F489803

General Info

Members Datasets Scaffolds Average Seq Length
1087 493 2174 397

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10014338|Ga0157369_100143385
Length 430
Sequence VIGDATALDRRAGTAILQPRLLNYHSVTREASMTRLAHTPGLTDVQEAILATVREFVTKEIIPHAQRLEHDDTYPADIVDGMREMGLFGLTIDEEYGGLGESLLTYALVVEELARGWMSISGIVNTHFIVAYLVSQHGTAEQKRRLLPRLATGEMRGAFSMSEPGCGSDVAGIRSRAVPDGDGFVLNGQKMWLTNGAYSSVVATLMKTDTGADSVYGNMTTFLLEKEPGFGETAPGLAIPGKIEKMGYKGVETTEMVLDNHSVSAIAVLGGAEGVGRGFYQMMDGIEVGRVNVAARACGIAIRAFELAIGYAQQRQTFGKPLYQHQAIAFKLAEMGTKIEAGHALMVNAARLKDSGQRNDVEAGMAKLLASEYCAEVVQESFRIHGGYGYSKEYEIERLMREAPFLLIGEGTSEIQKTIISRGLLKEYRQ

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
200 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
204 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
205 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
206 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
228 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
249 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
250 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
301 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
375 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
376 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
377 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
378 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
379 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
380 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
381 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
382 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
386 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
387 2501939600 Micromonospora sp. L5 Isolate Unclassified
388 2506783011 Frankia datiscae Dg1 Isolate Nodule
389 2508501039 Frankia saprophytica CN3 Isolate Nodule
390 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
391 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
392 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
393 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
394 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
395 2517572101 Frankia sp. DC12 Isolate Nodule
396 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
397 2527291627 Frankia casuarinae Thr Isolate Nodule
398 2527291629 Frankia sp. BMG5.23 Isolate Nodule
399 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
400 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
401 2558860280 Kutzneria sp. 744 Isolate Unclassified
402 2576861822 Frankia sp. CeD Isolate Nodule
403 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
404 2582580736 Prauserella sp. Am3 Isolate Unclassified
405 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
406 2619618881 Frankia sp. ACN1ag Isolate Unclassified
407 2619619003 Frankia sp. CpI1-P Isolate Nodule
408 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
409 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
410 2626541554 Frankia sp. AvcI.1 Isolate Nodule
411 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
412 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
413 2671180195 Frankia sp. CcI49 Isolate Nodule
414 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
415 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
416 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
417 2684623036 Frankia sp. CgIM4 Isolate Nodule
418 2687453737 Frankia sp. BMG5.36 Isolate Nodule
419 2710264753 Frankia sp. KB5 Isolate Nodule
420 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
421 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
422 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
423 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
424 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
425 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
426 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
427 2773857922 Frankia sp. CcI49 Isolate Nodule
428 2773857924 Frankia sp. CgIS1 Isolate Nodule
429 2773857933 Frankia sp. BMG5.30 Isolate Nodule
430 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
431 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
432 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
433 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
434 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
435 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
436 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
437 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
438 2855683550 Micromonospora sp. RP3T Isolate Unclassified
439 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
440 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
441 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
442 2858868258 Micromonospora sp. MH33 Isolate Unclassified
443 2858882152 Micromonospora noduli MED15 Isolate Nodule
444 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
445 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
446 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
447 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
448 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
449 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
450 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
451 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
452 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
453 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
454 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
455 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
456 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
457 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
458 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
459 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
460 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
461 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
462 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
463 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
464 2902582711 Micromonospora sp. AP08 Isolate Unclassified
465 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
466 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
467 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
468 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
469 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
470 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
471 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
472 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
473 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
474 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
475 637000116 Frankia casuarinae CcI3 Isolate Nodule
476 649633069 Micromonospora sp. L5 Isolate Unclassified
477 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
478 8002775197 Frankia nepalensis CN7 Isolate Nodule
479 8002784119 Frankia sp. AgB1.9 Isolate Nodule
480 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
481 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
482 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
483 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
484 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
485 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
486 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
487 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
488 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
489 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
490 8054920844 Frankia tisae Agncl-8 Isolate Nodule
491 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
492 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
493 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.33
Metatranscriptomes 0.64
Isolates 10.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 2.85
Rhizoplane 8.65
Rhizosphere 70.93
Stem 0
Stem Tuber 0.18
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10014338 3300013105 Bacteria 8950
2 LJQas_1002727 3300000549 Bacteria 2429
3 JGI24739J22299_10039237 3300001989 Bacteria 1587
4 JGI24737J22298_10025874 3300001990 Bacteria 1853
5 JGI24743J22301_10001350 3300001991 Bacteria 3367
6 JGI24735J21928_10007384 3300002067 Bacteria 3587
7 JGI24744J21845_10002473 3300002077 Bacteria 3766
8 JGI24033J26618_1005562 3300002155 Bacteria 1393
9 JGI24034J26672_10001418 3300002239 Bacteria 3179
10 JGI24742J22300_10000583 3300002244 Bacteria 5485
11 JGI25406J46586_10002477 3300003203 Bacteria 8731
12 JGI25406J46586_10024529 3300003203 Bacteria 2360
13 Ga0055540_1000003 3300003792 Bacteria 428375
14 Ga0055540_1000261 3300003792 Bacteria 47645
15 Ga0055540_1002970 3300003792 Bacteria 8507
16 Ga0055540_1016606 3300003792 Bacteria 2087
17 JGI25405J52794_10009820 3300003911 Bacteria 1813
18 Ga0070658_10001192 3300005327 Bacteria 22232
19 Ga0070658_10003430 3300005327 Bacteria 13031
20 Ga0070676_10021409 3300005328 Bacteria 3621
21 Ga0070683_100009730 3300005329 Bacteria 8233
22 Ga0070690_100071686 3300005330 Bacteria 2251
23 Ga0070670_100001154 3300005331 Bacteria 20925
24 Ga0068869_100002993 3300005334 Bacteria 10267
25 Ga0068869_100014710 3300005334 Bacteria 5233
26 Ga0068869_100108312 3300005334 Bacteria 2111
27 Ga0068869_100114859 3300005334 Bacteria 2052
28 Ga0070666_10025034 3300005335 Bacteria 3890
29 Ga0070680_100000297 3300005336 Bacteria 33160
30 Ga0070680_100112545 3300005336 Bacteria 2266
31 Ga0070682_100000335 3300005337 Bacteria 32356
32 Ga0070682_100054424 3300005337 Bacteria 2511
33 Ga0068868_100004268 3300005338 Bacteria 10003
34 Ga0068868_100008435 3300005338 Bacteria 7379
35 Ga0068868_100008450 3300005338 Bacteria 7371
36 Ga0068868_100064065 3300005338 Bacteria 2917
37 Ga0070660_100001969 3300005339 Bacteria 14171
38 Ga0070660_100085916 3300005339 Bacteria 2475
39 Ga0070689_100067656 3300005340 Bacteria 2785
40 Ga0070689_100089896 3300005340 Bacteria 2419
41 Ga0070691_10003837 3300005341 Bacteria 6790
42 Ga0070691_10015402 3300005341 Bacteria 3514
43 Ga0070692_10000043 3300005345 Bacteria 24251
44 Ga0070668_100001102 3300005347 Bacteria 19064
45 Ga0070668_100002458 3300005347 Bacteria 13634
46 Ga0070668_100031527 3300005347 Bacteria 4033
47 Ga0070668_100194534 3300005347 Bacteria 1662
48 Ga0070669_100172314 3300005353 Bacteria 1688
49 Ga0070675_100000578 3300005354 Bacteria 25111
50 Ga0070675_100005371 3300005354 Bacteria 9793
51 Ga0070671_100001349 3300005355 Bacteria 18370
52 Ga0070671_100001748 3300005355 Bacteria 16507
53 Ga0070674_100021522 3300005356 Bacteria 4142
54 Ga0070673_100029092 3300005364 Bacteria 4117
55 Ga0070688_100010150 3300005365 Bacteria 5182
56 Ga0070659_100048536 3300005366 Bacteria 3335
57 Ga0070659_100060152 3300005366 Bacteria 3001
58 Ga0070659_100179378 3300005366 Bacteria 1737
59 Ga0070667_100000087 3300005367 Bacteria 114528
60 Ga0070667_100004630 3300005367 Bacteria 11547
61 Ga0070667_100007753 3300005367 Bacteria 8902
62 Ga0070667_100038520 3300005367 Bacteria 4007
63 Ga0070667_100047658 3300005367 Bacteria 3606
64 Ga0070703_10024660 3300005406 Bacteria 1779
65 Ga0070709_10061429 3300005434 Bacteria 2392
66 Ga0070714_100000057 3300005435 Bacteria 103150
67 Ga0070714_100000701 3300005435 Bacteria 23697
68 Ga0070714_100198913 3300005435 Bacteria 1832
69 Ga0070714_100232497 3300005435 Bacteria 1699
70 Ga0070710_10000110 3300005437 Bacteria 38306
71 Ga0070710_10002992 3300005437 Bacteria 8030
72 Ga0070701_10002400 3300005438 Bacteria 7209
73 Ga0070711_100001653 3300005439 Bacteria 12332
74 Ga0070711_100002316 3300005439 Bacteria 10815
75 Ga0070711_100002351 3300005439 Bacteria 10752
76 Ga0070705_100005450 3300005440 Bacteria 6200
77 Ga0070700_100000031 3300005441 Bacteria 117217
78 Ga0070700_100001352 3300005441 Bacteria 12196
79 Ga0070700_100003917 3300005441 Bacteria 7734
80 Ga0070700_100005474 3300005441 Bacteria 6733
81 Ga0070700_100006150 3300005441 Bacteria 6396
82 Ga0070694_100018471 3300005444 Bacteria 4424
83 Ga0070663_100001468 3300005455 Bacteria 12965
84 Ga0070663_100003006 3300005455 Bacteria 9625
85 Ga0070663_100016296 3300005455 Bacteria 4823
86 Ga0070663_100048175 3300005455 Bacteria 3021
87 Ga0070663_100170063 3300005455 Bacteria 1684
88 Ga0070663_100271223 3300005455 Bacteria 1349
89 Ga0070678_100000372 3300005456 Bacteria 20951
90 Ga0070678_100003411 3300005456 Bacteria 8859
91 Ga0070662_100015433 3300005457 Bacteria 5117
92 Ga0070681_10001041 3300005458 Bacteria 23550
93 Ga0070681_10025473 3300005458 Bacteria 5950
94 Ga0070681_10056346 3300005458 Bacteria 3912
95 Ga0070685_10177846 3300005466 Bacteria 1367
96 Ga0070679_100006559 3300005530 Bacteria 10844
97 Ga0070679_100086354 3300005530 Bacteria 3124
98 Ga0070684_100010145 3300005535 Bacteria 7448
99 Ga0068853_100016915 3300005539 Bacteria 6011
100 Ga0068853_100018399 3300005539 Bacteria 5783
101 Ga0068853_100073150 3300005539 Bacteria 2987
102 Ga0068853_100078561 3300005539 Bacteria 2884
103 Ga0070672_100095272 3300005543 Bacteria 2407
104 Ga0070672_100141087 3300005543 Bacteria 1987
105 Ga0070672_100240741 3300005543 Bacteria 1522
106 Ga0070686_100144858 3300005544 Bacteria 1658
107 Ga0070695_100127130 3300005545 Bacteria 1752
108 Ga0070696_100002982 3300005546 Bacteria 11245
109 Ga0070696_100061054 3300005546 Bacteria 2637
110 Ga0070696_100178864 3300005546 Bacteria 1572
111 Ga0070693_100000246 3300005547 Bacteria 25400
112 Ga0070665_100002158 3300005548 Bacteria 21947
113 Ga0070665_100003039 3300005548 Bacteria 18078
114 Ga0070665_100011089 3300005548 Bacteria 9106
115 Ga0070665_100031876 3300005548 Bacteria 5306
116 Ga0070665_100045698 3300005548 Bacteria 4397
117 Ga0070665_100054609 3300005548 Bacteria 4007
118 Ga0070704_100000113 3300005549 Bacteria 28575
119 Ga0068855_100006282 3300005563 Bacteria 14479
120 Ga0068855_100029171 3300005563 Bacteria 6597
121 Ga0068855_100032959 3300005563 Bacteria 6184
122 Ga0070664_100009850 3300005564 Bacteria 7744
123 Ga0070664_100151040 3300005564 Bacteria 2051
124 Ga0068857_100089002 3300005577 Bacteria 2762
125 Ga0068854_100000637 3300005578 Bacteria 20747
126 Ga0068854_100029847 3300005578 Bacteria 3778
127 Ga0068854_100057853 3300005578 Bacteria 2797
128 Ga0068856_100047641 3300005614 Bacteria 4223
129 Ga0070702_100000639 3300005615 Bacteria 12985
130 Ga0070702_100050915 3300005615 Bacteria 2368
131 Ga0068852_100012774 3300005616 Bacteria 6396
132 Ga0068852_100019689 3300005616 Bacteria 5349
133 Ga0068852_100039518 3300005616 Bacteria 3972
134 Ga0068852_100058283 3300005616 Bacteria 3345
135 Ga0068859_100000291 3300005617 Bacteria 49882
136 Ga0068859_100000301 3300005617 Bacteria 49173
137 Ga0068859_100003956 3300005617 Bacteria 15123
138 Ga0068859_100004810 3300005617 Bacteria 13749
139 Ga0068859_100013254 3300005617 Bacteria 8273
140 Ga0068859_100015017 3300005617 Bacteria 7774
141 Ga0068859_100045625 3300005617 Bacteria 4402
142 Ga0068864_100001934 3300005618 Bacteria 17015
143 Ga0068864_100109298 3300005618 Bacteria 2461
144 Ga0068864_100261526 3300005618 Bacteria 1610
145 Ga0068866_10000435 3300005718 Bacteria 19346
146 Ga0068866_10007493 3300005718 Bacteria 4570
147 Ga0068861_100002086 3300005719 Bacteria 12955
148 Ga0068861_100018749 3300005719 Bacteria 4932
149 Ga0068861_100042769 3300005719 Bacteria 3397
150 Ga0068861_100090221 3300005719 Bacteria 2417
151 Ga0068863_100000163 3300005841 Bacteria 71286
152 Ga0068863_100000179 3300005841 Bacteria 67666
153 Ga0068863_100000580 3300005841 Bacteria 37264
154 Ga0068863_100001505 3300005841 Bacteria 23071
155 Ga0068863_100006453 3300005841 Bacteria 11503
156 Ga0068863_100057846 3300005841 Bacteria 3669
157 Ga0068863_100089506 3300005841 Bacteria 2919
158 Ga0068858_100000010 3300005842 Bacteria 234748
159 Ga0068858_100000071 3300005842 Bacteria 105192
160 Ga0068858_100000362 3300005842 Bacteria 47914
161 Ga0068858_100009793 3300005842 Bacteria 9122
162 Ga0068858_100020931 3300005842 Bacteria 6112
163 Ga0068858_100053123 3300005842 Bacteria 3749
164 Ga0068858_100099585 3300005842 Bacteria 2710
165 Ga0068858_100288793 3300005842 Bacteria 1563
166 Ga0068860_100000020 3300005843 Bacteria 283324
167 Ga0068860_100000345 3300005843 Bacteria 62383
168 Ga0068860_100016544 3300005843 Bacteria 7193
169 Ga0068860_100052772 3300005843 Bacteria 3866
170 Ga0068860_100060595 3300005843 Bacteria 3597
171 Ga0068862_100000013 3300005844 Bacteria 263115
172 Ga0068862_100000049 3300005844 Bacteria 149792
173 Ga0068862_100005089 3300005844 Bacteria 11065
174 Ga0068862_100057251 3300005844 Bacteria 3342
175 Ga0068862_100255275 3300005844 Bacteria 1599
176 Ga0081455_10000288 3300005937 Bacteria 66686
177 Ga0081455_10000436 3300005937 Bacteria 54915
178 Ga0081455_10009880 3300005937 Bacteria 9763
179 Ga0081455_10010864 3300005937 Bacteria 9189
180 Ga0081455_10039401 3300005937 Bacteria 4176
181 Ga0081538_10005232 3300005981 Bacteria 11726
182 Ga0081540_1000602 3300005983 Bacteria 34290
183 Ga0081540_1000710 3300005983 Bacteria 30907
184 Ga0081540_1051424 3300005983 Bacteria 2037
185 Ga0081539_10000094 3300005985 Bacteria 206102
186 Ga0081539_10000882 3300005985 Bacteria 57376
187 Ga0070717_10001308 3300006028 Bacteria 17047
188 Ga0070717_10072787 3300006028 Bacteria 2870
189 Ga0075365_10019566 3300006038 Bacteria 4182
190 Ga0075365_10023310 3300006038 Bacteria 3892
191 Ga0075365_10028336 3300006038 Bacteria 3572
192 Ga0075363_100000409 3300006048 Bacteria 13240
193 Ga0075363_100004494 3300006048 Bacteria 6113
194 Ga0075363_100014025 3300006048 Bacteria 3903
195 Ga0075363_100014723 3300006048 Bacteria 3830
196 Ga0075363_100073713 3300006048 Bacteria 1858
197 Ga0075364_10001494 3300006051 Bacteria 12733
198 Ga0075364_10006497 3300006051 Bacteria 6873
199 Ga0075364_10010332 3300006051 Bacteria 5634
200 Ga0075364_10017355 3300006051 Bacteria 4495
201 Ga0075432_10010849 3300006058 Bacteria 3096
202 Ga0070716_100001095 3300006173 Bacteria 11898
203 Ga0070716_100105017 3300006173 Bacteria 1740
204 Ga0070712_100003765 3300006175 Bacteria 9344
205 Ga0070712_100005974 3300006175 Bacteria 7527
206 Ga0075369_10004499 3300006186 Bacteria 5155
207 Ga0075369_10024999 3300006186 Bacteria 2480
208 Ga0075369_10034936 3300006186 Bacteria 2135
209 Ga0075366_10147537 3300006195 Bacteria 1424
210 Ga0097621_100009134 3300006237 Bacteria 7184
211 Ga0097621_100025930 3300006237 Bacteria 4592
212 Ga0075370_10022693 3300006353 Bacteria 3449
213 Ga0075370_10027158 3300006353 Bacteria 3175
214 Ga0075370_10031037 3300006353 Bacteria 2983
215 Ga0075428_100001458 3300006844 Bacteria 25308
216 Ga0075428_100161048 3300006844 Bacteria 2436
217 Ga0075428_100189572 3300006844 Bacteria 2224
218 Ga0075430_100005427 3300006846 Bacteria 10772
219 Ga0075430_100022533 3300006846 Bacteria 5360
220 Ga0075431_100074231 3300006847 Bacteria 3509
221 Ga0075433_10106885 3300006852 Bacteria 2481
222 Ga0075434_100015313 3300006871 Bacteria 7350
223 Ga0075434_100019371 3300006871 Bacteria 6585
224 Ga0075429_100033163 3300006880 Bacteria 4486
225 Ga0075429_100121583 3300006880 Bacteria 2282
226 Ga0068865_100006274 3300006881 Bacteria 7238
227 Ga0068865_100069746 3300006881 Bacteria 2488
228 Ga0075436_100007851 3300006914 Bacteria 7300
229 Ga0075436_100072828 3300006914 Bacteria 2377
230 Ga0097620_100000291 3300006931 Bacteria 49882
231 Ga0097620_100000301 3300006931 Bacteria 49173
232 Ga0097620_100003956 3300006931 Bacteria 15123
233 Ga0097620_100004810 3300006931 Bacteria 13749
234 Ga0097620_100013254 3300006931 Bacteria 8273
235 Ga0097620_100015017 3300006931 Bacteria 7774
236 Ga0097620_100045625 3300006931 Bacteria 4402
237 Ga0075435_100002890 3300007076 Bacteria 11524
238 Ga0075435_100007664 3300007076 Bacteria 7710
239 Ga0099795_10040891 3300007788 Bacteria 1649
240 Ga0105250_10049852 3300009092 Bacteria 1680
241 Ga0105240_10119840 3300009093 Bacteria 3169
242 Ga0105240_10122665 3300009093 Bacteria 3127
243 Ga0105240_10236659 3300009093 Bacteria 2119
244 Ga0111539_10000482 3300009094 Bacteria 50429
245 Ga0111539_10004560 3300009094 Bacteria 18110
246 Ga0111539_10387616 3300009094 Bacteria 1627
247 Ga0105245_10001247 3300009098 Bacteria 22970
248 Ga0105245_10080568 3300009098 Bacteria 2975
249 Ga0105245_10090761 3300009098 Bacteria 2811
250 Ga0105245_10217265 3300009098 Bacteria 1843
251 Ga0105247_10000009 3300009101 Bacteria 385991
252 Ga0105247_10000111 3300009101 Bacteria 83418
253 Ga0105247_10000834 3300009101 Bacteria 23420
254 Ga0105247_10002038 3300009101 Bacteria 13982
255 Ga0105247_10007205 3300009101 Bacteria 6826
256 Ga0114129_10000114 3300009147 Bacteria 80730
257 Ga0114129_10000585 3300009147 Bacteria 44984
258 Ga0114129_10021079 3300009147 Bacteria 9254
259 Ga0114129_10054519 3300009147 Bacteria 5605
260 Ga0114129_10230478 3300009147 Bacteria 2494
261 Ga0114129_10363980 3300009147 Bacteria 1913
262 Ga0105243_10001881 3300009148 Bacteria 17882
263 Ga0105243_10043836 3300009148 Bacteria 3507
264 Ga0105243_10149133 3300009148 Bacteria 2004
265 Ga0105241_10001137 3300009174 Bacteria 20251
266 Ga0105242_10000766 3300009176 Bacteria 24993
267 Ga0105242_10062239 3300009176 Bacteria 3071
268 Ga0105248_10000147 3300009177 Bacteria 81699
269 Ga0105248_10000207 3300009177 Bacteria 67863
270 Ga0105248_10000377 3300009177 Bacteria 52002
271 Ga0105248_10000450 3300009177 Bacteria 46809
272 Ga0105248_10004117 3300009177 Bacteria 16088
273 Ga0105248_10018906 3300009177 Bacteria 7618
274 Ga0105248_10028235 3300009177 Bacteria 6250
275 Ga0105248_10069913 3300009177 Bacteria 3942
276 Ga0105248_10133451 3300009177 Bacteria 2801
277 Ga0105248_10285059 3300009177 Bacteria 1860
278 Ga0105248_10401555 3300009177 Bacteria 1543
279 Ga0105237_10006936 3300009545 Bacteria 12486
280 Ga0105237_10042790 3300009545 Bacteria 4565
281 Ga0105237_10302090 3300009545 Bacteria 1604
282 Ga0105237_10374459 3300009545 Bacteria 1429
283 Ga0105238_10008912 3300009551 Bacteria 10041
284 Ga0105238_10032836 3300009551 Bacteria 5283
285 Ga0105238_10109655 3300009551 Bacteria 2741
286 Ga0105249_10000057 3300009553 Bacteria 159358
287 Ga0105249_10004171 3300009553 Bacteria 12481
288 Ga0105249_10011423 3300009553 Bacteria 7800
289 Ga0105249_10022525 3300009553 Bacteria 5644
290 Ga0105249_10129991 3300009553 Bacteria 2403
291 Ga0105249_10143452 3300009553 Bacteria 2292
292 Ga0105239_10001572 3300010375 Bacteria 30160
293 Ga0105239_10050445 3300010375 Bacteria 4564
294 Ga0105239_10053915 3300010375 Bacteria 4409
295 Ga0105239_10073274 3300010375 Bacteria 3765
296 Ga0105239_10144029 3300010375 Bacteria 2657
297 Ga0105239_10307076 3300010375 Bacteria 1787
298 Ga0105246_10016685 3300011119 Bacteria 4654
299 Ga0105246_10018512 3300011119 Bacteria 4441
300 Ga0157371_10007484 3300013102 Bacteria 8837
301 Ga0157370_10002735 3300013104 Bacteria 21092
302 Ga0157370_10018215 3300013104 Bacteria 7066
303 Ga0157370_10064903 3300013104 Bacteria 3455
304 Ga0157369_10019224 3300013105 Bacteria 7644
305 Ga0157374_10030500 3300013296 Bacteria 4896
306 Ga0157374_10123689 3300013296 Bacteria 2499
307 Ga0157378_10000831 3300013297 Bacteria 28691
308 Ga0157378_10076761 3300013297 Bacteria 3011
309 Ga0163162_10062818 3300013306 Bacteria 3755
310 Ga0163162_10066269 3300013306 Bacteria 3660
311 Ga0163162_10086860 3300013306 Bacteria 3206
312 Ga0157372_10000023 3300013307 Bacteria 198536
313 Ga0157372_10008689 3300013307 Bacteria 10787
314 Ga0157372_10631504 3300013307 Bacteria 1248
315 Ga0157375_10034872 3300013308 Bacteria 4797
316 Ga0157375_10044455 3300013308 Bacteria 4316
317 Ga0163163_10005277 3300014325 Bacteria 11151
318 Ga0163163_10039757 3300014325 Bacteria 4592
319 Ga0163163_10179325 3300014325 Bacteria 2165
320 Ga0157380_10001997 3300014326 Bacteria 13587
321 Ga0157377_10000649 3300014745 Bacteria 14517
322 Ga0157377_10005999 3300014745 Bacteria 5756
323 Ga0157379_10000015 3300014968 Bacteria 104289
324 Ga0157379_10000149 3300014968 Bacteria 51280
325 Ga0157379_10007816 3300014968 Bacteria 9260
326 Ga0157379_10058232 3300014968 Bacteria 3454
327 Ga0157379_10132060 3300014968 Bacteria 2248
328 Ga0157376_10028847 3300014969 Bacteria 4415
329 Ga0163161_10000872 3300017792 Bacteria 23503
330 Ga0163161_10005938 3300017792 Bacteria 8463
331 Ga0197907_10161669 3300020069 Bacteria 2116
332 Ga0206356_10255926 3300020070 Bacteria 1444
333 Ga0206356_10857683 3300020070 Bacteria 1335
334 Ga0206353_11500815 3300020082 Bacteria 3132
335 Ga0154015_1696953 3300020610 Bacteria 1560
336 Ga0213873_10000086 3300021358 Bacteria 19214
337 Ga0213876_10001258 3300021384 Bacteria 15988
338 Ga0213876_10012466 3300021384 Bacteria 4525
339 Ga0213875_10000111 3300021388 Bacteria 92836
340 Ga0213875_10018826 3300021388 Bacteria 3325
341 Ga0224712_10050376 3300022467 Bacteria 1617
342 Ga0224712_10056534 3300022467 Bacteria 1547
343 Ga0209673_1007257 3300025273 Bacteria 5149
344 Ga0209051_1000011 3300025303 Bacteria 610828
345 Ga0209051_1006016 3300025303 Bacteria 6934
346 Ga0209051_1013644 3300025303 Bacteria 3850
347 Ga0209051_1016811 3300025303 Bacteria 3289
348 Ga0207692_10000457 3300025898 Bacteria 14468
349 Ga0207692_10012087 3300025898 Bacteria 3697
350 Ga0207642_10001854 3300025899 Bacteria 6522
351 Ga0207710_10000014 3300025900 Bacteria 408072
352 Ga0207710_10000107 3300025900 Bacteria 105449
353 Ga0207710_10000144 3300025900 Bacteria 82093
354 Ga0207710_10004379 3300025900 Bacteria 6167
355 Ga0207710_10010119 3300025900 Bacteria 3968
356 Ga0207688_10000698 3300025901 Bacteria 16565
357 Ga0207688_10000946 3300025901 Bacteria 14709
358 Ga0207688_10001700 3300025901 Bacteria 11678
359 Ga0207688_10008927 3300025901 Bacteria 5455
360 Ga0207647_10043676 3300025904 Bacteria 2803
361 Ga0207647_10100957 3300025904 Bacteria 1712
362 Ga0207645_10015307 3300025907 Bacteria 5100
363 Ga0207643_10000326 3300025908 Bacteria 32686
364 Ga0207705_10014614 3300025909 Bacteria 5649
365 Ga0207705_10015019 3300025909 Bacteria 5567
366 Ga0207705_10016235 3300025909 Bacteria 5339
367 Ga0207654_10003544 3300025911 Bacteria 7893
368 Ga0207707_10001022 3300025912 Bacteria 26886
369 Ga0207707_10033830 3300025912 Bacteria 4473
370 Ga0207695_10027320 3300025913 Bacteria 6356
371 Ga0207671_10040499 3300025914 Bacteria 3449
372 Ga0207693_10000949 3300025915 Bacteria 25987
373 Ga0207693_10001079 3300025915 Bacteria 24466
374 Ga0207693_10007135 3300025915 Bacteria 9218
375 Ga0207663_10000777 3300025916 Bacteria 14291
376 Ga0207663_10116149 3300025916 Bacteria 1824
377 Ga0207660_10000404 3300025917 Bacteria 28485
378 Ga0207660_10001049 3300025917 Bacteria 18301
379 Ga0207660_10038877 3300025917 Bacteria 3324
380 Ga0207662_10212455 3300025918 Bacteria 1256
381 Ga0207657_10001506 3300025919 Bacteria 24916
382 Ga0207657_10038718 3300025919 Bacteria 4241
383 Ga0207657_10045558 3300025919 Bacteria 3848
384 Ga0207657_10070030 3300025919 Bacteria 2974
385 Ga0207649_10005345 3300025920 Bacteria 6953
386 Ga0207649_10036106 3300025920 Bacteria 2974
387 Ga0207652_10000717 3300025921 Bacteria 32120
388 Ga0207652_10027502 3300025921 Bacteria 4739
389 Ga0207650_10004876 3300025925 Bacteria 9168
390 Ga0207659_10000900 3300025926 Bacteria 17696
391 Ga0207659_10001150 3300025926 Bacteria 15753
392 Ga0207659_10099159 3300025926 Bacteria 2193
393 Ga0207687_10001698 3300025927 Bacteria 15171
394 Ga0207687_10007403 3300025927 Bacteria 7227
395 Ga0207687_10013866 3300025927 Bacteria 5264
396 Ga0207687_10016988 3300025927 Bacteria 4783
397 Ga0207687_10114634 3300025927 Bacteria 2006
398 Ga0207700_10120108 3300025928 Bacteria 2130
399 Ga0207664_10000002 3300025929 Bacteria 657053
400 Ga0207664_10000641 3300025929 Bacteria 24306
401 Ga0207644_10001436 3300025931 Bacteria 15349
402 Ga0207644_10012147 3300025931 Bacteria 5714
403 Ga0207644_10058447 3300025931 Bacteria 2787
404 Ga0207690_10149025 3300025932 Bacteria 1733
405 Ga0207706_10002283 3300025933 Bacteria 18697
406 Ga0207706_10024221 3300025933 Bacteria 5442
407 Ga0207706_10099658 3300025933 Bacteria 2556
408 Ga0207686_10004275 3300025934 Bacteria 7657
409 Ga0207686_10015402 3300025934 Bacteria 4275
410 Ga0207709_10008902 3300025935 Bacteria 5542
411 Ga0207709_10022088 3300025935 Bacteria 3607
412 Ga0207669_10000486 3300025937 Bacteria 17262
413 Ga0207704_10008655 3300025938 Bacteria 4878
414 Ga0207665_10001059 3300025939 Bacteria 18515
415 Ga0207665_10001980 3300025939 Bacteria 13800
416 Ga0207665_10002449 3300025939 Bacteria 12529
417 Ga0207691_10042385 3300025940 Bacteria 4196
418 Ga0207691_10053103 3300025940 Bacteria 3701
419 Ga0207711_10000056 3300025941 Bacteria 135485
420 Ga0207711_10000242 3300025941 Bacteria 58458
421 Ga0207711_10000967 3300025941 Bacteria 27498
422 Ga0207711_10010080 3300025941 Bacteria 7856
423 Ga0207711_10011062 3300025941 Bacteria 7500
424 Ga0207711_10042651 3300025941 Bacteria 3866
425 Ga0207689_10021188 3300025942 Bacteria 5465
426 Ga0207689_10034419 3300025942 Bacteria 4208
427 Ga0207689_10058656 3300025942 Bacteria 3166
428 Ga0207689_10083825 3300025942 Bacteria 2621
429 Ga0207689_10119121 3300025942 Bacteria 2172
430 Ga0207661_10007868 3300025944 Bacteria 7597
431 Ga0207661_10025555 3300025944 Bacteria 4490
432 Ga0207679_10000518 3300025945 Bacteria 26169
433 Ga0207679_10001380 3300025945 Bacteria 15313
434 Ga0207679_10145844 3300025945 Bacteria 1919
435 Ga0207667_10018101 3300025949 Bacteria 7909
436 Ga0207667_10052382 3300025949 Bacteria 4298
437 Ga0207712_10000050 3300025961 Bacteria 159469
438 Ga0207712_10005038 3300025961 Bacteria 8360
439 Ga0207712_10012050 3300025961 Bacteria 5521
440 Ga0207712_10042846 3300025961 Bacteria 3120
441 Ga0207668_10000733 3300025972 Bacteria 20083
442 Ga0207668_10001475 3300025972 Bacteria 13792
443 Ga0207668_10008379 3300025972 Bacteria 6159
444 Ga0207668_10262669 3300025972 Bacteria 1407
445 Ga0207640_10002229 3300025981 Bacteria 10431
446 Ga0207640_10002522 3300025981 Bacteria 9819
447 Ga0207658_10000065 3300025986 Bacteria 117079
448 Ga0207658_10002834 3300025986 Bacteria 12422
449 Ga0207658_10003413 3300025986 Bacteria 11248
450 Ga0207658_10041531 3300025986 Bacteria 3331
451 Ga0207658_10053391 3300025986 Bacteria 2986
452 Ga0207677_10004713 3300026023 Bacteria 7347
453 Ga0207677_10027108 3300026023 Bacteria 3603
454 Ga0207703_10000002 3300026035 Bacteria 600711
455 Ga0207703_10000094 3300026035 Bacteria 104297
456 Ga0207703_10006889 3300026035 Bacteria 9050
457 Ga0207703_10026958 3300026035 Bacteria 4526
458 Ga0207703_10056971 3300026035 Bacteria 3185
459 Ga0207703_10080017 3300026035 Bacteria 2721
460 Ga0207703_10104289 3300026035 Bacteria 2409
461 Ga0207639_10043174 3300026041 Bacteria 3383
462 Ga0207639_10055464 3300026041 Bacteria 3033
463 Ga0207678_10000377 3300026067 Bacteria 40712
464 Ga0207678_10003800 3300026067 Bacteria 13579
465 Ga0207678_10006924 3300026067 Bacteria 10061
466 Ga0207678_10042150 3300026067 Bacteria 3956
467 Ga0207678_10046245 3300026067 Bacteria 3763
468 Ga0207708_10000046 3300026075 Bacteria 116515
469 Ga0207708_10002058 3300026075 Bacteria 14815
470 Ga0207708_10004173 3300026075 Bacteria 10619
471 Ga0207708_10019544 3300026075 Bacteria 5108
472 Ga0207708_10027529 3300026075 Bacteria 4304
473 Ga0207702_10000541 3300026078 Bacteria 42221
474 Ga0207702_10429416 3300026078 Bacteria 1279
475 Ga0207641_10000562 3300026088 Bacteria 41565
476 Ga0207641_10000740 3300026088 Bacteria 35113
477 Ga0207641_10014236 3300026088 Bacteria 6517
478 Ga0207641_10019865 3300026088 Bacteria 5512
479 Ga0207641_10038076 3300026088 Bacteria 4020
480 Ga0207641_10170786 3300026088 Bacteria 1984
481 Ga0207648_10002377 3300026089 Bacteria 20269
482 Ga0207648_10077267 3300026089 Bacteria 2902
483 Ga0207676_10002174 3300026095 Bacteria 14145
484 Ga0207676_10111309 3300026095 Bacteria 2291
485 Ga0207674_10001847 3300026116 Bacteria 26995
486 Ga0207674_10006778 3300026116 Bacteria 13439
487 Ga0207674_10019724 3300026116 Bacteria 7298
488 Ga0207674_10064844 3300026116 Bacteria 3684
489 Ga0207674_10077418 3300026116 Bacteria 3331
490 Ga0207674_10177825 3300026116 Bacteria 2080
491 Ga0207675_100001291 3300026118 Bacteria 25101
492 Ga0207675_100045219 3300026118 Bacteria 4114
493 Ga0207675_100110916 3300026118 Bacteria 2588
494 Ga0207683_10000634 3300026121 Bacteria 32125
495 Ga0207683_10000738 3300026121 Bacteria 29767
496 Ga0207683_10003326 3300026121 Bacteria 14009
497 Ga0207683_10009633 3300026121 Bacteria 8232
498 Ga0207698_10008276 3300026142 Bacteria 6567
499 Ga0207698_10052324 3300026142 Bacteria 3128
500 Ga0207698_10135667 3300026142 Bacteria 2111
501 Ga0207698_10187647 3300026142 Bacteria 1838
502 Ga0207428_10002331 3300027907 Bacteria 19015
503 Ga0207428_10088600 3300027907 Bacteria 2407
504 Ga0268266_10010107 3300028379 Bacteria 8273
505 Ga0268266_10016725 3300028379 Bacteria 6271
506 Ga0268266_10062421 3300028379 Bacteria 3216
507 Ga0268266_10110017 3300028379 Bacteria 2440
508 Ga0268266_10285149 3300028379 Bacteria 1537
509 Ga0268265_10000004 3300028380 Bacteria 648376
510 Ga0268265_10000017 3300028380 Bacteria 293875
511 Ga0268265_10005435 3300028380 Bacteria 8709
512 Ga0268264_10000024 3300028381 Bacteria 470081
513 Ga0268264_10000257 3300028381 Bacteria 96251
514 Ga0268264_10002508 3300028381 Bacteria 16141
515 Ga0268264_10003187 3300028381 Bacteria 14212
516 Ga0268264_10081549 3300028381 Bacteria 2765
517 Ga0265319_1011896 3300028563 Bacteria 3540
518 Ga0265336_10005066 3300028666 Bacteria 4903
519 Ga0307515_10008569 3300028794 Bacteria 19910
520 Ga0307515_10099199 3300028794 Bacteria 3538
521 Ga0307515_10170971 3300028794 Bacteria 2166
522 Ga0265338_10000745 3300028800 Bacteria 55424
523 Ga0307511_10027297 3300030521 Bacteria 5217
524 Ga0307511_10147330 3300030521 Bacteria 1363
525 Ga0307512_10036831 3300030522 Bacteria 4142
526 Ga0316177_1052337 3300030731 Bacteria 3726
527 Ga0314311_1180288 3300030733 Bacteria 4550
528 Ga0265327_10009371 3300031251 Bacteria 7075
529 Ga0307513_10013296 3300031456 Bacteria 10107
530 Ga0307513_10057511 3300031456 Bacteria 4142
531 Ga0307509_10261448 3300031507 Bacteria 1506
532 Ga0307408_100077423 3300031548 Bacteria 2476
533 Ga0307508_10093651 3300031616 Bacteria 2594
534 Ga0316578_10043764 3300031728 Bacteria 2602
535 Ga0307516_10000999 3300031730 Bacteria 39119
536 Ga0307405_10019059 3300031731 Bacteria 3801
537 Ga0307413_10000893 3300031824 Bacteria 10543
538 Ga0307413_10039074 3300031824 Bacteria 2756
539 Ga0307518_10000618 3300031838 Bacteria 26718
540 Ga0307518_10014471 3300031838 Bacteria 5640
541 Ga0307410_10008087 3300031852 Bacteria 5810
542 Ga0307406_10013548 3300031901 Bacteria 4673
543 Ga0307406_10122790 3300031901 Bacteria 1809
544 Ga0307412_10042207 3300031911 Bacteria 2962
545 Ga0307409_100000369 3300031995 Bacteria 18914
546 Ga0307409_100218696 3300031995 Bacteria 1718
547 Ga0307416_100001881 3300032002 Bacteria 11711
548 Ga0307416_100011301 3300032002 Bacteria 5941
549 Ga0307416_100025892 3300032002 Bacteria 4312
550 Ga0307416_100088103 3300032002 Bacteria 2653
551 Ga0307416_100132268 3300032002 Bacteria 2249
552 Ga0307414_10070978 3300032004 Bacteria 2510
553 Ga0307411_10018384 3300032005 Bacteria 4008
554 Ga0307411_10033278 3300032005 Bacteria 3196
555 Ga0307415_100000012 3300032126 Bacteria 84249
556 Ga0307415_100077551 3300032126 Bacteria 2360
557 Ga0307507_10004395 3300033179 Bacteria 25121
558 Ga0307507_10055651 3300033179 Bacteria 3746
559 Ga0307510_10022164 3300033180 Bacteria 7383
560 Ga0373929_0006036 3300035085 Bacteria 2188
561 Ga0373940_0001450 3300035088 Bacteria 4296
562 Ga0373936_0024454 3300035113 Bacteria 2358
563 Ga0373956_0000258 3300035119 Bacteria 21190
564 Ga0373957_0019558 3300035120 Bacteria 2384
565 Ga0373960_0016902 3300035121 Bacteria 1883
566 Ga0373931_0006845 3300035691 Bacteria 5362
567 Ga0373931_0019651 3300035691 Bacteria 3374
568 Ga0373931_0119669 3300035691 Bacteria 1504
569 Ga0373927_0039947 3300035695 Bacteria 3044
570 Ga0373937_0131387 3300036401 Bacteria 2338
571 Ga0373925_0089855 3300037068 Bacteria 2347
572 Ga0373925_0229357 3300037068 Bacteria 1484
573 Ga0395900_0048293 3300037418 Bacteria 4384
574 Ga0395898_0026569 3300037466 Bacteria 5822
575 Ga0395905_0020862 3300037471 Bacteria 6204
576 Ga0436364_0155073 3300037853 Bacteria 2064
577 Ga0436364_0284917 3300037853 Bacteria 21290
578 Ga0436364_0296067 3300037853 Bacteria 138817
579 Ga0436364_1031907 3300037853 Bacteria 102112
580 Ga0436364_1038490 3300037853 Bacteria 8940
581 Ga0436364_1406310 3300037853 Bacteria 13026
582 Ga0436364_1554479 3300037853 Bacteria 21396
583 Ga0395901_0028510 3300038443 Bacteria 5741
584 Ga0395901_0147327 3300038443 Bacteria 2474
585 Ga0436365_1354167 3300039437 Bacteria 9239
586 Ga0436365_1453781 3300039437 Bacteria 4885
587 Ga0436365_1605762 3300039437 Bacteria 5318
588 Ga0436365_1607916 3300039437 Bacteria 4808
589 Ga0436365_1889369 3300039437 Bacteria 169293
590 Ga0436363_0578534 3300039450 Bacteria 3342
591 Ga0436363_1446743 3300039450 Bacteria 1534
592 Ga0436362_0218630 3300039453 Bacteria 40774
593 Ga0439465_0018051 3300041413 Bacteria 2204
594 Ga0451789_0707078 3300041443 Bacteria 1911
595 Ga0451853_3429478 3300041512 Bacteria 5980
596 Ga0439445_0004151 3300042004 Bacteria 3273
597 Ga0439448_0028867 3300042005 Bacteria 1754
598 Ga0439463_001998 3300042016 Bacteria 5304
599 Ga0439434_0002590 3300042435 Bacteria 5265
600 Ga0439435_0003483 3300042436 Bacteria 3280
601 Ga0451577_0300822 3300042876 Bacteria 1454
602 Ga0466969_0002252 3300044656 Bacteria 10314
603 Ga0466969_0003530 3300044656 Bacteria 8315
604 Ga0466972_0002059 3300044658 Bacteria 9850
605 Ga0466972_0002859 3300044658 Bacteria 8548
606 Ga0466972_0015337 3300044658 Bacteria 3830
607 Ga0466972_0036989 3300044658 Bacteria 2386
608 Ga0466965_0003251 3300044683 Bacteria 7106
609 Ga0466965_0006273 3300044683 Bacteria 5383
610 Ga0466965_0025222 3300044683 Bacteria 2878
611 Ga0466965_0026947 3300044683 Bacteria 2787
612 Ga0466966_0002064 3300044684 Bacteria 13030
613 Ga0466966_0002131 3300044684 Bacteria 12832
614 Ga0466966_0018665 3300044684 Bacteria 4571
615 Ga0466966_0033312 3300044684 Bacteria 3336
616 Ga0466966_0046838 3300044684 Bacteria 2759
617 Ga0466966_0058740 3300044684 Bacteria 2430
618 Ga0466961_0001303 3300044693 Bacteria 15391
619 Ga0466961_0018032 3300044693 Bacteria 4539
620 Ga0466961_0039915 3300044693 Bacteria 3009
621 Ga0466961_0050049 3300044693 Bacteria 2669
622 Ga0466961_0069587 3300044693 Bacteria 2234
623 Ga0466961_0117862 3300044693 Bacteria 1668
624 Ga0466963_0000288 3300044694 Bacteria 22679
625 Ga0466963_0002774 3300044694 Bacteria 9872
626 Ga0466963_0004890 3300044694 Bacteria 7812
627 Ga0466963_0011650 3300044694 Bacteria 5357
628 Ga0466963_0026683 3300044694 Bacteria 3695
629 Ga0466963_0066325 3300044694 Bacteria 2421
630 Ga0466963_0187237 3300044694 Bacteria 1446
631 Ga0466964_0033655 3300044706 Bacteria 2042
632 Ga0466971_0004672 3300044719 Bacteria 5918
633 Ga0466971_0005045 3300044719 Bacteria 5715
634 Ga0466968_0001581 3300044735 Bacteria 8203
635 Ga0466968_0024051 3300044735 Bacteria 2487
636 Ga0466970_0036670 3300044765 Bacteria 2598
637 Ga0466957_0001403 3300044842 Bacteria 12553
638 Ga0466957_0006143 3300044842 Bacteria 6779
639 Ga0466957_0027046 3300044842 Bacteria 3407
640 Ga0466957_0061434 3300044842 Bacteria 2306
641 Ga0466957_0080003 3300044842 Bacteria 2034
642 Ga0466957_0300468 3300044842 Bacteria 1078
643 Ga0466960_0001002 3300044901 Bacteria 10082
644 Ga0466960_0001087 3300044901 Bacteria 9771
645 Ga0466960_0002372 3300044901 Bacteria 7089
646 Ga0466959_0000897 3300045049 Bacteria 17554
647 Ga0466959_0001476 3300045049 Bacteria 14417
648 Ga0466959_0001547 3300045049 Bacteria 14146
649 Ga0466959_0017877 3300045049 Bacteria 5200
650 Ga0466959_0027589 3300045049 Bacteria 4210
651 Ga0466959_0037300 3300045049 Bacteria 3591
652 Ga0466959_0068273 3300045049 Bacteria 2576
653 Ga0466959_0129690 3300045049 Bacteria 1787
654 Ga0466958_0005151 3300045836 Bacteria 6988
655 Ga0466958_0006888 3300045836 Bacteria 6215
656 Ga0466958_0039394 3300045836 Bacteria 2839
657 Ga0466958_0040735 3300045836 Bacteria 2792
658 Ga0466958_0041381 3300045836 Bacteria 2771
659 Ga0466958_0050560 3300045836 Bacteria 2516
660 Ga0466958_0110713 3300045836 Bacteria 1714
661 Ga0466967_0003546 3300045976 Bacteria 10219
662 Ga0466967_0011765 3300045976 Bacteria 6653
663 Ga0466967_0011960 3300045976 Bacteria 6613
664 Ga0466967_0016973 3300045976 Bacteria 5759
665 Ga0466967_0026318 3300045976 Bacteria 4817
666 Ga0466967_0036386 3300045976 Bacteria 4202
667 Ga0466967_0036918 3300045976 Bacteria 4176
668 Ga0466967_0041552 3300045976 Bacteria 3966
669 Ga0466967_0051161 3300045976 Bacteria 3619
670 Ga0466967_0076612 3300045976 Bacteria 3009
671 Ga0466967_0121806 3300045976 Bacteria 2411
672 Ga0466967_0178777 3300045976 Bacteria 2000
673 Ga0466967_0182264 3300045976 Bacteria 1981
674 Ga0466967_0186768 3300045976 Bacteria 1957
675 Ga0466967_0188129 3300045976 Bacteria 1950
676 Ga0466967_0341518 3300045976 Bacteria 1448
677 Ga0495603_0107818 3300046455 Bacteria 1625
678 Ga0495629_0185365 3300046459 Bacteria 1441
679 Ga0495638_0000563 3300046460 Bacteria 42248
680 Ga0495638_0058022 3300046460 Bacteria 2399
681 Ga0495641_0041725 3300046461 Bacteria 2130
682 Ga0495653_0108174 3300046463 Bacteria 2002
683 Ga0495650_0027022 3300046471 Bacteria 2659
684 Ga0495582_0120994 3300046473 Bacteria 1475
685 Ga0495639_0020463 3300046475 Bacteria 2892
686 Ga0495662_0052534 3300046476 Bacteria 1967
687 Ga0495662_0068307 3300046476 Bacteria 1721
688 Ga0495664_0089469 3300046477 Bacteria 1850
689 Ga0495594_0002125 3300046499 Bacteria 10318
690 Ga0495594_0016140 3300046499 Bacteria 3931
691 Ga0495594_0029099 3300046499 Bacteria 2985
692 Ga0495594_0125002 3300046499 Bacteria 1455
693 Ga0495606_0002365 3300046507 Bacteria 22146
694 Ga0495648_0004975 3300046524 Bacteria 11167
695 Ga0495648_0014101 3300046524 Bacteria 5871
696 Ga0495652_0102062 3300046529 Bacteria 2324
697 Ga0495665_0020854 3300046531 Bacteria 3520
698 Ga0495665_0059379 3300046531 Bacteria 2018
699 Ga0495640_0073786 3300046533 Bacteria 2283
700 Ga0495640_0082893 3300046533 Bacteria 2128
701 Ga0495667_0158278 3300046559 Bacteria 1457
702 Ga0495656_0054210 3300046615 Bacteria 1725
703 Ga0495668_0000169 3300046616 Bacteria 97150
704 Ga0495634_0116644 3300046642 Bacteria 1712
705 Ga0495625_0002435 3300046660 Bacteria 20135
706 Ga0495635_0107726 3300046663 Bacteria 1903
707 Ga0495635_0126535 3300046663 Bacteria 1742
708 Ga0495588_0035197 3300046674 Bacteria 2537
709 Ga0495669_0005418 3300046684 Bacteria 5324
710 Ga0495613_0054572 3300046689 Bacteria 2937
711 Ga0495624_0105330 3300046690 Bacteria 1735
712 Ga0495604_0069356 3300047317 Bacteria 2672
713 Ga0495674_0052692 3300047319 Bacteria 3579
714 Ga0495674_0125381 3300047319 Bacteria 2167
715 Ga0495672_0023054 3300047320 Bacteria 4036
716 Ga0495672_0083267 3300047320 Bacteria 1777
717 Ga0495672_0103428 3300047320 Bacteria 1541
718 Ga0495676_0045519 3300047321 Bacteria 3571
719 Ga0495680_0028397 3300047322 Bacteria 4586
720 Ga0495680_0141162 3300047322 Bacteria 1762
721 Ga0495683_0066124 3300047323 Bacteria 1782
722 Ga0495673_0001489 3300047469 Bacteria 18531
723 Ga0495686_0005660 3300047472 Bacteria 9780
724 Ga0495593_0031677 3300047673 Bacteria 2886
725 Ga0495626_0000312 3300048091 Bacteria 51412
726 Ga0496100_0000076 3300048903 Bacteria 54910
727 Ga0496100_0001035 3300048903 Bacteria 13427
728 Ga0496100_0001268 3300048903 Bacteria 12329
729 Ga0496100_0002861 3300048903 Bacteria 8840
730 Ga0496100_0023093 3300048903 Bacteria 3773
731 Ga0496101_0000084 3300048904 Bacteria 104071
732 Ga0496101_0000094 3300048904 Bacteria 95577
733 Ga0496101_0024663 3300048904 Bacteria 4165
734 Ga0496101_0054318 3300048904 Bacteria 2892
735 Ga0496101_0062230 3300048904 Bacteria 2713
736 Ga0496101_0124461 3300048904 Bacteria 1952
737 Ga0496102_0000014 3300048905 Bacteria 310241
738 Ga0496102_0000718 3300048905 Bacteria 32794
739 Ga0496102_0000923 3300048905 Bacteria 27676
740 Ga0496102_0001481 3300048905 Bacteria 20733
741 Ga0496102_0002467 3300048905 Bacteria 15780
742 Ga0496102_0003991 3300048905 Bacteria 12497
743 Ga0496102_0008831 3300048905 Bacteria 8645
744 Ga0496102_0012499 3300048905 Bacteria 7350
745 Ga0496102_0016217 3300048905 Bacteria 6511
746 Ga0496102_0174766 3300048905 Bacteria 2022
747 Ga0496102_0269201 3300048905 Bacteria 1606
748 Ga0496102_0430437 3300048905 Bacteria 1239
749 Ga0496103_0000004 3300048906 Bacteria 510080
750 Ga0496103_0000030 3300048906 Bacteria 211729
751 Ga0496103_0000630 3300048906 Bacteria 26992
752 Ga0496103_0001260 3300048906 Bacteria 17289
753 Ga0496103_0033606 3300048906 Bacteria 3133
754 Ga0496103_0105726 3300048906 Bacteria 1785
755 Ga0496103_0143998 3300048906 Bacteria 1525
756 Ga0496104_0002885 3300048907 Bacteria 14814
757 Ga0496104_0004329 3300048907 Bacteria 12358
758 Ga0496104_0005253 3300048907 Bacteria 11319
759 Ga0496104_0210252 3300048907 Bacteria 1857
760 Ga0496104_0244539 3300048907 Bacteria 1707
761 Ga0496105_0001491 3300048908 Bacteria 16529
762 Ga0496105_0012144 3300048908 Bacteria 6820
763 Ga0496105_0016809 3300048908 Bacteria 5849
764 Ga0496105_0058452 3300048908 Bacteria 3183
765 Ga0496105_0122311 3300048908 Bacteria 2145
766 Ga0496105_0394156 3300048908 Bacteria 1100
767 Ga0496106_0002103 3300048909 Bacteria 14917
768 Ga0496106_0002972 3300048909 Bacteria 12619
769 Ga0496106_0012998 3300048909 Bacteria 6142
770 Ga0496106_0044746 3300048909 Bacteria 3324
771 Ga0496107_0000270 3300048910 Bacteria 27582
772 Ga0496107_0001773 3300048910 Bacteria 13595
773 Ga0496107_0002556 3300048910 Bacteria 11864
774 Ga0496107_0028257 3300048910 Bacteria 3985
775 Ga0496107_0044087 3300048910 Bacteria 3206
776 Ga0496107_0127549 3300048910 Bacteria 1877
777 Ga0496107_0151894 3300048910 Bacteria 1713
778 Ga0496108_0001463 3300048911 Bacteria 18677
779 Ga0496108_0002468 3300048911 Bacteria 14806
780 Ga0496108_0004287 3300048911 Bacteria 11482
781 Ga0496108_0006483 3300048911 Bacteria 9493
782 Ga0496108_0032843 3300048911 Bacteria 4310
783 Ga0496109_0000344 3300048912 Bacteria 43282
784 Ga0496109_0010406 3300048912 Bacteria 7944
785 Ga0496109_0017263 3300048912 Bacteria 6323
786 Ga0496109_0054926 3300048912 Bacteria 3633
787 Ga0496110_0014435 3300048913 Bacteria 6559
788 Ga0496110_0037507 3300048913 Bacteria 4213
789 Ga0496110_0093651 3300048913 Bacteria 2689
790 Ga0496110_0115056 3300048913 Bacteria 2421
791 Ga0496110_0172554 3300048913 Bacteria 1962
792 Ga0496111_0001016 3300048914 Bacteria 15409
793 Ga0496111_0015472 3300048914 Bacteria 5238
794 Ga0496111_0027683 3300048914 Bacteria 4013
795 Ga0496111_0096564 3300048914 Bacteria 2169
796 Ga0496111_0140049 3300048914 Bacteria 1792
797 Ga0496112_0007119 3300048915 Bacteria 9895
798 Ga0496112_0032493 3300048915 Bacteria 5068
799 Ga0496112_0036248 3300048915 Bacteria 4811
800 Ga0496112_0040073 3300048915 Bacteria 4579
801 Ga0496112_0088623 3300048915 Bacteria 3062
802 Ga0496112_0095801 3300048915 Bacteria 2938
803 Ga0496112_0096870 3300048915 Bacteria 2920
804 Ga0496112_0203459 3300048915 Bacteria 1938
805 Ga0496112_0261377 3300048915 Bacteria 1680
806 Ga0496113_0014747 3300048916 Bacteria 5345
807 Ga0496113_0017750 3300048916 Bacteria 4947
808 Ga0496114_0000842 3300048917 Bacteria 22978
809 Ga0496114_0001102 3300048917 Bacteria 20408
810 Ga0496114_0029191 3300048917 Bacteria 4531
811 Ga0496114_0127872 3300048917 Bacteria 2192
812 Ga0496114_0149915 3300048917 Bacteria 2023
813 Ga0496115_0007651 3300048918 Bacteria 7961
814 Ga0496115_0018123 3300048918 Bacteria 5398
815 Ga0496115_0079646 3300048918 Bacteria 2666
816 Ga0496115_0147233 3300048918 Bacteria 1944
817 Ga0496115_0234302 3300048918 Bacteria 1513
818 Ga0496116_0000069 3300048919 Bacteria 252643
819 Ga0496116_0000578 3300048919 Bacteria 48938
820 Ga0496116_0002811 3300048919 Bacteria 17874
821 Ga0496117_0000003 3300048920 Bacteria 1881097
822 Ga0496117_0001462 3300048920 Bacteria 34041
823 Ga0496117_0019905 3300048920 Bacteria 5491
824 Ga0496117_0021310 3300048920 Bacteria 5248
825 Ga0496117_0028936 3300048920 Bacteria 4281
826 Ga0496118_0000001 3300048921 Bacteria 1881100
827 Ga0496118_0000236 3300048921 Bacteria 97321
828 Ga0496118_0002249 3300048921 Bacteria 26504
829 Ga0496118_0012121 3300048921 Bacteria 8321
830 Ga0496118_0086760 3300048921 Bacteria 2173
831 Ga0496119_0000549 3300048922 Bacteria 51126
832 Ga0496119_0000803 3300048922 Bacteria 42034
833 Ga0496119_0003615 3300048922 Bacteria 15913
834 Ga0496119_0005467 3300048922 Bacteria 12159
835 Ga0496119_0007110 3300048922 Bacteria 10173
836 Ga0496119_0008226 3300048922 Bacteria 9220
837 Ga0496120_0000085 3300048923 Bacteria 155343
838 Ga0496120_0000250 3300048923 Bacteria 90632
839 Ga0496120_0004382 3300048923 Bacteria 11881
840 Ga0496120_0018927 3300048923 Bacteria 4422
841 Ga0496120_0044947 3300048923 Bacteria 2562
842 Ga0496121_0000016 3300048924 Bacteria 562911
843 Ga0496121_0000032 3300048924 Bacteria 378997
844 Ga0496121_0002393 3300048924 Bacteria 28754
845 Ga0496121_0032516 3300048924 Bacteria 4740
846 Ga0496121_0058018 3300048924 Bacteria 3204
847 Ga0496122_0000526 3300048925 Bacteria 79269
848 Ga0496123_0004458 3300048926 Bacteria 14696
849 Ga0496123_0050772 3300048926 Bacteria 2768
850 Ga0496124_0000015 3300048927 Bacteria 460700
851 Ga0496125_0000021 3300048928 Bacteria 460688
852 Ga0496126_0000015 3300048929 Bacteria 663212
853 Ga0496126_0000035 3300048929 Bacteria 361590
854 Ga0496126_0000067 3300048929 Bacteria 249091
855 Ga0496126_0000208 3300048929 Bacteria 131604
856 Ga0496126_0005873 3300048929 Bacteria 13845
857 Ga0496126_0037045 3300048929 Bacteria 4555
858 Ga0496126_0058610 3300048929 Bacteria 3470
859 Ga0496126_0087310 3300048929 Bacteria 2748
860 Ga0501032_0000706 3300049569 Bacteria 27189
861 Ga0501032_0006930 3300049569 Bacteria 8308
862 Ga0501032_0012122 3300049569 Bacteria 6171
863 Ga0501033_0009060 3300049570 Bacteria 7678
864 Ga0501033_0037516 3300049570 Bacteria 3627
865 Ga0501034_0005030 3300049571 Bacteria 14530
866 Ga0501034_0013263 3300049571 Bacteria 8490
867 Ga0501034_0037652 3300049571 Bacteria 4899
868 Ga0501034_0076278 3300049571 Bacteria 3359
869 Ga0501034_0088737 3300049571 Bacteria 3090
870 Ga0501036_0038851 3300049572 Bacteria 4029
871 Ga0501036_0144342 3300049572 Bacteria 2008
872 Ga0501037_0001277 3300049573 Bacteria 18552
873 Ga0501037_0001845 3300049573 Bacteria 15371
874 Ga0501037_0054026 3300049573 Bacteria 2938
875 Ga0501038_0000620 3300049574 Bacteria 31614
876 Ga0501038_0013687 3300049574 Bacteria 7393
877 Ga0501038_0014050 3300049574 Bacteria 7296
878 Ga0501039_0000909 3300049575 Bacteria 21583
879 Ga0501039_0022360 3300049575 Bacteria 4854
880 Ga0501039_0178776 3300049575 Bacteria 1669
881 Ga0501040_0042780 3300049576 Bacteria 3086
882 Ga0501041_0029441 3300049577 Bacteria 3312
883 Ga0501041_0122404 3300049577 Bacteria 1617
884 Ga0501042_0019941 3300049578 Bacteria 4663
885 Ga0501042_0025668 3300049578 Bacteria 4140
886 Ga0501043_0001657 3300049579 Bacteria 19328
887 Ga0501043_0041148 3300049579 Bacteria 3631
888 Ga0501043_0222802 3300049579 Bacteria 1458
889 Ga0501046_0019678 3300049580 Bacteria 5594
890 Ga0501047_0004744 3300049581 Bacteria 12783
891 Ga0501047_0006713 3300049581 Bacteria 10820
892 Ga0501047_0010437 3300049581 Bacteria 8790
893 Ga0501047_0068897 3300049581 Bacteria 3407
894 Ga0501048_0008553 3300049582 Bacteria 7731
895 Ga0501048_0008968 3300049582 Bacteria 7530
896 Ga0501048_0051146 3300049582 Bacteria 2942
897 Ga0501068_0181903 3300049584 Bacteria 1329
898 Ga0501069_0178003 3300049585 Bacteria 1229
899 Ga0501070_0000213 3300049586 Bacteria 55004
900 Ga0501070_0000386 3300049586 Bacteria 40434
901 Ga0501071_0001758 3300049587 Bacteria 12768
902 Ga0501071_0111275 3300049587 Bacteria 2024
903 Ga0501072_0011692 3300049588 Bacteria 6707
904 Ga0501074_0002345 3300049590 Bacteria 13178
905 Ga0501074_0090606 3300049590 Bacteria 2190
906 Ga0501077_0063682 3300049593 Bacteria 2339
907 Ga0501077_0101867 3300049593 Bacteria 1820
908 Ga0501081_0028586 3300049743 Bacteria 3763
909 Ga0501035_0000340 3300049822 Bacteria 54226
910 Ga0501035_0008647 3300049822 Bacteria 9478
911 Ga0501044_0000380 3300049823 Bacteria 55272
912 Ga0501044_0028696 3300049823 Bacteria 5871
913 Ga0501044_0082871 3300049823 Bacteria 3244
914 Ga0501044_0104258 3300049823 Bacteria 2850
915 Ga0501044_0213532 3300049823 Bacteria 1883
916 Ga0501045_0007214 3300049824 Bacteria 7714
917 Ga0501045_0050949 3300049824 Bacteria 3021
918 nmdc:mga03n38_1427_c1 3300050490 Bacteria 6826
919 nmdc:mga03n38_1511_c1 3300050490 Bacteria 6716
920 nmdc:mga00v17_1138_c1 3300050491 Bacteria 13972
921 nmdc:mga00v17_44455_c1 3300050491 Bacteria 2678
922 nmdc:mga00v17_60940_c1 3300050491 Bacteria 2319
923 nmdc:mga00v17_6740_c1 3300050491 Bacteria 6102
924 nmdc:mga00v17_8771_c1 3300050491 Bacteria 5445
925 nmdc:mga00v17_96380_c1 3300050491 Bacteria 1863
926 nmdc:mga0yw44_24337_c1 3300050492 Bacteria 3425
927 nmdc:mga0yw44_780_c1 3300050492 Bacteria 11811
928 nmdc:mga07m45_13392_c1 3300050496 Bacteria 4351
929 nmdc:mga07m45_21555_c1 3300050496 Bacteria 3509
930 nmdc:mga07m45_27168_c1 3300050496 Bacteria 3150
931 nmdc:mga07m45_337_c1 3300050496 Bacteria 19051
932 nmdc:mga07m45_84550_c1 3300050496 Bacteria 1814
933 nmdc:mga05p37_16765_c1 3300050507 Bacteria 8832
934 nmdc:mga05p37_181377_c1 3300050507 Bacteria 2561
935 nmdc:mga05p37_26114_c1 3300050507 Bacteria 7102
936 nmdc:mga05p37_9074_c1 3300050507 Bacteria 11755
937 nmdc:mga09592_16810_c1 3300050508 Bacteria 5988
938 nmdc:mga09592_62_c1 3300050508 Bacteria 60818
939 nmdc:mga0qj67_10555_c1 3300050509 Bacteria 6899
940 nmdc:mga0qj67_106_c2 3300050509 Bacteria 34014
941 nmdc:mga0qj67_13793_c1 3300050509 Bacteria 6098
942 nmdc:mga0qj67_21963_c1 3300050509 Bacteria 4897
943 nmdc:mga06r32_1375_c1 3300050510 Bacteria 21993
944 nmdc:mga06r32_25_c7 3300050510 Bacteria 11552
945 nmdc:mga06r32_77325_c1 3300050510 Bacteria 3233
946 nmdc:mga06r32_9570_c1 3300050510 Bacteria 8752
947 nmdc:mga08y16_19132_c1 3300050511 Bacteria 7216
948 nmdc:mga08y16_309796_c1 3300050511 Bacteria 1626
949 nmdc:mga0n895_119551_c1 3300050512 Bacteria 2656
950 nmdc:mga0n895_3029_c1 3300050512 Bacteria 13368
951 nmdc:mga08x19_8640_c1 3300050514 Bacteria 6071
952 nmdc:mga0a205_10838_c1 3300050515 Bacteria 8386
953 nmdc:mga0a205_70823_c1 3300050515 Bacteria 3367
954 nmdc:mga0sz30_3286_c1 3300050516 Bacteria 5813
955 nmdc:mga0sz30_36543_c1 3300050516 Bacteria 2053
956 nmdc:mga0sz30_927_c1 3300050516 Bacteria 10562
957 Ga0495601_0015871 3300053077 Bacteria 4558
958 Ga0500635_0003696 3300053080 Bacteria 3871
959 Ga0495595_0090115 3300053084 Bacteria 1470
960 Ga0495619_0225913 3300053085 Bacteria 1297
961 Ga0500643_000240 3300053087 Bacteria 50980
962 Ga0500643_003897 3300053087 Bacteria 6930
963 Ga0500644_0008807 3300053088 Bacteria 2676
964 Ga0500646_0003381 3300053090 Bacteria 4095
965 Ga0500583_0083104 3300053092 Bacteria 1550
966 Ga0500562_004337 3300053108 Bacteria 3589
967 Ga0500652_000479 3300053131 Bacteria 14179
968 Ga0500652_035905 3300053131 Bacteria 1971
969 Ga0500588_0000341 3300053146 Bacteria 7098
970 Ga0500616_0007655 3300053153 Bacteria 6823
971 Ga0500645_000123 3300053730 Bacteria 61404
972 Ga0500645_009049 3300053730 Bacteria 3363
973 Ga0501084_0202597 3300054114 Bacteria 1674
974 Ga0501082_0143043 3300060353 Bacteria 2076
975 Ga0466962_0010071 3300061719 Bacteria 4536
976 Ga0466962_0022948 3300061719 Bacteria 2999
977 Ga0530510_0103344 3300061734 Bacteria 2084
978 Ga0530510_0168046 3300061734 Bacteria 1624
979 2501941842 2501939600 Bacteria 6907073
980 2506865430 2506783011 Bacteria 5323186
981 2508672362 2508501039 Bacteria 9978592
982 2515493923 2515154088 Bacteria 5526283
983 2515720617 2515154129 Bacteria 5584369
984 2515755299 2515154137 Bacteria 5711575
985 2516086759 2515154202 Bacteria 5471270
986 2516092345 2515154203 Bacteria 5458536
987 2517760699 2517572101 Bacteria 6884336
988 2523384642 2523231044 Bacteria 6434991
989 2528204833 2527291627 Bacteria 5309833
990 2528216273 2527291629 Bacteria 5267418
991 2546950180 2546825537 Bacteria 5389291
992 2558909285 2558860112 Bacteria 9931328
993 2559426958 2558860280 Bacteria 11429938
994 2579750781 2576861822 Bacteria 5004595
995 2579852809 2579778521 Bacteria 7624758
996 2583151582 2582580736 Bacteria 5325865
997 2586064139 2585427649 Bacteria 9053857
998 2619856604 2619618881 Bacteria 7521104
999 2620348830 2619619003 Bacteria 7619552
1000 2623502299 2622736605 Bacteria 4992138
1001 2623586433 2622736626 Bacteria 7181580
1002 2626636124 2626541554 Bacteria 7741902
1003 2644486648 2643221687 Bacteria 6500351
1004 2644636053 2643221715 Bacteria 6671032
1005 2671840324 2671180195 Bacteria 9757215
1006 2676198229 2675902999 Bacteria 9438463
1007 2676484870 2675903059 Bacteria 8644972
1008 2686537433 2684623035 Bacteria 8032739
1009 2686543239 2684623036 Bacteria 5199090
1010 2689959501 2687453737 Bacteria 11203906
1011 2710606209 2710264753 Bacteria 5455564
1012 2738665279 2738541264 Bacteria 5935393
1013 2738706286 2738541274 Bacteria 6909446
1014 2739144413 2738541356 Bacteria 5935017
1015 2739328775 2738543028 Bacteria 6917070
1016 2753073314 2751185734 Bacteria 8863695
1017 2772641670 2772190715 Bacteria 6959372
1018 2774842807 2773857921 Bacteria 9435764
1019 2774858480 2773857922 Bacteria 9757215
1020 2774865980 2773857924 Bacteria 5256821
1021 2774901233 2773857933 Bacteria 5818019
1022 2791914036 2791354901 Bacteria 8322202
1023 2795791485 2795385472 Bacteria 6627535
1024 2809586616 2808606522 Bacteria 9488490
1025 2816511542 2816332139 Bacteria 9138787
1026 2842138692 2842134933 Bacteria 5847019
1027 2855021844 2855020534 Bacteria 3204685
1028 2855672226 2855670206 Bacteria 7120389
1029 2855678865 2855676851 Bacteria 7063653
1030 2855685291 2855683550 Bacteria 7134265
1031 2856860351 2856858025 Bacteria 7255264
1032 2857295162 2857288857 Bacteria 7189066
1033 2858854533 2858848962 Bacteria 6963058
1034 2858874076 2858868258 Bacteria 7683772
1035 2858888535 2858882152 Bacteria 7230291
1036 2858890759 2858888857 Bacteria 7060307
1037 2858898553 2858895516 Bacteria 7378898
1038 2858905641 2858902515 Bacteria 7086037
1039 2861520750 2861520306 Bacteria 8348283
1040 2866618724 2866612099 Bacteria 7543886
1041 2867303805 2867302475 Bacteria 7087181
1042 2867313357 2867312974 Bacteria 7058875
1043 2867322824 2867319477 Bacteria 7069771
1044 2869054255 2869048445 Bacteria 6875584
1045 2869065822 2869061728 Bacteria 7112407
1046 2869070626 2869068681 Bacteria 7205615
1047 2870729141 2870721527 Bacteria 9689237
1048 2870783488 2870782633 Bacteria 9624083
1049 2880493748 2880489317 Bacteria 7096270
1050 2880498574 2880495981 Bacteria 7340502
1051 2887483707 2887478801 Bacteria 8972725
1052 2891327121 2891326441 Bacteria 6439512
1053 2895882363 2895880812 Bacteria 11255272
1054 2899360234 2899359706 Bacteria 10940472
1055 2899376835 2899370129 Bacteria 6781179
1056 2902586396 2902582711 Bacteria 6187705
1057 2902793196 2902792274 Bacteria 7270173
1058 2902804063 2902799365 Bacteria 5419524
1059 2915772438 2915768154 Bacteria 8424322
1060 2917737472 2917736166 Bacteria 9690793
1061 2917738066 2917736166 Bacteria 9690793
1062 2929214578 2929212328 Bacteria 7708288
1063 2929220566 2929219909 Bacteria 6984360
1064 2929227153 2929226422 Bacteria 7248583
1065 2939587838 2939582691 Bacteria 7088898
1066 2996224794 2996221748 Bacteria 6799777
1067 3003008800 3002998708 Bacteria 11715108
1068 637879500 637000116 Bacteria 5433628
1069 649811090 649633069 Bacteria 6962533
1070 8001782513 8001781756 Bacteria 9586736
1071 8002782596 8002775197 Bacteria 10728764
1072 8002789205 8002784119 Bacteria 9788632
1073 8003320399 8003314358 Bacteria 10575343
1074 8003835336 8003830390 Bacteria 6541657
1075 8003857203 8003856774 Bacteria 7675274
1076 8003873523 8003870546 Bacteria 7396674
1077 8047715081 8047710418 Bacteria 11023148
1078 8054475476 8054472261 Bacteria 7464355
1079 8054708087 8054704163 Bacteria 7247792
1080 8054730990 8054727385 Bacteria 7558670
1081 8054735121 8054734606 Bacteria 6947278
1082 8054915208 8054913762 Bacteria 7713009
1083 8054918306 8054913762 Bacteria 7713009
1084 8054922262 8054920844 Bacteria 7068637
1085 8055159745 8055157932 Bacteria 6429399
1086 8055414775 8055412473 Bacteria 6257500
1087 8057568883 8057568493 Bacteria 7221719
1088 Ga0157369_10014338
1089 LJQas_1002727
1090 JGI24739J22299_10039237
1091 JGI24737J22298_10025874
1092 JGI24743J22301_10001350
1093 JGI24735J21928_10007384
1094 JGI24744J21845_10002473
1095 JGI24033J26618_1005562
1096 JGI24034J26672_10001418
1097 JGI24742J22300_10000583
1098 JGI25406J46586_10002477
1099 JGI25406J46586_10024529
1100 Ga0055540_1000003
1101 Ga0055540_1000261
1102 Ga0055540_1002970
1103 Ga0055540_1016606
1104 JGI25405J52794_10009820
1105 Ga0070658_10001192
1106 Ga0070658_10003430
1107 Ga0070676_10021409
1108 Ga0070683_100009730
1109 Ga0070690_100071686
1110 Ga0070670_100001154
1111 Ga0068869_100002993
1112 Ga0068869_100014710
1113 Ga0068869_100108312
1114 Ga0068869_100114859
1115 Ga0070666_10025034
1116 Ga0070680_100000297
1117 Ga0070680_100112545
1118 Ga0070682_100000335
1119 Ga0070682_100054424
1120 Ga0068868_100004268
1121 Ga0068868_100008435
1122 Ga0068868_100008450
1123 Ga0068868_100064065
1124 Ga0070660_100001969
1125 Ga0070660_100085916
1126 Ga0070689_100067656
1127 Ga0070689_100089896
1128 Ga0070691_10003837
1129 Ga0070691_10015402
1130 Ga0070692_10000043
1131 Ga0070668_100001102
1132 Ga0070668_100002458
1133 Ga0070668_100031527
1134 Ga0070668_100194534
1135 Ga0070669_100172314
1136 Ga0070675_100000578
1137 Ga0070675_100005371
1138 Ga0070671_100001349
1139 Ga0070671_100001748
1140 Ga0070674_100021522
1141 Ga0070673_100029092
1142 Ga0070688_100010150
1143 Ga0070659_100048536
1144 Ga0070659_100060152
1145 Ga0070659_100179378
1146 Ga0070667_100000087
1147 Ga0070667_100004630
1148 Ga0070667_100007753
1149 Ga0070667_100038520
1150 Ga0070667_100047658
1151 Ga0070703_10024660
1152 Ga0070709_10061429
1153 Ga0070714_100000057
1154 Ga0070714_100000701
1155 Ga0070714_100198913
1156 Ga0070714_100232497
1157 Ga0070710_10000110
1158 Ga0070710_10002992
1159 Ga0070701_10002400
1160 Ga0070711_100001653
1161 Ga0070711_100002316
1162 Ga0070711_100002351
1163 Ga0070705_100005450
1164 Ga0070700_100000031
1165 Ga0070700_100001352
1166 Ga0070700_100003917
1167 Ga0070700_100005474
1168 Ga0070700_100006150
1169 Ga0070694_100018471
1170 Ga0070663_100001468
1171 Ga0070663_100003006
1172 Ga0070663_100016296
1173 Ga0070663_100048175
1174 Ga0070663_100170063
1175 Ga0070663_100271223
1176 Ga0070678_100000372
1177 Ga0070678_100003411
1178 Ga0070662_100015433
1179 Ga0070681_10001041
1180 Ga0070681_10025473
1181 Ga0070681_10056346
1182 Ga0070685_10177846
1183 Ga0070679_100006559
1184 Ga0070679_100086354
1185 Ga0070684_100010145
1186 Ga0068853_100016915
1187 Ga0068853_100018399
1188 Ga0068853_100073150
1189 Ga0068853_100078561
1190 Ga0070672_100095272
1191 Ga0070672_100141087
1192 Ga0070672_100240741
1193 Ga0070686_100144858
1194 Ga0070695_100127130
1195 Ga0070696_100002982
1196 Ga0070696_100061054
1197 Ga0070696_100178864
1198 Ga0070693_100000246
1199 Ga0070665_100002158
1200 Ga0070665_100003039
1201 Ga0070665_100011089
1202 Ga0070665_100031876
1203 Ga0070665_100045698
1204 Ga0070665_100054609
1205 Ga0070704_100000113
1206 Ga0068855_100006282
1207 Ga0068855_100029171
1208 Ga0068855_100032959
1209 Ga0070664_100009850
1210 Ga0070664_100151040
1211 Ga0068857_100089002
1212 Ga0068854_100000637
1213 Ga0068854_100029847
1214 Ga0068854_100057853
1215 Ga0068856_100047641
1216 Ga0070702_100000639
1217 Ga0070702_100050915
1218 Ga0068852_100012774
1219 Ga0068852_100019689
1220 Ga0068852_100039518
1221 Ga0068852_100058283
1222 Ga0068859_100000291
1223 Ga0068859_100000301
1224 Ga0068859_100003956
1225 Ga0068859_100004810
1226 Ga0068859_100013254
1227 Ga0068859_100015017
1228 Ga0068859_100045625
1229 Ga0068864_100001934
1230 Ga0068864_100109298
1231 Ga0068864_100261526
1232 Ga0068866_10000435
1233 Ga0068866_10007493
1234 Ga0068861_100002086
1235 Ga0068861_100018749
1236 Ga0068861_100042769
1237 Ga0068861_100090221
1238 Ga0068863_100000163
1239 Ga0068863_100000179
1240 Ga0068863_100000580
1241 Ga0068863_100001505
1242 Ga0068863_100006453
1243 Ga0068863_100057846
1244 Ga0068863_100089506
1245 Ga0068858_100000010
1246 Ga0068858_100000071
1247 Ga0068858_100000362
1248 Ga0068858_100009793
1249 Ga0068858_100020931
1250 Ga0068858_100053123
1251 Ga0068858_100099585
1252 Ga0068858_100288793
1253 Ga0068860_100000020
1254 Ga0068860_100000345
1255 Ga0068860_100016544
1256 Ga0068860_100052772
1257 Ga0068860_100060595
1258 Ga0068862_100000013
1259 Ga0068862_100000049
1260 Ga0068862_100005089
1261 Ga0068862_100057251
1262 Ga0068862_100255275
1263 Ga0081455_10000288
1264 Ga0081455_10000436
1265 Ga0081455_10009880
1266 Ga0081455_10010864
1267 Ga0081455_10039401
1268 Ga0081538_10005232
1269 Ga0081540_1000602
1270 Ga0081540_1000710
1271 Ga0081540_1051424
1272 Ga0081539_10000094
1273 Ga0081539_10000882
1274 Ga0070717_10001308
1275 Ga0070717_10072787
1276 Ga0075365_10019566
1277 Ga0075365_10023310
1278 Ga0075365_10028336
1279 Ga0075363_100000409
1280 Ga0075363_100004494
1281 Ga0075363_100014025
1282 Ga0075363_100014723
1283 Ga0075363_100073713
1284 Ga0075364_10001494
1285 Ga0075364_10006497
1286 Ga0075364_10010332
1287 Ga0075364_10017355
1288 Ga0075432_10010849
1289 Ga0070716_100001095
1290 Ga0070716_100105017
1291 Ga0070712_100003765
1292 Ga0070712_100005974
1293 Ga0075369_10004499
1294 Ga0075369_10024999
1295 Ga0075369_10034936
1296 Ga0075366_10147537
1297 Ga0097621_100009134
1298 Ga0097621_100025930
1299 Ga0075370_10022693
1300 Ga0075370_10027158
1301 Ga0075370_10031037
1302 Ga0075428_100001458
1303 Ga0075428_100161048
1304 Ga0075428_100189572
1305 Ga0075430_100005427
1306 Ga0075430_100022533
1307 Ga0075431_100074231
1308 Ga0075433_10106885
1309 Ga0075434_100015313
1310 Ga0075434_100019371
1311 Ga0075429_100033163
1312 Ga0075429_100121583
1313 Ga0068865_100006274
1314 Ga0068865_100069746
1315 Ga0075436_100007851
1316 Ga0075436_100072828
1317 Ga0097620_100000291
1318 Ga0097620_100000301
1319 Ga0097620_100003956
1320 Ga0097620_100004810
1321 Ga0097620_100013254
1322 Ga0097620_100015017
1323 Ga0097620_100045625
1324 Ga0075435_100002890
1325 Ga0075435_100007664
1326 Ga0099795_10040891
1327 Ga0105250_10049852
1328 Ga0105240_10119840
1329 Ga0105240_10122665
1330 Ga0105240_10236659
1331 Ga0111539_10000482
1332 Ga0111539_10004560
1333 Ga0111539_10387616
1334 Ga0105245_10001247
1335 Ga0105245_10080568
1336 Ga0105245_10090761
1337 Ga0105245_10217265
1338 Ga0105247_10000009
1339 Ga0105247_10000111
1340 Ga0105247_10000834
1341 Ga0105247_10002038
1342 Ga0105247_10007205
1343 Ga0114129_10000114
1344 Ga0114129_10000585
1345 Ga0114129_10021079
1346 Ga0114129_10054519
1347 Ga0114129_10230478
1348 Ga0114129_10363980
1349 Ga0105243_10001881
1350 Ga0105243_10043836
1351 Ga0105243_10149133
1352 Ga0105241_10001137
1353 Ga0105242_10000766
1354 Ga0105242_10062239
1355 Ga0105248_10000147
1356 Ga0105248_10000207
1357 Ga0105248_10000377
1358 Ga0105248_10000450
1359 Ga0105248_10004117
1360 Ga0105248_10018906
1361 Ga0105248_10028235
1362 Ga0105248_10069913
1363 Ga0105248_10133451
1364 Ga0105248_10285059
1365 Ga0105248_10401555
1366 Ga0105237_10006936
1367 Ga0105237_10042790
1368 Ga0105237_10302090
1369 Ga0105237_10374459
1370 Ga0105238_10008912
1371 Ga0105238_10032836
1372 Ga0105238_10109655
1373 Ga0105249_10000057
1374 Ga0105249_10004171
1375 Ga0105249_10011423
1376 Ga0105249_10022525
1377 Ga0105249_10129991
1378 Ga0105249_10143452
1379 Ga0105239_10001572
1380 Ga0105239_10050445
1381 Ga0105239_10053915
1382 Ga0105239_10073274
1383 Ga0105239_10144029
1384 Ga0105239_10307076
1385 Ga0105246_10016685
1386 Ga0105246_10018512
1387 Ga0157371_10007484
1388 Ga0157370_10002735
1389 Ga0157370_10018215
1390 Ga0157370_10064903
1391 Ga0157369_10019224
1392 Ga0157374_10030500
1393 Ga0157374_10123689
1394 Ga0157378_10000831
1395 Ga0157378_10076761
1396 Ga0163162_10062818
1397 Ga0163162_10066269
1398 Ga0163162_10086860
1399 Ga0157372_10000023
1400 Ga0157372_10008689
1401 Ga0157372_10631504
1402 Ga0157375_10034872
1403 Ga0157375_10044455
1404 Ga0163163_10005277
1405 Ga0163163_10039757
1406 Ga0163163_10179325
1407 Ga0157380_10001997
1408 Ga0157377_10000649
1409 Ga0157377_10005999
1410 Ga0157379_10000015
1411 Ga0157379_10000149
1412 Ga0157379_10007816
1413 Ga0157379_10058232
1414 Ga0157379_10132060
1415 Ga0157376_10028847
1416 Ga0163161_10000872
1417 Ga0163161_10005938
1418 Ga0197907_10161669
1419 Ga0206356_10255926
1420 Ga0206356_10857683
1421 Ga0206353_11500815
1422 Ga0154015_1696953
1423 Ga0213873_10000086
1424 Ga0213876_10001258
1425 Ga0213876_10012466
1426 Ga0213875_10000111
1427 Ga0213875_10018826
1428 Ga0224712_10050376
1429 Ga0224712_10056534
1430 Ga0209673_1007257
1431 Ga0209051_1000011
1432 Ga0209051_1006016
1433 Ga0209051_1013644
1434 Ga0209051_1016811
1435 Ga0207692_10000457
1436 Ga0207692_10012087
1437 Ga0207642_10001854
1438 Ga0207710_10000014
1439 Ga0207710_10000107
1440 Ga0207710_10000144
1441 Ga0207710_10004379
1442 Ga0207710_10010119
1443 Ga0207688_10000698
1444 Ga0207688_10000946
1445 Ga0207688_10001700
1446 Ga0207688_10008927
1447 Ga0207647_10043676
1448 Ga0207647_10100957
1449 Ga0207645_10015307
1450 Ga0207643_10000326
1451 Ga0207705_10014614
1452 Ga0207705_10015019
1453 Ga0207705_10016235
1454 Ga0207654_10003544
1455 Ga0207707_10001022
1456 Ga0207707_10033830
1457 Ga0207695_10027320
1458 Ga0207671_10040499
1459 Ga0207693_10000949
1460 Ga0207693_10001079
1461 Ga0207693_10007135
1462 Ga0207663_10000777
1463 Ga0207663_10116149
1464 Ga0207660_10000404
1465 Ga0207660_10001049
1466 Ga0207660_10038877
1467 Ga0207662_10212455
1468 Ga0207657_10001506
1469 Ga0207657_10038718
1470 Ga0207657_10045558
1471 Ga0207657_10070030
1472 Ga0207649_10005345
1473 Ga0207649_10036106
1474 Ga0207652_10000717
1475 Ga0207652_10027502
1476 Ga0207650_10004876
1477 Ga0207659_10000900
1478 Ga0207659_10001150
1479 Ga0207659_10099159
1480 Ga0207687_10001698
1481 Ga0207687_10007403
1482 Ga0207687_10013866
1483 Ga0207687_10016988
1484 Ga0207687_10114634
1485 Ga0207700_10120108
1486 Ga0207664_10000002
1487 Ga0207664_10000641
1488 Ga0207644_10001436
1489 Ga0207644_10012147
1490 Ga0207644_10058447
1491 Ga0207690_10149025
1492 Ga0207706_10002283
1493 Ga0207706_10024221
1494 Ga0207706_10099658
1495 Ga0207686_10004275
1496 Ga0207686_10015402
1497 Ga0207709_10008902
1498 Ga0207709_10022088
1499 Ga0207669_10000486
1500 Ga0207704_10008655
1501 Ga0207665_10001059
1502 Ga0207665_10001980
1503 Ga0207665_10002449
1504 Ga0207691_10042385
1505 Ga0207691_10053103
1506 Ga0207711_10000056
1507 Ga0207711_10000242
1508 Ga0207711_10000967
1509 Ga0207711_10010080
1510 Ga0207711_10011062
1511 Ga0207711_10042651
1512 Ga0207689_10021188
1513 Ga0207689_10034419
1514 Ga0207689_10058656
1515 Ga0207689_10083825
1516 Ga0207689_10119121
1517 Ga0207661_10007868
1518 Ga0207661_10025555
1519 Ga0207679_10000518
1520 Ga0207679_10001380
1521 Ga0207679_10145844
1522 Ga0207667_10018101
1523 Ga0207667_10052382
1524 Ga0207712_10000050
1525 Ga0207712_10005038
1526 Ga0207712_10012050
1527 Ga0207712_10042846
1528 Ga0207668_10000733
1529 Ga0207668_10001475
1530 Ga0207668_10008379
1531 Ga0207668_10262669
1532 Ga0207640_10002229
1533 Ga0207640_10002522
1534 Ga0207658_10000065
1535 Ga0207658_10002834
1536 Ga0207658_10003413
1537 Ga0207658_10041531
1538 Ga0207658_10053391
1539 Ga0207677_10004713
1540 Ga0207677_10027108
1541 Ga0207703_10000002
1542 Ga0207703_10000094
1543 Ga0207703_10006889
1544 Ga0207703_10026958
1545 Ga0207703_10056971
1546 Ga0207703_10080017
1547 Ga0207703_10104289
1548 Ga0207639_10043174
1549 Ga0207639_10055464
1550 Ga0207678_10000377
1551 Ga0207678_10003800
1552 Ga0207678_10006924
1553 Ga0207678_10042150
1554 Ga0207678_10046245
1555 Ga0207708_10000046
1556 Ga0207708_10002058
1557 Ga0207708_10004173
1558 Ga0207708_10019544
1559 Ga0207708_10027529
1560 Ga0207702_10000541
1561 Ga0207702_10429416
1562 Ga0207641_10000562
1563 Ga0207641_10000740
1564 Ga0207641_10014236
1565 Ga0207641_10019865
1566 Ga0207641_10038076
1567 Ga0207641_10170786
1568 Ga0207648_10002377
1569 Ga0207648_10077267
1570 Ga0207676_10002174
1571 Ga0207676_10111309
1572 Ga0207674_10001847
1573 Ga0207674_10006778
1574 Ga0207674_10019724
1575 Ga0207674_10064844
1576 Ga0207674_10077418
1577 Ga0207674_10177825
1578 Ga0207675_100001291
1579 Ga0207675_100045219
1580 Ga0207675_100110916
1581 Ga0207683_10000634
1582 Ga0207683_10000738
1583 Ga0207683_10003326
1584 Ga0207683_10009633
1585 Ga0207698_10008276
1586 Ga0207698_10052324
1587 Ga0207698_10135667
1588 Ga0207698_10187647
1589 Ga0207428_10002331
1590 Ga0207428_10088600
1591 Ga0268266_10010107
1592 Ga0268266_10016725
1593 Ga0268266_10062421
1594 Ga0268266_10110017
1595 Ga0268266_10285149
1596 Ga0268265_10000004
1597 Ga0268265_10000017
1598 Ga0268265_10005435
1599 Ga0268264_10000024
1600 Ga0268264_10000257
1601 Ga0268264_10002508
1602 Ga0268264_10003187
1603 Ga0268264_10081549
1604 Ga0265319_1011896
1605 Ga0265336_10005066
1606 Ga0307515_10008569
1607 Ga0307515_10099199
1608 Ga0307515_10170971
1609 Ga0265338_10000745
1610 Ga0307511_10027297
1611 Ga0307511_10147330
1612 Ga0307512_10036831
1613 Ga0316177_1052337
1614 Ga0314311_1180288
1615 Ga0265327_10009371
1616 Ga0307513_10013296
1617 Ga0307513_10057511
1618 Ga0307509_10261448
1619 Ga0307408_100077423
1620 Ga0307508_10093651
1621 Ga0316578_10043764
1622 Ga0307516_10000999
1623 Ga0307405_10019059
1624 Ga0307413_10000893
1625 Ga0307413_10039074
1626 Ga0307518_10000618
1627 Ga0307518_10014471
1628 Ga0307410_10008087
1629 Ga0307406_10013548
1630 Ga0307406_10122790
1631 Ga0307412_10042207
1632 Ga0307409_100000369
1633 Ga0307409_100218696
1634 Ga0307416_100001881
1635 Ga0307416_100011301
1636 Ga0307416_100025892
1637 Ga0307416_100088103
1638 Ga0307416_100132268
1639 Ga0307414_10070978
1640 Ga0307411_10018384
1641 Ga0307411_10033278
1642 Ga0307415_100000012
1643 Ga0307415_100077551
1644 Ga0307507_10004395
1645 Ga0307507_10055651
1646 Ga0307510_10022164
1647 Ga0373929_0006036
1648 Ga0373940_0001450
1649 Ga0373936_0024454
1650 Ga0373956_0000258
1651 Ga0373957_0019558
1652 Ga0373960_0016902
1653 Ga0373931_0006845
1654 Ga0373931_0019651
1655 Ga0373931_0119669
1656 Ga0373927_0039947
1657 Ga0373937_0131387
1658 Ga0373925_0089855
1659 Ga0373925_0229357
1660 Ga0395900_0048293
1661 Ga0395898_0026569
1662 Ga0395905_0020862
1663 Ga0436364_0155073
1664 Ga0436364_0284917
1665 Ga0436364_0296067
1666 Ga0436364_1031907
1667 Ga0436364_1038490
1668 Ga0436364_1406310
1669 Ga0436364_1554479
1670 Ga0395901_0028510
1671 Ga0395901_0147327
1672 Ga0436365_1354167
1673 Ga0436365_1453781
1674 Ga0436365_1605762
1675 Ga0436365_1607916
1676 Ga0436365_1889369
1677 Ga0436363_0578534
1678 Ga0436363_1446743
1679 Ga0436362_0218630
1680 Ga0439465_0018051
1681 Ga0451789_0707078
1682 Ga0451853_3429478
1683 Ga0439445_0004151
1684 Ga0439448_0028867
1685 Ga0439463_001998
1686 Ga0439434_0002590
1687 Ga0439435_0003483
1688 Ga0451577_0300822
1689 Ga0466969_0002252
1690 Ga0466969_0003530
1691 Ga0466972_0002059
1692 Ga0466972_0002859
1693 Ga0466972_0015337
1694 Ga0466972_0036989
1695 Ga0466965_0003251
1696 Ga0466965_0006273
1697 Ga0466965_0025222
1698 Ga0466965_0026947
1699 Ga0466966_0002064
1700 Ga0466966_0002131
1701 Ga0466966_0018665
1702 Ga0466966_0033312
1703 Ga0466966_0046838
1704 Ga0466966_0058740
1705 Ga0466961_0001303
1706 Ga0466961_0018032
1707 Ga0466961_0039915
1708 Ga0466961_0050049
1709 Ga0466961_0069587
1710 Ga0466961_0117862
1711 Ga0466963_0000288
1712 Ga0466963_0002774
1713 Ga0466963_0004890
1714 Ga0466963_0011650
1715 Ga0466963_0026683
1716 Ga0466963_0066325
1717 Ga0466963_0187237
1718 Ga0466964_0033655
1719 Ga0466971_0004672
1720 Ga0466971_0005045
1721 Ga0466968_0001581
1722 Ga0466968_0024051
1723 Ga0466970_0036670
1724 Ga0466957_0001403
1725 Ga0466957_0006143
1726 Ga0466957_0027046
1727 Ga0466957_0061434
1728 Ga0466957_0080003
1729 Ga0466957_0300468
1730 Ga0466960_0001002
1731 Ga0466960_0001087
1732 Ga0466960_0002372
1733 Ga0466959_0000897
1734 Ga0466959_0001476
1735 Ga0466959_0001547
1736 Ga0466959_0017877
1737 Ga0466959_0027589
1738 Ga0466959_0037300
1739 Ga0466959_0068273
1740 Ga0466959_0129690
1741 Ga0466958_0005151
1742 Ga0466958_0006888
1743 Ga0466958_0039394
1744 Ga0466958_0040735
1745 Ga0466958_0041381
1746 Ga0466958_0050560
1747 Ga0466958_0110713
1748 Ga0466967_0003546
1749 Ga0466967_0011765
1750 Ga0466967_0011960
1751 Ga0466967_0016973
1752 Ga0466967_0026318
1753 Ga0466967_0036386
1754 Ga0466967_0036918
1755 Ga0466967_0041552
1756 Ga0466967_0051161
1757 Ga0466967_0076612
1758 Ga0466967_0121806
1759 Ga0466967_0178777
1760 Ga0466967_0182264
1761 Ga0466967_0186768
1762 Ga0466967_0188129
1763 Ga0466967_0341518
1764 Ga0495603_0107818
1765 Ga0495629_0185365
1766 Ga0495638_0000563
1767 Ga0495638_0058022
1768 Ga0495641_0041725
1769 Ga0495653_0108174
1770 Ga0495650_0027022
1771 Ga0495582_0120994
1772 Ga0495639_0020463
1773 Ga0495662_0052534
1774 Ga0495662_0068307
1775 Ga0495664_0089469
1776 Ga0495594_0002125
1777 Ga0495594_0016140
1778 Ga0495594_0029099
1779 Ga0495594_0125002
1780 Ga0495606_0002365
1781 Ga0495648_0004975
1782 Ga0495648_0014101
1783 Ga0495652_0102062
1784 Ga0495665_0020854
1785 Ga0495665_0059379
1786 Ga0495640_0073786
1787 Ga0495640_0082893
1788 Ga0495667_0158278
1789 Ga0495656_0054210
1790 Ga0495668_0000169
1791 Ga0495634_0116644
1792 Ga0495625_0002435
1793 Ga0495635_0107726
1794 Ga0495635_0126535
1795 Ga0495588_0035197
1796 Ga0495669_0005418
1797 Ga0495613_0054572
1798 Ga0495624_0105330
1799 Ga0495604_0069356
1800 Ga0495674_0052692
1801 Ga0495674_0125381
1802 Ga0495672_0023054
1803 Ga0495672_0083267
1804 Ga0495672_0103428
1805 Ga0495676_0045519
1806 Ga0495680_0028397
1807 Ga0495680_0141162
1808 Ga0495683_0066124
1809 Ga0495673_0001489
1810 Ga0495686_0005660
1811 Ga0495593_0031677
1812 Ga0495626_0000312
1813 Ga0496100_0000076
1814 Ga0496100_0001035
1815 Ga0496100_0001268
1816 Ga0496100_0002861
1817 Ga0496100_0023093
1818 Ga0496101_0000084
1819 Ga0496101_0000094
1820 Ga0496101_0024663
1821 Ga0496101_0054318
1822 Ga0496101_0062230
1823 Ga0496101_0124461
1824 Ga0496102_0000014
1825 Ga0496102_0000718
1826 Ga0496102_0000923
1827 Ga0496102_0001481
1828 Ga0496102_0002467
1829 Ga0496102_0003991
1830 Ga0496102_0008831
1831 Ga0496102_0012499
1832 Ga0496102_0016217
1833 Ga0496102_0174766
1834 Ga0496102_0269201
1835 Ga0496102_0430437
1836 Ga0496103_0000004
1837 Ga0496103_0000030
1838 Ga0496103_0000630
1839 Ga0496103_0001260
1840 Ga0496103_0033606
1841 Ga0496103_0105726
1842 Ga0496103_0143998
1843 Ga0496104_0002885
1844 Ga0496104_0004329
1845 Ga0496104_0005253
1846 Ga0496104_0210252
1847 Ga0496104_0244539
1848 Ga0496105_0001491
1849 Ga0496105_0012144
1850 Ga0496105_0016809
1851 Ga0496105_0058452
1852 Ga0496105_0122311
1853 Ga0496105_0394156
1854 Ga0496106_0002103
1855 Ga0496106_0002972
1856 Ga0496106_0012998
1857 Ga0496106_0044746
1858 Ga0496107_0000270
1859 Ga0496107_0001773
1860 Ga0496107_0002556
1861 Ga0496107_0028257
1862 Ga0496107_0044087
1863 Ga0496107_0127549
1864 Ga0496107_0151894
1865 Ga0496108_0001463
1866 Ga0496108_0002468
1867 Ga0496108_0004287
1868 Ga0496108_0006483
1869 Ga0496108_0032843
1870 Ga0496109_0000344
1871 Ga0496109_0010406
1872 Ga0496109_0017263
1873 Ga0496109_0054926
1874 Ga0496110_0014435
1875 Ga0496110_0037507
1876 Ga0496110_0093651
1877 Ga0496110_0115056
1878 Ga0496110_0172554
1879 Ga0496111_0001016
1880 Ga0496111_0015472
1881 Ga0496111_0027683
1882 Ga0496111_0096564
1883 Ga0496111_0140049
1884 Ga0496112_0007119
1885 Ga0496112_0032493
1886 Ga0496112_0036248
1887 Ga0496112_0040073
1888 Ga0496112_0088623
1889 Ga0496112_0095801
1890 Ga0496112_0096870
1891 Ga0496112_0203459
1892 Ga0496112_0261377
1893 Ga0496113_0014747
1894 Ga0496113_0017750
1895 Ga0496114_0000842
1896 Ga0496114_0001102
1897 Ga0496114_0029191
1898 Ga0496114_0127872
1899 Ga0496114_0149915
1900 Ga0496115_0007651
1901 Ga0496115_0018123
1902 Ga0496115_0079646
1903 Ga0496115_0147233
1904 Ga0496115_0234302
1905 Ga0496116_0000069
1906 Ga0496116_0000578
1907 Ga0496116_0002811
1908 Ga0496117_0000003
1909 Ga0496117_0001462
1910 Ga0496117_0019905
1911 Ga0496117_0021310
1912 Ga0496117_0028936
1913 Ga0496118_0000001
1914 Ga0496118_0000236
1915 Ga0496118_0002249
1916 Ga0496118_0012121
1917 Ga0496118_0086760
1918 Ga0496119_0000549
1919 Ga0496119_0000803
1920 Ga0496119_0003615
1921 Ga0496119_0005467
1922 Ga0496119_0007110
1923 Ga0496119_0008226
1924 Ga0496120_0000085
1925 Ga0496120_0000250
1926 Ga0496120_0004382
1927 Ga0496120_0018927
1928 Ga0496120_0044947
1929 Ga0496121_0000016
1930 Ga0496121_0000032
1931 Ga0496121_0002393
1932 Ga0496121_0032516
1933 Ga0496121_0058018
1934 Ga0496122_0000526
1935 Ga0496123_0004458
1936 Ga0496123_0050772
1937 Ga0496124_0000015
1938 Ga0496125_0000021
1939 Ga0496126_0000015
1940 Ga0496126_0000035
1941 Ga0496126_0000067
1942 Ga0496126_0000208
1943 Ga0496126_0005873
1944 Ga0496126_0037045
1945 Ga0496126_0058610
1946 Ga0496126_0087310
1947 Ga0501032_0000706
1948 Ga0501032_0006930
1949 Ga0501032_0012122
1950 Ga0501033_0009060
1951 Ga0501033_0037516
1952 Ga0501034_0005030
1953 Ga0501034_0013263
1954 Ga0501034_0037652
1955 Ga0501034_0076278
1956 Ga0501034_0088737
1957 Ga0501036_0038851
1958 Ga0501036_0144342
1959 Ga0501037_0001277
1960 Ga0501037_0001845
1961 Ga0501037_0054026
1962 Ga0501038_0000620
1963 Ga0501038_0013687
1964 Ga0501038_0014050
1965 Ga0501039_0000909
1966 Ga0501039_0022360
1967 Ga0501039_0178776
1968 Ga0501040_0042780
1969 Ga0501041_0029441
1970 Ga0501041_0122404
1971 Ga0501042_0019941
1972 Ga0501042_0025668
1973 Ga0501043_0001657
1974 Ga0501043_0041148
1975 Ga0501043_0222802
1976 Ga0501046_0019678
1977 Ga0501047_0004744
1978 Ga0501047_0006713
1979 Ga0501047_0010437
1980 Ga0501047_0068897
1981 Ga0501048_0008553
1982 Ga0501048_0008968
1983 Ga0501048_0051146
1984 Ga0501068_0181903
1985 Ga0501069_0178003
1986 Ga0501070_0000213
1987 Ga0501070_0000386
1988 Ga0501071_0001758
1989 Ga0501071_0111275
1990 Ga0501072_0011692
1991 Ga0501074_0002345
1992 Ga0501074_0090606
1993 Ga0501077_0063682
1994 Ga0501077_0101867
1995 Ga0501081_0028586
1996 Ga0501035_0000340
1997 Ga0501035_0008647
1998 Ga0501044_0000380
1999 Ga0501044_0028696
2000 Ga0501044_0082871
2001 Ga0501044_0104258
2002 Ga0501044_0213532
2003 Ga0501045_0007214
2004 Ga0501045_0050949
2005 nmdc:mga03n38_1427_c1
2006 nmdc:mga03n38_1511_c1
2007 nmdc:mga00v17_1138_c1
2008 nmdc:mga00v17_44455_c1
2009 nmdc:mga00v17_60940_c1
2010 nmdc:mga00v17_6740_c1
2011 nmdc:mga00v17_8771_c1
2012 nmdc:mga00v17_96380_c1
2013 nmdc:mga0yw44_24337_c1
2014 nmdc:mga0yw44_780_c1
2015 nmdc:mga07m45_13392_c1
2016 nmdc:mga07m45_21555_c1
2017 nmdc:mga07m45_27168_c1
2018 nmdc:mga07m45_337_c1
2019 nmdc:mga07m45_84550_c1
2020 nmdc:mga05p37_16765_c1
2021 nmdc:mga05p37_181377_c1
2022 nmdc:mga05p37_26114_c1
2023 nmdc:mga05p37_9074_c1
2024 nmdc:mga09592_16810_c1
2025 nmdc:mga09592_62_c1
2026 nmdc:mga0qj67_10555_c1
2027 nmdc:mga0qj67_106_c2
2028 nmdc:mga0qj67_13793_c1
2029 nmdc:mga0qj67_21963_c1
2030 nmdc:mga06r32_1375_c1
2031 nmdc:mga06r32_25_c7
2032 nmdc:mga06r32_77325_c1
2033 nmdc:mga06r32_9570_c1
2034 nmdc:mga08y16_19132_c1
2035 nmdc:mga08y16_309796_c1
2036 nmdc:mga0n895_119551_c1
2037 nmdc:mga0n895_3029_c1
2038 nmdc:mga08x19_8640_c1
2039 nmdc:mga0a205_10838_c1
2040 nmdc:mga0a205_70823_c1
2041 nmdc:mga0sz30_3286_c1
2042 nmdc:mga0sz30_36543_c1
2043 nmdc:mga0sz30_927_c1
2044 Ga0495601_0015871
2045 Ga0500635_0003696
2046 Ga0495595_0090115
2047 Ga0495619_0225913
2048 Ga0500643_000240
2049 Ga0500643_003897
2050 Ga0500644_0008807
2051 Ga0500646_0003381
2052 Ga0500583_0083104
2053 Ga0500562_004337
2054 Ga0500652_000479
2055 Ga0500652_035905
2056 Ga0500588_0000341
2057 Ga0500616_0007655
2058 Ga0500645_000123
2059 Ga0500645_009049
2060 Ga0501084_0202597
2061 Ga0501082_0143043
2062 Ga0466962_0010071
2063 Ga0466962_0022948
2064 Ga0530510_0103344
2065 Ga0530510_0168046
2066 2501941842
2067 2506865430
2068 2508672362
2069 2515493923
2070 2515720617
2071 2515755299
2072 2516086759
2073 2516092345
2074 2517760699
2075 2523384642
2076 2528204833
2077 2528216273
2078 2546950180
2079 2558909285
2080 2559426958
2081 2579750781
2082 2579852809
2083 2583151582
2084 2586064139
2085 2619856604
2086 2620348830
2087 2623502299
2088 2623586433
2089 2626636124
2090 2644486648
2091 2644636053
2092 2671840324
2093 2676198229
2094 2676484870
2095 2686537433
2096 2686543239
2097 2689959501
2098 2710606209
2099 2738665279
2100 2738706286
2101 2739144413
2102 2739328775
2103 2753073314
2104 2772641670
2105 2774842807
2106 2774858480
2107 2774865980
2108 2774901233
2109 2791914036
2110 2795791485
2111 2809586616
2112 2816511542
2113 2842138692
2114 2855021844
2115 2855672226
2116 2855678865
2117 2855685291
2118 2856860351
2119 2857295162
2120 2858854533
2121 2858874076
2122 2858888535
2123 2858890759
2124 2858898553
2125 2858905641
2126 2861520750
2127 2866618724
2128 2867303805
2129 2867313357
2130 2867322824
2131 2869054255
2132 2869065822
2133 2869070626
2134 2870729141
2135 2870783488
2136 2880493748
2137 2880498574
2138 2887483707
2139 2891327121
2140 2895882363
2141 2899360234
2142 2899376835
2143 2902586396
2144 2902793196
2145 2902804063
2146 2915772438
2147 2917737472
2148 2917738066
2149 2929214578
2150 2929220566
2151 2929227153
2152 2939587838
2153 2996224794
2154 3003008800
2155 637879500
2156 649811090
2157 8001782513
2158 8002782596
2159 8002789205
2160 8003320399
2161 8003835336
2162 8003857203
2163 8003873523
2164 8047715081
2165 8054475476
2166 8054708087
2167 8054730990
2168 8054735121
2169 8054915208
2170 8054918306
2171 8054922262
2172 8055159745
2173 8055414775
2174 8057568883

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

276

425

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

43

154

0.97

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

291

408

0.97

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

158

261

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vig-assembly2.cif.gz_H crystal structure of human short-chain acyl coa dehydrogenase 0.9735 10 395
2vig-assembly1.cif.gz_D crystal structure of human short-chain acyl coa dehydrogenase 0.9734 10 395
2vig-assembly2.cif.gz_F crystal structure of human short-chain acyl coa dehydrogenase 0.9724 10 395
2dvl-assembly1.cif.gz_A crystal structure of project tt0160 from thermus thermophilus hb8 0.9714 10 390
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.9707 10 395
ID Description Score Start End Superfamily
af_A0A0K3AQR2_269_362_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9815 249 336 1.20.140.10
4iv6A01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.978 10 124 1.10.540.10
af_Q9VDT1_256_405_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9767 249 395 1.20.140.10
1jqiB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9767 253 391 1.20.140.10
1jqiA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9764 253 391 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A399XYP2-F1-model_v4 deleted 0.9812 7 317
AF-A0A519UGP9-F1-model_v4 Acyl-CoA dehydrogenase 0.9787 227 391 GO:0003995
AF-A0A4Q3UBN6-F1-model_v4 Acyl-CoA dehydrogenase 0.9777 225 391 GO:0003995
AF-A0A2R6LVG2-F1-model_v4 Acyl-CoA dehydrogenase 0.9771 252 391 GO:0003995
AF-A0A6N8W020-F1-model_v4 Acyl-CoA dehydrogenase 0.9769 7 307 GO:0003995
GO:0050660

Map