F489803
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1087 | 493 | 2174 | 397 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10014338|Ga0157369_100143385 |
| Length | 430 |
| Sequence | VIGDATALDRRAGTAILQPRLLNYHSVTREASMTRLAHTPGLTDVQEAILATVREFVTKEIIPHAQRLEHDDTYPADIVDGMREMGLFGLTIDEEYGGLGESLLTYALVVEELARGWMSISGIVNTHFIVAYLVSQHGTAEQKRRLLPRLATGEMRGAFSMSEPGCGSDVAGIRSRAVPDGDGFVLNGQKMWLTNGAYSSVVATLMKTDTGADSVYGNMTTFLLEKEPGFGETAPGLAIPGKIEKMGYKGVETTEMVLDNHSVSAIAVLGGAEGVGRGFYQMMDGIEVGRVNVAARACGIAIRAFELAIGYAQQRQTFGKPLYQHQAIAFKLAEMGTKIEAGHALMVNAARLKDSGQRNDVEAGMAKLLASEYCAEVVQESFRIHGGYGYSKEYEIERLMREAPFLLIGEGTSEIQKTIISRGLLKEYRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 204 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 205 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 206 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 244 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 245 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 246 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 248 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 249 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 250 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 251 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 252 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 255 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 375 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 377 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 378 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 379 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 380 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 381 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 382 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 383 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 386 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 387 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 388 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 389 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 390 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 391 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 392 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 393 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 394 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 395 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 396 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 397 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 398 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 399 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 400 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 401 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 402 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 403 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 404 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 405 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 406 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 407 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 408 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 409 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 410 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 411 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 412 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 413 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 414 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 415 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 416 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 417 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 418 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 419 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 420 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 421 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 422 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 423 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 424 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 425 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 426 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 427 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 428 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 429 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 430 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 431 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 432 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 433 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 434 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 435 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 436 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 437 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 438 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 439 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 440 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 441 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 442 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 443 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 444 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 445 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 446 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 447 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 448 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 449 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 450 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 451 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 452 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 453 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 454 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 455 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 456 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 457 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 458 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 459 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 460 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 461 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 462 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 463 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 464 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 465 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 466 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 467 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 468 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 469 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 470 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 471 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 472 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 473 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 474 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 475 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 476 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 477 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 478 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 479 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 480 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 481 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 482 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 483 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 484 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 485 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 486 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 487 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 488 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 489 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 490 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 491 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 492 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 493 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.33 |
| Metatranscriptomes | 0.64 |
| Isolates | 10.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.43 |
| Nodule | 2.85 |
| Rhizoplane | 8.65 |
| Rhizosphere | 70.93 |
| Stem | 0 |
| Stem Tuber | 0.18 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157369_10014338 | 3300013105 | Bacteria | 8950 |
| 2 | LJQas_1002727 | 3300000549 | Bacteria | 2429 |
| 3 | JGI24739J22299_10039237 | 3300001989 | Bacteria | 1587 |
| 4 | JGI24737J22298_10025874 | 3300001990 | Bacteria | 1853 |
| 5 | JGI24743J22301_10001350 | 3300001991 | Bacteria | 3367 |
| 6 | JGI24735J21928_10007384 | 3300002067 | Bacteria | 3587 |
| 7 | JGI24744J21845_10002473 | 3300002077 | Bacteria | 3766 |
| 8 | JGI24033J26618_1005562 | 3300002155 | Bacteria | 1393 |
| 9 | JGI24034J26672_10001418 | 3300002239 | Bacteria | 3179 |
| 10 | JGI24742J22300_10000583 | 3300002244 | Bacteria | 5485 |
| 11 | JGI25406J46586_10002477 | 3300003203 | Bacteria | 8731 |
| 12 | JGI25406J46586_10024529 | 3300003203 | Bacteria | 2360 |
| 13 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 14 | Ga0055540_1000261 | 3300003792 | Bacteria | 47645 |
| 15 | Ga0055540_1002970 | 3300003792 | Bacteria | 8507 |
| 16 | Ga0055540_1016606 | 3300003792 | Bacteria | 2087 |
| 17 | JGI25405J52794_10009820 | 3300003911 | Bacteria | 1813 |
| 18 | Ga0070658_10001192 | 3300005327 | Bacteria | 22232 |
| 19 | Ga0070658_10003430 | 3300005327 | Bacteria | 13031 |
| 20 | Ga0070676_10021409 | 3300005328 | Bacteria | 3621 |
| 21 | Ga0070683_100009730 | 3300005329 | Bacteria | 8233 |
| 22 | Ga0070690_100071686 | 3300005330 | Bacteria | 2251 |
| 23 | Ga0070670_100001154 | 3300005331 | Bacteria | 20925 |
| 24 | Ga0068869_100002993 | 3300005334 | Bacteria | 10267 |
| 25 | Ga0068869_100014710 | 3300005334 | Bacteria | 5233 |
| 26 | Ga0068869_100108312 | 3300005334 | Bacteria | 2111 |
| 27 | Ga0068869_100114859 | 3300005334 | Bacteria | 2052 |
| 28 | Ga0070666_10025034 | 3300005335 | Bacteria | 3890 |
| 29 | Ga0070680_100000297 | 3300005336 | Bacteria | 33160 |
| 30 | Ga0070680_100112545 | 3300005336 | Bacteria | 2266 |
| 31 | Ga0070682_100000335 | 3300005337 | Bacteria | 32356 |
| 32 | Ga0070682_100054424 | 3300005337 | Bacteria | 2511 |
| 33 | Ga0068868_100004268 | 3300005338 | Bacteria | 10003 |
| 34 | Ga0068868_100008435 | 3300005338 | Bacteria | 7379 |
| 35 | Ga0068868_100008450 | 3300005338 | Bacteria | 7371 |
| 36 | Ga0068868_100064065 | 3300005338 | Bacteria | 2917 |
| 37 | Ga0070660_100001969 | 3300005339 | Bacteria | 14171 |
| 38 | Ga0070660_100085916 | 3300005339 | Bacteria | 2475 |
| 39 | Ga0070689_100067656 | 3300005340 | Bacteria | 2785 |
| 40 | Ga0070689_100089896 | 3300005340 | Bacteria | 2419 |
| 41 | Ga0070691_10003837 | 3300005341 | Bacteria | 6790 |
| 42 | Ga0070691_10015402 | 3300005341 | Bacteria | 3514 |
| 43 | Ga0070692_10000043 | 3300005345 | Bacteria | 24251 |
| 44 | Ga0070668_100001102 | 3300005347 | Bacteria | 19064 |
| 45 | Ga0070668_100002458 | 3300005347 | Bacteria | 13634 |
| 46 | Ga0070668_100031527 | 3300005347 | Bacteria | 4033 |
| 47 | Ga0070668_100194534 | 3300005347 | Bacteria | 1662 |
| 48 | Ga0070669_100172314 | 3300005353 | Bacteria | 1688 |
| 49 | Ga0070675_100000578 | 3300005354 | Bacteria | 25111 |
| 50 | Ga0070675_100005371 | 3300005354 | Bacteria | 9793 |
| 51 | Ga0070671_100001349 | 3300005355 | Bacteria | 18370 |
| 52 | Ga0070671_100001748 | 3300005355 | Bacteria | 16507 |
| 53 | Ga0070674_100021522 | 3300005356 | Bacteria | 4142 |
| 54 | Ga0070673_100029092 | 3300005364 | Bacteria | 4117 |
| 55 | Ga0070688_100010150 | 3300005365 | Bacteria | 5182 |
| 56 | Ga0070659_100048536 | 3300005366 | Bacteria | 3335 |
| 57 | Ga0070659_100060152 | 3300005366 | Bacteria | 3001 |
| 58 | Ga0070659_100179378 | 3300005366 | Bacteria | 1737 |
| 59 | Ga0070667_100000087 | 3300005367 | Bacteria | 114528 |
| 60 | Ga0070667_100004630 | 3300005367 | Bacteria | 11547 |
| 61 | Ga0070667_100007753 | 3300005367 | Bacteria | 8902 |
| 62 | Ga0070667_100038520 | 3300005367 | Bacteria | 4007 |
| 63 | Ga0070667_100047658 | 3300005367 | Bacteria | 3606 |
| 64 | Ga0070703_10024660 | 3300005406 | Bacteria | 1779 |
| 65 | Ga0070709_10061429 | 3300005434 | Bacteria | 2392 |
| 66 | Ga0070714_100000057 | 3300005435 | Bacteria | 103150 |
| 67 | Ga0070714_100000701 | 3300005435 | Bacteria | 23697 |
| 68 | Ga0070714_100198913 | 3300005435 | Bacteria | 1832 |
| 69 | Ga0070714_100232497 | 3300005435 | Bacteria | 1699 |
| 70 | Ga0070710_10000110 | 3300005437 | Bacteria | 38306 |
| 71 | Ga0070710_10002992 | 3300005437 | Bacteria | 8030 |
| 72 | Ga0070701_10002400 | 3300005438 | Bacteria | 7209 |
| 73 | Ga0070711_100001653 | 3300005439 | Bacteria | 12332 |
| 74 | Ga0070711_100002316 | 3300005439 | Bacteria | 10815 |
| 75 | Ga0070711_100002351 | 3300005439 | Bacteria | 10752 |
| 76 | Ga0070705_100005450 | 3300005440 | Bacteria | 6200 |
| 77 | Ga0070700_100000031 | 3300005441 | Bacteria | 117217 |
| 78 | Ga0070700_100001352 | 3300005441 | Bacteria | 12196 |
| 79 | Ga0070700_100003917 | 3300005441 | Bacteria | 7734 |
| 80 | Ga0070700_100005474 | 3300005441 | Bacteria | 6733 |
| 81 | Ga0070700_100006150 | 3300005441 | Bacteria | 6396 |
| 82 | Ga0070694_100018471 | 3300005444 | Bacteria | 4424 |
| 83 | Ga0070663_100001468 | 3300005455 | Bacteria | 12965 |
| 84 | Ga0070663_100003006 | 3300005455 | Bacteria | 9625 |
| 85 | Ga0070663_100016296 | 3300005455 | Bacteria | 4823 |
| 86 | Ga0070663_100048175 | 3300005455 | Bacteria | 3021 |
| 87 | Ga0070663_100170063 | 3300005455 | Bacteria | 1684 |
| 88 | Ga0070663_100271223 | 3300005455 | Bacteria | 1349 |
| 89 | Ga0070678_100000372 | 3300005456 | Bacteria | 20951 |
| 90 | Ga0070678_100003411 | 3300005456 | Bacteria | 8859 |
| 91 | Ga0070662_100015433 | 3300005457 | Bacteria | 5117 |
| 92 | Ga0070681_10001041 | 3300005458 | Bacteria | 23550 |
| 93 | Ga0070681_10025473 | 3300005458 | Bacteria | 5950 |
| 94 | Ga0070681_10056346 | 3300005458 | Bacteria | 3912 |
| 95 | Ga0070685_10177846 | 3300005466 | Bacteria | 1367 |
| 96 | Ga0070679_100006559 | 3300005530 | Bacteria | 10844 |
| 97 | Ga0070679_100086354 | 3300005530 | Bacteria | 3124 |
| 98 | Ga0070684_100010145 | 3300005535 | Bacteria | 7448 |
| 99 | Ga0068853_100016915 | 3300005539 | Bacteria | 6011 |
| 100 | Ga0068853_100018399 | 3300005539 | Bacteria | 5783 |
| 101 | Ga0068853_100073150 | 3300005539 | Bacteria | 2987 |
| 102 | Ga0068853_100078561 | 3300005539 | Bacteria | 2884 |
| 103 | Ga0070672_100095272 | 3300005543 | Bacteria | 2407 |
| 104 | Ga0070672_100141087 | 3300005543 | Bacteria | 1987 |
| 105 | Ga0070672_100240741 | 3300005543 | Bacteria | 1522 |
| 106 | Ga0070686_100144858 | 3300005544 | Bacteria | 1658 |
| 107 | Ga0070695_100127130 | 3300005545 | Bacteria | 1752 |
| 108 | Ga0070696_100002982 | 3300005546 | Bacteria | 11245 |
| 109 | Ga0070696_100061054 | 3300005546 | Bacteria | 2637 |
| 110 | Ga0070696_100178864 | 3300005546 | Bacteria | 1572 |
| 111 | Ga0070693_100000246 | 3300005547 | Bacteria | 25400 |
| 112 | Ga0070665_100002158 | 3300005548 | Bacteria | 21947 |
| 113 | Ga0070665_100003039 | 3300005548 | Bacteria | 18078 |
| 114 | Ga0070665_100011089 | 3300005548 | Bacteria | 9106 |
| 115 | Ga0070665_100031876 | 3300005548 | Bacteria | 5306 |
| 116 | Ga0070665_100045698 | 3300005548 | Bacteria | 4397 |
| 117 | Ga0070665_100054609 | 3300005548 | Bacteria | 4007 |
| 118 | Ga0070704_100000113 | 3300005549 | Bacteria | 28575 |
| 119 | Ga0068855_100006282 | 3300005563 | Bacteria | 14479 |
| 120 | Ga0068855_100029171 | 3300005563 | Bacteria | 6597 |
| 121 | Ga0068855_100032959 | 3300005563 | Bacteria | 6184 |
| 122 | Ga0070664_100009850 | 3300005564 | Bacteria | 7744 |
| 123 | Ga0070664_100151040 | 3300005564 | Bacteria | 2051 |
| 124 | Ga0068857_100089002 | 3300005577 | Bacteria | 2762 |
| 125 | Ga0068854_100000637 | 3300005578 | Bacteria | 20747 |
| 126 | Ga0068854_100029847 | 3300005578 | Bacteria | 3778 |
| 127 | Ga0068854_100057853 | 3300005578 | Bacteria | 2797 |
| 128 | Ga0068856_100047641 | 3300005614 | Bacteria | 4223 |
| 129 | Ga0070702_100000639 | 3300005615 | Bacteria | 12985 |
| 130 | Ga0070702_100050915 | 3300005615 | Bacteria | 2368 |
| 131 | Ga0068852_100012774 | 3300005616 | Bacteria | 6396 |
| 132 | Ga0068852_100019689 | 3300005616 | Bacteria | 5349 |
| 133 | Ga0068852_100039518 | 3300005616 | Bacteria | 3972 |
| 134 | Ga0068852_100058283 | 3300005616 | Bacteria | 3345 |
| 135 | Ga0068859_100000291 | 3300005617 | Bacteria | 49882 |
| 136 | Ga0068859_100000301 | 3300005617 | Bacteria | 49173 |
| 137 | Ga0068859_100003956 | 3300005617 | Bacteria | 15123 |
| 138 | Ga0068859_100004810 | 3300005617 | Bacteria | 13749 |
| 139 | Ga0068859_100013254 | 3300005617 | Bacteria | 8273 |
| 140 | Ga0068859_100015017 | 3300005617 | Bacteria | 7774 |
| 141 | Ga0068859_100045625 | 3300005617 | Bacteria | 4402 |
| 142 | Ga0068864_100001934 | 3300005618 | Bacteria | 17015 |
| 143 | Ga0068864_100109298 | 3300005618 | Bacteria | 2461 |
| 144 | Ga0068864_100261526 | 3300005618 | Bacteria | 1610 |
| 145 | Ga0068866_10000435 | 3300005718 | Bacteria | 19346 |
| 146 | Ga0068866_10007493 | 3300005718 | Bacteria | 4570 |
| 147 | Ga0068861_100002086 | 3300005719 | Bacteria | 12955 |
| 148 | Ga0068861_100018749 | 3300005719 | Bacteria | 4932 |
| 149 | Ga0068861_100042769 | 3300005719 | Bacteria | 3397 |
| 150 | Ga0068861_100090221 | 3300005719 | Bacteria | 2417 |
| 151 | Ga0068863_100000163 | 3300005841 | Bacteria | 71286 |
| 152 | Ga0068863_100000179 | 3300005841 | Bacteria | 67666 |
| 153 | Ga0068863_100000580 | 3300005841 | Bacteria | 37264 |
| 154 | Ga0068863_100001505 | 3300005841 | Bacteria | 23071 |
| 155 | Ga0068863_100006453 | 3300005841 | Bacteria | 11503 |
| 156 | Ga0068863_100057846 | 3300005841 | Bacteria | 3669 |
| 157 | Ga0068863_100089506 | 3300005841 | Bacteria | 2919 |
| 158 | Ga0068858_100000010 | 3300005842 | Bacteria | 234748 |
| 159 | Ga0068858_100000071 | 3300005842 | Bacteria | 105192 |
| 160 | Ga0068858_100000362 | 3300005842 | Bacteria | 47914 |
| 161 | Ga0068858_100009793 | 3300005842 | Bacteria | 9122 |
| 162 | Ga0068858_100020931 | 3300005842 | Bacteria | 6112 |
| 163 | Ga0068858_100053123 | 3300005842 | Bacteria | 3749 |
| 164 | Ga0068858_100099585 | 3300005842 | Bacteria | 2710 |
| 165 | Ga0068858_100288793 | 3300005842 | Bacteria | 1563 |
| 166 | Ga0068860_100000020 | 3300005843 | Bacteria | 283324 |
| 167 | Ga0068860_100000345 | 3300005843 | Bacteria | 62383 |
| 168 | Ga0068860_100016544 | 3300005843 | Bacteria | 7193 |
| 169 | Ga0068860_100052772 | 3300005843 | Bacteria | 3866 |
| 170 | Ga0068860_100060595 | 3300005843 | Bacteria | 3597 |
| 171 | Ga0068862_100000013 | 3300005844 | Bacteria | 263115 |
| 172 | Ga0068862_100000049 | 3300005844 | Bacteria | 149792 |
| 173 | Ga0068862_100005089 | 3300005844 | Bacteria | 11065 |
| 174 | Ga0068862_100057251 | 3300005844 | Bacteria | 3342 |
| 175 | Ga0068862_100255275 | 3300005844 | Bacteria | 1599 |
| 176 | Ga0081455_10000288 | 3300005937 | Bacteria | 66686 |
| 177 | Ga0081455_10000436 | 3300005937 | Bacteria | 54915 |
| 178 | Ga0081455_10009880 | 3300005937 | Bacteria | 9763 |
| 179 | Ga0081455_10010864 | 3300005937 | Bacteria | 9189 |
| 180 | Ga0081455_10039401 | 3300005937 | Bacteria | 4176 |
| 181 | Ga0081538_10005232 | 3300005981 | Bacteria | 11726 |
| 182 | Ga0081540_1000602 | 3300005983 | Bacteria | 34290 |
| 183 | Ga0081540_1000710 | 3300005983 | Bacteria | 30907 |
| 184 | Ga0081540_1051424 | 3300005983 | Bacteria | 2037 |
| 185 | Ga0081539_10000094 | 3300005985 | Bacteria | 206102 |
| 186 | Ga0081539_10000882 | 3300005985 | Bacteria | 57376 |
| 187 | Ga0070717_10001308 | 3300006028 | Bacteria | 17047 |
| 188 | Ga0070717_10072787 | 3300006028 | Bacteria | 2870 |
| 189 | Ga0075365_10019566 | 3300006038 | Bacteria | 4182 |
| 190 | Ga0075365_10023310 | 3300006038 | Bacteria | 3892 |
| 191 | Ga0075365_10028336 | 3300006038 | Bacteria | 3572 |
| 192 | Ga0075363_100000409 | 3300006048 | Bacteria | 13240 |
| 193 | Ga0075363_100004494 | 3300006048 | Bacteria | 6113 |
| 194 | Ga0075363_100014025 | 3300006048 | Bacteria | 3903 |
| 195 | Ga0075363_100014723 | 3300006048 | Bacteria | 3830 |
| 196 | Ga0075363_100073713 | 3300006048 | Bacteria | 1858 |
| 197 | Ga0075364_10001494 | 3300006051 | Bacteria | 12733 |
| 198 | Ga0075364_10006497 | 3300006051 | Bacteria | 6873 |
| 199 | Ga0075364_10010332 | 3300006051 | Bacteria | 5634 |
| 200 | Ga0075364_10017355 | 3300006051 | Bacteria | 4495 |
| 201 | Ga0075432_10010849 | 3300006058 | Bacteria | 3096 |
| 202 | Ga0070716_100001095 | 3300006173 | Bacteria | 11898 |
| 203 | Ga0070716_100105017 | 3300006173 | Bacteria | 1740 |
| 204 | Ga0070712_100003765 | 3300006175 | Bacteria | 9344 |
| 205 | Ga0070712_100005974 | 3300006175 | Bacteria | 7527 |
| 206 | Ga0075369_10004499 | 3300006186 | Bacteria | 5155 |
| 207 | Ga0075369_10024999 | 3300006186 | Bacteria | 2480 |
| 208 | Ga0075369_10034936 | 3300006186 | Bacteria | 2135 |
| 209 | Ga0075366_10147537 | 3300006195 | Bacteria | 1424 |
| 210 | Ga0097621_100009134 | 3300006237 | Bacteria | 7184 |
| 211 | Ga0097621_100025930 | 3300006237 | Bacteria | 4592 |
| 212 | Ga0075370_10022693 | 3300006353 | Bacteria | 3449 |
| 213 | Ga0075370_10027158 | 3300006353 | Bacteria | 3175 |
| 214 | Ga0075370_10031037 | 3300006353 | Bacteria | 2983 |
| 215 | Ga0075428_100001458 | 3300006844 | Bacteria | 25308 |
| 216 | Ga0075428_100161048 | 3300006844 | Bacteria | 2436 |
| 217 | Ga0075428_100189572 | 3300006844 | Bacteria | 2224 |
| 218 | Ga0075430_100005427 | 3300006846 | Bacteria | 10772 |
| 219 | Ga0075430_100022533 | 3300006846 | Bacteria | 5360 |
| 220 | Ga0075431_100074231 | 3300006847 | Bacteria | 3509 |
| 221 | Ga0075433_10106885 | 3300006852 | Bacteria | 2481 |
| 222 | Ga0075434_100015313 | 3300006871 | Bacteria | 7350 |
| 223 | Ga0075434_100019371 | 3300006871 | Bacteria | 6585 |
| 224 | Ga0075429_100033163 | 3300006880 | Bacteria | 4486 |
| 225 | Ga0075429_100121583 | 3300006880 | Bacteria | 2282 |
| 226 | Ga0068865_100006274 | 3300006881 | Bacteria | 7238 |
| 227 | Ga0068865_100069746 | 3300006881 | Bacteria | 2488 |
| 228 | Ga0075436_100007851 | 3300006914 | Bacteria | 7300 |
| 229 | Ga0075436_100072828 | 3300006914 | Bacteria | 2377 |
| 230 | Ga0097620_100000291 | 3300006931 | Bacteria | 49882 |
| 231 | Ga0097620_100000301 | 3300006931 | Bacteria | 49173 |
| 232 | Ga0097620_100003956 | 3300006931 | Bacteria | 15123 |
| 233 | Ga0097620_100004810 | 3300006931 | Bacteria | 13749 |
| 234 | Ga0097620_100013254 | 3300006931 | Bacteria | 8273 |
| 235 | Ga0097620_100015017 | 3300006931 | Bacteria | 7774 |
| 236 | Ga0097620_100045625 | 3300006931 | Bacteria | 4402 |
| 237 | Ga0075435_100002890 | 3300007076 | Bacteria | 11524 |
| 238 | Ga0075435_100007664 | 3300007076 | Bacteria | 7710 |
| 239 | Ga0099795_10040891 | 3300007788 | Bacteria | 1649 |
| 240 | Ga0105250_10049852 | 3300009092 | Bacteria | 1680 |
| 241 | Ga0105240_10119840 | 3300009093 | Bacteria | 3169 |
| 242 | Ga0105240_10122665 | 3300009093 | Bacteria | 3127 |
| 243 | Ga0105240_10236659 | 3300009093 | Bacteria | 2119 |
| 244 | Ga0111539_10000482 | 3300009094 | Bacteria | 50429 |
| 245 | Ga0111539_10004560 | 3300009094 | Bacteria | 18110 |
| 246 | Ga0111539_10387616 | 3300009094 | Bacteria | 1627 |
| 247 | Ga0105245_10001247 | 3300009098 | Bacteria | 22970 |
| 248 | Ga0105245_10080568 | 3300009098 | Bacteria | 2975 |
| 249 | Ga0105245_10090761 | 3300009098 | Bacteria | 2811 |
| 250 | Ga0105245_10217265 | 3300009098 | Bacteria | 1843 |
| 251 | Ga0105247_10000009 | 3300009101 | Bacteria | 385991 |
| 252 | Ga0105247_10000111 | 3300009101 | Bacteria | 83418 |
| 253 | Ga0105247_10000834 | 3300009101 | Bacteria | 23420 |
| 254 | Ga0105247_10002038 | 3300009101 | Bacteria | 13982 |
| 255 | Ga0105247_10007205 | 3300009101 | Bacteria | 6826 |
| 256 | Ga0114129_10000114 | 3300009147 | Bacteria | 80730 |
| 257 | Ga0114129_10000585 | 3300009147 | Bacteria | 44984 |
| 258 | Ga0114129_10021079 | 3300009147 | Bacteria | 9254 |
| 259 | Ga0114129_10054519 | 3300009147 | Bacteria | 5605 |
| 260 | Ga0114129_10230478 | 3300009147 | Bacteria | 2494 |
| 261 | Ga0114129_10363980 | 3300009147 | Bacteria | 1913 |
| 262 | Ga0105243_10001881 | 3300009148 | Bacteria | 17882 |
| 263 | Ga0105243_10043836 | 3300009148 | Bacteria | 3507 |
| 264 | Ga0105243_10149133 | 3300009148 | Bacteria | 2004 |
| 265 | Ga0105241_10001137 | 3300009174 | Bacteria | 20251 |
| 266 | Ga0105242_10000766 | 3300009176 | Bacteria | 24993 |
| 267 | Ga0105242_10062239 | 3300009176 | Bacteria | 3071 |
| 268 | Ga0105248_10000147 | 3300009177 | Bacteria | 81699 |
| 269 | Ga0105248_10000207 | 3300009177 | Bacteria | 67863 |
| 270 | Ga0105248_10000377 | 3300009177 | Bacteria | 52002 |
| 271 | Ga0105248_10000450 | 3300009177 | Bacteria | 46809 |
| 272 | Ga0105248_10004117 | 3300009177 | Bacteria | 16088 |
| 273 | Ga0105248_10018906 | 3300009177 | Bacteria | 7618 |
| 274 | Ga0105248_10028235 | 3300009177 | Bacteria | 6250 |
| 275 | Ga0105248_10069913 | 3300009177 | Bacteria | 3942 |
| 276 | Ga0105248_10133451 | 3300009177 | Bacteria | 2801 |
| 277 | Ga0105248_10285059 | 3300009177 | Bacteria | 1860 |
| 278 | Ga0105248_10401555 | 3300009177 | Bacteria | 1543 |
| 279 | Ga0105237_10006936 | 3300009545 | Bacteria | 12486 |
| 280 | Ga0105237_10042790 | 3300009545 | Bacteria | 4565 |
| 281 | Ga0105237_10302090 | 3300009545 | Bacteria | 1604 |
| 282 | Ga0105237_10374459 | 3300009545 | Bacteria | 1429 |
| 283 | Ga0105238_10008912 | 3300009551 | Bacteria | 10041 |
| 284 | Ga0105238_10032836 | 3300009551 | Bacteria | 5283 |
| 285 | Ga0105238_10109655 | 3300009551 | Bacteria | 2741 |
| 286 | Ga0105249_10000057 | 3300009553 | Bacteria | 159358 |
| 287 | Ga0105249_10004171 | 3300009553 | Bacteria | 12481 |
| 288 | Ga0105249_10011423 | 3300009553 | Bacteria | 7800 |
| 289 | Ga0105249_10022525 | 3300009553 | Bacteria | 5644 |
| 290 | Ga0105249_10129991 | 3300009553 | Bacteria | 2403 |
| 291 | Ga0105249_10143452 | 3300009553 | Bacteria | 2292 |
| 292 | Ga0105239_10001572 | 3300010375 | Bacteria | 30160 |
| 293 | Ga0105239_10050445 | 3300010375 | Bacteria | 4564 |
| 294 | Ga0105239_10053915 | 3300010375 | Bacteria | 4409 |
| 295 | Ga0105239_10073274 | 3300010375 | Bacteria | 3765 |
| 296 | Ga0105239_10144029 | 3300010375 | Bacteria | 2657 |
| 297 | Ga0105239_10307076 | 3300010375 | Bacteria | 1787 |
| 298 | Ga0105246_10016685 | 3300011119 | Bacteria | 4654 |
| 299 | Ga0105246_10018512 | 3300011119 | Bacteria | 4441 |
| 300 | Ga0157371_10007484 | 3300013102 | Bacteria | 8837 |
| 301 | Ga0157370_10002735 | 3300013104 | Bacteria | 21092 |
| 302 | Ga0157370_10018215 | 3300013104 | Bacteria | 7066 |
| 303 | Ga0157370_10064903 | 3300013104 | Bacteria | 3455 |
| 304 | Ga0157369_10019224 | 3300013105 | Bacteria | 7644 |
| 305 | Ga0157374_10030500 | 3300013296 | Bacteria | 4896 |
| 306 | Ga0157374_10123689 | 3300013296 | Bacteria | 2499 |
| 307 | Ga0157378_10000831 | 3300013297 | Bacteria | 28691 |
| 308 | Ga0157378_10076761 | 3300013297 | Bacteria | 3011 |
| 309 | Ga0163162_10062818 | 3300013306 | Bacteria | 3755 |
| 310 | Ga0163162_10066269 | 3300013306 | Bacteria | 3660 |
| 311 | Ga0163162_10086860 | 3300013306 | Bacteria | 3206 |
| 312 | Ga0157372_10000023 | 3300013307 | Bacteria | 198536 |
| 313 | Ga0157372_10008689 | 3300013307 | Bacteria | 10787 |
| 314 | Ga0157372_10631504 | 3300013307 | Bacteria | 1248 |
| 315 | Ga0157375_10034872 | 3300013308 | Bacteria | 4797 |
| 316 | Ga0157375_10044455 | 3300013308 | Bacteria | 4316 |
| 317 | Ga0163163_10005277 | 3300014325 | Bacteria | 11151 |
| 318 | Ga0163163_10039757 | 3300014325 | Bacteria | 4592 |
| 319 | Ga0163163_10179325 | 3300014325 | Bacteria | 2165 |
| 320 | Ga0157380_10001997 | 3300014326 | Bacteria | 13587 |
| 321 | Ga0157377_10000649 | 3300014745 | Bacteria | 14517 |
| 322 | Ga0157377_10005999 | 3300014745 | Bacteria | 5756 |
| 323 | Ga0157379_10000015 | 3300014968 | Bacteria | 104289 |
| 324 | Ga0157379_10000149 | 3300014968 | Bacteria | 51280 |
| 325 | Ga0157379_10007816 | 3300014968 | Bacteria | 9260 |
| 326 | Ga0157379_10058232 | 3300014968 | Bacteria | 3454 |
| 327 | Ga0157379_10132060 | 3300014968 | Bacteria | 2248 |
| 328 | Ga0157376_10028847 | 3300014969 | Bacteria | 4415 |
| 329 | Ga0163161_10000872 | 3300017792 | Bacteria | 23503 |
| 330 | Ga0163161_10005938 | 3300017792 | Bacteria | 8463 |
| 331 | Ga0197907_10161669 | 3300020069 | Bacteria | 2116 |
| 332 | Ga0206356_10255926 | 3300020070 | Bacteria | 1444 |
| 333 | Ga0206356_10857683 | 3300020070 | Bacteria | 1335 |
| 334 | Ga0206353_11500815 | 3300020082 | Bacteria | 3132 |
| 335 | Ga0154015_1696953 | 3300020610 | Bacteria | 1560 |
| 336 | Ga0213873_10000086 | 3300021358 | Bacteria | 19214 |
| 337 | Ga0213876_10001258 | 3300021384 | Bacteria | 15988 |
| 338 | Ga0213876_10012466 | 3300021384 | Bacteria | 4525 |
| 339 | Ga0213875_10000111 | 3300021388 | Bacteria | 92836 |
| 340 | Ga0213875_10018826 | 3300021388 | Bacteria | 3325 |
| 341 | Ga0224712_10050376 | 3300022467 | Bacteria | 1617 |
| 342 | Ga0224712_10056534 | 3300022467 | Bacteria | 1547 |
| 343 | Ga0209673_1007257 | 3300025273 | Bacteria | 5149 |
| 344 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 345 | Ga0209051_1006016 | 3300025303 | Bacteria | 6934 |
| 346 | Ga0209051_1013644 | 3300025303 | Bacteria | 3850 |
| 347 | Ga0209051_1016811 | 3300025303 | Bacteria | 3289 |
| 348 | Ga0207692_10000457 | 3300025898 | Bacteria | 14468 |
| 349 | Ga0207692_10012087 | 3300025898 | Bacteria | 3697 |
| 350 | Ga0207642_10001854 | 3300025899 | Bacteria | 6522 |
| 351 | Ga0207710_10000014 | 3300025900 | Bacteria | 408072 |
| 352 | Ga0207710_10000107 | 3300025900 | Bacteria | 105449 |
| 353 | Ga0207710_10000144 | 3300025900 | Bacteria | 82093 |
| 354 | Ga0207710_10004379 | 3300025900 | Bacteria | 6167 |
| 355 | Ga0207710_10010119 | 3300025900 | Bacteria | 3968 |
| 356 | Ga0207688_10000698 | 3300025901 | Bacteria | 16565 |
| 357 | Ga0207688_10000946 | 3300025901 | Bacteria | 14709 |
| 358 | Ga0207688_10001700 | 3300025901 | Bacteria | 11678 |
| 359 | Ga0207688_10008927 | 3300025901 | Bacteria | 5455 |
| 360 | Ga0207647_10043676 | 3300025904 | Bacteria | 2803 |
| 361 | Ga0207647_10100957 | 3300025904 | Bacteria | 1712 |
| 362 | Ga0207645_10015307 | 3300025907 | Bacteria | 5100 |
| 363 | Ga0207643_10000326 | 3300025908 | Bacteria | 32686 |
| 364 | Ga0207705_10014614 | 3300025909 | Bacteria | 5649 |
| 365 | Ga0207705_10015019 | 3300025909 | Bacteria | 5567 |
| 366 | Ga0207705_10016235 | 3300025909 | Bacteria | 5339 |
| 367 | Ga0207654_10003544 | 3300025911 | Bacteria | 7893 |
| 368 | Ga0207707_10001022 | 3300025912 | Bacteria | 26886 |
| 369 | Ga0207707_10033830 | 3300025912 | Bacteria | 4473 |
| 370 | Ga0207695_10027320 | 3300025913 | Bacteria | 6356 |
| 371 | Ga0207671_10040499 | 3300025914 | Bacteria | 3449 |
| 372 | Ga0207693_10000949 | 3300025915 | Bacteria | 25987 |
| 373 | Ga0207693_10001079 | 3300025915 | Bacteria | 24466 |
| 374 | Ga0207693_10007135 | 3300025915 | Bacteria | 9218 |
| 375 | Ga0207663_10000777 | 3300025916 | Bacteria | 14291 |
| 376 | Ga0207663_10116149 | 3300025916 | Bacteria | 1824 |
| 377 | Ga0207660_10000404 | 3300025917 | Bacteria | 28485 |
| 378 | Ga0207660_10001049 | 3300025917 | Bacteria | 18301 |
| 379 | Ga0207660_10038877 | 3300025917 | Bacteria | 3324 |
| 380 | Ga0207662_10212455 | 3300025918 | Bacteria | 1256 |
| 381 | Ga0207657_10001506 | 3300025919 | Bacteria | 24916 |
| 382 | Ga0207657_10038718 | 3300025919 | Bacteria | 4241 |
| 383 | Ga0207657_10045558 | 3300025919 | Bacteria | 3848 |
| 384 | Ga0207657_10070030 | 3300025919 | Bacteria | 2974 |
| 385 | Ga0207649_10005345 | 3300025920 | Bacteria | 6953 |
| 386 | Ga0207649_10036106 | 3300025920 | Bacteria | 2974 |
| 387 | Ga0207652_10000717 | 3300025921 | Bacteria | 32120 |
| 388 | Ga0207652_10027502 | 3300025921 | Bacteria | 4739 |
| 389 | Ga0207650_10004876 | 3300025925 | Bacteria | 9168 |
| 390 | Ga0207659_10000900 | 3300025926 | Bacteria | 17696 |
| 391 | Ga0207659_10001150 | 3300025926 | Bacteria | 15753 |
| 392 | Ga0207659_10099159 | 3300025926 | Bacteria | 2193 |
| 393 | Ga0207687_10001698 | 3300025927 | Bacteria | 15171 |
| 394 | Ga0207687_10007403 | 3300025927 | Bacteria | 7227 |
| 395 | Ga0207687_10013866 | 3300025927 | Bacteria | 5264 |
| 396 | Ga0207687_10016988 | 3300025927 | Bacteria | 4783 |
| 397 | Ga0207687_10114634 | 3300025927 | Bacteria | 2006 |
| 398 | Ga0207700_10120108 | 3300025928 | Bacteria | 2130 |
| 399 | Ga0207664_10000002 | 3300025929 | Bacteria | 657053 |
| 400 | Ga0207664_10000641 | 3300025929 | Bacteria | 24306 |
| 401 | Ga0207644_10001436 | 3300025931 | Bacteria | 15349 |
| 402 | Ga0207644_10012147 | 3300025931 | Bacteria | 5714 |
| 403 | Ga0207644_10058447 | 3300025931 | Bacteria | 2787 |
| 404 | Ga0207690_10149025 | 3300025932 | Bacteria | 1733 |
| 405 | Ga0207706_10002283 | 3300025933 | Bacteria | 18697 |
| 406 | Ga0207706_10024221 | 3300025933 | Bacteria | 5442 |
| 407 | Ga0207706_10099658 | 3300025933 | Bacteria | 2556 |
| 408 | Ga0207686_10004275 | 3300025934 | Bacteria | 7657 |
| 409 | Ga0207686_10015402 | 3300025934 | Bacteria | 4275 |
| 410 | Ga0207709_10008902 | 3300025935 | Bacteria | 5542 |
| 411 | Ga0207709_10022088 | 3300025935 | Bacteria | 3607 |
| 412 | Ga0207669_10000486 | 3300025937 | Bacteria | 17262 |
| 413 | Ga0207704_10008655 | 3300025938 | Bacteria | 4878 |
| 414 | Ga0207665_10001059 | 3300025939 | Bacteria | 18515 |
| 415 | Ga0207665_10001980 | 3300025939 | Bacteria | 13800 |
| 416 | Ga0207665_10002449 | 3300025939 | Bacteria | 12529 |
| 417 | Ga0207691_10042385 | 3300025940 | Bacteria | 4196 |
| 418 | Ga0207691_10053103 | 3300025940 | Bacteria | 3701 |
| 419 | Ga0207711_10000056 | 3300025941 | Bacteria | 135485 |
| 420 | Ga0207711_10000242 | 3300025941 | Bacteria | 58458 |
| 421 | Ga0207711_10000967 | 3300025941 | Bacteria | 27498 |
| 422 | Ga0207711_10010080 | 3300025941 | Bacteria | 7856 |
| 423 | Ga0207711_10011062 | 3300025941 | Bacteria | 7500 |
| 424 | Ga0207711_10042651 | 3300025941 | Bacteria | 3866 |
| 425 | Ga0207689_10021188 | 3300025942 | Bacteria | 5465 |
| 426 | Ga0207689_10034419 | 3300025942 | Bacteria | 4208 |
| 427 | Ga0207689_10058656 | 3300025942 | Bacteria | 3166 |
| 428 | Ga0207689_10083825 | 3300025942 | Bacteria | 2621 |
| 429 | Ga0207689_10119121 | 3300025942 | Bacteria | 2172 |
| 430 | Ga0207661_10007868 | 3300025944 | Bacteria | 7597 |
| 431 | Ga0207661_10025555 | 3300025944 | Bacteria | 4490 |
| 432 | Ga0207679_10000518 | 3300025945 | Bacteria | 26169 |
| 433 | Ga0207679_10001380 | 3300025945 | Bacteria | 15313 |
| 434 | Ga0207679_10145844 | 3300025945 | Bacteria | 1919 |
| 435 | Ga0207667_10018101 | 3300025949 | Bacteria | 7909 |
| 436 | Ga0207667_10052382 | 3300025949 | Bacteria | 4298 |
| 437 | Ga0207712_10000050 | 3300025961 | Bacteria | 159469 |
| 438 | Ga0207712_10005038 | 3300025961 | Bacteria | 8360 |
| 439 | Ga0207712_10012050 | 3300025961 | Bacteria | 5521 |
| 440 | Ga0207712_10042846 | 3300025961 | Bacteria | 3120 |
| 441 | Ga0207668_10000733 | 3300025972 | Bacteria | 20083 |
| 442 | Ga0207668_10001475 | 3300025972 | Bacteria | 13792 |
| 443 | Ga0207668_10008379 | 3300025972 | Bacteria | 6159 |
| 444 | Ga0207668_10262669 | 3300025972 | Bacteria | 1407 |
| 445 | Ga0207640_10002229 | 3300025981 | Bacteria | 10431 |
| 446 | Ga0207640_10002522 | 3300025981 | Bacteria | 9819 |
| 447 | Ga0207658_10000065 | 3300025986 | Bacteria | 117079 |
| 448 | Ga0207658_10002834 | 3300025986 | Bacteria | 12422 |
| 449 | Ga0207658_10003413 | 3300025986 | Bacteria | 11248 |
| 450 | Ga0207658_10041531 | 3300025986 | Bacteria | 3331 |
| 451 | Ga0207658_10053391 | 3300025986 | Bacteria | 2986 |
| 452 | Ga0207677_10004713 | 3300026023 | Bacteria | 7347 |
| 453 | Ga0207677_10027108 | 3300026023 | Bacteria | 3603 |
| 454 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 455 | Ga0207703_10000094 | 3300026035 | Bacteria | 104297 |
| 456 | Ga0207703_10006889 | 3300026035 | Bacteria | 9050 |
| 457 | Ga0207703_10026958 | 3300026035 | Bacteria | 4526 |
| 458 | Ga0207703_10056971 | 3300026035 | Bacteria | 3185 |
| 459 | Ga0207703_10080017 | 3300026035 | Bacteria | 2721 |
| 460 | Ga0207703_10104289 | 3300026035 | Bacteria | 2409 |
| 461 | Ga0207639_10043174 | 3300026041 | Bacteria | 3383 |
| 462 | Ga0207639_10055464 | 3300026041 | Bacteria | 3033 |
| 463 | Ga0207678_10000377 | 3300026067 | Bacteria | 40712 |
| 464 | Ga0207678_10003800 | 3300026067 | Bacteria | 13579 |
| 465 | Ga0207678_10006924 | 3300026067 | Bacteria | 10061 |
| 466 | Ga0207678_10042150 | 3300026067 | Bacteria | 3956 |
| 467 | Ga0207678_10046245 | 3300026067 | Bacteria | 3763 |
| 468 | Ga0207708_10000046 | 3300026075 | Bacteria | 116515 |
| 469 | Ga0207708_10002058 | 3300026075 | Bacteria | 14815 |
| 470 | Ga0207708_10004173 | 3300026075 | Bacteria | 10619 |
| 471 | Ga0207708_10019544 | 3300026075 | Bacteria | 5108 |
| 472 | Ga0207708_10027529 | 3300026075 | Bacteria | 4304 |
| 473 | Ga0207702_10000541 | 3300026078 | Bacteria | 42221 |
| 474 | Ga0207702_10429416 | 3300026078 | Bacteria | 1279 |
| 475 | Ga0207641_10000562 | 3300026088 | Bacteria | 41565 |
| 476 | Ga0207641_10000740 | 3300026088 | Bacteria | 35113 |
| 477 | Ga0207641_10014236 | 3300026088 | Bacteria | 6517 |
| 478 | Ga0207641_10019865 | 3300026088 | Bacteria | 5512 |
| 479 | Ga0207641_10038076 | 3300026088 | Bacteria | 4020 |
| 480 | Ga0207641_10170786 | 3300026088 | Bacteria | 1984 |
| 481 | Ga0207648_10002377 | 3300026089 | Bacteria | 20269 |
| 482 | Ga0207648_10077267 | 3300026089 | Bacteria | 2902 |
| 483 | Ga0207676_10002174 | 3300026095 | Bacteria | 14145 |
| 484 | Ga0207676_10111309 | 3300026095 | Bacteria | 2291 |
| 485 | Ga0207674_10001847 | 3300026116 | Bacteria | 26995 |
| 486 | Ga0207674_10006778 | 3300026116 | Bacteria | 13439 |
| 487 | Ga0207674_10019724 | 3300026116 | Bacteria | 7298 |
| 488 | Ga0207674_10064844 | 3300026116 | Bacteria | 3684 |
| 489 | Ga0207674_10077418 | 3300026116 | Bacteria | 3331 |
| 490 | Ga0207674_10177825 | 3300026116 | Bacteria | 2080 |
| 491 | Ga0207675_100001291 | 3300026118 | Bacteria | 25101 |
| 492 | Ga0207675_100045219 | 3300026118 | Bacteria | 4114 |
| 493 | Ga0207675_100110916 | 3300026118 | Bacteria | 2588 |
| 494 | Ga0207683_10000634 | 3300026121 | Bacteria | 32125 |
| 495 | Ga0207683_10000738 | 3300026121 | Bacteria | 29767 |
| 496 | Ga0207683_10003326 | 3300026121 | Bacteria | 14009 |
| 497 | Ga0207683_10009633 | 3300026121 | Bacteria | 8232 |
| 498 | Ga0207698_10008276 | 3300026142 | Bacteria | 6567 |
| 499 | Ga0207698_10052324 | 3300026142 | Bacteria | 3128 |
| 500 | Ga0207698_10135667 | 3300026142 | Bacteria | 2111 |
| 501 | Ga0207698_10187647 | 3300026142 | Bacteria | 1838 |
| 502 | Ga0207428_10002331 | 3300027907 | Bacteria | 19015 |
| 503 | Ga0207428_10088600 | 3300027907 | Bacteria | 2407 |
| 504 | Ga0268266_10010107 | 3300028379 | Bacteria | 8273 |
| 505 | Ga0268266_10016725 | 3300028379 | Bacteria | 6271 |
| 506 | Ga0268266_10062421 | 3300028379 | Bacteria | 3216 |
| 507 | Ga0268266_10110017 | 3300028379 | Bacteria | 2440 |
| 508 | Ga0268266_10285149 | 3300028379 | Bacteria | 1537 |
| 509 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 510 | Ga0268265_10000017 | 3300028380 | Bacteria | 293875 |
| 511 | Ga0268265_10005435 | 3300028380 | Bacteria | 8709 |
| 512 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 513 | Ga0268264_10000257 | 3300028381 | Bacteria | 96251 |
| 514 | Ga0268264_10002508 | 3300028381 | Bacteria | 16141 |
| 515 | Ga0268264_10003187 | 3300028381 | Bacteria | 14212 |
| 516 | Ga0268264_10081549 | 3300028381 | Bacteria | 2765 |
| 517 | Ga0265319_1011896 | 3300028563 | Bacteria | 3540 |
| 518 | Ga0265336_10005066 | 3300028666 | Bacteria | 4903 |
| 519 | Ga0307515_10008569 | 3300028794 | Bacteria | 19910 |
| 520 | Ga0307515_10099199 | 3300028794 | Bacteria | 3538 |
| 521 | Ga0307515_10170971 | 3300028794 | Bacteria | 2166 |
| 522 | Ga0265338_10000745 | 3300028800 | Bacteria | 55424 |
| 523 | Ga0307511_10027297 | 3300030521 | Bacteria | 5217 |
| 524 | Ga0307511_10147330 | 3300030521 | Bacteria | 1363 |
| 525 | Ga0307512_10036831 | 3300030522 | Bacteria | 4142 |
| 526 | Ga0316177_1052337 | 3300030731 | Bacteria | 3726 |
| 527 | Ga0314311_1180288 | 3300030733 | Bacteria | 4550 |
| 528 | Ga0265327_10009371 | 3300031251 | Bacteria | 7075 |
| 529 | Ga0307513_10013296 | 3300031456 | Bacteria | 10107 |
| 530 | Ga0307513_10057511 | 3300031456 | Bacteria | 4142 |
| 531 | Ga0307509_10261448 | 3300031507 | Bacteria | 1506 |
| 532 | Ga0307408_100077423 | 3300031548 | Bacteria | 2476 |
| 533 | Ga0307508_10093651 | 3300031616 | Bacteria | 2594 |
| 534 | Ga0316578_10043764 | 3300031728 | Bacteria | 2602 |
| 535 | Ga0307516_10000999 | 3300031730 | Bacteria | 39119 |
| 536 | Ga0307405_10019059 | 3300031731 | Bacteria | 3801 |
| 537 | Ga0307413_10000893 | 3300031824 | Bacteria | 10543 |
| 538 | Ga0307413_10039074 | 3300031824 | Bacteria | 2756 |
| 539 | Ga0307518_10000618 | 3300031838 | Bacteria | 26718 |
| 540 | Ga0307518_10014471 | 3300031838 | Bacteria | 5640 |
| 541 | Ga0307410_10008087 | 3300031852 | Bacteria | 5810 |
| 542 | Ga0307406_10013548 | 3300031901 | Bacteria | 4673 |
| 543 | Ga0307406_10122790 | 3300031901 | Bacteria | 1809 |
| 544 | Ga0307412_10042207 | 3300031911 | Bacteria | 2962 |
| 545 | Ga0307409_100000369 | 3300031995 | Bacteria | 18914 |
| 546 | Ga0307409_100218696 | 3300031995 | Bacteria | 1718 |
| 547 | Ga0307416_100001881 | 3300032002 | Bacteria | 11711 |
| 548 | Ga0307416_100011301 | 3300032002 | Bacteria | 5941 |
| 549 | Ga0307416_100025892 | 3300032002 | Bacteria | 4312 |
| 550 | Ga0307416_100088103 | 3300032002 | Bacteria | 2653 |
| 551 | Ga0307416_100132268 | 3300032002 | Bacteria | 2249 |
| 552 | Ga0307414_10070978 | 3300032004 | Bacteria | 2510 |
| 553 | Ga0307411_10018384 | 3300032005 | Bacteria | 4008 |
| 554 | Ga0307411_10033278 | 3300032005 | Bacteria | 3196 |
| 555 | Ga0307415_100000012 | 3300032126 | Bacteria | 84249 |
| 556 | Ga0307415_100077551 | 3300032126 | Bacteria | 2360 |
| 557 | Ga0307507_10004395 | 3300033179 | Bacteria | 25121 |
| 558 | Ga0307507_10055651 | 3300033179 | Bacteria | 3746 |
| 559 | Ga0307510_10022164 | 3300033180 | Bacteria | 7383 |
| 560 | Ga0373929_0006036 | 3300035085 | Bacteria | 2188 |
| 561 | Ga0373940_0001450 | 3300035088 | Bacteria | 4296 |
| 562 | Ga0373936_0024454 | 3300035113 | Bacteria | 2358 |
| 563 | Ga0373956_0000258 | 3300035119 | Bacteria | 21190 |
| 564 | Ga0373957_0019558 | 3300035120 | Bacteria | 2384 |
| 565 | Ga0373960_0016902 | 3300035121 | Bacteria | 1883 |
| 566 | Ga0373931_0006845 | 3300035691 | Bacteria | 5362 |
| 567 | Ga0373931_0019651 | 3300035691 | Bacteria | 3374 |
| 568 | Ga0373931_0119669 | 3300035691 | Bacteria | 1504 |
| 569 | Ga0373927_0039947 | 3300035695 | Bacteria | 3044 |
| 570 | Ga0373937_0131387 | 3300036401 | Bacteria | 2338 |
| 571 | Ga0373925_0089855 | 3300037068 | Bacteria | 2347 |
| 572 | Ga0373925_0229357 | 3300037068 | Bacteria | 1484 |
| 573 | Ga0395900_0048293 | 3300037418 | Bacteria | 4384 |
| 574 | Ga0395898_0026569 | 3300037466 | Bacteria | 5822 |
| 575 | Ga0395905_0020862 | 3300037471 | Bacteria | 6204 |
| 576 | Ga0436364_0155073 | 3300037853 | Bacteria | 2064 |
| 577 | Ga0436364_0284917 | 3300037853 | Bacteria | 21290 |
| 578 | Ga0436364_0296067 | 3300037853 | Bacteria | 138817 |
| 579 | Ga0436364_1031907 | 3300037853 | Bacteria | 102112 |
| 580 | Ga0436364_1038490 | 3300037853 | Bacteria | 8940 |
| 581 | Ga0436364_1406310 | 3300037853 | Bacteria | 13026 |
| 582 | Ga0436364_1554479 | 3300037853 | Bacteria | 21396 |
| 583 | Ga0395901_0028510 | 3300038443 | Bacteria | 5741 |
| 584 | Ga0395901_0147327 | 3300038443 | Bacteria | 2474 |
| 585 | Ga0436365_1354167 | 3300039437 | Bacteria | 9239 |
| 586 | Ga0436365_1453781 | 3300039437 | Bacteria | 4885 |
| 587 | Ga0436365_1605762 | 3300039437 | Bacteria | 5318 |
| 588 | Ga0436365_1607916 | 3300039437 | Bacteria | 4808 |
| 589 | Ga0436365_1889369 | 3300039437 | Bacteria | 169293 |
| 590 | Ga0436363_0578534 | 3300039450 | Bacteria | 3342 |
| 591 | Ga0436363_1446743 | 3300039450 | Bacteria | 1534 |
| 592 | Ga0436362_0218630 | 3300039453 | Bacteria | 40774 |
| 593 | Ga0439465_0018051 | 3300041413 | Bacteria | 2204 |
| 594 | Ga0451789_0707078 | 3300041443 | Bacteria | 1911 |
| 595 | Ga0451853_3429478 | 3300041512 | Bacteria | 5980 |
| 596 | Ga0439445_0004151 | 3300042004 | Bacteria | 3273 |
| 597 | Ga0439448_0028867 | 3300042005 | Bacteria | 1754 |
| 598 | Ga0439463_001998 | 3300042016 | Bacteria | 5304 |
| 599 | Ga0439434_0002590 | 3300042435 | Bacteria | 5265 |
| 600 | Ga0439435_0003483 | 3300042436 | Bacteria | 3280 |
| 601 | Ga0451577_0300822 | 3300042876 | Bacteria | 1454 |
| 602 | Ga0466969_0002252 | 3300044656 | Bacteria | 10314 |
| 603 | Ga0466969_0003530 | 3300044656 | Bacteria | 8315 |
| 604 | Ga0466972_0002059 | 3300044658 | Bacteria | 9850 |
| 605 | Ga0466972_0002859 | 3300044658 | Bacteria | 8548 |
| 606 | Ga0466972_0015337 | 3300044658 | Bacteria | 3830 |
| 607 | Ga0466972_0036989 | 3300044658 | Bacteria | 2386 |
| 608 | Ga0466965_0003251 | 3300044683 | Bacteria | 7106 |
| 609 | Ga0466965_0006273 | 3300044683 | Bacteria | 5383 |
| 610 | Ga0466965_0025222 | 3300044683 | Bacteria | 2878 |
| 611 | Ga0466965_0026947 | 3300044683 | Bacteria | 2787 |
| 612 | Ga0466966_0002064 | 3300044684 | Bacteria | 13030 |
| 613 | Ga0466966_0002131 | 3300044684 | Bacteria | 12832 |
| 614 | Ga0466966_0018665 | 3300044684 | Bacteria | 4571 |
| 615 | Ga0466966_0033312 | 3300044684 | Bacteria | 3336 |
| 616 | Ga0466966_0046838 | 3300044684 | Bacteria | 2759 |
| 617 | Ga0466966_0058740 | 3300044684 | Bacteria | 2430 |
| 618 | Ga0466961_0001303 | 3300044693 | Bacteria | 15391 |
| 619 | Ga0466961_0018032 | 3300044693 | Bacteria | 4539 |
| 620 | Ga0466961_0039915 | 3300044693 | Bacteria | 3009 |
| 621 | Ga0466961_0050049 | 3300044693 | Bacteria | 2669 |
| 622 | Ga0466961_0069587 | 3300044693 | Bacteria | 2234 |
| 623 | Ga0466961_0117862 | 3300044693 | Bacteria | 1668 |
| 624 | Ga0466963_0000288 | 3300044694 | Bacteria | 22679 |
| 625 | Ga0466963_0002774 | 3300044694 | Bacteria | 9872 |
| 626 | Ga0466963_0004890 | 3300044694 | Bacteria | 7812 |
| 627 | Ga0466963_0011650 | 3300044694 | Bacteria | 5357 |
| 628 | Ga0466963_0026683 | 3300044694 | Bacteria | 3695 |
| 629 | Ga0466963_0066325 | 3300044694 | Bacteria | 2421 |
| 630 | Ga0466963_0187237 | 3300044694 | Bacteria | 1446 |
| 631 | Ga0466964_0033655 | 3300044706 | Bacteria | 2042 |
| 632 | Ga0466971_0004672 | 3300044719 | Bacteria | 5918 |
| 633 | Ga0466971_0005045 | 3300044719 | Bacteria | 5715 |
| 634 | Ga0466968_0001581 | 3300044735 | Bacteria | 8203 |
| 635 | Ga0466968_0024051 | 3300044735 | Bacteria | 2487 |
| 636 | Ga0466970_0036670 | 3300044765 | Bacteria | 2598 |
| 637 | Ga0466957_0001403 | 3300044842 | Bacteria | 12553 |
| 638 | Ga0466957_0006143 | 3300044842 | Bacteria | 6779 |
| 639 | Ga0466957_0027046 | 3300044842 | Bacteria | 3407 |
| 640 | Ga0466957_0061434 | 3300044842 | Bacteria | 2306 |
| 641 | Ga0466957_0080003 | 3300044842 | Bacteria | 2034 |
| 642 | Ga0466957_0300468 | 3300044842 | Bacteria | 1078 |
| 643 | Ga0466960_0001002 | 3300044901 | Bacteria | 10082 |
| 644 | Ga0466960_0001087 | 3300044901 | Bacteria | 9771 |
| 645 | Ga0466960_0002372 | 3300044901 | Bacteria | 7089 |
| 646 | Ga0466959_0000897 | 3300045049 | Bacteria | 17554 |
| 647 | Ga0466959_0001476 | 3300045049 | Bacteria | 14417 |
| 648 | Ga0466959_0001547 | 3300045049 | Bacteria | 14146 |
| 649 | Ga0466959_0017877 | 3300045049 | Bacteria | 5200 |
| 650 | Ga0466959_0027589 | 3300045049 | Bacteria | 4210 |
| 651 | Ga0466959_0037300 | 3300045049 | Bacteria | 3591 |
| 652 | Ga0466959_0068273 | 3300045049 | Bacteria | 2576 |
| 653 | Ga0466959_0129690 | 3300045049 | Bacteria | 1787 |
| 654 | Ga0466958_0005151 | 3300045836 | Bacteria | 6988 |
| 655 | Ga0466958_0006888 | 3300045836 | Bacteria | 6215 |
| 656 | Ga0466958_0039394 | 3300045836 | Bacteria | 2839 |
| 657 | Ga0466958_0040735 | 3300045836 | Bacteria | 2792 |
| 658 | Ga0466958_0041381 | 3300045836 | Bacteria | 2771 |
| 659 | Ga0466958_0050560 | 3300045836 | Bacteria | 2516 |
| 660 | Ga0466958_0110713 | 3300045836 | Bacteria | 1714 |
| 661 | Ga0466967_0003546 | 3300045976 | Bacteria | 10219 |
| 662 | Ga0466967_0011765 | 3300045976 | Bacteria | 6653 |
| 663 | Ga0466967_0011960 | 3300045976 | Bacteria | 6613 |
| 664 | Ga0466967_0016973 | 3300045976 | Bacteria | 5759 |
| 665 | Ga0466967_0026318 | 3300045976 | Bacteria | 4817 |
| 666 | Ga0466967_0036386 | 3300045976 | Bacteria | 4202 |
| 667 | Ga0466967_0036918 | 3300045976 | Bacteria | 4176 |
| 668 | Ga0466967_0041552 | 3300045976 | Bacteria | 3966 |
| 669 | Ga0466967_0051161 | 3300045976 | Bacteria | 3619 |
| 670 | Ga0466967_0076612 | 3300045976 | Bacteria | 3009 |
| 671 | Ga0466967_0121806 | 3300045976 | Bacteria | 2411 |
| 672 | Ga0466967_0178777 | 3300045976 | Bacteria | 2000 |
| 673 | Ga0466967_0182264 | 3300045976 | Bacteria | 1981 |
| 674 | Ga0466967_0186768 | 3300045976 | Bacteria | 1957 |
| 675 | Ga0466967_0188129 | 3300045976 | Bacteria | 1950 |
| 676 | Ga0466967_0341518 | 3300045976 | Bacteria | 1448 |
| 677 | Ga0495603_0107818 | 3300046455 | Bacteria | 1625 |
| 678 | Ga0495629_0185365 | 3300046459 | Bacteria | 1441 |
| 679 | Ga0495638_0000563 | 3300046460 | Bacteria | 42248 |
| 680 | Ga0495638_0058022 | 3300046460 | Bacteria | 2399 |
| 681 | Ga0495641_0041725 | 3300046461 | Bacteria | 2130 |
| 682 | Ga0495653_0108174 | 3300046463 | Bacteria | 2002 |
| 683 | Ga0495650_0027022 | 3300046471 | Bacteria | 2659 |
| 684 | Ga0495582_0120994 | 3300046473 | Bacteria | 1475 |
| 685 | Ga0495639_0020463 | 3300046475 | Bacteria | 2892 |
| 686 | Ga0495662_0052534 | 3300046476 | Bacteria | 1967 |
| 687 | Ga0495662_0068307 | 3300046476 | Bacteria | 1721 |
| 688 | Ga0495664_0089469 | 3300046477 | Bacteria | 1850 |
| 689 | Ga0495594_0002125 | 3300046499 | Bacteria | 10318 |
| 690 | Ga0495594_0016140 | 3300046499 | Bacteria | 3931 |
| 691 | Ga0495594_0029099 | 3300046499 | Bacteria | 2985 |
| 692 | Ga0495594_0125002 | 3300046499 | Bacteria | 1455 |
| 693 | Ga0495606_0002365 | 3300046507 | Bacteria | 22146 |
| 694 | Ga0495648_0004975 | 3300046524 | Bacteria | 11167 |
| 695 | Ga0495648_0014101 | 3300046524 | Bacteria | 5871 |
| 696 | Ga0495652_0102062 | 3300046529 | Bacteria | 2324 |
| 697 | Ga0495665_0020854 | 3300046531 | Bacteria | 3520 |
| 698 | Ga0495665_0059379 | 3300046531 | Bacteria | 2018 |
| 699 | Ga0495640_0073786 | 3300046533 | Bacteria | 2283 |
| 700 | Ga0495640_0082893 | 3300046533 | Bacteria | 2128 |
| 701 | Ga0495667_0158278 | 3300046559 | Bacteria | 1457 |
| 702 | Ga0495656_0054210 | 3300046615 | Bacteria | 1725 |
| 703 | Ga0495668_0000169 | 3300046616 | Bacteria | 97150 |
| 704 | Ga0495634_0116644 | 3300046642 | Bacteria | 1712 |
| 705 | Ga0495625_0002435 | 3300046660 | Bacteria | 20135 |
| 706 | Ga0495635_0107726 | 3300046663 | Bacteria | 1903 |
| 707 | Ga0495635_0126535 | 3300046663 | Bacteria | 1742 |
| 708 | Ga0495588_0035197 | 3300046674 | Bacteria | 2537 |
| 709 | Ga0495669_0005418 | 3300046684 | Bacteria | 5324 |
| 710 | Ga0495613_0054572 | 3300046689 | Bacteria | 2937 |
| 711 | Ga0495624_0105330 | 3300046690 | Bacteria | 1735 |
| 712 | Ga0495604_0069356 | 3300047317 | Bacteria | 2672 |
| 713 | Ga0495674_0052692 | 3300047319 | Bacteria | 3579 |
| 714 | Ga0495674_0125381 | 3300047319 | Bacteria | 2167 |
| 715 | Ga0495672_0023054 | 3300047320 | Bacteria | 4036 |
| 716 | Ga0495672_0083267 | 3300047320 | Bacteria | 1777 |
| 717 | Ga0495672_0103428 | 3300047320 | Bacteria | 1541 |
| 718 | Ga0495676_0045519 | 3300047321 | Bacteria | 3571 |
| 719 | Ga0495680_0028397 | 3300047322 | Bacteria | 4586 |
| 720 | Ga0495680_0141162 | 3300047322 | Bacteria | 1762 |
| 721 | Ga0495683_0066124 | 3300047323 | Bacteria | 1782 |
| 722 | Ga0495673_0001489 | 3300047469 | Bacteria | 18531 |
| 723 | Ga0495686_0005660 | 3300047472 | Bacteria | 9780 |
| 724 | Ga0495593_0031677 | 3300047673 | Bacteria | 2886 |
| 725 | Ga0495626_0000312 | 3300048091 | Bacteria | 51412 |
| 726 | Ga0496100_0000076 | 3300048903 | Bacteria | 54910 |
| 727 | Ga0496100_0001035 | 3300048903 | Bacteria | 13427 |
| 728 | Ga0496100_0001268 | 3300048903 | Bacteria | 12329 |
| 729 | Ga0496100_0002861 | 3300048903 | Bacteria | 8840 |
| 730 | Ga0496100_0023093 | 3300048903 | Bacteria | 3773 |
| 731 | Ga0496101_0000084 | 3300048904 | Bacteria | 104071 |
| 732 | Ga0496101_0000094 | 3300048904 | Bacteria | 95577 |
| 733 | Ga0496101_0024663 | 3300048904 | Bacteria | 4165 |
| 734 | Ga0496101_0054318 | 3300048904 | Bacteria | 2892 |
| 735 | Ga0496101_0062230 | 3300048904 | Bacteria | 2713 |
| 736 | Ga0496101_0124461 | 3300048904 | Bacteria | 1952 |
| 737 | Ga0496102_0000014 | 3300048905 | Bacteria | 310241 |
| 738 | Ga0496102_0000718 | 3300048905 | Bacteria | 32794 |
| 739 | Ga0496102_0000923 | 3300048905 | Bacteria | 27676 |
| 740 | Ga0496102_0001481 | 3300048905 | Bacteria | 20733 |
| 741 | Ga0496102_0002467 | 3300048905 | Bacteria | 15780 |
| 742 | Ga0496102_0003991 | 3300048905 | Bacteria | 12497 |
| 743 | Ga0496102_0008831 | 3300048905 | Bacteria | 8645 |
| 744 | Ga0496102_0012499 | 3300048905 | Bacteria | 7350 |
| 745 | Ga0496102_0016217 | 3300048905 | Bacteria | 6511 |
| 746 | Ga0496102_0174766 | 3300048905 | Bacteria | 2022 |
| 747 | Ga0496102_0269201 | 3300048905 | Bacteria | 1606 |
| 748 | Ga0496102_0430437 | 3300048905 | Bacteria | 1239 |
| 749 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 750 | Ga0496103_0000030 | 3300048906 | Bacteria | 211729 |
| 751 | Ga0496103_0000630 | 3300048906 | Bacteria | 26992 |
| 752 | Ga0496103_0001260 | 3300048906 | Bacteria | 17289 |
| 753 | Ga0496103_0033606 | 3300048906 | Bacteria | 3133 |
| 754 | Ga0496103_0105726 | 3300048906 | Bacteria | 1785 |
| 755 | Ga0496103_0143998 | 3300048906 | Bacteria | 1525 |
| 756 | Ga0496104_0002885 | 3300048907 | Bacteria | 14814 |
| 757 | Ga0496104_0004329 | 3300048907 | Bacteria | 12358 |
| 758 | Ga0496104_0005253 | 3300048907 | Bacteria | 11319 |
| 759 | Ga0496104_0210252 | 3300048907 | Bacteria | 1857 |
| 760 | Ga0496104_0244539 | 3300048907 | Bacteria | 1707 |
| 761 | Ga0496105_0001491 | 3300048908 | Bacteria | 16529 |
| 762 | Ga0496105_0012144 | 3300048908 | Bacteria | 6820 |
| 763 | Ga0496105_0016809 | 3300048908 | Bacteria | 5849 |
| 764 | Ga0496105_0058452 | 3300048908 | Bacteria | 3183 |
| 765 | Ga0496105_0122311 | 3300048908 | Bacteria | 2145 |
| 766 | Ga0496105_0394156 | 3300048908 | Bacteria | 1100 |
| 767 | Ga0496106_0002103 | 3300048909 | Bacteria | 14917 |
| 768 | Ga0496106_0002972 | 3300048909 | Bacteria | 12619 |
| 769 | Ga0496106_0012998 | 3300048909 | Bacteria | 6142 |
| 770 | Ga0496106_0044746 | 3300048909 | Bacteria | 3324 |
| 771 | Ga0496107_0000270 | 3300048910 | Bacteria | 27582 |
| 772 | Ga0496107_0001773 | 3300048910 | Bacteria | 13595 |
| 773 | Ga0496107_0002556 | 3300048910 | Bacteria | 11864 |
| 774 | Ga0496107_0028257 | 3300048910 | Bacteria | 3985 |
| 775 | Ga0496107_0044087 | 3300048910 | Bacteria | 3206 |
| 776 | Ga0496107_0127549 | 3300048910 | Bacteria | 1877 |
| 777 | Ga0496107_0151894 | 3300048910 | Bacteria | 1713 |
| 778 | Ga0496108_0001463 | 3300048911 | Bacteria | 18677 |
| 779 | Ga0496108_0002468 | 3300048911 | Bacteria | 14806 |
| 780 | Ga0496108_0004287 | 3300048911 | Bacteria | 11482 |
| 781 | Ga0496108_0006483 | 3300048911 | Bacteria | 9493 |
| 782 | Ga0496108_0032843 | 3300048911 | Bacteria | 4310 |
| 783 | Ga0496109_0000344 | 3300048912 | Bacteria | 43282 |
| 784 | Ga0496109_0010406 | 3300048912 | Bacteria | 7944 |
| 785 | Ga0496109_0017263 | 3300048912 | Bacteria | 6323 |
| 786 | Ga0496109_0054926 | 3300048912 | Bacteria | 3633 |
| 787 | Ga0496110_0014435 | 3300048913 | Bacteria | 6559 |
| 788 | Ga0496110_0037507 | 3300048913 | Bacteria | 4213 |
| 789 | Ga0496110_0093651 | 3300048913 | Bacteria | 2689 |
| 790 | Ga0496110_0115056 | 3300048913 | Bacteria | 2421 |
| 791 | Ga0496110_0172554 | 3300048913 | Bacteria | 1962 |
| 792 | Ga0496111_0001016 | 3300048914 | Bacteria | 15409 |
| 793 | Ga0496111_0015472 | 3300048914 | Bacteria | 5238 |
| 794 | Ga0496111_0027683 | 3300048914 | Bacteria | 4013 |
| 795 | Ga0496111_0096564 | 3300048914 | Bacteria | 2169 |
| 796 | Ga0496111_0140049 | 3300048914 | Bacteria | 1792 |
| 797 | Ga0496112_0007119 | 3300048915 | Bacteria | 9895 |
| 798 | Ga0496112_0032493 | 3300048915 | Bacteria | 5068 |
| 799 | Ga0496112_0036248 | 3300048915 | Bacteria | 4811 |
| 800 | Ga0496112_0040073 | 3300048915 | Bacteria | 4579 |
| 801 | Ga0496112_0088623 | 3300048915 | Bacteria | 3062 |
| 802 | Ga0496112_0095801 | 3300048915 | Bacteria | 2938 |
| 803 | Ga0496112_0096870 | 3300048915 | Bacteria | 2920 |
| 804 | Ga0496112_0203459 | 3300048915 | Bacteria | 1938 |
| 805 | Ga0496112_0261377 | 3300048915 | Bacteria | 1680 |
| 806 | Ga0496113_0014747 | 3300048916 | Bacteria | 5345 |
| 807 | Ga0496113_0017750 | 3300048916 | Bacteria | 4947 |
| 808 | Ga0496114_0000842 | 3300048917 | Bacteria | 22978 |
| 809 | Ga0496114_0001102 | 3300048917 | Bacteria | 20408 |
| 810 | Ga0496114_0029191 | 3300048917 | Bacteria | 4531 |
| 811 | Ga0496114_0127872 | 3300048917 | Bacteria | 2192 |
| 812 | Ga0496114_0149915 | 3300048917 | Bacteria | 2023 |
| 813 | Ga0496115_0007651 | 3300048918 | Bacteria | 7961 |
| 814 | Ga0496115_0018123 | 3300048918 | Bacteria | 5398 |
| 815 | Ga0496115_0079646 | 3300048918 | Bacteria | 2666 |
| 816 | Ga0496115_0147233 | 3300048918 | Bacteria | 1944 |
| 817 | Ga0496115_0234302 | 3300048918 | Bacteria | 1513 |
| 818 | Ga0496116_0000069 | 3300048919 | Bacteria | 252643 |
| 819 | Ga0496116_0000578 | 3300048919 | Bacteria | 48938 |
| 820 | Ga0496116_0002811 | 3300048919 | Bacteria | 17874 |
| 821 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 822 | Ga0496117_0001462 | 3300048920 | Bacteria | 34041 |
| 823 | Ga0496117_0019905 | 3300048920 | Bacteria | 5491 |
| 824 | Ga0496117_0021310 | 3300048920 | Bacteria | 5248 |
| 825 | Ga0496117_0028936 | 3300048920 | Bacteria | 4281 |
| 826 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 827 | Ga0496118_0000236 | 3300048921 | Bacteria | 97321 |
| 828 | Ga0496118_0002249 | 3300048921 | Bacteria | 26504 |
| 829 | Ga0496118_0012121 | 3300048921 | Bacteria | 8321 |
| 830 | Ga0496118_0086760 | 3300048921 | Bacteria | 2173 |
| 831 | Ga0496119_0000549 | 3300048922 | Bacteria | 51126 |
| 832 | Ga0496119_0000803 | 3300048922 | Bacteria | 42034 |
| 833 | Ga0496119_0003615 | 3300048922 | Bacteria | 15913 |
| 834 | Ga0496119_0005467 | 3300048922 | Bacteria | 12159 |
| 835 | Ga0496119_0007110 | 3300048922 | Bacteria | 10173 |
| 836 | Ga0496119_0008226 | 3300048922 | Bacteria | 9220 |
| 837 | Ga0496120_0000085 | 3300048923 | Bacteria | 155343 |
| 838 | Ga0496120_0000250 | 3300048923 | Bacteria | 90632 |
| 839 | Ga0496120_0004382 | 3300048923 | Bacteria | 11881 |
| 840 | Ga0496120_0018927 | 3300048923 | Bacteria | 4422 |
| 841 | Ga0496120_0044947 | 3300048923 | Bacteria | 2562 |
| 842 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 843 | Ga0496121_0000032 | 3300048924 | Bacteria | 378997 |
| 844 | Ga0496121_0002393 | 3300048924 | Bacteria | 28754 |
| 845 | Ga0496121_0032516 | 3300048924 | Bacteria | 4740 |
| 846 | Ga0496121_0058018 | 3300048924 | Bacteria | 3204 |
| 847 | Ga0496122_0000526 | 3300048925 | Bacteria | 79269 |
| 848 | Ga0496123_0004458 | 3300048926 | Bacteria | 14696 |
| 849 | Ga0496123_0050772 | 3300048926 | Bacteria | 2768 |
| 850 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 851 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 852 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 853 | Ga0496126_0000035 | 3300048929 | Bacteria | 361590 |
| 854 | Ga0496126_0000067 | 3300048929 | Bacteria | 249091 |
| 855 | Ga0496126_0000208 | 3300048929 | Bacteria | 131604 |
| 856 | Ga0496126_0005873 | 3300048929 | Bacteria | 13845 |
| 857 | Ga0496126_0037045 | 3300048929 | Bacteria | 4555 |
| 858 | Ga0496126_0058610 | 3300048929 | Bacteria | 3470 |
| 859 | Ga0496126_0087310 | 3300048929 | Bacteria | 2748 |
| 860 | Ga0501032_0000706 | 3300049569 | Bacteria | 27189 |
| 861 | Ga0501032_0006930 | 3300049569 | Bacteria | 8308 |
| 862 | Ga0501032_0012122 | 3300049569 | Bacteria | 6171 |
| 863 | Ga0501033_0009060 | 3300049570 | Bacteria | 7678 |
| 864 | Ga0501033_0037516 | 3300049570 | Bacteria | 3627 |
| 865 | Ga0501034_0005030 | 3300049571 | Bacteria | 14530 |
| 866 | Ga0501034_0013263 | 3300049571 | Bacteria | 8490 |
| 867 | Ga0501034_0037652 | 3300049571 | Bacteria | 4899 |
| 868 | Ga0501034_0076278 | 3300049571 | Bacteria | 3359 |
| 869 | Ga0501034_0088737 | 3300049571 | Bacteria | 3090 |
| 870 | Ga0501036_0038851 | 3300049572 | Bacteria | 4029 |
| 871 | Ga0501036_0144342 | 3300049572 | Bacteria | 2008 |
| 872 | Ga0501037_0001277 | 3300049573 | Bacteria | 18552 |
| 873 | Ga0501037_0001845 | 3300049573 | Bacteria | 15371 |
| 874 | Ga0501037_0054026 | 3300049573 | Bacteria | 2938 |
| 875 | Ga0501038_0000620 | 3300049574 | Bacteria | 31614 |
| 876 | Ga0501038_0013687 | 3300049574 | Bacteria | 7393 |
| 877 | Ga0501038_0014050 | 3300049574 | Bacteria | 7296 |
| 878 | Ga0501039_0000909 | 3300049575 | Bacteria | 21583 |
| 879 | Ga0501039_0022360 | 3300049575 | Bacteria | 4854 |
| 880 | Ga0501039_0178776 | 3300049575 | Bacteria | 1669 |
| 881 | Ga0501040_0042780 | 3300049576 | Bacteria | 3086 |
| 882 | Ga0501041_0029441 | 3300049577 | Bacteria | 3312 |
| 883 | Ga0501041_0122404 | 3300049577 | Bacteria | 1617 |
| 884 | Ga0501042_0019941 | 3300049578 | Bacteria | 4663 |
| 885 | Ga0501042_0025668 | 3300049578 | Bacteria | 4140 |
| 886 | Ga0501043_0001657 | 3300049579 | Bacteria | 19328 |
| 887 | Ga0501043_0041148 | 3300049579 | Bacteria | 3631 |
| 888 | Ga0501043_0222802 | 3300049579 | Bacteria | 1458 |
| 889 | Ga0501046_0019678 | 3300049580 | Bacteria | 5594 |
| 890 | Ga0501047_0004744 | 3300049581 | Bacteria | 12783 |
| 891 | Ga0501047_0006713 | 3300049581 | Bacteria | 10820 |
| 892 | Ga0501047_0010437 | 3300049581 | Bacteria | 8790 |
| 893 | Ga0501047_0068897 | 3300049581 | Bacteria | 3407 |
| 894 | Ga0501048_0008553 | 3300049582 | Bacteria | 7731 |
| 895 | Ga0501048_0008968 | 3300049582 | Bacteria | 7530 |
| 896 | Ga0501048_0051146 | 3300049582 | Bacteria | 2942 |
| 897 | Ga0501068_0181903 | 3300049584 | Bacteria | 1329 |
| 898 | Ga0501069_0178003 | 3300049585 | Bacteria | 1229 |
| 899 | Ga0501070_0000213 | 3300049586 | Bacteria | 55004 |
| 900 | Ga0501070_0000386 | 3300049586 | Bacteria | 40434 |
| 901 | Ga0501071_0001758 | 3300049587 | Bacteria | 12768 |
| 902 | Ga0501071_0111275 | 3300049587 | Bacteria | 2024 |
| 903 | Ga0501072_0011692 | 3300049588 | Bacteria | 6707 |
| 904 | Ga0501074_0002345 | 3300049590 | Bacteria | 13178 |
| 905 | Ga0501074_0090606 | 3300049590 | Bacteria | 2190 |
| 906 | Ga0501077_0063682 | 3300049593 | Bacteria | 2339 |
| 907 | Ga0501077_0101867 | 3300049593 | Bacteria | 1820 |
| 908 | Ga0501081_0028586 | 3300049743 | Bacteria | 3763 |
| 909 | Ga0501035_0000340 | 3300049822 | Bacteria | 54226 |
| 910 | Ga0501035_0008647 | 3300049822 | Bacteria | 9478 |
| 911 | Ga0501044_0000380 | 3300049823 | Bacteria | 55272 |
| 912 | Ga0501044_0028696 | 3300049823 | Bacteria | 5871 |
| 913 | Ga0501044_0082871 | 3300049823 | Bacteria | 3244 |
| 914 | Ga0501044_0104258 | 3300049823 | Bacteria | 2850 |
| 915 | Ga0501044_0213532 | 3300049823 | Bacteria | 1883 |
| 916 | Ga0501045_0007214 | 3300049824 | Bacteria | 7714 |
| 917 | Ga0501045_0050949 | 3300049824 | Bacteria | 3021 |
| 918 | nmdc:mga03n38_1427_c1 | 3300050490 | Bacteria | 6826 |
| 919 | nmdc:mga03n38_1511_c1 | 3300050490 | Bacteria | 6716 |
| 920 | nmdc:mga00v17_1138_c1 | 3300050491 | Bacteria | 13972 |
| 921 | nmdc:mga00v17_44455_c1 | 3300050491 | Bacteria | 2678 |
| 922 | nmdc:mga00v17_60940_c1 | 3300050491 | Bacteria | 2319 |
| 923 | nmdc:mga00v17_6740_c1 | 3300050491 | Bacteria | 6102 |
| 924 | nmdc:mga00v17_8771_c1 | 3300050491 | Bacteria | 5445 |
| 925 | nmdc:mga00v17_96380_c1 | 3300050491 | Bacteria | 1863 |
| 926 | nmdc:mga0yw44_24337_c1 | 3300050492 | Bacteria | 3425 |
| 927 | nmdc:mga0yw44_780_c1 | 3300050492 | Bacteria | 11811 |
| 928 | nmdc:mga07m45_13392_c1 | 3300050496 | Bacteria | 4351 |
| 929 | nmdc:mga07m45_21555_c1 | 3300050496 | Bacteria | 3509 |
| 930 | nmdc:mga07m45_27168_c1 | 3300050496 | Bacteria | 3150 |
| 931 | nmdc:mga07m45_337_c1 | 3300050496 | Bacteria | 19051 |
| 932 | nmdc:mga07m45_84550_c1 | 3300050496 | Bacteria | 1814 |
| 933 | nmdc:mga05p37_16765_c1 | 3300050507 | Bacteria | 8832 |
| 934 | nmdc:mga05p37_181377_c1 | 3300050507 | Bacteria | 2561 |
| 935 | nmdc:mga05p37_26114_c1 | 3300050507 | Bacteria | 7102 |
| 936 | nmdc:mga05p37_9074_c1 | 3300050507 | Bacteria | 11755 |
| 937 | nmdc:mga09592_16810_c1 | 3300050508 | Bacteria | 5988 |
| 938 | nmdc:mga09592_62_c1 | 3300050508 | Bacteria | 60818 |
| 939 | nmdc:mga0qj67_10555_c1 | 3300050509 | Bacteria | 6899 |
| 940 | nmdc:mga0qj67_106_c2 | 3300050509 | Bacteria | 34014 |
| 941 | nmdc:mga0qj67_13793_c1 | 3300050509 | Bacteria | 6098 |
| 942 | nmdc:mga0qj67_21963_c1 | 3300050509 | Bacteria | 4897 |
| 943 | nmdc:mga06r32_1375_c1 | 3300050510 | Bacteria | 21993 |
| 944 | nmdc:mga06r32_25_c7 | 3300050510 | Bacteria | 11552 |
| 945 | nmdc:mga06r32_77325_c1 | 3300050510 | Bacteria | 3233 |
| 946 | nmdc:mga06r32_9570_c1 | 3300050510 | Bacteria | 8752 |
| 947 | nmdc:mga08y16_19132_c1 | 3300050511 | Bacteria | 7216 |
| 948 | nmdc:mga08y16_309796_c1 | 3300050511 | Bacteria | 1626 |
| 949 | nmdc:mga0n895_119551_c1 | 3300050512 | Bacteria | 2656 |
| 950 | nmdc:mga0n895_3029_c1 | 3300050512 | Bacteria | 13368 |
| 951 | nmdc:mga08x19_8640_c1 | 3300050514 | Bacteria | 6071 |
| 952 | nmdc:mga0a205_10838_c1 | 3300050515 | Bacteria | 8386 |
| 953 | nmdc:mga0a205_70823_c1 | 3300050515 | Bacteria | 3367 |
| 954 | nmdc:mga0sz30_3286_c1 | 3300050516 | Bacteria | 5813 |
| 955 | nmdc:mga0sz30_36543_c1 | 3300050516 | Bacteria | 2053 |
| 956 | nmdc:mga0sz30_927_c1 | 3300050516 | Bacteria | 10562 |
| 957 | Ga0495601_0015871 | 3300053077 | Bacteria | 4558 |
| 958 | Ga0500635_0003696 | 3300053080 | Bacteria | 3871 |
| 959 | Ga0495595_0090115 | 3300053084 | Bacteria | 1470 |
| 960 | Ga0495619_0225913 | 3300053085 | Bacteria | 1297 |
| 961 | Ga0500643_000240 | 3300053087 | Bacteria | 50980 |
| 962 | Ga0500643_003897 | 3300053087 | Bacteria | 6930 |
| 963 | Ga0500644_0008807 | 3300053088 | Bacteria | 2676 |
| 964 | Ga0500646_0003381 | 3300053090 | Bacteria | 4095 |
| 965 | Ga0500583_0083104 | 3300053092 | Bacteria | 1550 |
| 966 | Ga0500562_004337 | 3300053108 | Bacteria | 3589 |
| 967 | Ga0500652_000479 | 3300053131 | Bacteria | 14179 |
| 968 | Ga0500652_035905 | 3300053131 | Bacteria | 1971 |
| 969 | Ga0500588_0000341 | 3300053146 | Bacteria | 7098 |
| 970 | Ga0500616_0007655 | 3300053153 | Bacteria | 6823 |
| 971 | Ga0500645_000123 | 3300053730 | Bacteria | 61404 |
| 972 | Ga0500645_009049 | 3300053730 | Bacteria | 3363 |
| 973 | Ga0501084_0202597 | 3300054114 | Bacteria | 1674 |
| 974 | Ga0501082_0143043 | 3300060353 | Bacteria | 2076 |
| 975 | Ga0466962_0010071 | 3300061719 | Bacteria | 4536 |
| 976 | Ga0466962_0022948 | 3300061719 | Bacteria | 2999 |
| 977 | Ga0530510_0103344 | 3300061734 | Bacteria | 2084 |
| 978 | Ga0530510_0168046 | 3300061734 | Bacteria | 1624 |
| 979 | 2501941842 | 2501939600 | Bacteria | 6907073 |
| 980 | 2506865430 | 2506783011 | Bacteria | 5323186 |
| 981 | 2508672362 | 2508501039 | Bacteria | 9978592 |
| 982 | 2515493923 | 2515154088 | Bacteria | 5526283 |
| 983 | 2515720617 | 2515154129 | Bacteria | 5584369 |
| 984 | 2515755299 | 2515154137 | Bacteria | 5711575 |
| 985 | 2516086759 | 2515154202 | Bacteria | 5471270 |
| 986 | 2516092345 | 2515154203 | Bacteria | 5458536 |
| 987 | 2517760699 | 2517572101 | Bacteria | 6884336 |
| 988 | 2523384642 | 2523231044 | Bacteria | 6434991 |
| 989 | 2528204833 | 2527291627 | Bacteria | 5309833 |
| 990 | 2528216273 | 2527291629 | Bacteria | 5267418 |
| 991 | 2546950180 | 2546825537 | Bacteria | 5389291 |
| 992 | 2558909285 | 2558860112 | Bacteria | 9931328 |
| 993 | 2559426958 | 2558860280 | Bacteria | 11429938 |
| 994 | 2579750781 | 2576861822 | Bacteria | 5004595 |
| 995 | 2579852809 | 2579778521 | Bacteria | 7624758 |
| 996 | 2583151582 | 2582580736 | Bacteria | 5325865 |
| 997 | 2586064139 | 2585427649 | Bacteria | 9053857 |
| 998 | 2619856604 | 2619618881 | Bacteria | 7521104 |
| 999 | 2620348830 | 2619619003 | Bacteria | 7619552 |
| 1000 | 2623502299 | 2622736605 | Bacteria | 4992138 |
| 1001 | 2623586433 | 2622736626 | Bacteria | 7181580 |
| 1002 | 2626636124 | 2626541554 | Bacteria | 7741902 |
| 1003 | 2644486648 | 2643221687 | Bacteria | 6500351 |
| 1004 | 2644636053 | 2643221715 | Bacteria | 6671032 |
| 1005 | 2671840324 | 2671180195 | Bacteria | 9757215 |
| 1006 | 2676198229 | 2675902999 | Bacteria | 9438463 |
| 1007 | 2676484870 | 2675903059 | Bacteria | 8644972 |
| 1008 | 2686537433 | 2684623035 | Bacteria | 8032739 |
| 1009 | 2686543239 | 2684623036 | Bacteria | 5199090 |
| 1010 | 2689959501 | 2687453737 | Bacteria | 11203906 |
| 1011 | 2710606209 | 2710264753 | Bacteria | 5455564 |
| 1012 | 2738665279 | 2738541264 | Bacteria | 5935393 |
| 1013 | 2738706286 | 2738541274 | Bacteria | 6909446 |
| 1014 | 2739144413 | 2738541356 | Bacteria | 5935017 |
| 1015 | 2739328775 | 2738543028 | Bacteria | 6917070 |
| 1016 | 2753073314 | 2751185734 | Bacteria | 8863695 |
| 1017 | 2772641670 | 2772190715 | Bacteria | 6959372 |
| 1018 | 2774842807 | 2773857921 | Bacteria | 9435764 |
| 1019 | 2774858480 | 2773857922 | Bacteria | 9757215 |
| 1020 | 2774865980 | 2773857924 | Bacteria | 5256821 |
| 1021 | 2774901233 | 2773857933 | Bacteria | 5818019 |
| 1022 | 2791914036 | 2791354901 | Bacteria | 8322202 |
| 1023 | 2795791485 | 2795385472 | Bacteria | 6627535 |
| 1024 | 2809586616 | 2808606522 | Bacteria | 9488490 |
| 1025 | 2816511542 | 2816332139 | Bacteria | 9138787 |
| 1026 | 2842138692 | 2842134933 | Bacteria | 5847019 |
| 1027 | 2855021844 | 2855020534 | Bacteria | 3204685 |
| 1028 | 2855672226 | 2855670206 | Bacteria | 7120389 |
| 1029 | 2855678865 | 2855676851 | Bacteria | 7063653 |
| 1030 | 2855685291 | 2855683550 | Bacteria | 7134265 |
| 1031 | 2856860351 | 2856858025 | Bacteria | 7255264 |
| 1032 | 2857295162 | 2857288857 | Bacteria | 7189066 |
| 1033 | 2858854533 | 2858848962 | Bacteria | 6963058 |
| 1034 | 2858874076 | 2858868258 | Bacteria | 7683772 |
| 1035 | 2858888535 | 2858882152 | Bacteria | 7230291 |
| 1036 | 2858890759 | 2858888857 | Bacteria | 7060307 |
| 1037 | 2858898553 | 2858895516 | Bacteria | 7378898 |
| 1038 | 2858905641 | 2858902515 | Bacteria | 7086037 |
| 1039 | 2861520750 | 2861520306 | Bacteria | 8348283 |
| 1040 | 2866618724 | 2866612099 | Bacteria | 7543886 |
| 1041 | 2867303805 | 2867302475 | Bacteria | 7087181 |
| 1042 | 2867313357 | 2867312974 | Bacteria | 7058875 |
| 1043 | 2867322824 | 2867319477 | Bacteria | 7069771 |
| 1044 | 2869054255 | 2869048445 | Bacteria | 6875584 |
| 1045 | 2869065822 | 2869061728 | Bacteria | 7112407 |
| 1046 | 2869070626 | 2869068681 | Bacteria | 7205615 |
| 1047 | 2870729141 | 2870721527 | Bacteria | 9689237 |
| 1048 | 2870783488 | 2870782633 | Bacteria | 9624083 |
| 1049 | 2880493748 | 2880489317 | Bacteria | 7096270 |
| 1050 | 2880498574 | 2880495981 | Bacteria | 7340502 |
| 1051 | 2887483707 | 2887478801 | Bacteria | 8972725 |
| 1052 | 2891327121 | 2891326441 | Bacteria | 6439512 |
| 1053 | 2895882363 | 2895880812 | Bacteria | 11255272 |
| 1054 | 2899360234 | 2899359706 | Bacteria | 10940472 |
| 1055 | 2899376835 | 2899370129 | Bacteria | 6781179 |
| 1056 | 2902586396 | 2902582711 | Bacteria | 6187705 |
| 1057 | 2902793196 | 2902792274 | Bacteria | 7270173 |
| 1058 | 2902804063 | 2902799365 | Bacteria | 5419524 |
| 1059 | 2915772438 | 2915768154 | Bacteria | 8424322 |
| 1060 | 2917737472 | 2917736166 | Bacteria | 9690793 |
| 1061 | 2917738066 | 2917736166 | Bacteria | 9690793 |
| 1062 | 2929214578 | 2929212328 | Bacteria | 7708288 |
| 1063 | 2929220566 | 2929219909 | Bacteria | 6984360 |
| 1064 | 2929227153 | 2929226422 | Bacteria | 7248583 |
| 1065 | 2939587838 | 2939582691 | Bacteria | 7088898 |
| 1066 | 2996224794 | 2996221748 | Bacteria | 6799777 |
| 1067 | 3003008800 | 3002998708 | Bacteria | 11715108 |
| 1068 | 637879500 | 637000116 | Bacteria | 5433628 |
| 1069 | 649811090 | 649633069 | Bacteria | 6962533 |
| 1070 | 8001782513 | 8001781756 | Bacteria | 9586736 |
| 1071 | 8002782596 | 8002775197 | Bacteria | 10728764 |
| 1072 | 8002789205 | 8002784119 | Bacteria | 9788632 |
| 1073 | 8003320399 | 8003314358 | Bacteria | 10575343 |
| 1074 | 8003835336 | 8003830390 | Bacteria | 6541657 |
| 1075 | 8003857203 | 8003856774 | Bacteria | 7675274 |
| 1076 | 8003873523 | 8003870546 | Bacteria | 7396674 |
| 1077 | 8047715081 | 8047710418 | Bacteria | 11023148 |
| 1078 | 8054475476 | 8054472261 | Bacteria | 7464355 |
| 1079 | 8054708087 | 8054704163 | Bacteria | 7247792 |
| 1080 | 8054730990 | 8054727385 | Bacteria | 7558670 |
| 1081 | 8054735121 | 8054734606 | Bacteria | 6947278 |
| 1082 | 8054915208 | 8054913762 | Bacteria | 7713009 |
| 1083 | 8054918306 | 8054913762 | Bacteria | 7713009 |
| 1084 | 8054922262 | 8054920844 | Bacteria | 7068637 |
| 1085 | 8055159745 | 8055157932 | Bacteria | 6429399 |
| 1086 | 8055414775 | 8055412473 | Bacteria | 6257500 |
| 1087 | 8057568883 | 8057568493 | Bacteria | 7221719 |
| 1088 | Ga0157369_10014338 | |||
| 1089 | LJQas_1002727 | |||
| 1090 | JGI24739J22299_10039237 | |||
| 1091 | JGI24737J22298_10025874 | |||
| 1092 | JGI24743J22301_10001350 | |||
| 1093 | JGI24735J21928_10007384 | |||
| 1094 | JGI24744J21845_10002473 | |||
| 1095 | JGI24033J26618_1005562 | |||
| 1096 | JGI24034J26672_10001418 | |||
| 1097 | JGI24742J22300_10000583 | |||
| 1098 | JGI25406J46586_10002477 | |||
| 1099 | JGI25406J46586_10024529 | |||
| 1100 | Ga0055540_1000003 | |||
| 1101 | Ga0055540_1000261 | |||
| 1102 | Ga0055540_1002970 | |||
| 1103 | Ga0055540_1016606 | |||
| 1104 | JGI25405J52794_10009820 | |||
| 1105 | Ga0070658_10001192 | |||
| 1106 | Ga0070658_10003430 | |||
| 1107 | Ga0070676_10021409 | |||
| 1108 | Ga0070683_100009730 | |||
| 1109 | Ga0070690_100071686 | |||
| 1110 | Ga0070670_100001154 | |||
| 1111 | Ga0068869_100002993 | |||
| 1112 | Ga0068869_100014710 | |||
| 1113 | Ga0068869_100108312 | |||
| 1114 | Ga0068869_100114859 | |||
| 1115 | Ga0070666_10025034 | |||
| 1116 | Ga0070680_100000297 | |||
| 1117 | Ga0070680_100112545 | |||
| 1118 | Ga0070682_100000335 | |||
| 1119 | Ga0070682_100054424 | |||
| 1120 | Ga0068868_100004268 | |||
| 1121 | Ga0068868_100008435 | |||
| 1122 | Ga0068868_100008450 | |||
| 1123 | Ga0068868_100064065 | |||
| 1124 | Ga0070660_100001969 | |||
| 1125 | Ga0070660_100085916 | |||
| 1126 | Ga0070689_100067656 | |||
| 1127 | Ga0070689_100089896 | |||
| 1128 | Ga0070691_10003837 | |||
| 1129 | Ga0070691_10015402 | |||
| 1130 | Ga0070692_10000043 | |||
| 1131 | Ga0070668_100001102 | |||
| 1132 | Ga0070668_100002458 | |||
| 1133 | Ga0070668_100031527 | |||
| 1134 | Ga0070668_100194534 | |||
| 1135 | Ga0070669_100172314 | |||
| 1136 | Ga0070675_100000578 | |||
| 1137 | Ga0070675_100005371 | |||
| 1138 | Ga0070671_100001349 | |||
| 1139 | Ga0070671_100001748 | |||
| 1140 | Ga0070674_100021522 | |||
| 1141 | Ga0070673_100029092 | |||
| 1142 | Ga0070688_100010150 | |||
| 1143 | Ga0070659_100048536 | |||
| 1144 | Ga0070659_100060152 | |||
| 1145 | Ga0070659_100179378 | |||
| 1146 | Ga0070667_100000087 | |||
| 1147 | Ga0070667_100004630 | |||
| 1148 | Ga0070667_100007753 | |||
| 1149 | Ga0070667_100038520 | |||
| 1150 | Ga0070667_100047658 | |||
| 1151 | Ga0070703_10024660 | |||
| 1152 | Ga0070709_10061429 | |||
| 1153 | Ga0070714_100000057 | |||
| 1154 | Ga0070714_100000701 | |||
| 1155 | Ga0070714_100198913 | |||
| 1156 | Ga0070714_100232497 | |||
| 1157 | Ga0070710_10000110 | |||
| 1158 | Ga0070710_10002992 | |||
| 1159 | Ga0070701_10002400 | |||
| 1160 | Ga0070711_100001653 | |||
| 1161 | Ga0070711_100002316 | |||
| 1162 | Ga0070711_100002351 | |||
| 1163 | Ga0070705_100005450 | |||
| 1164 | Ga0070700_100000031 | |||
| 1165 | Ga0070700_100001352 | |||
| 1166 | Ga0070700_100003917 | |||
| 1167 | Ga0070700_100005474 | |||
| 1168 | Ga0070700_100006150 | |||
| 1169 | Ga0070694_100018471 | |||
| 1170 | Ga0070663_100001468 | |||
| 1171 | Ga0070663_100003006 | |||
| 1172 | Ga0070663_100016296 | |||
| 1173 | Ga0070663_100048175 | |||
| 1174 | Ga0070663_100170063 | |||
| 1175 | Ga0070663_100271223 | |||
| 1176 | Ga0070678_100000372 | |||
| 1177 | Ga0070678_100003411 | |||
| 1178 | Ga0070662_100015433 | |||
| 1179 | Ga0070681_10001041 | |||
| 1180 | Ga0070681_10025473 | |||
| 1181 | Ga0070681_10056346 | |||
| 1182 | Ga0070685_10177846 | |||
| 1183 | Ga0070679_100006559 | |||
| 1184 | Ga0070679_100086354 | |||
| 1185 | Ga0070684_100010145 | |||
| 1186 | Ga0068853_100016915 | |||
| 1187 | Ga0068853_100018399 | |||
| 1188 | Ga0068853_100073150 | |||
| 1189 | Ga0068853_100078561 | |||
| 1190 | Ga0070672_100095272 | |||
| 1191 | Ga0070672_100141087 | |||
| 1192 | Ga0070672_100240741 | |||
| 1193 | Ga0070686_100144858 | |||
| 1194 | Ga0070695_100127130 | |||
| 1195 | Ga0070696_100002982 | |||
| 1196 | Ga0070696_100061054 | |||
| 1197 | Ga0070696_100178864 | |||
| 1198 | Ga0070693_100000246 | |||
| 1199 | Ga0070665_100002158 | |||
| 1200 | Ga0070665_100003039 | |||
| 1201 | Ga0070665_100011089 | |||
| 1202 | Ga0070665_100031876 | |||
| 1203 | Ga0070665_100045698 | |||
| 1204 | Ga0070665_100054609 | |||
| 1205 | Ga0070704_100000113 | |||
| 1206 | Ga0068855_100006282 | |||
| 1207 | Ga0068855_100029171 | |||
| 1208 | Ga0068855_100032959 | |||
| 1209 | Ga0070664_100009850 | |||
| 1210 | Ga0070664_100151040 | |||
| 1211 | Ga0068857_100089002 | |||
| 1212 | Ga0068854_100000637 | |||
| 1213 | Ga0068854_100029847 | |||
| 1214 | Ga0068854_100057853 | |||
| 1215 | Ga0068856_100047641 | |||
| 1216 | Ga0070702_100000639 | |||
| 1217 | Ga0070702_100050915 | |||
| 1218 | Ga0068852_100012774 | |||
| 1219 | Ga0068852_100019689 | |||
| 1220 | Ga0068852_100039518 | |||
| 1221 | Ga0068852_100058283 | |||
| 1222 | Ga0068859_100000291 | |||
| 1223 | Ga0068859_100000301 | |||
| 1224 | Ga0068859_100003956 | |||
| 1225 | Ga0068859_100004810 | |||
| 1226 | Ga0068859_100013254 | |||
| 1227 | Ga0068859_100015017 | |||
| 1228 | Ga0068859_100045625 | |||
| 1229 | Ga0068864_100001934 | |||
| 1230 | Ga0068864_100109298 | |||
| 1231 | Ga0068864_100261526 | |||
| 1232 | Ga0068866_10000435 | |||
| 1233 | Ga0068866_10007493 | |||
| 1234 | Ga0068861_100002086 | |||
| 1235 | Ga0068861_100018749 | |||
| 1236 | Ga0068861_100042769 | |||
| 1237 | Ga0068861_100090221 | |||
| 1238 | Ga0068863_100000163 | |||
| 1239 | Ga0068863_100000179 | |||
| 1240 | Ga0068863_100000580 | |||
| 1241 | Ga0068863_100001505 | |||
| 1242 | Ga0068863_100006453 | |||
| 1243 | Ga0068863_100057846 | |||
| 1244 | Ga0068863_100089506 | |||
| 1245 | Ga0068858_100000010 | |||
| 1246 | Ga0068858_100000071 | |||
| 1247 | Ga0068858_100000362 | |||
| 1248 | Ga0068858_100009793 | |||
| 1249 | Ga0068858_100020931 | |||
| 1250 | Ga0068858_100053123 | |||
| 1251 | Ga0068858_100099585 | |||
| 1252 | Ga0068858_100288793 | |||
| 1253 | Ga0068860_100000020 | |||
| 1254 | Ga0068860_100000345 | |||
| 1255 | Ga0068860_100016544 | |||
| 1256 | Ga0068860_100052772 | |||
| 1257 | Ga0068860_100060595 | |||
| 1258 | Ga0068862_100000013 | |||
| 1259 | Ga0068862_100000049 | |||
| 1260 | Ga0068862_100005089 | |||
| 1261 | Ga0068862_100057251 | |||
| 1262 | Ga0068862_100255275 | |||
| 1263 | Ga0081455_10000288 | |||
| 1264 | Ga0081455_10000436 | |||
| 1265 | Ga0081455_10009880 | |||
| 1266 | Ga0081455_10010864 | |||
| 1267 | Ga0081455_10039401 | |||
| 1268 | Ga0081538_10005232 | |||
| 1269 | Ga0081540_1000602 | |||
| 1270 | Ga0081540_1000710 | |||
| 1271 | Ga0081540_1051424 | |||
| 1272 | Ga0081539_10000094 | |||
| 1273 | Ga0081539_10000882 | |||
| 1274 | Ga0070717_10001308 | |||
| 1275 | Ga0070717_10072787 | |||
| 1276 | Ga0075365_10019566 | |||
| 1277 | Ga0075365_10023310 | |||
| 1278 | Ga0075365_10028336 | |||
| 1279 | Ga0075363_100000409 | |||
| 1280 | Ga0075363_100004494 | |||
| 1281 | Ga0075363_100014025 | |||
| 1282 | Ga0075363_100014723 | |||
| 1283 | Ga0075363_100073713 | |||
| 1284 | Ga0075364_10001494 | |||
| 1285 | Ga0075364_10006497 | |||
| 1286 | Ga0075364_10010332 | |||
| 1287 | Ga0075364_10017355 | |||
| 1288 | Ga0075432_10010849 | |||
| 1289 | Ga0070716_100001095 | |||
| 1290 | Ga0070716_100105017 | |||
| 1291 | Ga0070712_100003765 | |||
| 1292 | Ga0070712_100005974 | |||
| 1293 | Ga0075369_10004499 | |||
| 1294 | Ga0075369_10024999 | |||
| 1295 | Ga0075369_10034936 | |||
| 1296 | Ga0075366_10147537 | |||
| 1297 | Ga0097621_100009134 | |||
| 1298 | Ga0097621_100025930 | |||
| 1299 | Ga0075370_10022693 | |||
| 1300 | Ga0075370_10027158 | |||
| 1301 | Ga0075370_10031037 | |||
| 1302 | Ga0075428_100001458 | |||
| 1303 | Ga0075428_100161048 | |||
| 1304 | Ga0075428_100189572 | |||
| 1305 | Ga0075430_100005427 | |||
| 1306 | Ga0075430_100022533 | |||
| 1307 | Ga0075431_100074231 | |||
| 1308 | Ga0075433_10106885 | |||
| 1309 | Ga0075434_100015313 | |||
| 1310 | Ga0075434_100019371 | |||
| 1311 | Ga0075429_100033163 | |||
| 1312 | Ga0075429_100121583 | |||
| 1313 | Ga0068865_100006274 | |||
| 1314 | Ga0068865_100069746 | |||
| 1315 | Ga0075436_100007851 | |||
| 1316 | Ga0075436_100072828 | |||
| 1317 | Ga0097620_100000291 | |||
| 1318 | Ga0097620_100000301 | |||
| 1319 | Ga0097620_100003956 | |||
| 1320 | Ga0097620_100004810 | |||
| 1321 | Ga0097620_100013254 | |||
| 1322 | Ga0097620_100015017 | |||
| 1323 | Ga0097620_100045625 | |||
| 1324 | Ga0075435_100002890 | |||
| 1325 | Ga0075435_100007664 | |||
| 1326 | Ga0099795_10040891 | |||
| 1327 | Ga0105250_10049852 | |||
| 1328 | Ga0105240_10119840 | |||
| 1329 | Ga0105240_10122665 | |||
| 1330 | Ga0105240_10236659 | |||
| 1331 | Ga0111539_10000482 | |||
| 1332 | Ga0111539_10004560 | |||
| 1333 | Ga0111539_10387616 | |||
| 1334 | Ga0105245_10001247 | |||
| 1335 | Ga0105245_10080568 | |||
| 1336 | Ga0105245_10090761 | |||
| 1337 | Ga0105245_10217265 | |||
| 1338 | Ga0105247_10000009 | |||
| 1339 | Ga0105247_10000111 | |||
| 1340 | Ga0105247_10000834 | |||
| 1341 | Ga0105247_10002038 | |||
| 1342 | Ga0105247_10007205 | |||
| 1343 | Ga0114129_10000114 | |||
| 1344 | Ga0114129_10000585 | |||
| 1345 | Ga0114129_10021079 | |||
| 1346 | Ga0114129_10054519 | |||
| 1347 | Ga0114129_10230478 | |||
| 1348 | Ga0114129_10363980 | |||
| 1349 | Ga0105243_10001881 | |||
| 1350 | Ga0105243_10043836 | |||
| 1351 | Ga0105243_10149133 | |||
| 1352 | Ga0105241_10001137 | |||
| 1353 | Ga0105242_10000766 | |||
| 1354 | Ga0105242_10062239 | |||
| 1355 | Ga0105248_10000147 | |||
| 1356 | Ga0105248_10000207 | |||
| 1357 | Ga0105248_10000377 | |||
| 1358 | Ga0105248_10000450 | |||
| 1359 | Ga0105248_10004117 | |||
| 1360 | Ga0105248_10018906 | |||
| 1361 | Ga0105248_10028235 | |||
| 1362 | Ga0105248_10069913 | |||
| 1363 | Ga0105248_10133451 | |||
| 1364 | Ga0105248_10285059 | |||
| 1365 | Ga0105248_10401555 | |||
| 1366 | Ga0105237_10006936 | |||
| 1367 | Ga0105237_10042790 | |||
| 1368 | Ga0105237_10302090 | |||
| 1369 | Ga0105237_10374459 | |||
| 1370 | Ga0105238_10008912 | |||
| 1371 | Ga0105238_10032836 | |||
| 1372 | Ga0105238_10109655 | |||
| 1373 | Ga0105249_10000057 | |||
| 1374 | Ga0105249_10004171 | |||
| 1375 | Ga0105249_10011423 | |||
| 1376 | Ga0105249_10022525 | |||
| 1377 | Ga0105249_10129991 | |||
| 1378 | Ga0105249_10143452 | |||
| 1379 | Ga0105239_10001572 | |||
| 1380 | Ga0105239_10050445 | |||
| 1381 | Ga0105239_10053915 | |||
| 1382 | Ga0105239_10073274 | |||
| 1383 | Ga0105239_10144029 | |||
| 1384 | Ga0105239_10307076 | |||
| 1385 | Ga0105246_10016685 | |||
| 1386 | Ga0105246_10018512 | |||
| 1387 | Ga0157371_10007484 | |||
| 1388 | Ga0157370_10002735 | |||
| 1389 | Ga0157370_10018215 | |||
| 1390 | Ga0157370_10064903 | |||
| 1391 | Ga0157369_10019224 | |||
| 1392 | Ga0157374_10030500 | |||
| 1393 | Ga0157374_10123689 | |||
| 1394 | Ga0157378_10000831 | |||
| 1395 | Ga0157378_10076761 | |||
| 1396 | Ga0163162_10062818 | |||
| 1397 | Ga0163162_10066269 | |||
| 1398 | Ga0163162_10086860 | |||
| 1399 | Ga0157372_10000023 | |||
| 1400 | Ga0157372_10008689 | |||
| 1401 | Ga0157372_10631504 | |||
| 1402 | Ga0157375_10034872 | |||
| 1403 | Ga0157375_10044455 | |||
| 1404 | Ga0163163_10005277 | |||
| 1405 | Ga0163163_10039757 | |||
| 1406 | Ga0163163_10179325 | |||
| 1407 | Ga0157380_10001997 | |||
| 1408 | Ga0157377_10000649 | |||
| 1409 | Ga0157377_10005999 | |||
| 1410 | Ga0157379_10000015 | |||
| 1411 | Ga0157379_10000149 | |||
| 1412 | Ga0157379_10007816 | |||
| 1413 | Ga0157379_10058232 | |||
| 1414 | Ga0157379_10132060 | |||
| 1415 | Ga0157376_10028847 | |||
| 1416 | Ga0163161_10000872 | |||
| 1417 | Ga0163161_10005938 | |||
| 1418 | Ga0197907_10161669 | |||
| 1419 | Ga0206356_10255926 | |||
| 1420 | Ga0206356_10857683 | |||
| 1421 | Ga0206353_11500815 | |||
| 1422 | Ga0154015_1696953 | |||
| 1423 | Ga0213873_10000086 | |||
| 1424 | Ga0213876_10001258 | |||
| 1425 | Ga0213876_10012466 | |||
| 1426 | Ga0213875_10000111 | |||
| 1427 | Ga0213875_10018826 | |||
| 1428 | Ga0224712_10050376 | |||
| 1429 | Ga0224712_10056534 | |||
| 1430 | Ga0209673_1007257 | |||
| 1431 | Ga0209051_1000011 | |||
| 1432 | Ga0209051_1006016 | |||
| 1433 | Ga0209051_1013644 | |||
| 1434 | Ga0209051_1016811 | |||
| 1435 | Ga0207692_10000457 | |||
| 1436 | Ga0207692_10012087 | |||
| 1437 | Ga0207642_10001854 | |||
| 1438 | Ga0207710_10000014 | |||
| 1439 | Ga0207710_10000107 | |||
| 1440 | Ga0207710_10000144 | |||
| 1441 | Ga0207710_10004379 | |||
| 1442 | Ga0207710_10010119 | |||
| 1443 | Ga0207688_10000698 | |||
| 1444 | Ga0207688_10000946 | |||
| 1445 | Ga0207688_10001700 | |||
| 1446 | Ga0207688_10008927 | |||
| 1447 | Ga0207647_10043676 | |||
| 1448 | Ga0207647_10100957 | |||
| 1449 | Ga0207645_10015307 | |||
| 1450 | Ga0207643_10000326 | |||
| 1451 | Ga0207705_10014614 | |||
| 1452 | Ga0207705_10015019 | |||
| 1453 | Ga0207705_10016235 | |||
| 1454 | Ga0207654_10003544 | |||
| 1455 | Ga0207707_10001022 | |||
| 1456 | Ga0207707_10033830 | |||
| 1457 | Ga0207695_10027320 | |||
| 1458 | Ga0207671_10040499 | |||
| 1459 | Ga0207693_10000949 | |||
| 1460 | Ga0207693_10001079 | |||
| 1461 | Ga0207693_10007135 | |||
| 1462 | Ga0207663_10000777 | |||
| 1463 | Ga0207663_10116149 | |||
| 1464 | Ga0207660_10000404 | |||
| 1465 | Ga0207660_10001049 | |||
| 1466 | Ga0207660_10038877 | |||
| 1467 | Ga0207662_10212455 | |||
| 1468 | Ga0207657_10001506 | |||
| 1469 | Ga0207657_10038718 | |||
| 1470 | Ga0207657_10045558 | |||
| 1471 | Ga0207657_10070030 | |||
| 1472 | Ga0207649_10005345 | |||
| 1473 | Ga0207649_10036106 | |||
| 1474 | Ga0207652_10000717 | |||
| 1475 | Ga0207652_10027502 | |||
| 1476 | Ga0207650_10004876 | |||
| 1477 | Ga0207659_10000900 | |||
| 1478 | Ga0207659_10001150 | |||
| 1479 | Ga0207659_10099159 | |||
| 1480 | Ga0207687_10001698 | |||
| 1481 | Ga0207687_10007403 | |||
| 1482 | Ga0207687_10013866 | |||
| 1483 | Ga0207687_10016988 | |||
| 1484 | Ga0207687_10114634 | |||
| 1485 | Ga0207700_10120108 | |||
| 1486 | Ga0207664_10000002 | |||
| 1487 | Ga0207664_10000641 | |||
| 1488 | Ga0207644_10001436 | |||
| 1489 | Ga0207644_10012147 | |||
| 1490 | Ga0207644_10058447 | |||
| 1491 | Ga0207690_10149025 | |||
| 1492 | Ga0207706_10002283 | |||
| 1493 | Ga0207706_10024221 | |||
| 1494 | Ga0207706_10099658 | |||
| 1495 | Ga0207686_10004275 | |||
| 1496 | Ga0207686_10015402 | |||
| 1497 | Ga0207709_10008902 | |||
| 1498 | Ga0207709_10022088 | |||
| 1499 | Ga0207669_10000486 | |||
| 1500 | Ga0207704_10008655 | |||
| 1501 | Ga0207665_10001059 | |||
| 1502 | Ga0207665_10001980 | |||
| 1503 | Ga0207665_10002449 | |||
| 1504 | Ga0207691_10042385 | |||
| 1505 | Ga0207691_10053103 | |||
| 1506 | Ga0207711_10000056 | |||
| 1507 | Ga0207711_10000242 | |||
| 1508 | Ga0207711_10000967 | |||
| 1509 | Ga0207711_10010080 | |||
| 1510 | Ga0207711_10011062 | |||
| 1511 | Ga0207711_10042651 | |||
| 1512 | Ga0207689_10021188 | |||
| 1513 | Ga0207689_10034419 | |||
| 1514 | Ga0207689_10058656 | |||
| 1515 | Ga0207689_10083825 | |||
| 1516 | Ga0207689_10119121 | |||
| 1517 | Ga0207661_10007868 | |||
| 1518 | Ga0207661_10025555 | |||
| 1519 | Ga0207679_10000518 | |||
| 1520 | Ga0207679_10001380 | |||
| 1521 | Ga0207679_10145844 | |||
| 1522 | Ga0207667_10018101 | |||
| 1523 | Ga0207667_10052382 | |||
| 1524 | Ga0207712_10000050 | |||
| 1525 | Ga0207712_10005038 | |||
| 1526 | Ga0207712_10012050 | |||
| 1527 | Ga0207712_10042846 | |||
| 1528 | Ga0207668_10000733 | |||
| 1529 | Ga0207668_10001475 | |||
| 1530 | Ga0207668_10008379 | |||
| 1531 | Ga0207668_10262669 | |||
| 1532 | Ga0207640_10002229 | |||
| 1533 | Ga0207640_10002522 | |||
| 1534 | Ga0207658_10000065 | |||
| 1535 | Ga0207658_10002834 | |||
| 1536 | Ga0207658_10003413 | |||
| 1537 | Ga0207658_10041531 | |||
| 1538 | Ga0207658_10053391 | |||
| 1539 | Ga0207677_10004713 | |||
| 1540 | Ga0207677_10027108 | |||
| 1541 | Ga0207703_10000002 | |||
| 1542 | Ga0207703_10000094 | |||
| 1543 | Ga0207703_10006889 | |||
| 1544 | Ga0207703_10026958 | |||
| 1545 | Ga0207703_10056971 | |||
| 1546 | Ga0207703_10080017 | |||
| 1547 | Ga0207703_10104289 | |||
| 1548 | Ga0207639_10043174 | |||
| 1549 | Ga0207639_10055464 | |||
| 1550 | Ga0207678_10000377 | |||
| 1551 | Ga0207678_10003800 | |||
| 1552 | Ga0207678_10006924 | |||
| 1553 | Ga0207678_10042150 | |||
| 1554 | Ga0207678_10046245 | |||
| 1555 | Ga0207708_10000046 | |||
| 1556 | Ga0207708_10002058 | |||
| 1557 | Ga0207708_10004173 | |||
| 1558 | Ga0207708_10019544 | |||
| 1559 | Ga0207708_10027529 | |||
| 1560 | Ga0207702_10000541 | |||
| 1561 | Ga0207702_10429416 | |||
| 1562 | Ga0207641_10000562 | |||
| 1563 | Ga0207641_10000740 | |||
| 1564 | Ga0207641_10014236 | |||
| 1565 | Ga0207641_10019865 | |||
| 1566 | Ga0207641_10038076 | |||
| 1567 | Ga0207641_10170786 | |||
| 1568 | Ga0207648_10002377 | |||
| 1569 | Ga0207648_10077267 | |||
| 1570 | Ga0207676_10002174 | |||
| 1571 | Ga0207676_10111309 | |||
| 1572 | Ga0207674_10001847 | |||
| 1573 | Ga0207674_10006778 | |||
| 1574 | Ga0207674_10019724 | |||
| 1575 | Ga0207674_10064844 | |||
| 1576 | Ga0207674_10077418 | |||
| 1577 | Ga0207674_10177825 | |||
| 1578 | Ga0207675_100001291 | |||
| 1579 | Ga0207675_100045219 | |||
| 1580 | Ga0207675_100110916 | |||
| 1581 | Ga0207683_10000634 | |||
| 1582 | Ga0207683_10000738 | |||
| 1583 | Ga0207683_10003326 | |||
| 1584 | Ga0207683_10009633 | |||
| 1585 | Ga0207698_10008276 | |||
| 1586 | Ga0207698_10052324 | |||
| 1587 | Ga0207698_10135667 | |||
| 1588 | Ga0207698_10187647 | |||
| 1589 | Ga0207428_10002331 | |||
| 1590 | Ga0207428_10088600 | |||
| 1591 | Ga0268266_10010107 | |||
| 1592 | Ga0268266_10016725 | |||
| 1593 | Ga0268266_10062421 | |||
| 1594 | Ga0268266_10110017 | |||
| 1595 | Ga0268266_10285149 | |||
| 1596 | Ga0268265_10000004 | |||
| 1597 | Ga0268265_10000017 | |||
| 1598 | Ga0268265_10005435 | |||
| 1599 | Ga0268264_10000024 | |||
| 1600 | Ga0268264_10000257 | |||
| 1601 | Ga0268264_10002508 | |||
| 1602 | Ga0268264_10003187 | |||
| 1603 | Ga0268264_10081549 | |||
| 1604 | Ga0265319_1011896 | |||
| 1605 | Ga0265336_10005066 | |||
| 1606 | Ga0307515_10008569 | |||
| 1607 | Ga0307515_10099199 | |||
| 1608 | Ga0307515_10170971 | |||
| 1609 | Ga0265338_10000745 | |||
| 1610 | Ga0307511_10027297 | |||
| 1611 | Ga0307511_10147330 | |||
| 1612 | Ga0307512_10036831 | |||
| 1613 | Ga0316177_1052337 | |||
| 1614 | Ga0314311_1180288 | |||
| 1615 | Ga0265327_10009371 | |||
| 1616 | Ga0307513_10013296 | |||
| 1617 | Ga0307513_10057511 | |||
| 1618 | Ga0307509_10261448 | |||
| 1619 | Ga0307408_100077423 | |||
| 1620 | Ga0307508_10093651 | |||
| 1621 | Ga0316578_10043764 | |||
| 1622 | Ga0307516_10000999 | |||
| 1623 | Ga0307405_10019059 | |||
| 1624 | Ga0307413_10000893 | |||
| 1625 | Ga0307413_10039074 | |||
| 1626 | Ga0307518_10000618 | |||
| 1627 | Ga0307518_10014471 | |||
| 1628 | Ga0307410_10008087 | |||
| 1629 | Ga0307406_10013548 | |||
| 1630 | Ga0307406_10122790 | |||
| 1631 | Ga0307412_10042207 | |||
| 1632 | Ga0307409_100000369 | |||
| 1633 | Ga0307409_100218696 | |||
| 1634 | Ga0307416_100001881 | |||
| 1635 | Ga0307416_100011301 | |||
| 1636 | Ga0307416_100025892 | |||
| 1637 | Ga0307416_100088103 | |||
| 1638 | Ga0307416_100132268 | |||
| 1639 | Ga0307414_10070978 | |||
| 1640 | Ga0307411_10018384 | |||
| 1641 | Ga0307411_10033278 | |||
| 1642 | Ga0307415_100000012 | |||
| 1643 | Ga0307415_100077551 | |||
| 1644 | Ga0307507_10004395 | |||
| 1645 | Ga0307507_10055651 | |||
| 1646 | Ga0307510_10022164 | |||
| 1647 | Ga0373929_0006036 | |||
| 1648 | Ga0373940_0001450 | |||
| 1649 | Ga0373936_0024454 | |||
| 1650 | Ga0373956_0000258 | |||
| 1651 | Ga0373957_0019558 | |||
| 1652 | Ga0373960_0016902 | |||
| 1653 | Ga0373931_0006845 | |||
| 1654 | Ga0373931_0019651 | |||
| 1655 | Ga0373931_0119669 | |||
| 1656 | Ga0373927_0039947 | |||
| 1657 | Ga0373937_0131387 | |||
| 1658 | Ga0373925_0089855 | |||
| 1659 | Ga0373925_0229357 | |||
| 1660 | Ga0395900_0048293 | |||
| 1661 | Ga0395898_0026569 | |||
| 1662 | Ga0395905_0020862 | |||
| 1663 | Ga0436364_0155073 | |||
| 1664 | Ga0436364_0284917 | |||
| 1665 | Ga0436364_0296067 | |||
| 1666 | Ga0436364_1031907 | |||
| 1667 | Ga0436364_1038490 | |||
| 1668 | Ga0436364_1406310 | |||
| 1669 | Ga0436364_1554479 | |||
| 1670 | Ga0395901_0028510 | |||
| 1671 | Ga0395901_0147327 | |||
| 1672 | Ga0436365_1354167 | |||
| 1673 | Ga0436365_1453781 | |||
| 1674 | Ga0436365_1605762 | |||
| 1675 | Ga0436365_1607916 | |||
| 1676 | Ga0436365_1889369 | |||
| 1677 | Ga0436363_0578534 | |||
| 1678 | Ga0436363_1446743 | |||
| 1679 | Ga0436362_0218630 | |||
| 1680 | Ga0439465_0018051 | |||
| 1681 | Ga0451789_0707078 | |||
| 1682 | Ga0451853_3429478 | |||
| 1683 | Ga0439445_0004151 | |||
| 1684 | Ga0439448_0028867 | |||
| 1685 | Ga0439463_001998 | |||
| 1686 | Ga0439434_0002590 | |||
| 1687 | Ga0439435_0003483 | |||
| 1688 | Ga0451577_0300822 | |||
| 1689 | Ga0466969_0002252 | |||
| 1690 | Ga0466969_0003530 | |||
| 1691 | Ga0466972_0002059 | |||
| 1692 | Ga0466972_0002859 | |||
| 1693 | Ga0466972_0015337 | |||
| 1694 | Ga0466972_0036989 | |||
| 1695 | Ga0466965_0003251 | |||
| 1696 | Ga0466965_0006273 | |||
| 1697 | Ga0466965_0025222 | |||
| 1698 | Ga0466965_0026947 | |||
| 1699 | Ga0466966_0002064 | |||
| 1700 | Ga0466966_0002131 | |||
| 1701 | Ga0466966_0018665 | |||
| 1702 | Ga0466966_0033312 | |||
| 1703 | Ga0466966_0046838 | |||
| 1704 | Ga0466966_0058740 | |||
| 1705 | Ga0466961_0001303 | |||
| 1706 | Ga0466961_0018032 | |||
| 1707 | Ga0466961_0039915 | |||
| 1708 | Ga0466961_0050049 | |||
| 1709 | Ga0466961_0069587 | |||
| 1710 | Ga0466961_0117862 | |||
| 1711 | Ga0466963_0000288 | |||
| 1712 | Ga0466963_0002774 | |||
| 1713 | Ga0466963_0004890 | |||
| 1714 | Ga0466963_0011650 | |||
| 1715 | Ga0466963_0026683 | |||
| 1716 | Ga0466963_0066325 | |||
| 1717 | Ga0466963_0187237 | |||
| 1718 | Ga0466964_0033655 | |||
| 1719 | Ga0466971_0004672 | |||
| 1720 | Ga0466971_0005045 | |||
| 1721 | Ga0466968_0001581 | |||
| 1722 | Ga0466968_0024051 | |||
| 1723 | Ga0466970_0036670 | |||
| 1724 | Ga0466957_0001403 | |||
| 1725 | Ga0466957_0006143 | |||
| 1726 | Ga0466957_0027046 | |||
| 1727 | Ga0466957_0061434 | |||
| 1728 | Ga0466957_0080003 | |||
| 1729 | Ga0466957_0300468 | |||
| 1730 | Ga0466960_0001002 | |||
| 1731 | Ga0466960_0001087 | |||
| 1732 | Ga0466960_0002372 | |||
| 1733 | Ga0466959_0000897 | |||
| 1734 | Ga0466959_0001476 | |||
| 1735 | Ga0466959_0001547 | |||
| 1736 | Ga0466959_0017877 | |||
| 1737 | Ga0466959_0027589 | |||
| 1738 | Ga0466959_0037300 | |||
| 1739 | Ga0466959_0068273 | |||
| 1740 | Ga0466959_0129690 | |||
| 1741 | Ga0466958_0005151 | |||
| 1742 | Ga0466958_0006888 | |||
| 1743 | Ga0466958_0039394 | |||
| 1744 | Ga0466958_0040735 | |||
| 1745 | Ga0466958_0041381 | |||
| 1746 | Ga0466958_0050560 | |||
| 1747 | Ga0466958_0110713 | |||
| 1748 | Ga0466967_0003546 | |||
| 1749 | Ga0466967_0011765 | |||
| 1750 | Ga0466967_0011960 | |||
| 1751 | Ga0466967_0016973 | |||
| 1752 | Ga0466967_0026318 | |||
| 1753 | Ga0466967_0036386 | |||
| 1754 | Ga0466967_0036918 | |||
| 1755 | Ga0466967_0041552 | |||
| 1756 | Ga0466967_0051161 | |||
| 1757 | Ga0466967_0076612 | |||
| 1758 | Ga0466967_0121806 | |||
| 1759 | Ga0466967_0178777 | |||
| 1760 | Ga0466967_0182264 | |||
| 1761 | Ga0466967_0186768 | |||
| 1762 | Ga0466967_0188129 | |||
| 1763 | Ga0466967_0341518 | |||
| 1764 | Ga0495603_0107818 | |||
| 1765 | Ga0495629_0185365 | |||
| 1766 | Ga0495638_0000563 | |||
| 1767 | Ga0495638_0058022 | |||
| 1768 | Ga0495641_0041725 | |||
| 1769 | Ga0495653_0108174 | |||
| 1770 | Ga0495650_0027022 | |||
| 1771 | Ga0495582_0120994 | |||
| 1772 | Ga0495639_0020463 | |||
| 1773 | Ga0495662_0052534 | |||
| 1774 | Ga0495662_0068307 | |||
| 1775 | Ga0495664_0089469 | |||
| 1776 | Ga0495594_0002125 | |||
| 1777 | Ga0495594_0016140 | |||
| 1778 | Ga0495594_0029099 | |||
| 1779 | Ga0495594_0125002 | |||
| 1780 | Ga0495606_0002365 | |||
| 1781 | Ga0495648_0004975 | |||
| 1782 | Ga0495648_0014101 | |||
| 1783 | Ga0495652_0102062 | |||
| 1784 | Ga0495665_0020854 | |||
| 1785 | Ga0495665_0059379 | |||
| 1786 | Ga0495640_0073786 | |||
| 1787 | Ga0495640_0082893 | |||
| 1788 | Ga0495667_0158278 | |||
| 1789 | Ga0495656_0054210 | |||
| 1790 | Ga0495668_0000169 | |||
| 1791 | Ga0495634_0116644 | |||
| 1792 | Ga0495625_0002435 | |||
| 1793 | Ga0495635_0107726 | |||
| 1794 | Ga0495635_0126535 | |||
| 1795 | Ga0495588_0035197 | |||
| 1796 | Ga0495669_0005418 | |||
| 1797 | Ga0495613_0054572 | |||
| 1798 | Ga0495624_0105330 | |||
| 1799 | Ga0495604_0069356 | |||
| 1800 | Ga0495674_0052692 | |||
| 1801 | Ga0495674_0125381 | |||
| 1802 | Ga0495672_0023054 | |||
| 1803 | Ga0495672_0083267 | |||
| 1804 | Ga0495672_0103428 | |||
| 1805 | Ga0495676_0045519 | |||
| 1806 | Ga0495680_0028397 | |||
| 1807 | Ga0495680_0141162 | |||
| 1808 | Ga0495683_0066124 | |||
| 1809 | Ga0495673_0001489 | |||
| 1810 | Ga0495686_0005660 | |||
| 1811 | Ga0495593_0031677 | |||
| 1812 | Ga0495626_0000312 | |||
| 1813 | Ga0496100_0000076 | |||
| 1814 | Ga0496100_0001035 | |||
| 1815 | Ga0496100_0001268 | |||
| 1816 | Ga0496100_0002861 | |||
| 1817 | Ga0496100_0023093 | |||
| 1818 | Ga0496101_0000084 | |||
| 1819 | Ga0496101_0000094 | |||
| 1820 | Ga0496101_0024663 | |||
| 1821 | Ga0496101_0054318 | |||
| 1822 | Ga0496101_0062230 | |||
| 1823 | Ga0496101_0124461 | |||
| 1824 | Ga0496102_0000014 | |||
| 1825 | Ga0496102_0000718 | |||
| 1826 | Ga0496102_0000923 | |||
| 1827 | Ga0496102_0001481 | |||
| 1828 | Ga0496102_0002467 | |||
| 1829 | Ga0496102_0003991 | |||
| 1830 | Ga0496102_0008831 | |||
| 1831 | Ga0496102_0012499 | |||
| 1832 | Ga0496102_0016217 | |||
| 1833 | Ga0496102_0174766 | |||
| 1834 | Ga0496102_0269201 | |||
| 1835 | Ga0496102_0430437 | |||
| 1836 | Ga0496103_0000004 | |||
| 1837 | Ga0496103_0000030 | |||
| 1838 | Ga0496103_0000630 | |||
| 1839 | Ga0496103_0001260 | |||
| 1840 | Ga0496103_0033606 | |||
| 1841 | Ga0496103_0105726 | |||
| 1842 | Ga0496103_0143998 | |||
| 1843 | Ga0496104_0002885 | |||
| 1844 | Ga0496104_0004329 | |||
| 1845 | Ga0496104_0005253 | |||
| 1846 | Ga0496104_0210252 | |||
| 1847 | Ga0496104_0244539 | |||
| 1848 | Ga0496105_0001491 | |||
| 1849 | Ga0496105_0012144 | |||
| 1850 | Ga0496105_0016809 | |||
| 1851 | Ga0496105_0058452 | |||
| 1852 | Ga0496105_0122311 | |||
| 1853 | Ga0496105_0394156 | |||
| 1854 | Ga0496106_0002103 | |||
| 1855 | Ga0496106_0002972 | |||
| 1856 | Ga0496106_0012998 | |||
| 1857 | Ga0496106_0044746 | |||
| 1858 | Ga0496107_0000270 | |||
| 1859 | Ga0496107_0001773 | |||
| 1860 | Ga0496107_0002556 | |||
| 1861 | Ga0496107_0028257 | |||
| 1862 | Ga0496107_0044087 | |||
| 1863 | Ga0496107_0127549 | |||
| 1864 | Ga0496107_0151894 | |||
| 1865 | Ga0496108_0001463 | |||
| 1866 | Ga0496108_0002468 | |||
| 1867 | Ga0496108_0004287 | |||
| 1868 | Ga0496108_0006483 | |||
| 1869 | Ga0496108_0032843 | |||
| 1870 | Ga0496109_0000344 | |||
| 1871 | Ga0496109_0010406 | |||
| 1872 | Ga0496109_0017263 | |||
| 1873 | Ga0496109_0054926 | |||
| 1874 | Ga0496110_0014435 | |||
| 1875 | Ga0496110_0037507 | |||
| 1876 | Ga0496110_0093651 | |||
| 1877 | Ga0496110_0115056 | |||
| 1878 | Ga0496110_0172554 | |||
| 1879 | Ga0496111_0001016 | |||
| 1880 | Ga0496111_0015472 | |||
| 1881 | Ga0496111_0027683 | |||
| 1882 | Ga0496111_0096564 | |||
| 1883 | Ga0496111_0140049 | |||
| 1884 | Ga0496112_0007119 | |||
| 1885 | Ga0496112_0032493 | |||
| 1886 | Ga0496112_0036248 | |||
| 1887 | Ga0496112_0040073 | |||
| 1888 | Ga0496112_0088623 | |||
| 1889 | Ga0496112_0095801 | |||
| 1890 | Ga0496112_0096870 | |||
| 1891 | Ga0496112_0203459 | |||
| 1892 | Ga0496112_0261377 | |||
| 1893 | Ga0496113_0014747 | |||
| 1894 | Ga0496113_0017750 | |||
| 1895 | Ga0496114_0000842 | |||
| 1896 | Ga0496114_0001102 | |||
| 1897 | Ga0496114_0029191 | |||
| 1898 | Ga0496114_0127872 | |||
| 1899 | Ga0496114_0149915 | |||
| 1900 | Ga0496115_0007651 | |||
| 1901 | Ga0496115_0018123 | |||
| 1902 | Ga0496115_0079646 | |||
| 1903 | Ga0496115_0147233 | |||
| 1904 | Ga0496115_0234302 | |||
| 1905 | Ga0496116_0000069 | |||
| 1906 | Ga0496116_0000578 | |||
| 1907 | Ga0496116_0002811 | |||
| 1908 | Ga0496117_0000003 | |||
| 1909 | Ga0496117_0001462 | |||
| 1910 | Ga0496117_0019905 | |||
| 1911 | Ga0496117_0021310 | |||
| 1912 | Ga0496117_0028936 | |||
| 1913 | Ga0496118_0000001 | |||
| 1914 | Ga0496118_0000236 | |||
| 1915 | Ga0496118_0002249 | |||
| 1916 | Ga0496118_0012121 | |||
| 1917 | Ga0496118_0086760 | |||
| 1918 | Ga0496119_0000549 | |||
| 1919 | Ga0496119_0000803 | |||
| 1920 | Ga0496119_0003615 | |||
| 1921 | Ga0496119_0005467 | |||
| 1922 | Ga0496119_0007110 | |||
| 1923 | Ga0496119_0008226 | |||
| 1924 | Ga0496120_0000085 | |||
| 1925 | Ga0496120_0000250 | |||
| 1926 | Ga0496120_0004382 | |||
| 1927 | Ga0496120_0018927 | |||
| 1928 | Ga0496120_0044947 | |||
| 1929 | Ga0496121_0000016 | |||
| 1930 | Ga0496121_0000032 | |||
| 1931 | Ga0496121_0002393 | |||
| 1932 | Ga0496121_0032516 | |||
| 1933 | Ga0496121_0058018 | |||
| 1934 | Ga0496122_0000526 | |||
| 1935 | Ga0496123_0004458 | |||
| 1936 | Ga0496123_0050772 | |||
| 1937 | Ga0496124_0000015 | |||
| 1938 | Ga0496125_0000021 | |||
| 1939 | Ga0496126_0000015 | |||
| 1940 | Ga0496126_0000035 | |||
| 1941 | Ga0496126_0000067 | |||
| 1942 | Ga0496126_0000208 | |||
| 1943 | Ga0496126_0005873 | |||
| 1944 | Ga0496126_0037045 | |||
| 1945 | Ga0496126_0058610 | |||
| 1946 | Ga0496126_0087310 | |||
| 1947 | Ga0501032_0000706 | |||
| 1948 | Ga0501032_0006930 | |||
| 1949 | Ga0501032_0012122 | |||
| 1950 | Ga0501033_0009060 | |||
| 1951 | Ga0501033_0037516 | |||
| 1952 | Ga0501034_0005030 | |||
| 1953 | Ga0501034_0013263 | |||
| 1954 | Ga0501034_0037652 | |||
| 1955 | Ga0501034_0076278 | |||
| 1956 | Ga0501034_0088737 | |||
| 1957 | Ga0501036_0038851 | |||
| 1958 | Ga0501036_0144342 | |||
| 1959 | Ga0501037_0001277 | |||
| 1960 | Ga0501037_0001845 | |||
| 1961 | Ga0501037_0054026 | |||
| 1962 | Ga0501038_0000620 | |||
| 1963 | Ga0501038_0013687 | |||
| 1964 | Ga0501038_0014050 | |||
| 1965 | Ga0501039_0000909 | |||
| 1966 | Ga0501039_0022360 | |||
| 1967 | Ga0501039_0178776 | |||
| 1968 | Ga0501040_0042780 | |||
| 1969 | Ga0501041_0029441 | |||
| 1970 | Ga0501041_0122404 | |||
| 1971 | Ga0501042_0019941 | |||
| 1972 | Ga0501042_0025668 | |||
| 1973 | Ga0501043_0001657 | |||
| 1974 | Ga0501043_0041148 | |||
| 1975 | Ga0501043_0222802 | |||
| 1976 | Ga0501046_0019678 | |||
| 1977 | Ga0501047_0004744 | |||
| 1978 | Ga0501047_0006713 | |||
| 1979 | Ga0501047_0010437 | |||
| 1980 | Ga0501047_0068897 | |||
| 1981 | Ga0501048_0008553 | |||
| 1982 | Ga0501048_0008968 | |||
| 1983 | Ga0501048_0051146 | |||
| 1984 | Ga0501068_0181903 | |||
| 1985 | Ga0501069_0178003 | |||
| 1986 | Ga0501070_0000213 | |||
| 1987 | Ga0501070_0000386 | |||
| 1988 | Ga0501071_0001758 | |||
| 1989 | Ga0501071_0111275 | |||
| 1990 | Ga0501072_0011692 | |||
| 1991 | Ga0501074_0002345 | |||
| 1992 | Ga0501074_0090606 | |||
| 1993 | Ga0501077_0063682 | |||
| 1994 | Ga0501077_0101867 | |||
| 1995 | Ga0501081_0028586 | |||
| 1996 | Ga0501035_0000340 | |||
| 1997 | Ga0501035_0008647 | |||
| 1998 | Ga0501044_0000380 | |||
| 1999 | Ga0501044_0028696 | |||
| 2000 | Ga0501044_0082871 | |||
| 2001 | Ga0501044_0104258 | |||
| 2002 | Ga0501044_0213532 | |||
| 2003 | Ga0501045_0007214 | |||
| 2004 | Ga0501045_0050949 | |||
| 2005 | nmdc:mga03n38_1427_c1 | |||
| 2006 | nmdc:mga03n38_1511_c1 | |||
| 2007 | nmdc:mga00v17_1138_c1 | |||
| 2008 | nmdc:mga00v17_44455_c1 | |||
| 2009 | nmdc:mga00v17_60940_c1 | |||
| 2010 | nmdc:mga00v17_6740_c1 | |||
| 2011 | nmdc:mga00v17_8771_c1 | |||
| 2012 | nmdc:mga00v17_96380_c1 | |||
| 2013 | nmdc:mga0yw44_24337_c1 | |||
| 2014 | nmdc:mga0yw44_780_c1 | |||
| 2015 | nmdc:mga07m45_13392_c1 | |||
| 2016 | nmdc:mga07m45_21555_c1 | |||
| 2017 | nmdc:mga07m45_27168_c1 | |||
| 2018 | nmdc:mga07m45_337_c1 | |||
| 2019 | nmdc:mga07m45_84550_c1 | |||
| 2020 | nmdc:mga05p37_16765_c1 | |||
| 2021 | nmdc:mga05p37_181377_c1 | |||
| 2022 | nmdc:mga05p37_26114_c1 | |||
| 2023 | nmdc:mga05p37_9074_c1 | |||
| 2024 | nmdc:mga09592_16810_c1 | |||
| 2025 | nmdc:mga09592_62_c1 | |||
| 2026 | nmdc:mga0qj67_10555_c1 | |||
| 2027 | nmdc:mga0qj67_106_c2 | |||
| 2028 | nmdc:mga0qj67_13793_c1 | |||
| 2029 | nmdc:mga0qj67_21963_c1 | |||
| 2030 | nmdc:mga06r32_1375_c1 | |||
| 2031 | nmdc:mga06r32_25_c7 | |||
| 2032 | nmdc:mga06r32_77325_c1 | |||
| 2033 | nmdc:mga06r32_9570_c1 | |||
| 2034 | nmdc:mga08y16_19132_c1 | |||
| 2035 | nmdc:mga08y16_309796_c1 | |||
| 2036 | nmdc:mga0n895_119551_c1 | |||
| 2037 | nmdc:mga0n895_3029_c1 | |||
| 2038 | nmdc:mga08x19_8640_c1 | |||
| 2039 | nmdc:mga0a205_10838_c1 | |||
| 2040 | nmdc:mga0a205_70823_c1 | |||
| 2041 | nmdc:mga0sz30_3286_c1 | |||
| 2042 | nmdc:mga0sz30_36543_c1 | |||
| 2043 | nmdc:mga0sz30_927_c1 | |||
| 2044 | Ga0495601_0015871 | |||
| 2045 | Ga0500635_0003696 | |||
| 2046 | Ga0495595_0090115 | |||
| 2047 | Ga0495619_0225913 | |||
| 2048 | Ga0500643_000240 | |||
| 2049 | Ga0500643_003897 | |||
| 2050 | Ga0500644_0008807 | |||
| 2051 | Ga0500646_0003381 | |||
| 2052 | Ga0500583_0083104 | |||
| 2053 | Ga0500562_004337 | |||
| 2054 | Ga0500652_000479 | |||
| 2055 | Ga0500652_035905 | |||
| 2056 | Ga0500588_0000341 | |||
| 2057 | Ga0500616_0007655 | |||
| 2058 | Ga0500645_000123 | |||
| 2059 | Ga0500645_009049 | |||
| 2060 | Ga0501084_0202597 | |||
| 2061 | Ga0501082_0143043 | |||
| 2062 | Ga0466962_0010071 | |||
| 2063 | Ga0466962_0022948 | |||
| 2064 | Ga0530510_0103344 | |||
| 2065 | Ga0530510_0168046 | |||
| 2066 | 2501941842 | |||
| 2067 | 2506865430 | |||
| 2068 | 2508672362 | |||
| 2069 | 2515493923 | |||
| 2070 | 2515720617 | |||
| 2071 | 2515755299 | |||
| 2072 | 2516086759 | |||
| 2073 | 2516092345 | |||
| 2074 | 2517760699 | |||
| 2075 | 2523384642 | |||
| 2076 | 2528204833 | |||
| 2077 | 2528216273 | |||
| 2078 | 2546950180 | |||
| 2079 | 2558909285 | |||
| 2080 | 2559426958 | |||
| 2081 | 2579750781 | |||
| 2082 | 2579852809 | |||
| 2083 | 2583151582 | |||
| 2084 | 2586064139 | |||
| 2085 | 2619856604 | |||
| 2086 | 2620348830 | |||
| 2087 | 2623502299 | |||
| 2088 | 2623586433 | |||
| 2089 | 2626636124 | |||
| 2090 | 2644486648 | |||
| 2091 | 2644636053 | |||
| 2092 | 2671840324 | |||
| 2093 | 2676198229 | |||
| 2094 | 2676484870 | |||
| 2095 | 2686537433 | |||
| 2096 | 2686543239 | |||
| 2097 | 2689959501 | |||
| 2098 | 2710606209 | |||
| 2099 | 2738665279 | |||
| 2100 | 2738706286 | |||
| 2101 | 2739144413 | |||
| 2102 | 2739328775 | |||
| 2103 | 2753073314 | |||
| 2104 | 2772641670 | |||
| 2105 | 2774842807 | |||
| 2106 | 2774858480 | |||
| 2107 | 2774865980 | |||
| 2108 | 2774901233 | |||
| 2109 | 2791914036 | |||
| 2110 | 2795791485 | |||
| 2111 | 2809586616 | |||
| 2112 | 2816511542 | |||
| 2113 | 2842138692 | |||
| 2114 | 2855021844 | |||
| 2115 | 2855672226 | |||
| 2116 | 2855678865 | |||
| 2117 | 2855685291 | |||
| 2118 | 2856860351 | |||
| 2119 | 2857295162 | |||
| 2120 | 2858854533 | |||
| 2121 | 2858874076 | |||
| 2122 | 2858888535 | |||
| 2123 | 2858890759 | |||
| 2124 | 2858898553 | |||
| 2125 | 2858905641 | |||
| 2126 | 2861520750 | |||
| 2127 | 2866618724 | |||
| 2128 | 2867303805 | |||
| 2129 | 2867313357 | |||
| 2130 | 2867322824 | |||
| 2131 | 2869054255 | |||
| 2132 | 2869065822 | |||
| 2133 | 2869070626 | |||
| 2134 | 2870729141 | |||
| 2135 | 2870783488 | |||
| 2136 | 2880493748 | |||
| 2137 | 2880498574 | |||
| 2138 | 2887483707 | |||
| 2139 | 2891327121 | |||
| 2140 | 2895882363 | |||
| 2141 | 2899360234 | |||
| 2142 | 2899376835 | |||
| 2143 | 2902586396 | |||
| 2144 | 2902793196 | |||
| 2145 | 2902804063 | |||
| 2146 | 2915772438 | |||
| 2147 | 2917737472 | |||
| 2148 | 2917738066 | |||
| 2149 | 2929214578 | |||
| 2150 | 2929220566 | |||
| 2151 | 2929227153 | |||
| 2152 | 2939587838 | |||
| 2153 | 2996224794 | |||
| 2154 | 3003008800 | |||
| 2155 | 637879500 | |||
| 2156 | 649811090 | |||
| 2157 | 8001782513 | |||
| 2158 | 8002782596 | |||
| 2159 | 8002789205 | |||
| 2160 | 8003320399 | |||
| 2161 | 8003835336 | |||
| 2162 | 8003857203 | |||
| 2163 | 8003873523 | |||
| 2164 | 8047715081 | |||
| 2165 | 8054475476 | |||
| 2166 | 8054708087 | |||
| 2167 | 8054730990 | |||
| 2168 | 8054735121 | |||
| 2169 | 8054915208 | |||
| 2170 | 8054918306 | |||
| 2171 | 8054922262 | |||
| 2172 | 8055159745 | |||
| 2173 | 8055414775 | |||
| 2174 | 8057568883 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vig-assembly2.cif.gz_H | crystal structure of human short-chain acyl coa dehydrogenase | 0.9735 | 10 | 395 |
| 2vig-assembly1.cif.gz_D | crystal structure of human short-chain acyl coa dehydrogenase | 0.9734 | 10 | 395 |
| 2vig-assembly2.cif.gz_F | crystal structure of human short-chain acyl coa dehydrogenase | 0.9724 | 10 | 395 |
| 2dvl-assembly1.cif.gz_A | crystal structure of project tt0160 from thermus thermophilus hb8 | 0.9714 | 10 | 390 |
| 2vig-assembly1.cif.gz_A | crystal structure of human short-chain acyl coa dehydrogenase | 0.9707 | 10 | 395 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0K3AQR2_269_362_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9815 | 249 | 336 | 1.20.140.10 |
| 4iv6A01 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.978 | 10 | 124 | 1.10.540.10 |
| af_Q9VDT1_256_405_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9767 | 249 | 395 | 1.20.140.10 |
| 1jqiB03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9767 | 253 | 391 | 1.20.140.10 |
| 1jqiA03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9764 | 253 | 391 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A399XYP2-F1-model_v4 | deleted | 0.9812 | 7 | 317 |
|
| AF-A0A519UGP9-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9787 | 227 | 391 |
GO:0003995
|
| AF-A0A4Q3UBN6-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9777 | 225 | 391 |
GO:0003995
|
| AF-A0A2R6LVG2-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9771 | 252 | 391 |
GO:0003995
|
| AF-A0A6N8W020-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9769 | 7 | 307 |
GO:0003995
GO:0050660 |