3743
757 Ga0501068_0071766 3300049584 Bacteria 2114
758 Ga0501069_0003736 3300049585 Bacteria 7821
759 Ga0501069_0003813 3300049585 Bacteria 7756
760 Ga0501070_0005383 3300049586 Bacteria 10920
761 Ga0501070_0022234 3300049586 Bacteria 5312
762 Ga0501070_0046564 3300049586 Bacteria 3606
763 Ga0501070_0068726 3300049586 Bacteria 2933
764 Ga0501071_0220347 3300049587 Bacteria 1428
765 Ga0501072_0001372 3300049588 Bacteria 18281
766 Ga0501072_0002038 3300049588 Bacteria 15051
767 Ga0501073_0000085 3300049589 Bacteria 59315
768 Ga0501073_0004871 3300049589 Bacteria 10076
769 Ga0501073_0026762 3300049589 Bacteria 4130
770 Ga0501074_0000145 3300049590 Bacteria 36757
771 Ga0501074_0159786 3300049590 Bacteria 1609
772 Ga0501079_0001762 3300049741 Bacteria 15438
773 Ga0501079_0012601 3300049741 Bacteria 6457
774 Ga0501080_0005166 3300049742 Bacteria 11628
775 Ga0501080_0005596 3300049742 Bacteria 11228
776 Ga0501080_0093793 3300049742 Bacteria 2787
777 Ga0501080_0195710 3300049742 Bacteria 1857
778 Ga0501081_0228803 3300049743 Bacteria 1354
779 Ga0501083_0015067 3300049744 Bacteria 5411
780 Ga0501083_0015766 3300049744 Bacteria 5289
781 Ga0501083_0099940 3300049744 Bacteria 1913
782 Ga0501083_0117923 3300049744 Bacteria 1741
783 Ga0501035_0001345 3300049822 Bacteria 25323
784 Ga0501035_0002989 3300049822 Bacteria 16240
785 Ga0501035_0008293 3300049822 Bacteria 9678
786 Ga0501035_0013984 3300049822 Bacteria 7403
787 Ga0501035_0054696 3300049822 Bacteria 3565
788 Ga0501035_0301024 3300049822 Bacteria 1351
789 Ga0501035_0418591 3300049822 Bacteria 1112
790 Ga0501044_0000667 3300049823 Bacteria 41447
791 Ga0501044_0027021 3300049823 Bacteria 6072
792 Ga0501044_0032753 3300049823 Bacteria 5462
793 Ga0501044_0081071 3300049823 Bacteria 3285
794 Ga0501044_0083394 3300049823 Bacteria 3232
795 Ga0501044_0109258 3300049823 Bacteria 2775
796 Ga0501044_0165131 3300049823 Bacteria 2188
797 Ga0501044_0209343 3300049823 Bacteria 1905
798 Ga0501045_0003017 3300049824 Bacteria 11527
799 Ga0501045_0012743 3300049824 Bacteria 5923
800 Ga0501045_0137643 3300049824 Bacteria 1816
801 nmdc:mga03n38_1891_c1 3300050490 Bacteria 6265
802 nmdc:mga03n38_91863_c1 3300050490 Bacteria 1447
803 nmdc:mga00v17_135430_c1 3300050491 Bacteria 1577
804 nmdc:mga0yw44_134578_c1 3300050492 Bacteria 1603
805 nmdc:mga0yw44_222728_c1 3300050492 Bacteria 1251
806 nmdc:mga0yw44_63789_c1 3300050492 Bacteria 2266
807 nmdc:mga0k408_157748_c1 3300050493 Bacteria 1351
808 nmdc:mga0k408_35179_c1 3300050493 Bacteria 2872
809 nmdc:mga0k408_60795_c1 3300050493 Bacteria 2196
810 nmdc:mga0k408_65696_c1 3300050493 Bacteria 2112
811 nmdc:mga06z11_27139_c1 3300050494 Bacteria 2735
812 nmdc:mga06z11_54543_c1 3300050494 Bacteria 2061
813 nmdc:mga04h51_3952_c1 3300050495 Bacteria 3649
814 nmdc:mga08y16_382969_c1 3300050511 Bacteria 1441
815 nmdc:mga0n895_227122_c1 3300050512 Bacteria 1895
816 nmdc:mga0n895_357578_c1 3300050512 Bacteria 1479
817 nmdc:mga0n895_4726_c1 3300050512 Bacteria 11245
818 nmdc:mga08x19_67652_c1 3300050514 Bacteria 2324
819 nmdc:mga0sz30_12669_c1 3300050516 Bacteria 3284
820 nmdc:mga0sz30_18835_c1 3300050516 Bacteria 2767
821 nmdc:mga0sz30_28201_c1 3300050516 Bacteria 2054
822 Ga0495601_0085301 3300053077 Bacteria 2029
823 Ga0500635_0012868 3300053080 Bacteria 2415
824 Ga0500643_000443 3300053087 Bacteria 30999
825 Ga0500647_0023852 3300053091 Bacteria 2874
826 Ga0500566_0000270 3300053094 Bacteria 27957
827 Ga0500566_0000780 3300053094 Bacteria 18033
828 Ga0500566_0014575 3300053094 Bacteria 4619
829 Ga0500641_0008048 3300053096 Bacteria 3758
830 Ga0500641_0008602 3300053096 Bacteria 3648
831 Ga0500641_0109731 3300053096 Bacteria 1187
832 Ga0500555_023586 3300053103 Bacteria 1764
833 Ga0500556_0004536 3300053104 Bacteria 3952
834 Ga0500556_0099071 3300053104 Bacteria 1121
835 Ga0500572_001115 3300053111 Bacteria 7839
836 Ga0500594_0043603 3300053118 Bacteria 1238
837 Ga0500595_000328 3300053119 Bacteria 31283
838 Ga0500595_001866 3300053119 Bacteria 10887
839 Ga0500595_012540 3300053119 Bacteria 3275
840 Ga0500614_001182 3300053123 Bacteria 6395
841 Ga0500617_115703 3300053124 Bacteria 1114
842 Ga0500559_0001813 3300053136 Bacteria 11672
843 Ga0500564_146053 3300053138 Bacteria 1011
844 Ga0500568_0084481 3300053139 Bacteria 1202
845 Ga0500573_0017246 3300053140 Bacteria 4109
846 Ga0500577_0030140 3300053142 Bacteria 1885
847 Ga0500588_0009801 3300053146 Bacteria 2291
848 Ga0500603_000151 3300053150 Bacteria 17010
849 Ga0500603_008750 3300053150 Bacteria 2255
850 Ga0500616_0053704 3300053153 Bacteria 2113
851 Ga0500622_0092915 3300053156 Bacteria 1494
852 Ga0500638_057307 3300053162 Bacteria 1876
853 Ga0500639_000065 3300053163 Bacteria 48250
854 Ga0500636_0000584 3300053177 Bacteria 19957
855 Ga0500636_0023297 3300053177 Bacteria 3661
856 Ga0500637_0000413 3300053178 Bacteria 16315
857 Ga0500637_0090652 3300053178 Bacteria 1770
858 Ga0500637_0157770 3300053178 Bacteria 1308
859 Ga0500645_025589 3300053730 Bacteria 1800
860 Ga0500645_054165 3300053730 Bacteria 1167
861 Ga0500596_000494 3300053735 Bacteria 7393
862 Ga0500599_000161 3300053736 Bacteria 6110
863 Ga0500601_000483 3300053737 Bacteria 6200
864 Ga0501084_0002085 3300054114 Bacteria 15967
865 Ga0501084_0003469 3300054114 Bacteria 12809
866 Ga0501082_0018999 3300060353 Bacteria 5921
867 Ga0501082_0033487 3300060353 Bacteria 4433
868 Ga0501082_0087916 3300060353 Bacteria 2681
869 2507505999 2507262055 Bacteria 8048963
870 2508540187 2508501009 Bacteria 7784016
871 2508696261 2508501042 Bacteria 8719808
872 2509148190 2508501128 Bacteria 8613869
873 2511397326 2511231028 Bacteria 8046582
874 2513592443 2513237087 Bacteria 5817514
875 2513624910 2513237092 Bacteria 8341956
876 2513638257 2513237094 Bacteria 8789602
877 2513649095 2513237095 Bacteria 8976980
878 2513657558 2513237096 Bacteria 8722461
879 2513674944 2513237098 Bacteria 9902361
880 2513701556 2513237102 Bacteria 7703324
881 2513716261 2513237104 Bacteria 10034502
882 2513861114 2513237137 Bacteria 9558895
883 2513877170 2513237139 Bacteria 8737671
884 2513916811 2513237145 Bacteria 8979722
885 2514014539 2513237161 Bacteria 8871253
886 2517103189 2517093001 Bacteria 9002274
887 2517889721 2517572143 Bacteria 9484767
888 2524440757 2524023205 Bacteria 8918781
889 2524533113 2524023228 Bacteria 10118060
890 2528850764 2528768022 Bacteria 10457665
891 2617347882 2617270735 Bacteria 9163226
892 2617374804 2617270741 Bacteria 8201522
893 2644290425 2643221651 Bacteria 4798932
894 2671119571 2667528175 Bacteria 7532676
895 2723848926 2721755755 Bacteria 8322773
896 2728748933 2728368998 Bacteria 8720350
897 2745075998 2744054633 Bacteria 8678936
898 2758640684 2758568016 Bacteria 5645291
899 2793061467 2791355196 Bacteria 7323613
900 2793070299 2791355197 Bacteria 8420563
901 2793078930
902 2805916231 2802429603 Bacteria 8777136
903 2818240486 2816332527 Bacteria 8933356
904 2824603706 2824600985 Bacteria 8488197
905 2824610708 2824609381 Bacteria 8672835
906 2824624968 2824617872 Bacteria 8814715
907 2824630995 2824626560 Bacteria 8813858
908 2824641243 2824635225 Bacteria 8785348
909 2824649673 2824644064 Bacteria 8743947
910 2824657910 2824653114 Bacteria 8493680
911 2824666907 2824661429 Bacteria 9877870
912 2824674085 2824671348 Bacteria 8369588
913 2824690751 2824687955 Bacteria 8360029
914 2824703321 2824696289 Bacteria 8335049
915 2824710962 2824704595 Bacteria 9667483
916 2824719598 2824714736 Bacteria 8717648
917 2824728573 2824723954 Bacteria 8758240
918 2824737933 2824732956 Bacteria 7810675
919 2824752186 2824746037 Bacteria 7911610
920 2824760348 2824753945 Bacteria 9787441
921 2824772484 2824763712 Bacteria 9792355
922 2824776341 2824773399 Bacteria 8360218
923 2838125008 2838122688 Bacteria 8803140
924 2841945747 2841941048 Bacteria 8688029
925 2841956846 2841949485 Bacteria 8680857
926 2841964029 2841957949 Bacteria 8652217
927 2841973594 2841966195 Bacteria 8673214
928 2841981928 2841974524 Bacteria 8931498
929 2841989482 2841983080 Bacteria 8395090
930 2842044467 2842038055 Bacteria 8002051
931 2842051544 2842045827 Bacteria 8006841
932 2842778407 2842775625 Bacteria 5587290
933 2847939359 2847930680 Bacteria 9342022
934 2847941115 2847939898 Bacteria 8606328
935 2849082101 2849076700 Bacteria 7039503
936 2857513418 2857509624 Bacteria 7472071
937 2874130557 2874123672 Bacteria 7238285
938 2874596264 2874590934 Bacteria 8299676
939 2874610051 2874604998 Bacteria 7834745
940 2874616536 2874612657 Bacteria 8252029
941 2874622554 2874620515 Bacteria 8290088
942 2874633467 2874628541 Bacteria 8630250
943 2874650251 2874645413 Bacteria 8214782
944 2876763652 2876761206 Bacteria 10111113
945 2876776729 2876771140 Bacteria 8287509
946 2876824519 2876818435 Bacteria 8274608
947 2879080866 2879074833 Bacteria 8279565
948 2879087032 2879083081 Bacteria 8587928
949 2879104363 2879099564 Bacteria 10442239
950 2879116915 2879110137 Bacteria 8907982
951 2879133711 2879127579 Bacteria 8294491
952 2879148213 2879142872 Bacteria 8267021
953 2881369522 2881364244 Bacteria 7710352
954 2881669762 2881665667 Bacteria 8175609
955 2885367832 2885366525 Bacteria 8326213
956 2885378461 2885374607 Bacteria 8927485
957 2885386468 2885383462 Bacteria 9473874
958 2885412984 2885409591 Bacteria 9235467
959 2888387161 2888378607 Bacteria 9652610
960 2888421257 2888419890 Bacteria 7857137
961 2903750330 2903748898 Bacteria 9972761
962 2903775238 2903768456 Bacteria 9749579
963 2904671439 2904666416 Bacteria 8226587
964 2904691971 2904690495 Bacteria 9412302
965 2904707522
966 2904719731 2904711408 Bacteria 9771557
967 2906614697
968 2906631358 2906626472 Bacteria 8826946
969 2906636216 2906635258 Bacteria 8601019
970 2906646702 2906643746 Bacteria 8722424
971 2906661026 2906660503 Bacteria 8595048
972 2908746475 2908739725 Bacteria 8628932
973 2908757431 2908756301 Bacteria 8864324
974 2908777286 2908775508 Bacteria 8092255
975 2922377328
976 2922389453 2922386360 Bacteria 7017218
977 2922398430 2922393267 Bacteria 8285685
978 2922426559
979 2929622130 2929615660 Bacteria 9193770
980 2929630225 2929624759 Bacteria 9339455
981 2932787853 2932784394 Bacteria 9704911
982 2932795971 2932794094 Bacteria 7915132
983 2932807548 2932801729 Bacteria 7987968
984 2932817577 2932809354 Bacteria 9135765
985 2932826263 2932818245 Bacteria 9955613
986 2932835119 2932828146 Bacteria 9745859
987 2933584254 2933577622 Bacteria 9116884
988 2935614424 2935608549 Bacteria 8203142
989 2935620497 2935616580 Bacteria 9032984
990 2935632899 2935630451 Bacteria 8169952
991 2935640819 2935638405 Bacteria 10015038
992 2935649453 2935648319 Bacteria 8801166
993 2935657775 2935656913 Bacteria 8965014
994 2935670322 2935665750 Bacteria 9571747
995 2935679752 2935675223 Bacteria 9928132
996 2935687321 2935684952 Bacteria 9590419
997 2935696708 2935694250 Bacteria 9291695
998 2935709200 2935703347 Bacteria 10242284
999 2935718780 2935713505 Bacteria 9608509
1000 2935728432 2935722832 Bacteria 9608746
1001 2935736971 2935732158 Bacteria 9706831
1002 2935746026 2935741537 Bacteria 9707219
1003 2935753287 2935750917 Bacteria 9590372
1004 2935766320 2935760218 Bacteria 9817913
1005 2935770291 2935769743 Bacteria 7878163
1006 2935777682 2935777560 Bacteria 8077691
1007 2935786656 2935785616 Bacteria 7962367
1008 2935794710 2935793552 Bacteria 8012592
1009 2935809002 2935801545 Bacteria 9301974
1010 2935813819 2935810662 Bacteria 9401221
1011 2935826642 2935819856 Bacteria 8261050
1012 2935832326 2935827899 Bacteria 10038562
1013 2935844031 2935837841 Bacteria 9454360
1014 2935851064 2935847175 Bacteria 8228321
1015 2935862823 2935855204 Bacteria 9035059
1016 2935864566 2935864058 Bacteria 9784707
1017 2935875082 2935873716 Bacteria 9632195
1018 2935890238 2935883170 Bacteria 7964738
1019 2935913114 2935908558 Bacteria 8568796
1020 2935922536 2935916978 Bacteria 9113783
1021 2935930961 2935926038 Bacteria 8601059
1022 2935939705 2935934488 Bacteria 8602579
1023 2935946654 2935942939 Bacteria 8599779
1024 2935956145 2935951376 Bacteria 8602333
1025 2935965051 2935959822 Bacteria 7869783
1026 2935972938 2935967501 Bacteria 8603075
1027 2935978146 2935975950 Bacteria 8347125
1028 2935985730 2935984226 Bacteria 8302647
1029 2935999299 2935992306 Bacteria 9802711
1030 2936005854 2936002035 Bacteria 9362176
1031 2936011994 2936011229 Bacteria 8801034
1032 2936020925 2936019824 Bacteria 8804134
1033 2936029287 2936028420 Bacteria 8965941
1034 2936039375 2936037263 Bacteria 9446081
1035 2936048389 2936046547 Bacteria 8903709
1036 2936056500 2936055302 Bacteria 8785755
1037 2940559200 2940556831 Bacteria 9590747
1038 2941508436 2941507105 Bacteria 8166816
1039 2941516267 2941515067 Bacteria 8166720
1040 2941524717 2941523033 Bacteria 8169134
1041 2941541894 2941538514 Bacteria 9402094
1042 3005475905 3005474847 Bacteria 9259049
1043 3005491148 3005483717 Bacteria 7877331
1044 3005510989 3005506211 Bacteria 6943378
1045 3005591834 3005587118 Bacteria 7794411
1046 3005711890 3005710791 Bacteria 7622528
1047 8006931481 8006926726 Bacteria 6749210
1048 8006937217 8006933436 Bacteria 10410654
1049 8006966234 8006964411 Bacteria 8966052
1050 8006977228 8006973647 Bacteria 10679141
1051 8006993039 8006984368 Bacteria 9651211
1052 8006996899 8006994254 Bacteria 8309700
1053 8016517182 8016511872 Bacteria 9921665
1054 8016527062 8016522445 Bacteria 8156687
1055 8016532144 8016530956 Bacteria 8155261
1056 8016545354 8016539877 Bacteria 8155419
1057 8016556734 8016548790 Bacteria 8155074
1058 8016565091 8016557553 Bacteria 8154380
1059 8016570441 8016566248 Bacteria 8158151
1060 8016582973 8016575299 Bacteria 8154085
1061 8016585326 8016583857 Bacteria 10421953
1062 8016602739 8016595262 Bacteria 8149947
1063 8016605596 8016603502 Bacteria 8731218
1064 8016617514 8016613128 Bacteria 8794220
1065 8016624059 8016622563 Bacteria 7999408
1066 8016634809 8016630954 Bacteria 9217207
1067 8017059406 8017057580 Bacteria 10023680
1068 8019531962 8019530166 Bacteria 8155624
1069 8019539574 8019538911 Bacteria 7872763
1070 8019551081 8019547302 Bacteria 7996444
1071 8019571513 8019565922 Bacteria 9639779
1072 8019576212 8019576017 Bacteria 10049540
1073 8019594086 8019586578 Bacteria 10212056
1074 8019607476 8019597564 Bacteria 10041141
1075 8019621884 8019619141 Bacteria 9218857
1076 8019639171 8019638758 Bacteria 9062356
1077 8019651322 8019648815 Bacteria 10014479
1078 8019668254 8019659431 Bacteria 8577854
1079 8019677705 8019668869 Bacteria 8791617
1080 8019687237 8019678201 Bacteria 8863603
1081 8019693219 8019687851 Bacteria 8712826
1082 8055743619 8055742211 Bacteria 9226248
1083 8056675289 8056673599 Bacteria 7871253
1084 8056681593 8056681323 Bacteria 8472857
1085 8056692930 8056689827 Bacteria 6712655
1086 8056974074 8056967851 Bacteria 9038162
1087 Ga0068860_100000411
1088 LJQas_1003629
1089 JGI24740J21852_10010589
1090 JGI24735J21928_10038218
1091 JGI24750J21931_1003497
1092 JGI24744J21845_10006597
1093 JGI25153J46596_10000600
1094 JGI25153J46596_10001390
1095 JGI25153J46596_10002696
1096 JGI25160J50197_1001415
1097 JGI25404J52841_10000278
1098 JGI25404J52841_10009489
1099 JGI25404J52841_10011990
1100 Ga0055542_1006533
1101 Ga0055536_1008613
1102 Ga0055531_10031132
1103 Ga0065165_1002667
1104 Ga0065165_1013580
1105 Ga0070676_10016539
1106 Ga0070683_100025289
1107 Ga0070683_100130359
1108 Ga0070683_100215018
1109 Ga0070666_10243708
1110 Ga0070680_100010901
1111 Ga0070680_100350873
1112 Ga0070682_100174131
1113 Ga0070682_100284830
1114 Ga0070660_100004981
1115 Ga0070660_100311084
1116 Ga0070660_100323793
1117 Ga0070689_100027366
1118 Ga0070661_100135531
1119 Ga0070661_100311839
1120 Ga0070692_10032810
1121 Ga0070668_100003914
1122 Ga0070668_100076766
1123 Ga0070668_100209627
1124 Ga0070669_100000033
1125 Ga0070669_100000387
1126 Ga0070669_100037707
1127 Ga0070675_100061546
1128 Ga0070675_100589391
1129 Ga0070671_100000012
1130 Ga0070671_100017669
1131 Ga0070671_100109525
1132 Ga0070674_100020257
1133 Ga0070673_100076660
1134 Ga0070673_100233740
1135 Ga0070688_100004706
1136 Ga0070688_100017655
1137 Ga0070659_100072567
1138 Ga0070667_100000279
1139 Ga0070667_100136017
1140 Ga0070703_10067958
1141 Ga0070709_10000375
1142 Ga0070714_100212996
1143 Ga0070713_100041867
1144 Ga0070713_100089707
1145 Ga0070710_10000275
1146 Ga0070710_10017525
1147 Ga0070710_10040067
1148 Ga0070710_10228597
1149 Ga0070711_100006414
1150 Ga0070711_100020739
1151 Ga0070711_100022239
1152 Ga0070663_100018265
1153 Ga0070663_100161988
1154 Ga0070678_100106912
1155 Ga0070662_100134192
1156 Ga0070662_100140170
1157 Ga0070662_100391421
1158 Ga0070681_10061629
1159 Ga0070681_10216576
1160 Ga0070681_10308969
1161 Ga0068867_100029064
1162 Ga0070685_10000001
1163 Ga0070685_10049514
1164 Ga0070706_100219916
1165 Ga0070707_100083474
1166 Ga0070679_100034040
1167 Ga0070679_100053135
1168 Ga0070679_100075094
1169 Ga0070679_100076591
1170 Ga0070684_100001508
1171 Ga0070684_100028072
1172 Ga0070684_100053196
1173 Ga0070684_100168155
1174 Ga0070684_100398277
1175 Ga0068853_100000629
1176 Ga0068853_100086846
1177 Ga0068853_100296802
1178 Ga0070672_100005802
1179 Ga0070672_100147354
1180 Ga0070686_100014547
1181 Ga0070696_100024651
1182 Ga0070696_100313661
1183 Ga0070665_100078792
1184 Ga0070665_100102324
1185 Ga0070665_100135855
1186 Ga0070665_100313579
1187 Ga0070665_100326537
1188 Ga0070704_100044331
1189 Ga0070704_100110635
1190 Ga0068855_100029638
1191 Ga0068855_100034408
1192 Ga0068855_100058404
1193 Ga0068855_100094463
1194 Ga0068855_100098198
1195 Ga0068855_100237342
1196 Ga0068855_100250279
1197 Ga0068855_100582204
1198 Ga0070664_100096036
1199 Ga0070664_100387472
1200 Ga0068857_100036777
1201 Ga0068857_100064583
1202 Ga0068857_100066950
1203 Ga0068857_100084387
1204 Ga0068857_100274189
1205 Ga0068854_100026612
1206 Ga0068854_100043105
1207 Ga0068854_100150904
1208 Ga0068854_100354045
1209 Ga0068856_100003776
1210 Ga0068856_100062045
1211 Ga0068856_100338831
1212 Ga0070702_100215099
1213 Ga0068852_100005759
1214 Ga0068852_100064924
1215 Ga0068852_100064930
1216 Ga0068864_100000018
1217 Ga0068864_100047366
1218 Ga0068864_100055374
1219 Ga0068864_100248805
1220 Ga0068864_100261239
1221 Ga0068864_100663065
1222 Ga0068861_100010209
1223 Ga0068861_100136558
1224 Ga0068861_100176343
1225 Ga0068851_10017462
1226 Ga0068851_10054937
1227 Ga0068863_100630285
1228 Ga0068858_100004448
1229 Ga0068858_100136821
1230 Ga0068860_100000456
1231 Ga0068860_100012696
1232 Ga0068860_100044144
1233 Ga0068862_100002580
1234 Ga0068862_100006134
1235 Ga0068862_100270297
1236 Ga0068862_100526453
1237 Ga0081455_10002674
1238 Ga0081455_10016366
1239 Ga0081455_10052651
1240 Ga0081455_10092032
1241 Ga0081540_1000128
1242 Ga0081540_1001275
1243 Ga0081540_1001299
1244 Ga0081540_1005588
1245 Ga0081540_1006389
1246 Ga0081540_1012898
1247 Ga0081540_1016667
1248 Ga0081540_1028615
1249 Ga0081540_1028764
1250 Ga0081540_1041487
1251 Ga0081539_10074173
1252 Ga0081539_10105926
1253 Ga0081539_10120167
1254 Ga0070717_10069615
1255 Ga0070717_10073105
1256 Ga0075365_10060955
1257 Ga0075365_10082394
1258 Ga0075365_10136170
1259 Ga0075365_10179433
1260 Ga0075365_10228216
1261 Ga0075365_10269441
1262 Ga0075368_10001639
1263 Ga0075368_10048310
1264 Ga0075363_100002809
1265 Ga0075363_100017335
1266 Ga0075364_10085142
1267 Ga0075364_10221940
1268 Ga0070715_10024687
1269 Ga0070716_100013938
1270 Ga0070712_100005151
1271 Ga0070712_100005941
1272 Ga0070712_100045559
1273 Ga0070712_100070842
1274 Ga0070712_100434960
1275 Ga0075367_10042532
1276 Ga0075369_10044924
1277 Ga0075369_10089752
1278 Ga0097621_100033964
1279 Ga0097621_100122673
1280 Ga0075370_10034039
1281 Ga0075370_10194632
1282 Ga0068871_100081737
1283 Ga0068871_100195541
1284 Ga0075428_100155620
1285 Ga0075434_100359271
1286 Ga0068865_100070580
1287 Ga0075436_100009187
1288 Ga0099825_1032482
1289 Ga0099824_1014728
1290 Ga0099822_1000031
1291 Ga0099794_10102171
1292 Ga0099795_10009109
1293 Ga0099795_10042026
1294 Ga0105250_10048076
1295 Ga0105240_10005310
1296 Ga0105240_10008157
1297 Ga0105240_10020584
1298 Ga0105240_10020686
1299 Ga0105240_10194470
1300 Ga0105245_10233172
1301 Ga0105247_10037262
1302 Ga0105247_10085391
1303 Ga0105247_10101322
1304 Ga0105247_10153131
1305 Ga0105247_10178817
1306 Ga0105247_10290054
1307 Ga0114129_10085137
1308 Ga0105243_10181929
1309 Ga0105241_10001771
1310 Ga0105241_10104105
1311 Ga0105242_10086402
1312 Ga0105248_10042837
1313 Ga0105248_10082009
1314 Ga0105248_10095178
1315 Ga0105248_10400059
1316 Ga0105248_10512173
1317 Ga0105237_10008184
1318 Ga0105237_10045694
1319 Ga0105237_10046343
1320 Ga0105237_10113822
1321 Ga0105237_10146340
1322 Ga0105237_10361717
1323 Ga0105237_10385688
1324 Ga0105238_10000517
1325 Ga0105238_10022670
1326 Ga0105238_10026980
1327 Ga0105249_10471740
1328 Ga0099796_10009283
1329 Ga0099796_10021895
1330 Ga0099796_10023122
1331 Ga0099796_10033766
1332 Ga0105239_10002648
1333 Ga0105239_10017924
1334 Ga0105239_10021488
1335 Ga0105239_10031806
1336 Ga0105239_10065141
1337 Ga0105239_10072205
1338 Ga0105239_10134890
1339 Ga0105239_10234595
1340 Ga0105239_10391969
1341 Ga0105246_10116136
1342 Ga0105246_10191791
1343 Ga0105246_10220229
1344 Ga0157371_10021936
1345 Ga0157370_10014532
1346 Ga0157370_10124641
1347 Ga0157369_10003506
1348 Ga0157369_10006970
1349 Ga0157369_10014315
1350 Ga0157369_10052523
1351 Ga0157369_10496025
1352 Ga0157374_10061178
1353 Ga0157374_10077659
1354 Ga0157378_10063588
1355 Ga0157378_10293822
1356 Ga0157378_10454106
1357 Ga0163162_10382877
1358 Ga0157372_10023555
1359 Ga0157375_10055632
1360 Ga0157375_10073375
1361 Ga0163163_10000069
1362 Ga0157380_10210285
1363 Ga0157380_10338602
1364 Ga0157380_10448403
1365 Ga0157377_10060818
1366 Ga0157377_10090470
1367 Ga0157379_10051655
1368 Ga0157379_10355752
1369 Ga0157376_10325225
1370 Ga0157376_10419511
1371 Ga0213872_10022702
1372 Ga0213876_10000477
1373 Ga0209677_102608
1374 Ga0209148_1001000
1375 Ga0209233_1002990
1376 Ga0209233_1009100
1377 Ga0209455_1001389
1378 Ga0209455_1010687
1379 Ga0209455_1015147
1380 Ga0209675_1006021
1381 Ga0209676_1000284
1382 Ga0209564_1002110
1383 Ga0209564_1013028
1384 Ga0209758_1000206
1385 Ga0209758_1001267
1386 Ga0209758_1001347
1387 Ga0209758_1011263
1388 Ga0209758_1037256
1389 Ga0209050_1016402
1390 Ga0207426_1000799
1391 Ga0207426_1003234
1392 Ga0207426_1008081
1393 Ga0207426_1030869
1394 Ga0209257_1000394
1395 Ga0209257_1008387
1396 Ga0209257_1013507
1397 Ga0207697_10064088
1398 Ga0207656_10003517
1399 Ga0207692_10000229
1400 Ga0207692_10023181
1401 Ga0207710_10014586
1402 Ga0207710_10038836
1403 Ga0207710_10084508
1404 Ga0207688_10001503
1405 Ga0207688_10067444
1406 Ga0207688_10072127
1407 Ga0207680_10100912
1408 Ga0207685_10041278
1409 Ga0207699_10000242
1410 Ga0207645_10012744
1411 Ga0207645_10083437
1412 Ga0207645_10139770
1413 Ga0207654_10000248
1414 Ga0207654_10009059
1415 Ga0207654_10041873
1416 Ga0207654_10062044
1417 Ga0207707_10002685
1418 Ga0207707_10045342
1419 Ga0207695_10000006
1420 Ga0207695_10000343
1421 Ga0207695_10050510
1422 Ga0207695_10050929
1423 Ga0207695_10063575
1424 Ga0207695_10075958
1425 Ga0207671_10029138
1426 Ga0207671_10061668
1427 Ga0207693_10007398
1428 Ga0207693_10033852
1429 Ga0207693_10073908
1430 Ga0207693_10096274
1431 Ga0207663_10009571
1432 Ga0207663_10025694
1433 Ga0207663_10186331
1434 Ga0207660_10008346
1435 Ga0207660_10029917
1436 Ga0207660_10205430
1437 Ga0207660_10207998
1438 Ga0207660_10286956
1439 Ga0207657_10004349
1440 Ga0207657_10012048
1441 Ga0207657_10127903
1442 Ga0207657_10280914
1443 Ga0207649_10064731
1444 Ga0207652_10166910
1445 Ga0207652_10201178
1446 Ga0207646_10028422
1447 Ga0207681_10000011
1448 Ga0207681_10001220
1449 Ga0207681_10136657
1450 Ga0207694_10000136
1451 Ga0207694_10029183
1452 Ga0207694_10360648
1453 Ga0207650_10000003
1454 Ga0207659_10046382
1455 Ga0207687_10065440
1456 Ga0207700_10168867
1457 Ga0207700_10301374
1458 Ga0207664_10124695
1459 Ga0207644_10000036
1460 Ga0207644_10114097
1461 Ga0207690_10118641
1462 Ga0207690_10345481
1463 Ga0207706_10002700
1464 Ga0207706_10247650
1465 Ga0207709_10174233
1466 Ga0207669_10057536
1467 Ga0207665_10004541
1468 Ga0207665_10081743
1469 Ga0207691_10002238
1470 Ga0207691_10097989
1471 Ga0207691_10192500
1472 Ga0207691_10329244
1473 Ga0207711_10000469
1474 Ga0207689_10012288
1475 Ga0207661_10000613
1476 Ga0207661_10053399
1477 Ga0207661_10173608
1478 Ga0207679_10133539
1479 Ga0207667_10018828
1480 Ga0207667_10084423
1481 Ga0207667_10174101
1482 Ga0207667_10377599
1483 Ga0207712_10062581
1484 Ga0207668_10021332
1485 Ga0207668_10111939
1486 Ga0207668_10117302
1487 Ga0207668_10292653
1488 Ga0207668_10421735
1489 Ga0207640_10080475
1490 Ga0207640_10138490
1491 Ga0207658_10000007
1492 Ga0207658_10101121
1493 Ga0207677_10130335
1494 Ga0207703_10036999
1495 Ga0207639_10056591
1496 Ga0207639_10277079
1497 Ga0207678_10045082
1498 Ga0207678_10079165
1499 Ga0207678_10162783
1500 Ga0207678_10198830
1501 Ga0207678_10237184
1502 Ga0207708_10088913
1503 Ga0207702_10000006
1504 Ga0207702_10128736
1505 Ga0207641_10099781
1506 Ga0207648_10008717
1507 Ga0207648_10201861
1508 Ga0207648_10265156
1509 Ga0207676_10000003
1510 Ga0207676_10005493
1511 Ga0207676_10019688
1512 Ga0207676_10023076
1513 Ga0207674_10003449
1514 Ga0207674_10108458
1515 Ga0207674_10217126
1516 Ga0207674_10287903
1517 Ga0207675_100001986
1518 Ga0207683_10021982
1519 Ga0207683_10041690
1520 Ga0207683_10089991
1521 Ga0207683_10127715
1522 Ga0207698_10175307
1523 Ga0209389_1000039
1524 Ga0209589_1000025
1525 Ga0209489_100039
1526 Ga0209489_100087
1527 Ga0209700_100043
1528 Ga0209700_100090
1529 Ga0207428_10091011
1530 Ga0268266_10002576
1531 Ga0268266_10010607
1532 Ga0268266_10023222
1533 Ga0268266_10049211
1534 Ga0268266_10117706
1535 Ga0268266_10161996
1536 Ga0268266_10190963
1537 Ga0268266_10252527
1538 Ga0268266_10576138
1539 Ga0268265_10000404
1540 Ga0268265_10518300
1541 Ga0268264_10000009
1542 Ga0268264_10000194
1543 Ga0268264_10267649
1544 Ga0265337_1007418
1545 Ga0265326_10003492
1546 Ga0265334_10052977
1547 Ga0265318_10013434
1548 Ga0265323_10001501
1549 Ga0265336_10000238
1550 Ga0307517_10000460
1551 Ga0307515_10022467
1552 Ga0265338_10000278
1553 Ga0265338_10015741
1554 Ga0265324_10001755
1555 Ga0307511_10087368
1556 Ga0265328_10062648
1557 Ga0265325_10035604
1558 Ga0265339_10000080
1559 Ga0265331_10062111
1560 Ga0265327_10133407
1561 Ga0307513_10108928
1562 Ga0307509_10046806
1563 Ga0265313_10000948
1564 Ga0307508_10009068
1565 Ga0307508_10072172
1566 Ga0307508_10117091
1567 Ga0307508_10138745
1568 Ga0316576_10039580
1569 Ga0307516_10020275
1570 Ga0307516_10024100
1571 Ga0307516_10097455
1572 Ga0307413_10260066
1573 Ga0307507_10094534
1574 Ga0307510_10003787
1575 Ga0307510_10015985
1576 Ga0307510_10034065
1577 Ga0307510_10034602
1578 Ga0373934_0040432
1579 Ga0373934_0084520
1580 Ga0373923_0003366
1581 Ga0373936_0032224
1582 Ga0373954_0003572
1583 Ga0373943_0110063
1584 Ga0373946_0027530
1585 Ga0373924_0007531
1586 Ga0373931_0019668
1587 Ga0373935_0000718
1588 Ga0373927_0000666
1589 Ga0373927_0028210
1590 Ga0373927_0055244
1591 Ga0373927_0083230
1592 Ga0373927_0116554
1593 Ga0373933_0016974
1594 Ga0373947_0004761
1595 Ga0373947_0007585
1596 Ga0373937_0351720
1597 Ga0373925_0005280
1598 Ga0373925_0017463
1599 Ga0373925_0108934
1600 Ga0373925_0116855
1601 Ga0395899_0139018
1602 Ga0395900_0001340
1603 Ga0395900_0040887
1604 Ga0395900_0062560
1605 Ga0395900_0215928
1606 Ga0395898_0005324
1607 Ga0395898_0018293
1608 Ga0395905_0006516
1609 Ga0395905_0393524
1610 Ga0395901_0007542
1611 Ga0395901_0043404
1612 Ga0395901_0070968
1613 Ga0395901_0106088
1614 Ga0395901_0278347
1615 Ga0436365_0009505
1616 Ga0436365_0646338
1617 Ga0436365_1302408
1618 Ga0436362_0825075
1619 Ga0451837_0551018
1620 Ga0439458_0010422
1621 Ga0451577_0002389
1622 Ga0453683_0008359
1623 Ga0453684_0002985
1624 Ga0453684_0004556
1625 Ga0453684_0029755
1626 Ga0453684_0434711
1627 Ga0466957_0024632
1628 Ga0466959_0065671
1629 Ga0451576_0181107
1630 Ga0451576_0551541
1631 Ga0466967_0113558
1632 Ga0466967_0127095
1633 Ga0495592_0034591
1634 Ga0495592_0142153
1635 Ga0495603_0000206
1636 Ga0495603_0069469
1637 Ga0495603_0146188
1638 Ga0495629_0000338
1639 Ga0495638_0003637
1640 Ga0495641_0005602
1641 Ga0495653_0183846
1642 Ga0495650_0048142
1643 Ga0495580_0003372
1644 Ga0495582_0000423
1645 Ga0495582_0034111
1646 Ga0495605_0034758
1647 Ga0495639_0000039
1648 Ga0495639_0026043
1649 Ga0495664_0000847
1650 Ga0495664_0009313
1651 Ga0495664_0082926
1652 Ga0495584_0054927
1653 Ga0495585_0058241
1654 Ga0495594_0006677
1655 Ga0495594_0122324
1656 Ga0495606_0001194
1657 Ga0495606_0036283
1658 Ga0495606_0073803
1659 Ga0495610_0109050
1660 Ga0495618_0003604
1661 Ga0495628_0048999
1662 Ga0495630_0024274
1663 Ga0495630_0132772
1664 Ga0495643_0008839
1665 Ga0495644_0043687
1666 Ga0495644_0044816
1667 Ga0495648_0000536
1668 Ga0495648_0012759
1669 Ga0495663_0052662
1670 Ga0495666_0007417
1671 Ga0495652_0085687
1672 Ga0495652_0113761
1673 Ga0495665_0000082
1674 Ga0495665_0084964
1675 Ga0495640_0177856
1676 Ga0495609_0077069
1677 Ga0495645_0017895
1678 Ga0495622_0011857
1679 Ga0495622_0024190
1680 Ga0495633_0015568
1681 Ga0495667_0043015
1682 Ga0495656_0007521
1683 Ga0495656_0074139
1684 Ga0495668_0116184
1685 Ga0495634_0000776
1686 Ga0495635_0009338
1687 Ga0495659_0002499
1688 Ga0495588_0033674
1689 Ga0495657_0025940
1690 Ga0495599_0012128
1691 Ga0495623_0149613
1692 Ga0495646_0137791
1693 Ga0495658_0003324
1694 Ga0495658_0004531
1695 Ga0495669_0031299
1696 Ga0495613_0016376
1697 Ga0495624_0159753
1698 Ga0495624_0165888
1699 Ga0495624_0209447
1700 Ga0495670_0068221
1701 Ga0495649_0111470
1702 Ga0495589_0202372
1703 Ga0495600_0100275
1704 Ga0495581_0000006
1705 Ga0495581_0010765
1706 Ga0495604_0005606
1707 Ga0495604_0102161
1708 Ga0495636_0014126
1709 Ga0495674_0012193
1710 Ga0495672_0008439
1711 Ga0495672_0037381
1712 Ga0495680_0005494
1713 Ga0495683_0132631
1714 Ga0495675_0002994
1715 Ga0495684_0001984
1716 Ga0495684_0050956
1717 Ga0495684_0109343
1718 Ga0495593_0000032
1719 Ga0495602_0039658
1720 Ga0495614_0014894
1721 Ga0496100_0018954
1722 Ga0496101_0015301
1723 Ga0496101_0151395
1724 Ga0496101_0155163
1725 Ga0496101_0174929
1726 Ga0496102_0019308
1727 Ga0496102_0334042
1728 Ga0496103_0039846
1729 Ga0496104_0031856
1730 Ga0496104_0032721
1731 Ga0496104_0173868
1732 Ga0496104_0178162
1733 Ga0496105_0059106
1734 Ga0496106_0002364
1735 Ga0496106_0020140
1736 Ga0496106_0039179
1737 Ga0496106_0158596
1738 Ga0496106_0194625
1739 Ga0496108_0020520
1740 Ga0496108_0261238
1741 Ga0496109_0088902
1742 Ga0496109_0412342
1743 Ga0496110_0554298
1744 Ga0496111_0016061
1745 Ga0496111_0021658
1746 Ga0496111_0139669
1747 Ga0496111_0452783
1748 Ga0496112_0000029
1749 Ga0496112_0108628
1750 Ga0496112_0440467
1751 Ga0496113_0060918
1752 Ga0496113_0068963
1753 Ga0496113_0116139
1754 Ga0496114_0042973
1755 Ga0496114_0056894
1756 Ga0496114_0269007
1757 Ga0496114_0527816
1758 Ga0496115_0006927
1759 Ga0496115_0052564
1760 Ga0496117_0016836
1761 Ga0496118_0002319
1762 Ga0496118_0032776
1763 Ga0496120_0022972
1764 Ga0496121_0000352
1765 Ga0496121_0003091
1766 Ga0496121_0018747
1767 Ga0496121_0019666
1768 Ga0496121_0085513
1769 Ga0496121_0091056
1770 Ga0496121_0120703
1771 Ga0496121_0158117
1772 Ga0496124_0001443
1773 Ga0496124_0054966
1774 Ga0496124_0107167
1775 Ga0496125_0008186
1776 Ga0496125_0026403
1777 Ga0496125_0029894
1778 Ga0496126_0003276
1779 Ga0496126_0005702
1780 Ga0496126_0013048
1781 Ga0496126_0014279
1782 Ga0496126_0016514
1783 Ga0496126_0042845
1784 Ga0496126_0051752
1785 Ga0496126_0065029
1786 Ga0496126_0206382
1787 Ga0501031_0002569
1788 Ga0501031_0008055
1789 Ga0501032_0000301
1790 Ga0501032_0005845
1791 Ga0501032_0017725
1792 Ga0501032_0030565
1793 Ga0501032_0097679
1794 Ga0501032_0282915
1795 Ga0501033_0000270
1796 Ga0501033_0001377
1797 Ga0501033_0010053
1798 Ga0501033_0080248
1799 Ga0501034_0000715
1800 Ga0501034_0030327
1801 Ga0501036_0000043
1802 Ga0501036_0000128
1803 Ga0501036_0006458
1804 Ga0501036_0007332
1805 Ga0501036_0063189
1806 Ga0501037_0000040
1807 Ga0501037_0006378
1808 Ga0501037_0006531
1809 Ga0501037_0009276
1810 Ga0501037_0051620
1811 Ga0501037_0097398
1812 Ga0501037_0247706
1813 Ga0501038_0000131
1814 Ga0501038_0000630
1815 Ga0501038_0038383
1816 Ga0501038_0198446
1817 Ga0501039_0000106
1818 Ga0501039_0006604
1819 Ga0501039_0096394
1820 Ga0501040_0068247
1821 Ga0501041_0018507
1822 Ga0501042_0159404
1823 Ga0501042_0170445
1824 Ga0501043_0000074
1825 Ga0501043_0005735
1826 Ga0501043_0036399
1827 Ga0501046_0000074
1828 Ga0501046_0005024
1829 Ga0501046_0013483
1830 Ga0501046_0014460
1831 Ga0501047_0000346
1832 Ga0501047_0020019
1833 Ga0501047_0057626
1834 Ga0501047_0078407
1835 Ga0501048_0000349
1836 Ga0501048_0000550
1837 Ga0501048_0009855
1838 Ga0501067_0007707
1839 Ga0501067_0037192
1840 Ga0501067_0118106
1841 Ga0501068_0006614
1842 Ga0501068_0021802
1843 Ga0501068_0071766
1844 Ga0501069_0003736
1845 Ga0501069_0003813
1846 Ga0501070_0005383
1847 Ga0501070_0022234
1848 Ga0501070_0046564
1849 Ga0501070_0068726
1850 Ga0501071_0220347
1851 Ga0501072_0001372
1852 Ga0501072_0002038
1853 Ga0501073_0000085
1854 Ga0501073_0004871
1855 Ga0501073_0026762
1856 Ga0501074_0000145
1857 Ga0501074_0159786
1858 Ga0501079_0001762
1859 Ga0501079_0012601
1860 Ga0501080_0005166
1861 Ga0501080_0005596
1862 Ga0501080_0093793
1863 Ga0501080_0195710
1864 Ga0501081_0228803
1865 Ga0501083_0015067
1866 Ga0501083_0015766
1867 Ga0501083_0099940
1868 Ga0501083_0117923
1869 Ga0501035_0001345
1870 Ga0501035_0002989
1871 Ga0501035_0008293
1872 Ga0501035_0013984
1873 Ga0501035_0054696
1874 Ga0501035_0301024
1875 Ga0501035_0418591
1876 Ga0501044_0000667
1877 Ga0501044_0027021
1878 Ga0501044_0032753
1879 Ga0501044_0081071
1880 Ga0501044_0083394
1881 Ga0501044_0109258
1882 Ga0501044_0165131
1883 Ga0501044_0209343
1884 Ga0501045_0003017
1885 Ga0501045_0012743
1886 Ga0501045_0137643
1887 nmdc:mga03n38_1891_c1
1888 nmdc:mga03n38_91863_c1
1889 nmdc:mga00v17_135430_c1
1890 nmdc:mga0yw44_134578_c1
1891 nmdc:mga0yw44_222728_c1
1892 nmdc:mga0yw44_63789_c1
1893 nmdc:mga0k408_157748_c1
1894 nmdc:mga0k408_35179_c1
1895 nmdc:mga0k408_60795_c1
1896 nmdc:mga0k408_65696_c1
1897 nmdc:mga06z11_27139_c1
1898 nmdc:mga06z11_54543_c1
1899 nmdc:mga04h51_3952_c1
1900 nmdc:mga08y16_382969_c1
1901 nmdc:mga0n895_227122_c1
1902 nmdc:mga0n895_357578_c1
1903 nmdc:mga0n895_4726_c1
1904 nmdc:mga08x19_67652_c1
1905 nmdc:mga0sz30_12669_c1
1906 nmdc:mga0sz30_18835_c1
1907 nmdc:mga0sz30_28201_c1
1908 Ga0495601_0085301
1909 Ga0500635_0012868
1910 Ga0500643_000443
1911 Ga0500647_0023852
1912 Ga0500566_0000270
1913 Ga0500566_0000780
1914 Ga0500566_0014575
1915 Ga0500641_0008048
1916 Ga0500641_0008602
1917 Ga0500641_0109731
1918 Ga0500555_023586
1919 Ga0500556_0004536
1920 Ga0500556_0099071
1921 Ga0500572_001115
1922 Ga0500594_0043603
1923 Ga0500595_000328
1924 Ga0500595_001866
1925 Ga0500595_012540
1926 Ga0500614_001182
1927 Ga0500617_115703
1928 Ga0500559_0001813
1929 Ga0500564_146053
1930 Ga0500568_0084481
1931 Ga0500573_0017246
1932 Ga0500577_0030140
1933 Ga0500588_0009801
1934 Ga0500603_000151
1935 Ga0500603_008750
1936 Ga0500616_0053704
1937 Ga0500622_0092915
1938 Ga0500638_057307
1939 Ga0500639_000065
1940 Ga0500636_0000584
1941 Ga0500636_0023297
1942 Ga0500637_0000413
1943 Ga0500637_0090652
1944 Ga0500637_0157770
1945 Ga0500645_025589
1946 Ga0500645_054165
1947 Ga0500596_000494
1948 Ga0500599_000161
1949 Ga0500601_000483
1950 Ga0501084_0002085
1951 Ga0501084_0003469
1952 Ga0501082_0018999
1953 Ga0501082_0033487
1954 Ga0501082_0087916
1955 2507505999
1956 2508540187
1957 2508696261
1958 2509148190
1959 2511397326
1960 2513592443
1961 2513624910
1962 2513638257
1963 2513649095
1964 2513657558
1965 2513674944
1966 2513701556
1967 2513716261
1968 2513861114
1969 2513877170
1970 2513916811
1971 2514014539
1972 2517103189
1973 2517889721
1974 2524440757
1975 2524533113
1976 2528850764
1977 2617347882
1978 2617374804
1979 2644290425
1980 2671119571
1981 2723848926
1982 2728748933
1983 2745075998
1984 2758640684
1985 2793061467
1986 2793070299
1987 2793078930
1988 2805916231
1989 2818240486
1990 2824603706
1991 2824610708
1992 2824624968
1993 2824630995
1994 2824641243
1995 2824649673
1996 2824657910
1997 2824666907
1998 2824674085
1999 2824690751
2000 2824703321
2001 2824710962
2002 2824719598
2003 2824728573
2004 2824737933
2005 2824752186
2006 2824760348
2007 2824772484
2008 2824776341
2009 2838125008
2010 2841945747
2011 2841956846
2012 2841964029
2013 2841973594
2014 2841981928
2015 2841989482
2016 2842044467
2017 2842051544
2018 2842778407
2019 2847939359
2020 2847941115
2021 2849082101
2022 2857513418
2023 2874130557
2024 2874596264
2025 2874610051
2026 2874616536
2027 2874622554
2028 2874633467
2029 2874650251
2030 2876763652
2031 2876776729
2032 2876824519
2033 2879080866
2034 2879087032
2035 2879104363
2036 2879116915
2037 2879133711
2038 2879148213
2039 2881369522
2040 2881669762
2041 2885367832
2042 2885378461
2043 2885386468
2044 2885412984
2045 2888387161
2046 2888421257
2047 2903750330
2048 2903775238
2049 2904671439
2050 2904691971
2051 2904707522
2052 2904719731
2053 2906614697
2054 2906631358
2055 2906636216
2056 2906646702
2057 2906661026
2058 2908746475
2059 2908757431
2060 2908777286
2061 2922377328
2062 2922389453
2063 2922398430
2064 2922426559
2065 2929622130
2066 2929630225
2067 2932787853
2068 2932795971
2069 2932807548
2070 2932817577
2071 2932826263
2072 2932835119
2073 2933584254
2074 2935614424
2075 2935620497
2076 2935632899
2077 2935640819
2078 2935649453
2079 2935657775
2080 2935670322
2081 2935679752
2082 2935687321
2083 2935696708
2084 2935709200
2085 2935718780
2086 2935728432
2087 2935736971
2088 2935746026
2089 2935753287
2090 2935766320
2091 2935770291
2092 2935777682
2093 2935786656
2094 2935794710
2095 2935809002
2096 2935813819
2097 2935826642
2098 2935832326
2099 2935844031
2100 2935851064
2101 2935862823
2102 2935864566
2103 2935875082
2104 2935890238
2105 2935913114
2106 2935922536
2107 2935930961
2108 2935939705
2109 2935946654
2110 2935956145
2111 2935965051
2112 2935972938
2113 2935978146
2114 2935985730
2115 2935999299
2116 2936005854
2117 2936011994
2118 2936020925
2119 2936029287
2120 2936039375
2121 2936048389
2122 2936056500
2123 2940559200
2124 2941508436
2125 2941516267
2126 2941524717
2127 2941541894
2128 3005475905
2129 3005491148
2130 3005510989
2131 3005591834
2132 3005711890
2133 8006931481
2134 8006937217
2135 8006966234
2136 8006977228
2137 8006993039
2138 8006996899
2139 8016517182
2140 8016527062
2141 8016532144
2142 8016545354
2143 8016556734
2144 8016565091
2145 8016570441
2146 8016582973
2147 8016585326
2148 8016602739
2149 8016605596
2150 8016617514
2151 8016624059
2152 8016634809
2153 8017059406
2154 8019531962
2155 8019539574
2156 8019551081
2157 8019571513
2158 8019576212
2159 8019594086
2160 8019607476
2161 8019621884
2162 8019639171
2163 8019651322
2164 8019668254
2165 8019677705
2166 8019687237
2167 8019693219
2168 8055743619
2169 8056675289
2170 8056681593
2171 8056692930
2172 8056974074

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

127

324

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.6681 39 251
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6558 44 255
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6437 44 255
3fh6-assembly2.cif.gz_H crystal structure of the resting state maltose transporter from e. coli 0.6286 58 255
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.6268 39 254
ID Description Score Start End Superfamily
3puzF04 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7632 53 208 1.10.3720.10
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6882 24 260 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.669 22 259 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6665 22 265 1.10.3720.10
af_Q2G2A9_6_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6649 21 263 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A6N8KAJ4-F1-model_v4 deleted 0.8747 24 157
AF-A0A351BIM1-F1-model_v4 Sulfate/thiosulfate ABC transporter permease CysW 0.8568 49 210 GO:0005886
GO:0015419
AF-A0A351BIM1-F1-model_v4 Sulfate/thiosulfate ABC transporter permease CysW 0.8474 49 210 GO:0005886
GO:0015419
AF-A0A1F7MUY6-F1-model_v4 Molybdenum ABC transporter permease subunit 0.844 53 203 GO:0005886
GO:0055085
AF-A0A328V5M5-F1-model_v4 deleted 0.84 22 195

Map