F489804

General Info

Members Datasets Scaffolds Average Seq Length
1087 538 2175 258

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10347990|Ga0207671_103479902
Length 319
Sequence MAPALPAACRRSPPPRYFSRPVLPPPAWAAGRPDSTQRLGTIASPPATGYRAAGNVDFGFFILQAVILAGGMGTRIAEESHLRPKPMIEIGGRPILWHIMKIYGHFGVHDFIICLGYRGYMIKEYFSNYFLHNADVTIDTLTNHVTYHNTKAEPWRVTMVDTGEASMTGGRLKRVASYLQPGRPFCFTYGDGLADVDIAATIAFHKRHGRKATLTGVVPPGRYGSLSLDGDQITRFIEKPPGDNTLVNGGFFVLDPSVIDLIADDATSWEGAPLETLAASGELMVHRHAGFWQPMDTLRDKNHLEALWAGGKPPWKVWE

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
147 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
148 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
166 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
167 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
174 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
232 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
235 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
240 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
241 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
242 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
243 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
244 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
245 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
246 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
262 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
263 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
264 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
277 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
278 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
279 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
283 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
285 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
295 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
296 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
297 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
298 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
299 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
302 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
303 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
304 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
305 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
306 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
307 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
308 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
309 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
310 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
311 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
312 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
313 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
314 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
315 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
316 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
317 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
318 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
319 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
320 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
321 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
322 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
326 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
327 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
328 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
329 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
330 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
331 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
332 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
336 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
337 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
338 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
341 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
342 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
345 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
346 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
347 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
348 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
349 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
352 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
353 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
354 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
355 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
356 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
357 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
358 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
359 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
365 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
366 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
367 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
368 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
369 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
370 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
371 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
375 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
380 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
381 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
382 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
383 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
384 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
385 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
386 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
387 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
388 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
389 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
390 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
394 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
395 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
398 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
399 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
400 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
401 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
402 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
403 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
404 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
405 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
406 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
407 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
408 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
409 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
412 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
413 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
414 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
415 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
416 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
417 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
418 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
419 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
420 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
421 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
422 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
423 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
425 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
426 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
427 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
439 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
440 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
441 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
442 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
443 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
444 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
445 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
446 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
447 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
448 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
450 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
451 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
452 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
453 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
454 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
455 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
456 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
457 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
458 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
459 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
460 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
461 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
462 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
463 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
464 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
465 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
466 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
467 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
468 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
469 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
470 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
471 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
472 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
473 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
474 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
475 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
476 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
477 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
478 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
479 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
480 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
481 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
482 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
483 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
484 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
485 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
486 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
487 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
488 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
489 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
490 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
491 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
492 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
493 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
494 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
495 2547132374 Acidovorax radicis N35 Isolate Unclassified
496 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
497 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
498 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
499 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
500 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
501 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
502 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
503 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
504 2643221717 Acidovorax sp. Root267 Isolate Unclassified
505 2684622632 Bacillus cereus 905 Isolate Unclassified
506 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
507 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
508 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
509 2738543006 Bacillus sp. OK077 Isolate Unclassified
510 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
511 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
512 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
513 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
514 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
515 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
516 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
517 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
518 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
519 2831426010 Nostoc sp. 106C Isolate Unclassified
520 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
521 2849660919 Nostoc sp. T09 Isolate Unclassified
522 2885211737 Variovorax sp. 553 Isolate Unclassified
523 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
524 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
525 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
526 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
527 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
528 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
529 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
530 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
531 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
532 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
533 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
534 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
535 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
536 8023438354 Bacillus sp. BH2 Isolate Unclassified
537 8023444577 Bacillus sp. BH32 Isolate Unclassified
538 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.22
Metatranscriptomes 0.74
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.36
Nodule 0.74
Rhizoplane 1.75
Rhizosphere 71.57
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10347990 3300025914 Bacteria 1175
2 SwRhRL2b_contig_2410546 2162886007 Bacteria 2012
3 SwRhRL2b_contig_3658071 2162886007 Bacteria 1138
4 JGI24736J21556_1008511 3300001904 Bacteria 1704
5 JGI24740J21852_10001139 3300001979 Bacteria 12026
6 JGI24739J22299_10001771 3300001989 Bacteria 8219
7 JGI24739J22299_10010873 3300001989 Bacteria 3368
8 JGI24737J22298_10027737 3300001990 Bacteria 1784
9 JGI24735J21928_10003349 3300002067 Bacteria 5466
10 JGI24735J21928_10005690 3300002067 Bacteria 4122
11 JGI24748J21848_1000023 3300002074 Bacteria 106523
12 JGI24738J21930_10003984 3300002075 Bacteria 3670
13 JGI24034J26672_10000010 3300002239 Bacteria 150746
14 JGI24751J29686_10015855 3300002459 Bacteria 1554
15 JGI25151J46595_10002312 3300003187 Bacteria 11632
16 JGI25165J46597_1001250 3300003214 Bacteria 15019
17 JGI25153J46596_10013055 3300003215 Bacteria 3538
18 rootH1_10069913 3300003316 Bacteria 3118
19 rootH2_10221868 3300003320 Bacteria 9511
20 rootH2_10295353 3300003320 Bacteria 3205
21 rootH1_10013795 3300003316 Bacteria 5255
22 rootH1_10013795 3300003323 Bacteria 7318
23 Ga0006562J51391_1051510 3300003578 Bacteria 2594
24 Ga0055532_1000054 3300003758 Bacteria 161617
25 Ga0055525_1000021 3300003759 Bacteria 370802
26 Ga0055525_1000663 3300003759 Bacteria 13277
27 Ga0055535_1000037 3300003761 Bacteria 161617
28 Ga0055535_1000475 3300003761 Bacteria 36547
29 Ga0055542_1000157 3300003762 Bacteria 85679
30 Ga0055529_1000070 3300003763 Bacteria 161617
31 Ga0055526_1000329 3300003771 Bacteria 39211
32 Ga0055526_1004142 3300003771 Bacteria 8841
33 Ga0055526_1011388 3300003771 Bacteria 4011
34 Ga0055526_1025080 3300003771 Bacteria 1925
35 Ga0055536_1000149 3300003781 Bacteria 59801
36 Ga0055536_1004606 3300003781 Bacteria 6987
37 Ga0055534_1000883 3300003784 Bacteria 13641
38 Ga0055530_10002573 3300003791 Bacteria 11505
39 Ga0055540_1000622 3300003792 Bacteria 25228
40 Ga0055540_1017869 3300003792 Bacteria 1963
41 Ga0055531_10001158 3300003794 Bacteria 20326
42 Ga0055531_10006162 3300003794 Bacteria 6856
43 Ga0055541_1003285 3300003841 Bacteria 3066
44 Ga0065165_1000030 3300005262 Bacteria 218104
45 Ga0065714_10021842 3300005288 Bacteria 1972
46 Ga0065714_10098217 3300005288 Bacteria 1716
47 Ga0065704_10000597 3300005289 Bacteria 15674
48 Ga0065704_10173848 3300005289 Bacteria 1275
49 Ga0065704_10178514 3300005289 Bacteria 1250
50 Ga0065715_10001856 3300005293 Bacteria 6970
51 Ga0065707_10087919 3300005295 Bacteria 4842
52 Ga0070658_10001409 3300005327 Bacteria 20543
53 Ga0070658_10004364 3300005327 Bacteria 11538
54 Ga0070676_10111913 3300005328 Bacteria 1701
55 Ga0070676_10131404 3300005328 Bacteria 1584
56 Ga0070676_10207484 3300005328 Bacteria 1287
57 Ga0070683_100319670 3300005329 Bacteria 1477
58 Ga0070683_100439147 3300005329 Bacteria 1245
59 Ga0070683_100478424 3300005329 Bacteria 1189
60 Ga0070690_100000055 3300005330 Bacteria 55023
61 Ga0070670_100068558 3300005331 Bacteria 3044
62 Ga0068869_100065438 3300005334 Bacteria 2676
63 Ga0068869_100093641 3300005334 Bacteria 2264
64 Ga0070666_10000009 3300005335 Bacteria 279209
65 Ga0070680_100294027 3300005336 Bacteria 1377
66 Ga0068868_100008614 3300005338 Bacteria 7305
67 Ga0070660_100201357 3300005339 Bacteria 1615
68 Ga0070689_100094929 3300005340 Bacteria 2355
69 Ga0070689_100261327 3300005340 Bacteria 1431
70 Ga0070689_100438803 3300005340 Bacteria 1109
71 Ga0070661_100000068 3300005344 Bacteria 83844
72 Ga0070692_10066907 3300005345 Bacteria 1906
73 Ga0070668_100000109 3300005347 Bacteria 50768
74 Ga0070668_100020350 3300005347 Bacteria 5007
75 Ga0070668_100025441 3300005347 Bacteria 4487
76 Ga0070669_100006318 3300005353 Bacteria 8544
77 Ga0070669_100129610 3300005353 Bacteria 1933
78 Ga0070675_100003633 3300005354 Bacteria 11728
79 Ga0070675_100060402 3300005354 Bacteria 3130
80 Ga0070671_100099442 3300005355 Bacteria 2440
81 Ga0070671_100114564 3300005355 Bacteria 2266
82 Ga0070674_100002357 3300005356 Bacteria 10422
83 Ga0070673_100229224 3300005364 Bacteria 1611
84 Ga0070673_100557303 3300005364 Bacteria 1042
85 Ga0070659_100000135 3300005366 Bacteria 56628
86 Ga0070659_100000867 3300005366 Bacteria 22120
87 Ga0070659_100002242 3300005366 Bacteria 13752
88 Ga0070659_100135341 3300005366 Bacteria 2003
89 Ga0070667_100000385 3300005367 Bacteria 47859
90 Ga0070667_100003070 3300005367 Bacteria 14351
91 Ga0070667_100015911 3300005367 Bacteria 6223
92 Ga0070667_100263786 3300005367 Bacteria 1543
93 Ga0070714_100121818 3300005435 Bacteria 2321
94 Ga0070714_100305947 3300005435 Bacteria 1483
95 Ga0070700_100055104 3300005441 Bacteria 2487
96 Ga0070700_100207240 3300005441 Bacteria 1381
97 Ga0070663_100000008 3300005455 Bacteria 188775
98 Ga0070663_100137142 3300005455 Bacteria 1864
99 Ga0070663_100250688 3300005455 Bacteria 1401
100 Ga0070678_100027075 3300005456 Bacteria 3887
101 Ga0070678_100559426 3300005456 Bacteria 1016
102 Ga0070662_100006646 3300005457 Bacteria 7468
103 Ga0070662_100022445 3300005457 Bacteria 4321
104 Ga0070662_100157186 3300005457 Bacteria 1775
105 Ga0070662_100533245 3300005457 Bacteria 982
106 Ga0070681_10079866 3300005458 Unclassified 3227
107 Ga0070681_10266915 3300005458 Bacteria 1623
108 Ga0070681_10405649 3300005458 Bacteria 1274
109 Ga0068867_100043843 3300005459 Bacteria 3275
110 Ga0068867_100283078 3300005459 Bacteria 1360
111 Ga0070685_10152786 3300005466 Bacteria 1464
112 Ga0070707_100465665 3300005468 Bacteria 1225
113 Ga0070698_100000489 3300005471 Bacteria 42118
114 Ga0070698_100080822 3300005471 Bacteria 3245
115 Ga0070698_100135130 3300005471 Bacteria 2421
116 Ga0070698_100700802 3300005471 Bacteria 955
117 Ga0070699_100070764 3300005518 Bacteria 3033
118 Ga0070699_100110679 3300005518 Bacteria 2411
119 Ga0070699_100381774 3300005518 Bacteria 1272
120 Ga0070679_100004697 3300005530 Bacteria 12599
121 Ga0070679_100097498 3300005530 Bacteria 2927
122 Ga0070679_100183999 3300005530 Bacteria 2061
123 Ga0070697_100016631 3300005536 Bacteria 5786
124 Ga0070697_100824900 3300005536 Bacteria 821
125 Ga0068853_100020311 3300005539 Bacteria 5523
126 Ga0068853_100052107 3300005539 Bacteria 3524
127 Ga0068853_100104158 3300005539 Bacteria 2512
128 Ga0068853_100175136 3300005539 Bacteria 1943
129 Ga0070672_100000409 3300005543 Bacteria 24906
130 Ga0070672_100312494 3300005543 Bacteria 1334
131 Ga0070686_100000041 3300005544 Bacteria 104174
132 Ga0070686_100099002 3300005544 Bacteria 1966
133 Ga0070695_100017307 3300005545 Bacteria 4370
134 Ga0070696_100406706 3300005546 Bacteria 1066
135 Ga0070665_100018737 3300005548 Bacteria 6939
136 Ga0070665_100032348 3300005548 Bacteria 5265
137 Ga0070665_100087832 3300005548 Bacteria 3115
138 Ga0070665_100683176 3300005548 Bacteria 1040
139 Ga0070704_100242736 3300005549 Bacteria 1475
140 Ga0068855_100006481 3300005563 Bacteria 14234
141 Ga0068855_100016802 3300005563 Bacteria 8799
142 Ga0068855_100024389 3300005563 Bacteria 7236
143 Ga0068855_100380428 3300005563 Bacteria 1550
144 Ga0070664_100000009 3300005564 Bacteria 166396
145 Ga0070664_100193602 3300005564 Bacteria 1812
146 Ga0070664_100681236 3300005564 Bacteria 957
147 Ga0068857_100007095 3300005577 Bacteria 9649
148 Ga0068857_100179674 3300005577 Bacteria 1926
149 Ga0068854_100000023 3300005578 Bacteria 127086
150 Ga0068854_100000024 3300005578 Bacteria 124310
151 Ga0068854_100028898 3300005578 Bacteria 3834
152 Ga0068854_100057533 3300005578 Bacteria 2805
153 Ga0068854_100075122 3300005578 Bacteria 2481
154 Ga0068854_100229675 3300005578 Bacteria 1472
155 Ga0068856_100000019 3300005614 Bacteria 150500
156 Ga0068856_100002944 3300005614 Bacteria 17452
157 Ga0068856_100109698 3300005614 Bacteria 2756
158 Ga0068852_100012678 3300005616 Bacteria 6412
159 Ga0068852_100048495 3300005616 Bacteria 3629
160 Ga0068852_100340373 3300005616 Bacteria 1462
161 Ga0068859_100002443 3300005617 Bacteria 18918
162 Ga0068859_100002746 3300005617 Bacteria 17844
163 Ga0068859_100016879 3300005617 Bacteria 7328
164 Ga0068859_100163494 3300005617 Bacteria 2305
165 Ga0068864_100000661 3300005618 Bacteria 28761
166 Ga0068864_100241190 3300005618 Bacteria 1675
167 Ga0068864_100388585 3300005618 Bacteria 1324
168 Ga0068864_100562955 3300005618 Bacteria 1103
169 Ga0068866_10004073 3300005718 Bacteria 5996
170 Ga0068861_100000441 3300005719 Bacteria 24079
171 Ga0068861_100002019 3300005719 Bacteria 13142
172 Ga0068861_100019804 3300005719 Bacteria 4809
173 Ga0068851_10078371 3300005834 Bacteria 1722
174 Ga0068863_100000317 3300005841 Bacteria 48992
175 Ga0068863_100000705 3300005841 Bacteria 33651
176 Ga0068863_100003514 3300005841 Bacteria 15465
177 Ga0068863_100008845 3300005841 Bacteria 9833
178 Ga0068863_100076557 3300005841 Bacteria 3165
179 Ga0068860_100000022 3300005843 Bacteria 279209
180 Ga0068860_100003256 3300005843 Bacteria 16733
181 Ga0068860_100065199 3300005843 Bacteria 3459
182 Ga0068860_100119863 3300005843 Bacteria 2519
183 Ga0068860_100197992 3300005843 Bacteria 1946
184 Ga0068860_100657848 3300005843 Bacteria 1056
185 Ga0068862_100000596 3300005844 Bacteria 37603
186 Ga0068862_100020520 3300005844 Bacteria 5520
187 Ga0081455_10049469 3300005937 Bacteria 3623
188 Ga0075365_10000349 3300006038 Bacteria 16542
189 Ga0075365_10000706 3300006038 Bacteria 13439
190 Ga0075365_10004015 3300006038 Bacteria 7714
191 Ga0075365_10027179 3300006038 Bacteria 3637
192 Ga0075365_10368842 3300006038 Bacteria 1012
193 Ga0075368_10011102 3300006042 Unclassified 3273
194 Ga0075368_10091685 3300006042 Bacteria 1243
195 Ga0075363_100011278 3300006048 Bacteria 4275
196 Ga0075363_100015353 3300006048 Bacteria 3763
197 Ga0075363_100018241 3300006048 Bacteria 3492
198 Ga0075364_10001743 3300006051 Bacteria 11994
199 Ga0075364_10002839 3300006051 Bacteria 9759
200 Ga0075364_10048942 3300006051 Bacteria 2755
201 Ga0075364_10054472 3300006051 Unclassified 2616
202 Ga0070716_100129679 3300006173 Bacteria 1592
203 Ga0075362_10009498 3300006177 Bacteria 3764
204 Ga0075362_10036243 3300006177 Bacteria 2157
205 Ga0075362_10154567 3300006177 Unclassified 1102
206 Ga0075367_10003220 3300006178 Bacteria 7716
207 Ga0075367_10012827 3300006178 Bacteria 4487
208 Ga0075367_10020340 3300006178 Bacteria 3694
209 Ga0075367_10031060 3300006178 Bacteria 3067
210 Ga0075367_10051082 3300006178 Bacteria 2443
211 Ga0075367_10129808 3300006178 Bacteria 1557
212 Ga0075369_10002209 3300006186 Bacteria 6891
213 Ga0075369_10002288 3300006186 Bacteria 6806
214 Ga0075369_10080599 3300006186 Bacteria 1443
215 Ga0075366_10003243 3300006195 Bacteria 8547
216 Ga0075366_10029525 3300006195 Bacteria 3221
217 Ga0075366_10030236 3300006195 Bacteria 3183
218 Ga0097621_100021383 3300006237 Bacteria 5004
219 Ga0097621_100076541 3300006237 Bacteria 2776
220 Ga0075370_10004495 3300006353 Bacteria 6783
221 Ga0075370_10012301 3300006353 Bacteria 4519
222 Ga0075370_10078839 3300006353 Bacteria 1891
223 Ga0075370_10127782 3300006353 Bacteria 1482
224 Ga0068871_100001760 3300006358 Bacteria 14588
225 Ga0075428_100001894 3300006844 Bacteria 22450
226 Ga0075428_100037054 3300006844 Bacteria 5371
227 Ga0075430_100003424 3300006846 Bacteria 13262
228 Ga0075430_100013674 3300006846 Bacteria 6918
229 Ga0075431_100000364 3300006847 Bacteria 35896
230 Ga0075431_100021229 3300006847 Bacteria 6637
231 Ga0075434_100020199 3300006871 Bacteria 6455
232 Ga0075434_100133179 3300006871 Bacteria 2505
233 Ga0075429_100005261 3300006880 Bacteria 11132
234 Ga0075429_100008541 3300006880 Bacteria 8910
235 Ga0075436_100000321 3300006914 Bacteria 30575
236 Ga0075436_100119610 3300006914 Bacteria 1842
237 Ga0097620_100002442 3300006931 Bacteria 18918
238 Ga0097620_100002746 3300006931 Bacteria 17844
239 Ga0097620_100016879 3300006931 Bacteria 7328
240 Ga0097620_100163495 3300006931 Bacteria 2305
241 Ga0079104_1000163 3300006946 Bacteria 94189
242 Ga0099826_10000013 3300006948 Bacteria 265459
243 Ga0099826_10000048 3300006948 Bacteria 74895
244 Ga0099826_10048612 3300006948 Bacteria 2867
245 Ga0075435_100008156 3300007076 Bacteria 7501
246 Ga0075435_100059536 3300007076 Bacteria 3096
247 Ga0105251_10059587 3300009011 Bacteria 1800
248 Ga0105244_10000698 3300009036 Bacteria 29096
249 Ga0105244_10073094 3300009036 Bacteria 1707
250 Ga0105250_10014263 3300009092 Bacteria 3268
251 Ga0105250_10054927 3300009092 Bacteria 1598
252 Ga0105240_10001579 3300009093 Bacteria 38656
253 Ga0105240_10006137 3300009093 Bacteria 17725
254 Ga0105240_10017956 3300009093 Bacteria 9516
255 Ga0105240_10057143 3300009093 Bacteria 4878
256 Ga0105240_10100584 3300009093 Bacteria 3517
257 Ga0105240_10563674 3300009093 Bacteria 1259
258 Ga0111539_10027771 3300009094 Bacteria 6911
259 Ga0111539_10080845 3300009094 Bacteria 3823
260 Ga0111539_10303704 3300009094 Bacteria 1857
261 Ga0111539_11364438 3300009094 Bacteria 822
262 Ga0105245_10204915 3300009098 Bacteria 1896
263 Ga0105247_10048675 3300009101 Bacteria 2604
264 Ga0114129_10015902 3300009147 Bacteria 10703
265 Ga0114129_10193241 3300009147 Bacteria 2762
266 Ga0114129_10362065 3300009147 Bacteria 1919
267 Ga0114129_10542149 3300009147 Bacteria 1514
268 Ga0105243_10033187 3300009148 Bacteria 3991
269 Ga0105243_10110900 3300009148 Bacteria 2295
270 Ga0105241_10002815 3300009174 Bacteria 13015
271 Ga0105241_10110745 3300009174 Bacteria 2197
272 Ga0105241_10118112 3300009174 Bacteria 2132
273 Ga0105241_10701495 3300009174 Bacteria 924
274 Ga0105242_10008344 3300009176 Bacteria 7960
275 Ga0105248_10001248 3300009177 Bacteria 28422
276 Ga0105248_10001677 3300009177 Bacteria 24650
277 Ga0105248_10002804 3300009177 Bacteria 19370
278 Ga0105248_10010586 3300009177 Bacteria 10165
279 Ga0105248_10028059 3300009177 Bacteria 6270
280 Ga0105248_10300172 3300009177 Bacteria 1808
281 Ga0105248_10624854 3300009177 Bacteria 1215
282 Ga0105237_10003070 3300009545 Bacteria 20134
283 Ga0105237_10065625 3300009545 Bacteria 3626
284 Ga0105237_10086871 3300009545 Bacteria 3117
285 Ga0105237_10130696 3300009545 Bacteria 2505
286 Ga0105237_10367331 3300009545 Bacteria 1444
287 Ga0105238_10070117 3300009551 Bacteria 3505
288 Ga0105249_10000014 3300009553 Bacteria 283274
289 Ga0105249_10002930 3300009553 Bacteria 14719
290 Ga0105249_10003753 3300009553 Bacteria 13111
291 Ga0105249_10269945 3300009553 Bacteria 1694
292 Ga0105239_10001206 3300010375 Bacteria 35293
293 Ga0105239_10009151 3300010375 Bacteria 11204
294 Ga0105239_10020093 3300010375 Bacteria 7368
295 Ga0105239_10022264 3300010375 Bacteria 6985
296 Ga0105239_10261695 3300010375 Bacteria 1944
297 Ga0105239_10325619 3300010375 Bacteria 1733
298 Ga0105239_10342452 3300010375 Bacteria 1687
299 Ga0105246_10577033 3300011119 Bacteria 968
300 Ga0157326_1001295 3300012513 Bacteria 2771
301 Ga0157373_10006717 3300013100 Bacteria 8566
302 Ga0157373_10011249 3300013100 Bacteria 6584
303 Ga0157373_10061387 3300013100 Bacteria 2662
304 Ga0157373_10099741 3300013100 Bacteria 2044
305 Ga0157371_10000047 3300013102 Bacteria 185590
306 Ga0157371_10002969 3300013102 Bacteria 15746
307 Ga0157371_10004449 3300013102 Bacteria 12229
308 Ga0157371_10008594 3300013102 Bacteria 8115
309 Ga0157370_10000004 3300013104 Bacteria 366426
310 Ga0157370_10002004 3300013104 Bacteria 25038
311 Ga0157370_10013356 3300013104 Bacteria 8460
312 Ga0157370_10014211 3300013104 Bacteria 8159
313 Ga0157370_10014608 3300013104 Bacteria 8024
314 Ga0157370_10047662 3300013104 Bacteria 4107
315 Ga0157370_10056784 3300013104 Bacteria 3725
316 Ga0157369_10006530 3300013105 Bacteria 13505
317 Ga0157369_10020204 3300013105 Bacteria 7447
318 Ga0157374_10519518 3300013296 Bacteria 1196
319 Ga0157374_10619616 3300013296 Bacteria 1093
320 Ga0157378_10035146 3300013297 Bacteria 4432
321 Ga0157378_10111102 3300013297 Bacteria 2513
322 Ga0157378_10670415 3300013297 Bacteria 1054
323 Ga0163162_10016338 3300013306 Bacteria 7255
324 Ga0163162_10105499 3300013306 Bacteria 2912
325 Ga0163162_10127587 3300013306 Bacteria 2651
326 Ga0163162_10457492 3300013306 Bacteria 1408
327 Ga0163162_10477272 3300013306 Bacteria 1378
328 Ga0163162_10741644 3300013306 Bacteria 1102
329 Ga0157372_10000362 3300013307 Bacteria 50100
330 Ga0157372_10002551 3300013307 Bacteria 19751
331 Ga0157372_10031659 3300013307 Bacteria 5791
332 Ga0157372_10177662 3300013307 Bacteria 2464
333 Ga0157375_10000055 3300013308 Bacteria 126704
334 Ga0157375_10000541 3300013308 Bacteria 33927
335 Ga0157375_10022569 3300013308 Bacteria 5794
336 Ga0157375_10204597 3300013308 Bacteria 2130
337 Ga0157375_10401610 3300013308 Bacteria 1537
338 Ga0157375_11074087 3300013308 Bacteria 941
339 Ga0163163_10129014 3300014325 Bacteria 2568
340 Ga0157380_10000325 3300014326 Bacteria 28843
341 Ga0157380_10007519 3300014326 Bacteria 7739
342 Ga0157380_10347251 3300014326 Bacteria 1387
343 Ga0182008_10002412 3300014497 Bacteria 11737
344 Ga0182008_10013003 3300014497 Bacteria 4379
345 Ga0182008_10047525 3300014497 Bacteria 2132
346 Ga0157379_10020026 3300014968 Bacteria 5913
347 Ga0157379_10200051 3300014968 Bacteria 1807
348 Ga0157379_10228856 3300014968 Bacteria 1685
349 Ga0157376_10002090 3300014969 Bacteria 13430
350 Ga0157376_10039071 3300014969 Bacteria 3867
351 Ga0157376_10059668 3300014969 Bacteria 3199
352 Ga0182006_1002028 3300015261 Bacteria 11368
353 Ga0182006_1043206 3300015261 Bacteria 1762
354 Ga0182006_1059276 3300015261 Bacteria 1450
355 Ga0182007_10001040 3300015262 Bacteria 15203
356 Ga0182007_10010076 3300015262 Bacteria 3760
357 Ga0182007_10010490 3300015262 Bacteria 3656
358 Ga0182007_10010979 3300015262 Bacteria 3547
359 Ga0182005_1031995 3300015265 Bacteria 1432
360 Ga0163161_10000057 3300017792 Bacteria 114339
361 Ga0163161_10030363 3300017792 Bacteria 3846
362 Ga0163161_10101528 3300017792 Bacteria 2142
363 Ga0206356_11628886 3300020070 Bacteria 5585
364 Ga0206351_10745048 3300020077 Bacteria 9435
365 Ga0154015_1245876 3300020610 Bacteria 30783
366 Ga0213872_10000256 3300021361 Bacteria 46367
367 Ga0213872_10020201 3300021361 Bacteria 3069
368 Ga0213876_10098049 3300021384 Bacteria 1553
369 Ga0209784_100029 3300025224 Bacteria 347315
370 Ga0209566_100030 3300025225 Bacteria 347329
371 Ga0209566_101369 3300025225 Bacteria 7596
372 Ga0209566_102510 3300025225 Bacteria 3350
373 Ga0209674_100075 3300025226 Bacteria 216004
374 Ga0209672_100178 3300025228 Bacteria 52778
375 Ga0209672_100721 3300025228 Bacteria 16329
376 Ga0209147_100008 3300025229 Bacteria 777096
377 Ga0209563_100005 3300025230 Bacteria 1774893
378 Ga0209563_100117 3300025230 Bacteria 132048
379 Ga0209437_101870 3300025233 Bacteria 4430
380 Ga0209258_100013 3300025242 Bacteria 777096
381 Ga0209258_100158 3300025242 Bacteria 156881
382 Ga0209677_100030 3300025253 Bacteria 347314
383 Ga0209677_100248 3300025253 Bacteria 36912
384 Ga0209148_1000092 3300025254 Bacteria 249076
385 Ga0209148_1002665 3300025254 Bacteria 5746
386 Ga0209759_1002970 3300025256 Bacteria 7057
387 Ga0209233_1000340 3300025261 Bacteria 45824
388 Ga0209565_1001410 3300025263 Bacteria 10658
389 Ga0209565_1018256 3300025263 Bacteria 1520
390 Ga0209455_1000130 3300025272 Bacteria 161669
391 Ga0209455_1005930 3300025272 Bacteria 3685
392 Ga0209675_1000050 3300025291 Bacteria 212222
393 Ga0209675_1018444 3300025291 Bacteria 1953
394 Ga0209676_1000053 3300025292 Bacteria 370111
395 Ga0209676_1001174 3300025292 Bacteria 28334
396 Ga0209676_1006985 3300025292 Bacteria 5427
397 Ga0209025_1000093 3300025294 Bacteria 241788
398 Ga0209025_1004087 3300025294 Bacteria 13012
399 Ga0209564_1000211 3300025295 Bacteria 133277
400 Ga0209564_1002127 3300025295 Bacteria 16795
401 Ga0209564_1002156 3300025295 Bacteria 16604
402 Ga0209758_1000349 3300025297 Bacteria 84164
403 Ga0209758_1036668 3300025297 Bacteria 1909
404 Ga0209050_1001493 3300025298 Bacteria 24848
405 Ga0209256_1000538 3300025299 Bacteria 54992
406 Ga0209051_1000924 3300025303 Bacteria 29157
407 Ga0209051_1006399 3300025303 Bacteria 6645
408 Ga0209257_1000598 3300025304 Bacteria 59869
409 Ga0207697_10103774 3300025315 Bacteria 1213
410 Ga0207655_1000885 3300025728 Bacteria 31714
411 Ga0207655_1030163 3300025728 Bacteria 2527
412 Ga0207713_1046306 3300025735 Bacteria 1769
413 Ga0207642_10008016 3300025899 Bacteria 3600
414 Ga0207680_10000007 3300025903 Bacteria 623574
415 Ga0207647_10016643 3300025904 Bacteria 5014
416 Ga0207645_10004107 3300025907 Bacteria 10831
417 Ga0207643_10061099 3300025908 Bacteria 2152
418 Ga0207705_10011507 3300025909 Bacteria 6400
419 Ga0207654_10003667 3300025911 Bacteria 7747
420 Ga0207654_10085380 3300025911 Bacteria 1910
421 Ga0207654_10208476 3300025911 Bacteria 1290
422 Ga0207707_10007428 3300025912 Bacteria 9548
423 Ga0207707_10046166 3300025912 Bacteria 3793
424 Ga0207707_10300623 3300025912 Bacteria 1388
425 Ga0207707_10314034 3300025912 Bacteria 1354
426 Ga0207695_10005037 3300025913 Bacteria 17741
427 Ga0207695_10009597 3300025913 Bacteria 11953
428 Ga0207695_10021604 3300025913 Bacteria 7337
429 Ga0207695_10082586 3300025913 Plasmid 3247
430 Ga0207671_10001189 3300025914 Bacteria 30894
431 Ga0207671_10157292 3300025914 Bacteria 1758
432 Ga0207671_10264108 3300025914 Bacteria 1355
433 Ga0207663_10346632 3300025916 Bacteria 1123
434 Ga0207660_10009000 3300025917 Bacteria 6461
435 Ga0207660_10128401 3300025917 Bacteria 1927
436 Ga0207657_10078269 3300025919 Bacteria 2784
437 Ga0207649_10000030 3300025920 Bacteria 154458
438 Ga0207652_10010117 3300025921 Bacteria 7598
439 Ga0207652_10026130 3300025921 Bacteria 4860
440 Ga0207652_10699067 3300025921 Bacteria 905
441 Ga0207681_10002214 3300025923 Bacteria 12380
442 Ga0207694_10016307 3300025924 Bacteria 5608
443 Ga0207650_10008268 3300025925 Bacteria 7104
444 Ga0207650_10016778 3300025925 Bacteria 5121
445 Ga0207659_10147503 3300025926 Bacteria 1833
446 Ga0207687_10002040 3300025927 Bacteria 13851
447 Ga0207687_10267913 3300025927 Bacteria 1364
448 Ga0207664_10011490 3300025929 Bacteria 6299
449 Ga0207664_10031159 3300025929 Bacteria 4077
450 Ga0207644_10000121 3300025931 Bacteria 57269
451 Ga0207644_10254077 3300025931 Bacteria 1403
452 Ga0207690_10001021 3300025932 Bacteria 17926
453 Ga0207690_10008695 3300025932 Bacteria 6024
454 Ga0207690_10012406 3300025932 Bacteria 5096
455 Ga0207706_10013054 3300025933 Bacteria 7559
456 Ga0207706_10027735 3300025933 Bacteria 5062
457 Ga0207706_10041302 3300025933 Bacteria 4089
458 Ga0207706_10041900 3300025933 Bacteria 4057
459 Ga0207706_10651558 3300025933 Bacteria 902
460 Ga0207686_10070672 3300025934 Bacteria 2244
461 Ga0207686_10591545 3300025934 Bacteria 872
462 Ga0207709_10004576 3300025935 Bacteria 7962
463 Ga0207704_10072113 3300025938 Bacteria 2194
464 Ga0207665_10163772 3300025939 Bacteria 1601
465 Ga0207691_10000575 3300025940 Bacteria 36701
466 Ga0207691_10290528 3300025940 Bacteria 1406
467 Ga0207711_10004771 3300025941 Bacteria 11509
468 Ga0207711_10013297 3300025941 Bacteria 6837
469 Ga0207711_10019873 3300025941 Bacteria 5598
470 Ga0207711_10029581 3300025941 Bacteria 4622
471 Ga0207689_10027859 3300025942 Bacteria 4727
472 Ga0207689_10587338 3300025942 Bacteria 937
473 Ga0207661_10040878 3300025944 Bacteria 3648
474 Ga0207661_10266582 3300025944 Bacteria 1527
475 Ga0207661_10398247 3300025944 Bacteria 1248
476 Ga0207679_10000004 3300025945 Bacteria 589021
477 Ga0207679_10094057 3300025945 Bacteria 2326
478 Ga0207667_10004203 3300025949 Bacteria 17674
479 Ga0207667_10007423 3300025949 Bacteria 13174
480 Ga0207712_10000004 3300025961 Bacteria 614655
481 Ga0207712_10042902 3300025961 Bacteria 3118
482 Ga0207668_10000166 3300025972 Bacteria 45782
483 Ga0207668_10054097 3300025972 Bacteria 2785
484 Ga0207668_10078011 3300025972 Bacteria 2390
485 Ga0207640_10000039 3300025981 Bacteria 107982
486 Ga0207640_10000595 3300025981 Bacteria 21495
487 Ga0207640_10139724 3300025981 Bacteria 1764
488 Ga0207640_10197393 3300025981 Bacteria 1522
489 Ga0207658_10000328 3300025986 Bacteria 47873
490 Ga0207658_10000462 3300025986 Bacteria 38001
491 Ga0207658_10212823 3300025986 Bacteria 1621
492 Ga0207658_10437372 3300025986 Bacteria 1156
493 Ga0207677_10384993 3300026023 Bacteria 1185
494 Ga0207703_10126192 3300026035 Bacteria 2204
495 Ga0207639_10139809 3300026041 Bacteria 2016
496 Ga0207639_10173652 3300026041 Bacteria 1827
497 Ga0207639_10262228 3300026041 Bacteria 1512
498 Ga0207678_10000006 3300026067 Bacteria 188733
499 Ga0207678_10066935 3300026067 Bacteria 3084
500 Ga0207678_10428979 3300026067 Bacteria 1147
501 Ga0207708_10073140 3300026075 Bacteria 2627
502 Ga0207708_10155144 3300026075 Bacteria 1805
503 Ga0207702_10000206 3300026078 Bacteria 70068
504 Ga0207702_10009722 3300026078 Bacteria 8077
505 Ga0207702_10083392 3300026078 Bacteria 2781
506 Ga0207641_10000263 3300026088 Bacteria 66525
507 Ga0207641_10000582 3300026088 Bacteria 40259
508 Ga0207641_10013287 3300026088 Bacteria 6755
509 Ga0207641_10016644 3300026088 Bacteria 6020
510 Ga0207641_10137585 3300026088 Bacteria 2200
511 Ga0207648_10250716 3300026089 Bacteria 1578
512 Ga0207676_10000578 3300026095 Bacteria 30142
513 Ga0207676_10056843 3300026095 Bacteria 3078
514 Ga0207676_10121087 3300026095 Bacteria 2207
515 Ga0207676_10176649 3300026095 Bacteria 1866
516 Ga0207674_10016609 3300026116 Bacteria 8049
517 Ga0207675_100000131 3300026118 Bacteria 62791
518 Ga0207675_100001855 3300026118 Bacteria 21175
519 Ga0207675_100002202 3300026118 Bacteria 19367
520 Ga0207675_100003015 3300026118 Bacteria 16511
521 Ga0207683_10034058 3300026121 Bacteria 4426
522 Ga0207683_10042935 3300026121 Bacteria 3949
523 Ga0207683_10400897 3300026121 Bacteria 1262
524 Ga0207683_10527396 3300026121 Bacteria 1091
525 Ga0207698_10011260 3300026142 Bacteria 5791
526 Ga0207698_10062401 3300026142 Bacteria 2910
527 Ga0207698_10266046 3300026142 Bacteria 1578
528 Ga0207698_10286053 3300026142 Bacteria 1527
529 Ga0209281_1000064 3300027111 Bacteria 287876
530 Ga0209282_1000066 3300027666 Bacteria 87072
531 Ga0209282_1000081 3300027666 Bacteria 71750
532 Ga0207428_10139858 3300027907 Bacteria 1849
533 Ga0265354_1000840 3300028016 Bacteria 4950
534 Ga0265357_1000102 3300028023 Bacteria 3341
535 Ga0268266_10015846 3300028379 Bacteria 6452
536 Ga0268266_10058588 3300028379 Bacteria 3316
537 Ga0268266_10089707 3300028379 Bacteria 2693
538 Ga0268265_10000266 3300028380 Bacteria 59618
539 Ga0268265_10035901 3300028380 Bacteria 3626
540 Ga0268265_10037739 3300028380 Bacteria 3548
541 Ga0268264_10000003 3300028381 Bacteria 1141976
542 Ga0268264_10002685 3300028381 Bacteria 15533
543 Ga0268264_10108683 3300028381 Bacteria 2425
544 Ga0268264_10245401 3300028381 Bacteria 1661
545 Ga0265337_1027775 3300028556 Bacteria 1703
546 Ga0265334_10026302 3300028573 Bacteria 2349
547 Ga0265318_10004532 3300028577 Bacteria 6714
548 Ga0265318_10035698 3300028577 Bacteria 1910
549 Ga0265338_10008160 3300028800 Bacteria 12774
550 Ga0265338_10047685 3300028800 Bacteria 3910
551 Ga0265338_10056651 3300028800 Bacteria 3473
552 Ga0265338_10114013 3300028800 Bacteria 2170
553 Ga0237817_10015 3300030083 Bacteria 73147
554 Ga0307511_10001633 3300030521 Bacteria 23697
555 Ga0307511_10148041 3300030521 Bacteria 1357
556 Ga0316183_1060816 3300030742 Bacteria 7885
557 Ga0265771_1000126 3300031010 Bacteria 2037
558 Ga0265760_10000274 3300031090 Bacteria 13951
559 Ga0265760_10006202 3300031090 Bacteria 3418
560 Ga0265332_10005747 3300031238 Bacteria 5697
561 Ga0265320_10004192 3300031240 Bacteria 9473
562 Ga0265325_10008191 3300031241 Bacteria 6190
563 Ga0265327_10200214 3300031251 Bacteria 905
564 Ga0265316_10217443 3300031344 Bacteria 1411
565 Ga0307513_10000090 3300031456 Bacteria 129750
566 Ga0307513_10122883 3300031456 Bacteria 2559
567 Ga0307509_10235780 3300031507 Bacteria 1628
568 Ga0307509_10332975 3300031507 Bacteria 1249
569 Ga0307408_100000032 3300031548 Bacteria 213693
570 Ga0307408_100000364 3300031548 Bacteria 41737
571 Ga0307408_100000612 3300031548 Bacteria 30454
572 Ga0307408_100004980 3300031548 Bacteria 8924
573 Ga0307408_100005474 3300031548 Bacteria 8493
574 Ga0307408_100281295 3300031548 Bacteria 1386
575 Ga0265313_10000939 3300031595 Bacteria 28951
576 Ga0307508_10066349 3300031616 Bacteria 3178
577 Ga0307508_10206345 3300031616 Bacteria 1566
578 Ga0265314_10103094 3300031711 Bacteria 1829
579 Ga0316576_10024396 3300031727 Bacteria 4222
580 Ga0316576_10215141 3300031727 Unclassified 1446
581 Ga0307516_10362264 3300031730 Bacteria 1114
582 Ga0307405_10007500 3300031731 Bacteria 5462
583 Ga0307413_10010139 3300031824 Bacteria 4551
584 Ga0307413_10406488 3300031824 Bacteria 1068
585 Ga0307413_10444787 3300031824 Bacteria 1027
586 Ga0307410_10000015 3300031852 Bacteria 73395
587 Ga0307410_10001538 3300031852 Bacteria 10515
588 Ga0307406_10000454 3300031901 Bacteria 23796
589 Ga0307406_10022530 3300031901 Bacteria 3738
590 Ga0307406_10033934 3300031901 Bacteria 3127
591 Ga0307407_10004658 3300031903 Bacteria 5853
592 Ga0307407_10029021 3300031903 Bacteria 2965
593 Ga0307407_10063555 3300031903 Bacteria 2166
594 Ga0307412_10012487 3300031911 Bacteria 4955
595 Ga0307412_10037471 3300031911 Bacteria 3116
596 Ga0307412_10195347 3300031911 Unclassified 1533
597 Ga0307409_100000111 3300031995 Bacteria 30018
598 Ga0307409_100014852 3300031995 Bacteria 5085
599 Ga0307409_100024332 3300031995 Bacteria 4221
600 Ga0307416_100000038 3300032002 Bacteria 136704
601 Ga0307416_100003964 3300032002 Bacteria 8817
602 Ga0307416_100006832 3300032002 Bacteria 7180
603 Ga0307416_100007558 3300032002 Bacteria 6926
604 Ga0307416_100035622 3300032002 Bacteria 3804
605 Ga0307416_100193506 3300032002 Bacteria 1921
606 Ga0307414_10002982 3300032004 Bacteria 8962
607 Ga0307411_10002190 3300032005 Bacteria 8491
608 Ga0307415_100001167 3300032126 Bacteria 12279
609 Ga0307415_100668915 3300032126 Bacteria 933
610 Ga0307510_10036531 3300033180 Bacteria 5466
611 Ga0373926_0017293 3300035083 Bacteria 2474
612 Ga0373923_0036587 3300035111 Bacteria 2004
613 Ga0373932_0019569 3300035112 Bacteria 1766
614 Ga0373945_0052762 3300035116 Bacteria 1499
615 Ga0373954_0001145 3300035118 Bacteria 10665
616 Ga0373954_0080525 3300035118 Bacteria 1556
617 Ga0373957_0001986 3300035120 Bacteria 5711
618 Ga0373943_0001477 3300035170 Bacteria 10643
619 Ga0373955_0001023 3300035172 Bacteria 11872
620 Ga0373924_0001191 3300035410 Bacteria 8373
621 Ga0373931_0008709 3300035691 Bacteria 4827
622 Ga0373935_0000161 3300035692 Bacteria 30905
623 Ga0373935_0049948 3300035692 Bacteria 2653
624 Ga0373927_0038675 3300035695 Bacteria 3097
625 Ga0373927_0327213 3300035695 Bacteria 1009
626 Ga0373947_0002132 3300035725 Bacteria 12049
627 Ga0373947_0032276 3300035725 Bacteria 3085
628 Ga0373937_0000256 3300036401 Bacteria 51768
629 Ga0373937_0010619 3300036401 Bacteria 8047
630 Ga0373937_0101869 3300036401 Bacteria 2665
631 Ga0373937_0119531 3300036401 Bacteria 2455
632 Ga0373937_0278798 3300036401 Bacteria 1578
633 Ga0373937_0306755 3300036401 Bacteria 1501
634 Ga0316584_0015557 3300036712 Bacteria 5442
635 Ga0373925_0000087 3300037068 Bacteria 99043
636 Ga0395899_0142327 3300037312 Bacteria 1705
637 Ga0395900_0008015 3300037418 Bacteria 10869
638 Ga0395900_0026342 3300037418 Bacteria 5955
639 Ga0395900_0026620 3300037418 Bacteria 5922
640 Ga0395900_0127410 3300037418 Bacteria 2610
641 Ga0395898_0008110 3300037466 Bacteria 11117
642 Ga0395905_0000003 3300037471 Bacteria 1347396
643 Ga0395905_0000678 3300037471 Bacteria 45181
644 Ga0395905_0003795 3300037471 Bacteria 15977
645 Ga0395905_0010178 3300037471 Bacteria 9165
646 Ga0395905_0011428 3300037471 Bacteria 8579
647 Ga0395905_0013029 3300037471 Bacteria 7988
648 Ga0395901_0025008 3300038443 Bacteria 6129
649 Ga0395901_0026526 3300038443 Bacteria 5949
650 Ga0395901_0622179 3300038443 Bacteria 1086
651 Ga0237819_01424 3300038705 Bacteria 6186
652 Ga0237819_05966 3300038705 Bacteria 1869
653 Ga0400490_13146 3300038726 Bacteria 15035
654 Ga0400490_42190 3300038726 Bacteria 6698
655 Ga0400488_36200 3300038741 Bacteria 5476
656 Ga0400483_027285 3300039062 Bacteria 3313
657 Ga0400489_45819 3300039093 Bacteria 3427
658 Ga0400489_71985 3300039093 Bacteria 1929
659 Ga0400487_43094 3300039110 Bacteria 17442
660 Ga0436365_0827163 3300039437 Bacteria 2158
661 Ga0436360_0549688 3300039438 Bacteria 1913
662 Ga0436360_0757569 3300039438 Bacteria 1479
663 Ga0436361_0051717 3300039447 Bacteria 5904
664 Ga0436361_0151105 3300039447 Bacteria 6131
665 Ga0436361_0295037 3300039447 Bacteria 2369
666 Ga0436361_0677882 3300039447 Bacteria 228834
667 Ga0436361_1123576 3300039447 Bacteria 2210
668 Ga0451843_1071893 3300041509 Bacteria 1367
669 Ga0439433_0002009 3300041999 Bacteria 4269
670 Ga0439441_000192 3300042001 Bacteria 5560
671 Ga0439445_0015704 3300042004 Bacteria 1857
672 Ga0439449_0000154 3300042007 Bacteria 23362
673 Ga0439451_000122 3300042009 Bacteria 14186
674 Ga0439456_000640 3300042013 Bacteria 7263
675 Ga0439462_0000779 3300042015 Bacteria 6620
676 Ga0439463_000134 3300042016 Bacteria 18645
677 Ga0450911_000168 3300042115 Bacteria 25689
678 Ga0450913_007014 3300042117 Bacteria 840
679 Ga0450923_003258 3300042125 Bacteria 2429
680 Ga0450903_000726 3300042138 Bacteria 6518
681 Ga0450905_003879 3300042142 Bacteria 1968
682 Ga0439464_0002454 3300042439 Bacteria 4560
683 Ga0439460_0000538 3300042461 Bacteria 8276
684 Ga0451577_0000011 3300042876 Bacteria 597389
685 Ga0451577_0000219 3300042876 Bacteria 118088
686 Ga0451577_0000761 3300042876 Bacteria 49103
687 Ga0451577_0013357 3300042876 Bacteria 7689
688 Ga0451577_0016785 3300042876 Bacteria 6770
689 Ga0451577_0037400 3300042876 Bacteria 4369
690 Ga0451577_0068367 3300042876 Bacteria 3168
691 Ga0451577_0073801 3300042876 Bacteria 3044
692 Ga0439440_0000578 3300042993 Bacteria 6204
693 Ga0466986_0015418 3300044650 Bacteria 4890
694 Ga0453683_0000054 3300044673 Bacteria 194357
695 Ga0453683_0000313 3300044673 Bacteria 60061
696 Ga0453683_0097412 3300044673 Bacteria 1846
697 Ga0466966_0155885 3300044684 Bacteria 1391
698 Ga0466966_0213074 3300044684 Bacteria 1167
699 Ga0466961_0000213 3300044693 Bacteria 39056
700 Ga0453684_0000087 3300044712 Bacteria 395597
701 Ga0453684_0000114 3300044712 Bacteria 356610
702 Ga0453684_0000210 3300044712 Bacteria 255463
703 Ga0453684_0000381 3300044712 Bacteria 181609
704 Ga0453684_0000947 3300044712 Bacteria 95768
705 Ga0453684_0001345 3300044712 Bacteria 72030
706 Ga0453684_0007495 3300044712 Archaea 20020
707 Ga0453684_0008486 3300044712 Bacteria 18374
708 Ga0453684_0008826 3300044712 Bacteria 17873
709 Ga0453684_0010397 3300044712 Bacteria 15923
710 Ga0453684_0034369 3300044712 Bacteria 7037
711 Ga0453684_0042573 3300044712 Bacteria 6121
712 Ga0453684_0051916 3300044712 Bacteria 5368
713 Ga0453684_0125685 3300044712 Bacteria 3087
714 Ga0453684_0222068 3300044712 Bacteria 2188
715 Ga0453684_0662980 3300044712 Bacteria 1137
716 Ga0453684_0788165 3300044712 Bacteria 1026
717 Ga0466959_0001157 3300045049 Bacteria 15891
718 Ga0466959_0057462 3300045049 Bacteria 2836
719 Ga0451576_0002484 3300045051 Bacteria 27384
720 Ga0451576_0003256 3300045051 Bacteria 22524
721 Ga0451576_0003616 3300045051 Bacteria 21008
722 Ga0451576_0005653 3300045051 Bacteria 15615
723 Ga0451576_0020607 3300045051 Bacteria 7176
724 Ga0451576_0027071 3300045051 Bacteria 6162
725 Ga0451576_0035954 3300045051 Bacteria 5253
726 Ga0451576_0108140 3300045051 Bacteria 2894
727 Ga0451576_0138209 3300045051 Bacteria 2541
728 Ga0451576_0170525 3300045051 Bacteria 2271
729 Ga0466958_0000259 3300045836 Bacteria 20492
730 Ga0466967_0001151 3300045976 Bacteria 14779
731 Ga0495617_016103 3300046452 Bacteria 2529
732 Ga0495592_0000001 3300046454 Bacteria 305819
733 Ga0495590_0037613 3300046457 Bacteria 1687
734 Ga0495629_0036170 3300046459 Bacteria 3487
735 Ga0495638_0008030 3300046460 Bacteria 7516
736 Ga0495638_0011178 3300046460 Bacteria 6200
737 Ga0495651_0000078 3300046462 Bacteria 71749
738 Ga0495651_0062806 3300046462 Bacteria 2841
739 Ga0495653_0000015 3300046463 Bacteria 213697
740 Ga0495650_0001461 3300046471 Bacteria 22661
741 Ga0495650_0039176 3300046471 Bacteria 2047
742 Ga0495580_0000685 3300046472 Bacteria 28893
743 Ga0495580_0114224 3300046472 Bacteria 1876
744 Ga0495580_0293037 3300046472 Bacteria 1109
745 Ga0495605_0000759 3300046474 Bacteria 23640
746 Ga0495605_0001152 3300046474 Bacteria 17537
747 Ga0495662_0013543 3300046476 Bacteria 3969
748 Ga0495664_0000001 3300046477 Bacteria 757730
749 Ga0495584_0140364 3300046491 Bacteria 1227
750 Ga0495585_0090226 3300046492 Bacteria 1651
751 Ga0495596_0000011 3300046500 Bacteria 129089
752 Ga0495607_0003197 3300046501 Bacteria 12655
753 Ga0495583_0006197 3300046506 Bacteria 7872
754 Ga0495583_0010518 3300046506 Bacteria 5391
755 Ga0495606_0001564 3300046507 Bacteria 30026
756 Ga0495606_0014696 3300046507 Bacteria 6087
757 Ga0495608_0000066 3300046511 Bacteria 81664
758 Ga0495608_0060271 3300046511 Bacteria 2497
759 Ga0495610_0000162 3300046512 Bacteria 74163
760 Ga0495610_0161456 3300046512 Bacteria 947
761 Ga0495616_0000024 3300046513 Bacteria 145530
762 Ga0495616_0007343 3300046513 Bacteria 6593
763 Ga0495616_0066090 3300046513 Bacteria 1760
764 Ga0495618_0000021 3300046514 Bacteria 129750
765 Ga0495620_0000002 3300046515 Bacteria 373737
766 Ga0495620_0001167 3300046515 Bacteria 16094
767 Ga0495628_0000005 3300046516 Bacteria 420969
768 Ga0495630_0017055 3300046517 Bacteria 5315
769 Ga0495631_0051146 3300046518 Bacteria 1806
770 Ga0495632_0000955 3300046519 Bacteria 25262
771 Ga0495637_0004602 3300046520 Bacteria 7127
772 Ga0495643_0000782 3300046522 Bacteria 35381
773 Ga0495643_0003464 3300046522 Bacteria 11525
774 Ga0495643_0216728 3300046522 Bacteria 910
775 Ga0495648_0000645 3300046524 Bacteria 37175
776 Ga0495648_0001948 3300046524 Bacteria 19665
777 Ga0495648_0003713 3300046524 Bacteria 13340
778 Ga0495648_0009121 3300046524 Bacteria 7736
779 Ga0495648_0183871 3300046524 Bacteria 1060
780 Ga0495652_0000001 3300046529 Bacteria 1045081
781 Ga0495654_0000491 3300046530 Bacteria 32540
782 Ga0495654_0011699 3300046530 Bacteria 4741
783 Ga0495640_0000006 3300046533 Bacteria 285419
784 Ga0495586_0249196 3300046535 Bacteria 1013
785 Ga0495587_0000012 3300046536 Bacteria 197088
786 Ga0495609_0001374 3300046538 Bacteria 16350
787 Ga0495609_0004334 3300046538 Bacteria 7795
788 Ga0495609_0058819 3300046538 Bacteria 1700
789 Ga0495621_0023957 3300046539 Bacteria 2034
790 Ga0495597_0019454 3300046542 Bacteria 3178
791 Ga0495645_0000041 3300046543 Bacteria 92278
792 Ga0495645_0052455 3300046543 Bacteria 2967
793 Ga0495645_0092025 3300046543 Bacteria 2166
794 Ga0495633_0209406 3300046558 Bacteria 894
795 Ga0495667_0000001 3300046559 Bacteria 834831
796 Ga0495656_0126005 3300046615 Bacteria 1214
797 Ga0495668_0010122 3300046616 Bacteria 5735
798 Ga0495668_0031780 3300046616 Bacteria 2974
799 Ga0495668_0128632 3300046616 Bacteria 1386
800 Ga0495634_0000313 3300046642 Bacteria 46617
801 Ga0495611_0000001 3300046648 Bacteria 2628469
802 Ga0495625_0000037 3300046660 Bacteria 219383
803 Ga0495625_0020728 3300046660 Bacteria 5068
804 Ga0495625_0171373 3300046660 Bacteria 1449
805 Ga0495635_0000007 3300046663 Bacteria 278786
806 Ga0495661_0004835 3300046665 Bacteria 9654
807 Ga0495588_0208404 3300046674 Bacteria 1032
808 Ga0495657_0000047 3300046675 Bacteria 104362
809 Ga0495599_0000002 3300046678 Bacteria 348168
810 Ga0495623_0000023 3300046679 Bacteria 96650
811 Ga0495646_0000024 3300046680 Bacteria 107836
812 Ga0495658_0110150 3300046683 Bacteria 1655
813 Ga0495658_0293126 3300046683 Bacteria 1028
814 Ga0495669_0019329 3300046684 Bacteria 2940
815 Ga0495669_0029553 3300046684 Bacteria 2404
816 Ga0495613_0328771 3300046689 Bacteria 1054
817 Ga0495670_0003337 3300046691 Bacteria 7903
818 Ga0495670_0188104 3300046691 Bacteria 1091
819 Ga0495671_0000925 3300046692 Bacteria 20789
820 Ga0495671_0008172 3300046692 Bacteria 5904
821 Ga0495649_0007649 3300046694 Bacteria 6563
822 Ga0495589_0000366 3300046794 Bacteria 35102
823 Ga0495600_0000013 3300046809 Bacteria 119404
824 Ga0495600_0070662 3300046809 Bacteria 2281
825 Ga0495604_0000007 3300047317 Bacteria 412174
826 Ga0495604_0047820 3300047317 Bacteria 3330
827 Ga0495674_0000001 3300047319 Bacteria 778665
828 Ga0495674_0205187 3300047319 Bacteria 1634
829 Ga0495674_0312800 3300047319 Bacteria 1281
830 Ga0495672_0013927 3300047320 Bacteria 5528
831 Ga0495680_0001662 3300047322 Bacteria 23652
832 Ga0495683_0000194 3300047323 Bacteria 57773
833 Ga0495675_0000014 3300047444 Bacteria 137646
834 Ga0495675_0002266 3300047444 Bacteria 11482
835 Ga0495677_0155694 3300047445 Bacteria 881
836 Ga0495679_000001 3300047446 Bacteria 1607568
837 Ga0495673_0000607 3300047469 Bacteria 35637
838 Ga0495673_0036135 3300047469 Bacteria 2269
839 Ga0495684_0000027 3300047471 Bacteria 124367
840 Ga0495684_0410479 3300047471 Bacteria 949
841 Ga0495593_0000830 3300047673 Bacteria 17953
842 Ga0495602_0000004 3300048088 Bacteria 326932
843 Ga0496100_0013011 3300048903 Bacteria 4788
844 Ga0496100_0097304 3300048903 Bacteria 2021
845 Ga0496101_0485972 3300048904 Bacteria 975
846 Ga0496102_0011442 3300048905 Bacteria 7650
847 Ga0496102_0035649 3300048905 Bacteria 4478
848 Ga0496102_0273990 3300048905 Bacteria 1591
849 Ga0496103_0001011 3300048906 Bacteria 19667
850 Ga0496103_0082528 3300048906 Bacteria 2023
851 Ga0496104_0003666 3300048907 Bacteria 13261
852 Ga0496105_0207615 3300048908 Bacteria 1597
853 Ga0496105_0282806 3300048908 Bacteria 1337
854 Ga0496106_0088788 3300048909 Bacteria 2383
855 Ga0496106_0492133 3300048909 Bacteria 985
856 Ga0496110_0488163 3300048913 Bacteria 1122
857 Ga0496115_0327296 3300048918 Bacteria 1252
858 Ga0496116_0002738 3300048919 Bacteria 18106
859 Ga0496116_0003529 3300048919 Bacteria 15396
860 Ga0496116_0009769 3300048919 Bacteria 8139
861 Ga0496116_0049115 3300048919 Bacteria 2825
862 Ga0496117_0002061 3300048920 Bacteria 26591
863 Ga0496117_0002856 3300048920 Bacteria 21010
864 Ga0496117_0004128 3300048920 Bacteria 16255
865 Ga0496117_0007412 3300048920 Bacteria 10729
866 Ga0496117_0083164 3300048920 Bacteria 2094
867 Ga0496118_0004752 3300048921 Bacteria 15892
868 Ga0496118_0006005 3300048921 Bacteria 13541
869 Ga0496118_0015795 3300048921 Bacteria 6964
870 Ga0496118_0017662 3300048921 Bacteria 6478
871 Ga0496118_0083503 3300048921 Bacteria 2233
872 Ga0496119_0000049 3300048922 Bacteria 185482
873 Ga0496119_0003046 3300048922 Bacteria 17734
874 Ga0496119_0019062 3300048922 Bacteria 5073
875 Ga0496119_0066281 3300048922 Bacteria 2134
876 Ga0496120_0001178 3300048923 Bacteria 33301
877 Ga0496120_0001489 3300048923 Bacteria 27770
878 Ga0496120_0078867 3300048923 Bacteria 1789
879 Ga0496120_0227841 3300048923 Bacteria 886
880 Ga0496121_0002612 3300048924 Bacteria 27213
881 Ga0496121_0011198 3300048924 Bacteria 9997
882 Ga0496121_0011520 3300048924 Bacteria 9800
883 Ga0496121_0029865 3300048924 Bacteria 5023
884 Ga0496121_0049678 3300048924 Bacteria 3553
885 Ga0496121_0079495 3300048924 Bacteria 2603
886 Ga0496121_0085981 3300048924 Bacteria 2473
887 Ga0496121_0307949 3300048924 Bacteria 1072
888 Ga0496122_0004704 3300048925 Bacteria 16763
889 Ga0496122_0007770 3300048925 Bacteria 11795
890 Ga0496122_0011176 3300048925 Bacteria 9143
891 Ga0496122_0048982 3300048925 Bacteria 3243
892 Ga0496122_0084041 3300048925 Bacteria 2204
893 Ga0496123_0007892 3300048926 Bacteria 9891
894 Ga0496123_0063982 3300048926 Bacteria 2346
895 Ga0496123_0072684 3300048926 Bacteria 2138
896 Ga0496124_0002268 3300048927 Bacteria 25494
897 Ga0496124_0003913 3300048927 Bacteria 17798
898 Ga0496124_0006624 3300048927 Bacteria 12571
899 Ga0496124_0028679 3300048927 Bacteria 4976
900 Ga0496124_0079040 3300048927 Bacteria 2709
901 Ga0496124_0200297 3300048927 Bacteria 1519
902 Ga0496125_0003624 3300048928 Bacteria 18533
903 Ga0496125_0006720 3300048928 Bacteria 12368
904 Ga0496125_0006748 3300048928 Bacteria 12334
905 Ga0496125_0009915 3300048928 Bacteria 9686
906 Ga0496125_0012895 3300048928 Bacteria 8255
907 Ga0496125_0015028 3300048928 Bacteria 7518
908 Ga0496125_0021749 3300048928 Bacteria 5970
909 Ga0496125_0036054 3300048928 Bacteria 4326
910 Ga0496125_0048634 3300048928 Bacteria 3534
911 Ga0496126_0005826 3300048929 Bacteria 13933
912 Ga0496126_0018668 3300048929 Bacteria 6863
913 Ga0496126_0085799 3300048929 Bacteria 2775
914 Ga0496126_0189715 3300048929 Bacteria 1742
915 Ga0496126_0223815 3300048929 Bacteria 1579
916 Ga0496126_0271330 3300048929 Bacteria 1408
917 Ga0496126_0505738 3300048929 Bacteria 965
918 Ga0501307_006741 3300049162 Bacteria 1249
919 Ga0495678_000028 3300049459 Bacteria 220080
920 Ga0495682_0000265 3300049460 Bacteria 41386
921 Ga0495682_0061543 3300049460 Bacteria 1355
922 Ga0501300_000569 3300049523 Bacteria 5528
923 Ga0501300_009079 3300049523 Bacteria 1453
924 Ga0501031_0043942 3300049568 Bacteria 2915
925 Ga0501032_0024784 3300049569 Bacteria 4139
926 Ga0501033_0004466 3300049570 Bacteria 11188
927 Ga0501033_0320932 3300049570 Bacteria 1088
928 Ga0501034_0014595 3300049571 Bacteria 8088
929 Ga0501034_0129722 3300049571 Bacteria 2505
930 Ga0501034_0140064 3300049571 Bacteria 2399
931 Ga0501036_0045926 3300049572 Bacteria 3699
932 Ga0501041_0022949 3300049577 Bacteria 3740
933 Ga0501041_0079675 3300049577 Bacteria 2016
934 Ga0501042_0013949 3300049578 Bacteria 5475
935 Ga0501042_0167048 3300049578 Bacteria 1587
936 Ga0501043_0054085 3300049579 Bacteria 3153
937 Ga0501046_0165870 3300049580 Bacteria 1660
938 Ga0501047_0329837 3300049581 Bacteria 1365
939 Ga0501048_0086169 3300049582 Bacteria 2216
940 Ga0501070_0059333 3300049586 Bacteria 3172
941 Ga0501071_0263139 3300049587 Bacteria 1303
942 Ga0501072_0019483 3300049588 Bacteria 5246
943 Ga0501073_0022929 3300049589 Bacteria 4490
944 Ga0501076_0033043 3300049592 Bacteria 4039
945 Ga0501077_0131186 3300049593 Bacteria 1589
946 Ga0501259_000005 3300049688 Bacteria 33928
947 Ga0501081_0010148 3300049743 Bacteria 6146
948 Ga0501081_0018659 3300049743 Bacteria 4610
949 Ga0501241_023293 3300049758 Bacteria 1146
950 Ga0501266_000721 3300049763 Bacteria 4293
951 Ga0501035_0033080 3300049822 Bacteria 4702
952 Ga0501035_0199989 3300049822 Bacteria 1714
953 Ga0501044_0047218 3300049823 Bacteria 4455
954 nmdc:mga03683_17782_c1 3300050489 Bacteria 2696
955 nmdc:mga03683_49148_c1 3300050489 Bacteria 1755
956 nmdc:mga03683_58651_c1 3300050489 Bacteria 1099
957 nmdc:mga03n38_10895_c1 3300050490 Bacteria 3367
958 nmdc:mga03n38_130933_c1 3300050490 Bacteria 1243
959 nmdc:mga03n38_176098_c1 3300050490 Bacteria 1093
960 nmdc:mga03n38_20430_c1 3300050490 Bacteria 2649
961 nmdc:mga03n38_2106_c1 3300050490 Bacteria 6036
962 nmdc:mga00v17_16532_c1 3300050491 Bacteria 4157
963 nmdc:mga00v17_21160_c1 3300050491 Bacteria 3737
964 nmdc:mga00v17_550_c1 3300050491 Bacteria 20960
965 nmdc:mga00v17_76047_c1 3300050491 Bacteria 2088
966 nmdc:mga00v17_858_c1 3300050491 Bacteria 16444
967 nmdc:mga0yw44_115007_c1 3300050492 Bacteria 1425
968 nmdc:mga0yw44_164_c1 3300050492 Bacteria 23001
969 nmdc:mga0yw44_323_c1 3300050492 Bacteria 16681
970 nmdc:mga0yw44_5027_c1 3300050492 Bacteria 6177
971 nmdc:mga0yw44_6841_c1 3300050492 Bacteria 5547
972 nmdc:mga0yw44_85225_c1 3300050492 Bacteria 1988
973 nmdc:mga0k408_124283_c1 3300050493 Bacteria 1530
974 nmdc:mga0k408_15132_c1 3300050493 Bacteria 4264
975 nmdc:mga0k408_30968_c1 3300050493 Bacteria 3052
976 nmdc:mga0k408_54101_c1 3300050493 Bacteria 2327
977 nmdc:mga06z11_16137_c1 3300050494 Bacteria 3355
978 nmdc:mga06z11_26827_c1 3300050494 Bacteria 2747
979 nmdc:mga06z11_30013_c1 3300050494 Bacteria 2626
980 nmdc:mga06z11_7315_c1 3300050494 Bacteria 4535
981 nmdc:mga07m45_108967_c1 3300050496 Bacteria 1594
982 nmdc:mga07m45_16144_c1 3300050496 Bacteria 3996
983 nmdc:mga07m45_217778_c1 3300050496 Bacteria 1111
984 nmdc:mga07m45_6347_c1 3300050496 Bacteria 5968
985 nmdc:mga05p37_802106_c1 3300050507 Bacteria 1030
986 nmdc:mga05p37_9734_c1 3300050507 Bacteria 11396
987 nmdc:mga09592_54930_c1 3300050508 Bacteria 3365
988 nmdc:mga09592_7400_c1 3300050508 Bacteria 8924
989 nmdc:mga0qj67_26674_c1 3300050509 Bacteria 4473
990 nmdc:mga0qj67_27823_c1 3300050509 Bacteria 4384
991 nmdc:mga0qj67_609106_c1 3300050509 Bacteria 873
992 nmdc:mga06r32_2236_c1 3300050510 Bacteria 17323
993 nmdc:mga08y16_197348_c1 3300050511 Bacteria 2086
994 nmdc:mga0n895_9979_c1 3300050512 Bacteria 8355
995 nmdc:mga0rr50_6938_c1 3300050513 Bacteria 3119
996 nmdc:mga08x19_364727_c1 3300050514 Bacteria 1010
997 nmdc:mga08x19_4_c1 3300050514 Bacteria 335979
998 nmdc:mga0sz30_344_c1 3300050516 Bacteria 17753
999 nmdc:mga0sz30_47_c2 3300050516 Bacteria 30262
1000 nmdc:mga0sz30_59488_c1 3300050516 Bacteria 1141
1001 Ga0495601_0000006 3300053077 Bacteria 373770
1002 Ga0495601_0285975 3300053077 Bacteria 1075
1003 Ga0495612_0000004 3300053078 Bacteria 286946
1004 Ga0500610_0000109 3300053079 Bacteria 24958
1005 Ga0495595_0000006 3300053084 Bacteria 231295
1006 Ga0495619_0000011 3300053085 Bacteria 287128
1007 Ga0500643_000053 3300053087 Bacteria 142202
1008 Ga0500643_000439 3300053087 Bacteria 31314
1009 Ga0500643_000774 3300053087 Bacteria 20768
1010 Ga0500643_015298 3300053087 Bacteria 2635
1011 Ga0500643_021960 3300053087 Bacteria 2063
1012 Ga0500646_0000182 3300053090 Bacteria 18791
1013 Ga0500583_0000160 3300053092 Bacteria 27705
1014 Ga0500583_0005083 3300053092 Bacteria 4366
1015 Ga0500651_0082441 3300053093 Bacteria 1991
1016 Ga0500641_0012315 3300053096 Bacteria 3122
1017 Ga0500555_002225 3300053103 Bacteria 5663
1018 Ga0500592_010042 3300053116 Bacteria 1507
1019 Ga0500595_006413 3300053119 Bacteria 4993
1020 Ga0500595_027558 3300053119 Bacteria 1945
1021 Ga0500607_000386 3300053121 Bacteria 42198
1022 Ga0500607_000706 3300053121 Bacteria 32099
1023 Ga0500642_0001986 3300053130 Bacteria 5939
1024 Ga0500642_0027983 3300053130 Bacteria 2320
1025 Ga0500642_0123938 3300053130 Bacteria 1210
1026 Ga0500658_0047352 3300053134 Bacteria 1745
1027 Ga0500659_0000749 3300053135 Bacteria 20870
1028 Ga0500559_0000174 3300053136 Bacteria 50893
1029 Ga0500559_0007572 3300053136 Bacteria 4799
1030 Ga0500559_0218521 3300053136 Bacteria 899
1031 Ga0500568_0003968 3300053139 Bacteria 8044
1032 Ga0500573_0173075 3300053140 Bacteria 1166
1033 Ga0500590_110041 3300053148 Bacteria 1308
1034 Ga0500604_0000941 3300053151 Bacteria 8056
1035 Ga0500604_0008879 3300053151 Bacteria 2670
1036 Ga0500616_0001605 3300053153 Bacteria 21079
1037 Ga0500616_0183242 3300053153 Bacteria 941
1038 Ga0500622_0001570 3300053156 Bacteria 18004
1039 Ga0500627_0002950 3300053158 Bacteria 5161
1040 Ga0500627_0003538 3300053158 Bacteria 4851
1041 Ga0500645_000291 3300053730 Bacteria 35819
1042 Ga0501084_0018285 3300054114 Bacteria 5836
1043 Ga0500661_000076 3300055283 Bacteria 15473
1044 Ga0530510_0016714 3300061734 Bacteria 5195
1045 2548501250 2547132374 Bacteria 5530232
1046 2585282675 2582581308 Bacteria 7413247
1047 2585327848 2582581315 Bacteria 7318924
1048 2585555542 2585427530 Bacteria 7383882
1049 2599965322 2599185306 Bacteria 6637356
1050 2599978539 2599185308 Bacteria 6621546
1051 2600010554 2599185314 Bacteria 6621749
1052 2616310214 2615840626 Bacteria 7921970
1053 2617914983 2617270889 Bacteria 9064343
1054 2644649206 2643221717 Bacteria 5676132
1055 2685151340 2684622632 Bacteria 5380049
1056 2698321921 2695420987 Bacteria 6152737
1057 2721506506 2718218445 Bacteria 5113413
1058 2729148841 2728369097 Bacteria 4333476
1059 2739212055 2738543006 Bacteria 5904091
1060 2807409491 2806310737 Bacteria 5751088
1061 2807457792 2806310745 Bacteria 5742165
1062 2808856069 2808606361 Bacteria 6136259
1063 2808923536 2808606376 Bacteria 6248667
1064 2808936180 2808606378 Bacteria 6177535
1065 2808945701 2808606380 Bacteria 6248705
1066 2808964574 2808606383 Bacteria 6138645
1067 2808999462 2808606389 Bacteria 6138126
1068 2823423205 2823421272 Bacteria 5372474
1069 2831428821 2831426010 Bacteria 8662725
1070 2848702254 2848694841 Bacteria 9205737
1071 2849668013 2849660919 Bacteria 8251853
1072 2885215250 2885211737 Bacteria 7212420
1073 2886633781 2886627955 Bacteria 7618130
1074 2904762777 2904755435 Bacteria 7986759
1075 2913846980 2913844669 Bacteria 8381711
1076 2913916642 2913912277 Bacteria 9037797
1077 2913944457 2913939268 Bacteria 8559644
1078 2929145879 2929144301 Bacteria 6622272
1079 2929237011 2929233124 Bacteria 5948380
1080 2939618292 2939617950 Bacteria 4820956
1081 2947430048 2947426588 Bacteria 5357194
1082 2978971165 2978969890 Bacteria 5400756
1083 2979086957 2979083700 Bacteria 5894929
1084 3007400754 3007395558 Bacteria 6755444
1085 642600354 642555144 Bacteria 9059191
1086 8023440115 8023438354 Bacteria 5779374
1087 8023447006 8023444577 Bacteria 5661597
1088 8055636865 8055632911 Bacteria 5283357
1089 Ga0207671_10347990
1090 SwRhRL2b_contig_2410546
1091 SwRhRL2b_contig_3658071
1092 JGI24736J21556_1008511
1093 JGI24740J21852_10001139
1094 JGI24739J22299_10001771
1095 JGI24739J22299_10010873
1096 JGI24737J22298_10027737
1097 JGI24735J21928_10003349
1098 JGI24735J21928_10005690
1099 JGI24748J21848_1000023
1100 JGI24738J21930_10003984
1101 JGI24034J26672_10000010
1102 JGI24751J29686_10015855
1103 JGI25151J46595_10002312
1104 JGI25165J46597_1001250
1105 JGI25153J46596_10013055
1106 rootH1_10069913
1107 rootH2_10221868
1108 rootH2_10295353
1109 rootH1_10013795
1110 Ga0006562J51391_1051510
1111 Ga0055532_1000054
1112 Ga0055525_1000021
1113 Ga0055525_1000663
1114 Ga0055535_1000037
1115 Ga0055535_1000475
1116 Ga0055542_1000157
1117 Ga0055529_1000070
1118 Ga0055526_1000329
1119 Ga0055526_1004142
1120 Ga0055526_1011388
1121 Ga0055526_1025080
1122 Ga0055536_1000149
1123 Ga0055536_1004606
1124 Ga0055534_1000883
1125 Ga0055530_10002573
1126 Ga0055540_1000622
1127 Ga0055540_1017869
1128 Ga0055531_10001158
1129 Ga0055531_10006162
1130 Ga0055541_1003285
1131 Ga0065165_1000030
1132 Ga0065714_10021842
1133 Ga0065714_10098217
1134 Ga0065704_10000597
1135 Ga0065704_10173848
1136 Ga0065704_10178514
1137 Ga0065715_10001856
1138 Ga0065707_10087919
1139 Ga0070658_10001409
1140 Ga0070658_10004364
1141 Ga0070676_10111913
1142 Ga0070676_10131404
1143 Ga0070676_10207484
1144 Ga0070683_100319670
1145 Ga0070683_100439147
1146 Ga0070683_100478424
1147 Ga0070690_100000055
1148 Ga0070670_100068558
1149 Ga0068869_100065438
1150 Ga0068869_100093641
1151 Ga0070666_10000009
1152 Ga0070680_100294027
1153 Ga0068868_100008614
1154 Ga0070660_100201357
1155 Ga0070689_100094929
1156 Ga0070689_100261327
1157 Ga0070689_100438803
1158 Ga0070661_100000068
1159 Ga0070692_10066907
1160 Ga0070668_100000109
1161 Ga0070668_100020350
1162 Ga0070668_100025441
1163 Ga0070669_100006318
1164 Ga0070669_100129610
1165 Ga0070675_100003633
1166 Ga0070675_100060402
1167 Ga0070671_100099442
1168 Ga0070671_100114564
1169 Ga0070674_100002357
1170 Ga0070673_100229224
1171 Ga0070673_100557303
1172 Ga0070659_100000135
1173 Ga0070659_100000867
1174 Ga0070659_100002242
1175 Ga0070659_100135341
1176 Ga0070667_100000385
1177 Ga0070667_100003070
1178 Ga0070667_100015911
1179 Ga0070667_100263786
1180 Ga0070714_100121818
1181 Ga0070714_100305947
1182 Ga0070700_100055104
1183 Ga0070700_100207240
1184 Ga0070663_100000008
1185 Ga0070663_100137142
1186 Ga0070663_100250688
1187 Ga0070678_100027075
1188 Ga0070678_100559426
1189 Ga0070662_100006646
1190 Ga0070662_100022445
1191 Ga0070662_100157186
1192 Ga0070662_100533245
1193 Ga0070681_10079866
1194 Ga0070681_10266915
1195 Ga0070681_10405649
1196 Ga0068867_100043843
1197 Ga0068867_100283078
1198 Ga0070685_10152786
1199 Ga0070707_100465665
1200 Ga0070698_100000489
1201 Ga0070698_100080822
1202 Ga0070698_100135130
1203 Ga0070698_100700802
1204 Ga0070699_100070764
1205 Ga0070699_100110679
1206 Ga0070699_100381774
1207 Ga0070679_100004697
1208 Ga0070679_100097498
1209 Ga0070679_100183999
1210 Ga0070697_100016631
1211 Ga0070697_100824900
1212 Ga0068853_100020311
1213 Ga0068853_100052107
1214 Ga0068853_100104158
1215 Ga0068853_100175136
1216 Ga0070672_100000409
1217 Ga0070672_100312494
1218 Ga0070686_100000041
1219 Ga0070686_100099002
1220 Ga0070695_100017307
1221 Ga0070696_100406706
1222 Ga0070665_100018737
1223 Ga0070665_100032348
1224 Ga0070665_100087832
1225 Ga0070665_100683176
1226 Ga0070704_100242736
1227 Ga0068855_100006481
1228 Ga0068855_100016802
1229 Ga0068855_100024389
1230 Ga0068855_100380428
1231 Ga0070664_100000009
1232 Ga0070664_100193602
1233 Ga0070664_100681236
1234 Ga0068857_100007095
1235 Ga0068857_100179674
1236 Ga0068854_100000023
1237 Ga0068854_100000024
1238 Ga0068854_100028898
1239 Ga0068854_100057533
1240 Ga0068854_100075122
1241 Ga0068854_100229675
1242 Ga0068856_100000019
1243 Ga0068856_100002944
1244 Ga0068856_100109698
1245 Ga0068852_100012678
1246 Ga0068852_100048495
1247 Ga0068852_100340373
1248 Ga0068859_100002443
1249 Ga0068859_100002746
1250 Ga0068859_100016879
1251 Ga0068859_100163494
1252 Ga0068864_100000661
1253 Ga0068864_100241190
1254 Ga0068864_100388585
1255 Ga0068864_100562955
1256 Ga0068866_10004073
1257 Ga0068861_100000441
1258 Ga0068861_100002019
1259 Ga0068861_100019804
1260 Ga0068851_10078371
1261 Ga0068863_100000317
1262 Ga0068863_100000705
1263 Ga0068863_100003514
1264 Ga0068863_100008845
1265 Ga0068863_100076557
1266 Ga0068860_100000022
1267 Ga0068860_100003256
1268 Ga0068860_100065199
1269 Ga0068860_100119863
1270 Ga0068860_100197992
1271 Ga0068860_100657848
1272 Ga0068862_100000596
1273 Ga0068862_100020520
1274 Ga0081455_10049469
1275 Ga0075365_10000349
1276 Ga0075365_10000706
1277 Ga0075365_10004015
1278 Ga0075365_10027179
1279 Ga0075365_10368842
1280 Ga0075368_10011102
1281 Ga0075368_10091685
1282 Ga0075363_100011278
1283 Ga0075363_100015353
1284 Ga0075363_100018241
1285 Ga0075364_10001743
1286 Ga0075364_10002839
1287 Ga0075364_10048942
1288 Ga0075364_10054472
1289 Ga0070716_100129679
1290 Ga0075362_10009498
1291 Ga0075362_10036243
1292 Ga0075362_10154567
1293 Ga0075367_10003220
1294 Ga0075367_10012827
1295 Ga0075367_10020340
1296 Ga0075367_10031060
1297 Ga0075367_10051082
1298 Ga0075367_10129808
1299 Ga0075369_10002209
1300 Ga0075369_10002288
1301 Ga0075369_10080599
1302 Ga0075366_10003243
1303 Ga0075366_10029525
1304 Ga0075366_10030236
1305 Ga0097621_100021383
1306 Ga0097621_100076541
1307 Ga0075370_10004495
1308 Ga0075370_10012301
1309 Ga0075370_10078839
1310 Ga0075370_10127782
1311 Ga0068871_100001760
1312 Ga0075428_100001894
1313 Ga0075428_100037054
1314 Ga0075430_100003424
1315 Ga0075430_100013674
1316 Ga0075431_100000364
1317 Ga0075431_100021229
1318 Ga0075434_100020199
1319 Ga0075434_100133179
1320 Ga0075429_100005261
1321 Ga0075429_100008541
1322 Ga0075436_100000321
1323 Ga0075436_100119610
1324 Ga0097620_100002442
1325 Ga0097620_100002746
1326 Ga0097620_100016879
1327 Ga0097620_100163495
1328 Ga0079104_1000163
1329 Ga0099826_10000013
1330 Ga0099826_10000048
1331 Ga0099826_10048612
1332 Ga0075435_100008156
1333 Ga0075435_100059536
1334 Ga0105251_10059587
1335 Ga0105244_10000698
1336 Ga0105244_10073094
1337 Ga0105250_10014263
1338 Ga0105250_10054927
1339 Ga0105240_10001579
1340 Ga0105240_10006137
1341 Ga0105240_10017956
1342 Ga0105240_10057143
1343 Ga0105240_10100584
1344 Ga0105240_10563674
1345 Ga0111539_10027771
1346 Ga0111539_10080845
1347 Ga0111539_10303704
1348 Ga0111539_11364438
1349 Ga0105245_10204915
1350 Ga0105247_10048675
1351 Ga0114129_10015902
1352 Ga0114129_10193241
1353 Ga0114129_10362065
1354 Ga0114129_10542149
1355 Ga0105243_10033187
1356 Ga0105243_10110900
1357 Ga0105241_10002815
1358 Ga0105241_10110745
1359 Ga0105241_10118112
1360 Ga0105241_10701495
1361 Ga0105242_10008344
1362 Ga0105248_10001248
1363 Ga0105248_10001677
1364 Ga0105248_10002804
1365 Ga0105248_10010586
1366 Ga0105248_10028059
1367 Ga0105248_10300172
1368 Ga0105248_10624854
1369 Ga0105237_10003070
1370 Ga0105237_10065625
1371 Ga0105237_10086871
1372 Ga0105237_10130696
1373 Ga0105237_10367331
1374 Ga0105238_10070117
1375 Ga0105249_10000014
1376 Ga0105249_10002930
1377 Ga0105249_10003753
1378 Ga0105249_10269945
1379 Ga0105239_10001206
1380 Ga0105239_10009151
1381 Ga0105239_10020093
1382 Ga0105239_10022264
1383 Ga0105239_10261695
1384 Ga0105239_10325619
1385 Ga0105239_10342452
1386 Ga0105246_10577033
1387 Ga0157326_1001295
1388 Ga0157373_10006717
1389 Ga0157373_10011249
1390 Ga0157373_10061387
1391 Ga0157373_10099741
1392 Ga0157371_10000047
1393 Ga0157371_10002969
1394 Ga0157371_10004449
1395 Ga0157371_10008594
1396 Ga0157370_10000004
1397 Ga0157370_10002004
1398 Ga0157370_10013356
1399 Ga0157370_10014211
1400 Ga0157370_10014608
1401 Ga0157370_10047662
1402 Ga0157370_10056784
1403 Ga0157369_10006530
1404 Ga0157369_10020204
1405 Ga0157374_10519518
1406 Ga0157374_10619616
1407 Ga0157378_10035146
1408 Ga0157378_10111102
1409 Ga0157378_10670415
1410 Ga0163162_10016338
1411 Ga0163162_10105499
1412 Ga0163162_10127587
1413 Ga0163162_10457492
1414 Ga0163162_10477272
1415 Ga0163162_10741644
1416 Ga0157372_10000362
1417 Ga0157372_10002551
1418 Ga0157372_10031659
1419 Ga0157372_10177662
1420 Ga0157375_10000055
1421 Ga0157375_10000541
1422 Ga0157375_10022569
1423 Ga0157375_10204597
1424 Ga0157375_10401610
1425 Ga0157375_11074087
1426 Ga0163163_10129014
1427 Ga0157380_10000325
1428 Ga0157380_10007519
1429 Ga0157380_10347251
1430 Ga0182008_10002412
1431 Ga0182008_10013003
1432 Ga0182008_10047525
1433 Ga0157379_10020026
1434 Ga0157379_10200051
1435 Ga0157379_10228856
1436 Ga0157376_10002090
1437 Ga0157376_10039071
1438 Ga0157376_10059668
1439 Ga0182006_1002028
1440 Ga0182006_1043206
1441 Ga0182006_1059276
1442 Ga0182007_10001040
1443 Ga0182007_10010076
1444 Ga0182007_10010490
1445 Ga0182007_10010979
1446 Ga0182005_1031995
1447 Ga0163161_10000057
1448 Ga0163161_10030363
1449 Ga0163161_10101528
1450 Ga0206356_11628886
1451 Ga0206351_10745048
1452 Ga0154015_1245876
1453 Ga0213872_10000256
1454 Ga0213872_10020201
1455 Ga0213876_10098049
1456 Ga0209784_100029
1457 Ga0209566_100030
1458 Ga0209566_101369
1459 Ga0209566_102510
1460 Ga0209674_100075
1461 Ga0209672_100178
1462 Ga0209672_100721
1463 Ga0209147_100008
1464 Ga0209563_100005
1465 Ga0209563_100117
1466 Ga0209437_101870
1467 Ga0209258_100013
1468 Ga0209258_100158
1469 Ga0209677_100030
1470 Ga0209677_100248
1471 Ga0209148_1000092
1472 Ga0209148_1002665
1473 Ga0209759_1002970
1474 Ga0209233_1000340
1475 Ga0209565_1001410
1476 Ga0209565_1018256
1477 Ga0209455_1000130
1478 Ga0209455_1005930
1479 Ga0209675_1000050
1480 Ga0209675_1018444
1481 Ga0209676_1000053
1482 Ga0209676_1001174
1483 Ga0209676_1006985
1484 Ga0209025_1000093
1485 Ga0209025_1004087
1486 Ga0209564_1000211
1487 Ga0209564_1002127
1488 Ga0209564_1002156
1489 Ga0209758_1000349
1490 Ga0209758_1036668
1491 Ga0209050_1001493
1492 Ga0209256_1000538
1493 Ga0209051_1000924
1494 Ga0209051_1006399
1495 Ga0209257_1000598
1496 Ga0207697_10103774
1497 Ga0207655_1000885
1498 Ga0207655_1030163
1499 Ga0207713_1046306
1500 Ga0207642_10008016
1501 Ga0207680_10000007
1502 Ga0207647_10016643
1503 Ga0207645_10004107
1504 Ga0207643_10061099
1505 Ga0207705_10011507
1506 Ga0207654_10003667
1507 Ga0207654_10085380
1508 Ga0207654_10208476
1509 Ga0207707_10007428
1510 Ga0207707_10046166
1511 Ga0207707_10300623
1512 Ga0207707_10314034
1513 Ga0207695_10005037
1514 Ga0207695_10009597
1515 Ga0207695_10021604
1516 Ga0207695_10082586
1517 Ga0207671_10001189
1518 Ga0207671_10157292
1519 Ga0207671_10264108
1520 Ga0207663_10346632
1521 Ga0207660_10009000
1522 Ga0207660_10128401
1523 Ga0207657_10078269
1524 Ga0207649_10000030
1525 Ga0207652_10010117
1526 Ga0207652_10026130
1527 Ga0207652_10699067
1528 Ga0207681_10002214
1529 Ga0207694_10016307
1530 Ga0207650_10008268
1531 Ga0207650_10016778
1532 Ga0207659_10147503
1533 Ga0207687_10002040
1534 Ga0207687_10267913
1535 Ga0207664_10011490
1536 Ga0207664_10031159
1537 Ga0207644_10000121
1538 Ga0207644_10254077
1539 Ga0207690_10001021
1540 Ga0207690_10008695
1541 Ga0207690_10012406
1542 Ga0207706_10013054
1543 Ga0207706_10027735
1544 Ga0207706_10041302
1545 Ga0207706_10041900
1546 Ga0207706_10651558
1547 Ga0207686_10070672
1548 Ga0207686_10591545
1549 Ga0207709_10004576
1550 Ga0207704_10072113
1551 Ga0207665_10163772
1552 Ga0207691_10000575
1553 Ga0207691_10290528
1554 Ga0207711_10004771
1555 Ga0207711_10013297
1556 Ga0207711_10019873
1557 Ga0207711_10029581
1558 Ga0207689_10027859
1559 Ga0207689_10587338
1560 Ga0207661_10040878
1561 Ga0207661_10266582
1562 Ga0207661_10398247
1563 Ga0207679_10000004
1564 Ga0207679_10094057
1565 Ga0207667_10004203
1566 Ga0207667_10007423
1567 Ga0207712_10000004
1568 Ga0207712_10042902
1569 Ga0207668_10000166
1570 Ga0207668_10054097
1571 Ga0207668_10078011
1572 Ga0207640_10000039
1573 Ga0207640_10000595
1574 Ga0207640_10139724
1575 Ga0207640_10197393
1576 Ga0207658_10000328
1577 Ga0207658_10000462
1578 Ga0207658_10212823
1579 Ga0207658_10437372
1580 Ga0207677_10384993
1581 Ga0207703_10126192
1582 Ga0207639_10139809
1583 Ga0207639_10173652
1584 Ga0207639_10262228
1585 Ga0207678_10000006
1586 Ga0207678_10066935
1587 Ga0207678_10428979
1588 Ga0207708_10073140
1589 Ga0207708_10155144
1590 Ga0207702_10000206
1591 Ga0207702_10009722
1592 Ga0207702_10083392
1593 Ga0207641_10000263
1594 Ga0207641_10000582
1595 Ga0207641_10013287
1596 Ga0207641_10016644
1597 Ga0207641_10137585
1598 Ga0207648_10250716
1599 Ga0207676_10000578
1600 Ga0207676_10056843
1601 Ga0207676_10121087
1602 Ga0207676_10176649
1603 Ga0207674_10016609
1604 Ga0207675_100000131
1605 Ga0207675_100001855
1606 Ga0207675_100002202
1607 Ga0207675_100003015
1608 Ga0207683_10034058
1609 Ga0207683_10042935
1610 Ga0207683_10400897
1611 Ga0207683_10527396
1612 Ga0207698_10011260
1613 Ga0207698_10062401
1614 Ga0207698_10266046
1615 Ga0207698_10286053
1616 Ga0209281_1000064
1617 Ga0209282_1000066
1618 Ga0209282_1000081
1619 Ga0207428_10139858
1620 Ga0265354_1000840
1621 Ga0265357_1000102
1622 Ga0268266_10015846
1623 Ga0268266_10058588
1624 Ga0268266_10089707
1625 Ga0268265_10000266
1626 Ga0268265_10035901
1627 Ga0268265_10037739
1628 Ga0268264_10000003
1629 Ga0268264_10002685
1630 Ga0268264_10108683
1631 Ga0268264_10245401
1632 Ga0265337_1027775
1633 Ga0265334_10026302
1634 Ga0265318_10004532
1635 Ga0265318_10035698
1636 Ga0265338_10008160
1637 Ga0265338_10047685
1638 Ga0265338_10056651
1639 Ga0265338_10114013
1640 Ga0237817_10015
1641 Ga0307511_10001633
1642 Ga0307511_10148041
1643 Ga0316183_1060816
1644 Ga0265771_1000126
1645 Ga0265760_10000274
1646 Ga0265760_10006202
1647 Ga0265332_10005747
1648 Ga0265320_10004192
1649 Ga0265325_10008191
1650 Ga0265327_10200214
1651 Ga0265316_10217443
1652 Ga0307513_10000090
1653 Ga0307513_10122883
1654 Ga0307509_10235780
1655 Ga0307509_10332975
1656 Ga0307408_100000032
1657 Ga0307408_100000364
1658 Ga0307408_100000612
1659 Ga0307408_100004980
1660 Ga0307408_100005474
1661 Ga0307408_100281295
1662 Ga0265313_10000939
1663 Ga0307508_10066349
1664 Ga0307508_10206345
1665 Ga0265314_10103094
1666 Ga0316576_10024396
1667 Ga0316576_10215141
1668 Ga0307516_10362264
1669 Ga0307405_10007500
1670 Ga0307413_10010139
1671 Ga0307413_10406488
1672 Ga0307413_10444787
1673 Ga0307410_10000015
1674 Ga0307410_10001538
1675 Ga0307406_10000454
1676 Ga0307406_10022530
1677 Ga0307406_10033934
1678 Ga0307407_10004658
1679 Ga0307407_10029021
1680 Ga0307407_10063555
1681 Ga0307412_10012487
1682 Ga0307412_10037471
1683 Ga0307412_10195347
1684 Ga0307409_100000111
1685 Ga0307409_100014852
1686 Ga0307409_100024332
1687 Ga0307416_100000038
1688 Ga0307416_100003964
1689 Ga0307416_100006832
1690 Ga0307416_100007558
1691 Ga0307416_100035622
1692 Ga0307416_100193506
1693 Ga0307414_10002982
1694 Ga0307411_10002190
1695 Ga0307415_100001167
1696 Ga0307415_100668915
1697 Ga0307510_10036531
1698 Ga0373926_0017293
1699 Ga0373923_0036587
1700 Ga0373932_0019569
1701 Ga0373945_0052762
1702 Ga0373954_0001145
1703 Ga0373954_0080525
1704 Ga0373957_0001986
1705 Ga0373943_0001477
1706 Ga0373955_0001023
1707 Ga0373924_0001191
1708 Ga0373931_0008709
1709 Ga0373935_0000161
1710 Ga0373935_0049948
1711 Ga0373927_0038675
1712 Ga0373927_0327213
1713 Ga0373947_0002132
1714 Ga0373947_0032276
1715 Ga0373937_0000256
1716 Ga0373937_0010619
1717 Ga0373937_0101869
1718 Ga0373937_0119531
1719 Ga0373937_0278798
1720 Ga0373937_0306755
1721 Ga0316584_0015557
1722 Ga0373925_0000087
1723 Ga0395899_0142327
1724 Ga0395900_0008015
1725 Ga0395900_0026342
1726 Ga0395900_0026620
1727 Ga0395900_0127410
1728 Ga0395898_0008110
1729 Ga0395905_0000003
1730 Ga0395905_0000678
1731 Ga0395905_0003795
1732 Ga0395905_0010178
1733 Ga0395905_0011428
1734 Ga0395905_0013029
1735 Ga0395901_0025008
1736 Ga0395901_0026526
1737 Ga0395901_0622179
1738 Ga0237819_01424
1739 Ga0237819_05966
1740 Ga0400490_13146
1741 Ga0400490_42190
1742 Ga0400488_36200
1743 Ga0400483_027285
1744 Ga0400489_45819
1745 Ga0400489_71985
1746 Ga0400487_43094
1747 Ga0436365_0827163
1748 Ga0436360_0549688
1749 Ga0436360_0757569
1750 Ga0436361_0051717
1751 Ga0436361_0151105
1752 Ga0436361_0295037
1753 Ga0436361_0677882
1754 Ga0436361_1123576
1755 Ga0451843_1071893
1756 Ga0439433_0002009
1757 Ga0439441_000192
1758 Ga0439445_0015704
1759 Ga0439449_0000154
1760 Ga0439451_000122
1761 Ga0439456_000640
1762 Ga0439462_0000779
1763 Ga0439463_000134
1764 Ga0450911_000168
1765 Ga0450913_007014
1766 Ga0450923_003258
1767 Ga0450903_000726
1768 Ga0450905_003879
1769 Ga0439464_0002454
1770 Ga0439460_0000538
1771 Ga0451577_0000011
1772 Ga0451577_0000219
1773 Ga0451577_0000761
1774 Ga0451577_0013357
1775 Ga0451577_0016785
1776 Ga0451577_0037400
1777 Ga0451577_0068367
1778 Ga0451577_0073801
1779 Ga0439440_0000578
1780 Ga0466986_0015418
1781 Ga0453683_0000054
1782 Ga0453683_0000313
1783 Ga0453683_0097412
1784 Ga0466966_0155885
1785 Ga0466966_0213074
1786 Ga0466961_0000213
1787 Ga0453684_0000087
1788 Ga0453684_0000114
1789 Ga0453684_0000210
1790 Ga0453684_0000381
1791 Ga0453684_0000947
1792 Ga0453684_0001345
1793 Ga0453684_0007495
1794 Ga0453684_0008486
1795 Ga0453684_0008826
1796 Ga0453684_0010397
1797 Ga0453684_0034369
1798 Ga0453684_0042573
1799 Ga0453684_0051916
1800 Ga0453684_0125685
1801 Ga0453684_0222068
1802 Ga0453684_0662980
1803 Ga0453684_0788165
1804 Ga0466959_0001157
1805 Ga0466959_0057462
1806 Ga0451576_0002484
1807 Ga0451576_0003256
1808 Ga0451576_0003616
1809 Ga0451576_0005653
1810 Ga0451576_0020607
1811 Ga0451576_0027071
1812 Ga0451576_0035954
1813 Ga0451576_0108140
1814 Ga0451576_0138209
1815 Ga0451576_0170525
1816 Ga0466958_0000259
1817 Ga0466967_0001151
1818 Ga0495617_016103
1819 Ga0495592_0000001
1820 Ga0495590_0037613
1821 Ga0495629_0036170
1822 Ga0495638_0008030
1823 Ga0495638_0011178
1824 Ga0495651_0000078
1825 Ga0495651_0062806
1826 Ga0495653_0000015
1827 Ga0495650_0001461
1828 Ga0495650_0039176
1829 Ga0495580_0000685
1830 Ga0495580_0114224
1831 Ga0495580_0293037
1832 Ga0495605_0000759
1833 Ga0495605_0001152
1834 Ga0495662_0013543
1835 Ga0495664_0000001
1836 Ga0495584_0140364
1837 Ga0495585_0090226
1838 Ga0495596_0000011
1839 Ga0495607_0003197
1840 Ga0495583_0006197
1841 Ga0495583_0010518
1842 Ga0495606_0001564
1843 Ga0495606_0014696
1844 Ga0495608_0000066
1845 Ga0495608_0060271
1846 Ga0495610_0000162
1847 Ga0495610_0161456
1848 Ga0495616_0000024
1849 Ga0495616_0007343
1850 Ga0495616_0066090
1851 Ga0495618_0000021
1852 Ga0495620_0000002
1853 Ga0495620_0001167
1854 Ga0495628_0000005
1855 Ga0495630_0017055
1856 Ga0495631_0051146
1857 Ga0495632_0000955
1858 Ga0495637_0004602
1859 Ga0495643_0000782
1860 Ga0495643_0003464
1861 Ga0495643_0216728
1862 Ga0495648_0000645
1863 Ga0495648_0001948
1864 Ga0495648_0003713
1865 Ga0495648_0009121
1866 Ga0495648_0183871
1867 Ga0495652_0000001
1868 Ga0495654_0000491
1869 Ga0495654_0011699
1870 Ga0495640_0000006
1871 Ga0495586_0249196
1872 Ga0495587_0000012
1873 Ga0495609_0001374
1874 Ga0495609_0004334
1875 Ga0495609_0058819
1876 Ga0495621_0023957
1877 Ga0495597_0019454
1878 Ga0495645_0000041
1879 Ga0495645_0052455
1880 Ga0495645_0092025
1881 Ga0495633_0209406
1882 Ga0495667_0000001
1883 Ga0495656_0126005
1884 Ga0495668_0010122
1885 Ga0495668_0031780
1886 Ga0495668_0128632
1887 Ga0495634_0000313
1888 Ga0495611_0000001
1889 Ga0495625_0000037
1890 Ga0495625_0020728
1891 Ga0495625_0171373
1892 Ga0495635_0000007
1893 Ga0495661_0004835
1894 Ga0495588_0208404
1895 Ga0495657_0000047
1896 Ga0495599_0000002
1897 Ga0495623_0000023
1898 Ga0495646_0000024
1899 Ga0495658_0110150
1900 Ga0495658_0293126
1901 Ga0495669_0019329
1902 Ga0495669_0029553
1903 Ga0495613_0328771
1904 Ga0495670_0003337
1905 Ga0495670_0188104
1906 Ga0495671_0000925
1907 Ga0495671_0008172
1908 Ga0495649_0007649
1909 Ga0495589_0000366
1910 Ga0495600_0000013
1911 Ga0495600_0070662
1912 Ga0495604_0000007
1913 Ga0495604_0047820
1914 Ga0495674_0000001
1915 Ga0495674_0205187
1916 Ga0495674_0312800
1917 Ga0495672_0013927
1918 Ga0495680_0001662
1919 Ga0495683_0000194
1920 Ga0495675_0000014
1921 Ga0495675_0002266
1922 Ga0495677_0155694
1923 Ga0495679_000001
1924 Ga0495673_0000607
1925 Ga0495673_0036135
1926 Ga0495684_0000027
1927 Ga0495684_0410479
1928 Ga0495593_0000830
1929 Ga0495602_0000004
1930 Ga0496100_0013011
1931 Ga0496100_0097304
1932 Ga0496101_0485972
1933 Ga0496102_0011442
1934 Ga0496102_0035649
1935 Ga0496102_0273990
1936 Ga0496103_0001011
1937 Ga0496103_0082528
1938 Ga0496104_0003666
1939 Ga0496105_0207615
1940 Ga0496105_0282806
1941 Ga0496106_0088788
1942 Ga0496106_0492133
1943 Ga0496110_0488163
1944 Ga0496115_0327296
1945 Ga0496116_0002738
1946 Ga0496116_0003529
1947 Ga0496116_0009769
1948 Ga0496116_0049115
1949 Ga0496117_0002061
1950 Ga0496117_0002856
1951 Ga0496117_0004128
1952 Ga0496117_0007412
1953 Ga0496117_0083164
1954 Ga0496118_0004752
1955 Ga0496118_0006005
1956 Ga0496118_0015795
1957 Ga0496118_0017662
1958 Ga0496118_0083503
1959 Ga0496119_0000049
1960 Ga0496119_0003046
1961 Ga0496119_0019062
1962 Ga0496119_0066281
1963 Ga0496120_0001178
1964 Ga0496120_0001489
1965 Ga0496120_0078867
1966 Ga0496120_0227841
1967 Ga0496121_0002612
1968 Ga0496121_0011198
1969 Ga0496121_0011520
1970 Ga0496121_0029865
1971 Ga0496121_0049678
1972 Ga0496121_0079495
1973 Ga0496121_0085981
1974 Ga0496121_0307949
1975 Ga0496122_0004704
1976 Ga0496122_0007770
1977 Ga0496122_0011176
1978 Ga0496122_0048982
1979 Ga0496122_0084041
1980 Ga0496123_0007892
1981 Ga0496123_0063982
1982 Ga0496123_0072684
1983 Ga0496124_0002268
1984 Ga0496124_0003913
1985 Ga0496124_0006624
1986 Ga0496124_0028679
1987 Ga0496124_0079040
1988 Ga0496124_0200297
1989 Ga0496125_0003624
1990 Ga0496125_0006720
1991 Ga0496125_0006748
1992 Ga0496125_0009915
1993 Ga0496125_0012895
1994 Ga0496125_0015028
1995 Ga0496125_0021749
1996 Ga0496125_0036054
1997 Ga0496125_0048634
1998 Ga0496126_0005826
1999 Ga0496126_0018668
2000 Ga0496126_0085799
2001 Ga0496126_0189715
2002 Ga0496126_0223815
2003 Ga0496126_0271330
2004 Ga0496126_0505738
2005 Ga0501307_006741
2006 Ga0495678_000028
2007 Ga0495682_0000265
2008 Ga0495682_0061543
2009 Ga0501300_000569
2010 Ga0501300_009079
2011 Ga0501031_0043942
2012 Ga0501032_0024784
2013 Ga0501033_0004466
2014 Ga0501033_0320932
2015 Ga0501034_0014595
2016 Ga0501034_0129722
2017 Ga0501034_0140064
2018 Ga0501036_0045926
2019 Ga0501041_0022949
2020 Ga0501041_0079675
2021 Ga0501042_0013949
2022 Ga0501042_0167048
2023 Ga0501043_0054085
2024 Ga0501046_0165870
2025 Ga0501047_0329837
2026 Ga0501048_0086169
2027 Ga0501070_0059333
2028 Ga0501071_0263139
2029 Ga0501072_0019483
2030 Ga0501073_0022929
2031 Ga0501076_0033043
2032 Ga0501077_0131186
2033 Ga0501259_000005
2034 Ga0501081_0010148
2035 Ga0501081_0018659
2036 Ga0501241_023293
2037 Ga0501266_000721
2038 Ga0501035_0033080
2039 Ga0501035_0199989
2040 Ga0501044_0047218
2041 nmdc:mga03683_17782_c1
2042 nmdc:mga03683_49148_c1
2043 nmdc:mga03683_58651_c1
2044 nmdc:mga03n38_10895_c1
2045 nmdc:mga03n38_130933_c1
2046 nmdc:mga03n38_176098_c1
2047 nmdc:mga03n38_20430_c1
2048 nmdc:mga03n38_2106_c1
2049 nmdc:mga00v17_16532_c1
2050 nmdc:mga00v17_21160_c1
2051 nmdc:mga00v17_550_c1
2052 nmdc:mga00v17_76047_c1
2053 nmdc:mga00v17_858_c1
2054 nmdc:mga0yw44_115007_c1
2055 nmdc:mga0yw44_164_c1
2056 nmdc:mga0yw44_323_c1
2057 nmdc:mga0yw44_5027_c1
2058 nmdc:mga0yw44_6841_c1
2059 nmdc:mga0yw44_85225_c1
2060 nmdc:mga0k408_124283_c1
2061 nmdc:mga0k408_15132_c1
2062 nmdc:mga0k408_30968_c1
2063 nmdc:mga0k408_54101_c1
2064 nmdc:mga06z11_16137_c1
2065 nmdc:mga06z11_26827_c1
2066 nmdc:mga06z11_30013_c1
2067 nmdc:mga06z11_7315_c1
2068 nmdc:mga07m45_108967_c1
2069 nmdc:mga07m45_16144_c1
2070 nmdc:mga07m45_217778_c1
2071 nmdc:mga07m45_6347_c1
2072 nmdc:mga05p37_802106_c1
2073 nmdc:mga05p37_9734_c1
2074 nmdc:mga09592_54930_c1
2075 nmdc:mga09592_7400_c1
2076 nmdc:mga0qj67_26674_c1
2077 nmdc:mga0qj67_27823_c1
2078 nmdc:mga0qj67_609106_c1
2079 nmdc:mga06r32_2236_c1
2080 nmdc:mga08y16_197348_c1
2081 nmdc:mga0n895_9979_c1
2082 nmdc:mga0rr50_6938_c1
2083 nmdc:mga08x19_364727_c1
2084 nmdc:mga08x19_4_c1
2085 nmdc:mga0sz30_344_c1
2086 nmdc:mga0sz30_47_c2
2087 nmdc:mga0sz30_59488_c1
2088 Ga0495601_0000006
2089 Ga0495601_0285975
2090 Ga0495612_0000004
2091 Ga0500610_0000109
2092 Ga0495595_0000006
2093 Ga0495619_0000011
2094 Ga0500643_000053
2095 Ga0500643_000439
2096 Ga0500643_000774
2097 Ga0500643_015298
2098 Ga0500643_021960
2099 Ga0500646_0000182
2100 Ga0500583_0000160
2101 Ga0500583_0005083
2102 Ga0500651_0082441
2103 Ga0500641_0012315
2104 Ga0500555_002225
2105 Ga0500592_010042
2106 Ga0500595_006413
2107 Ga0500595_027558
2108 Ga0500607_000386
2109 Ga0500607_000706
2110 Ga0500642_0001986
2111 Ga0500642_0027983
2112 Ga0500642_0123938
2113 Ga0500658_0047352
2114 Ga0500659_0000749
2115 Ga0500559_0000174
2116 Ga0500559_0007572
2117 Ga0500559_0218521
2118 Ga0500568_0003968
2119 Ga0500573_0173075
2120 Ga0500590_110041
2121 Ga0500604_0000941
2122 Ga0500604_0008879
2123 Ga0500616_0001605
2124 Ga0500616_0183242
2125 Ga0500622_0001570
2126 Ga0500627_0002950
2127 Ga0500627_0003538
2128 Ga0500645_000291
2129 Ga0501084_0018285
2130 Ga0500661_000076
2131 Ga0530510_0016714
2132 2548501250
2133 2585282675
2134 2585327848
2135 2585555542
2136 2599965322
2137 2599978539
2138 2600010554
2139 2616310214
2140 2617914983
2141 2644649206
2142 2685151340
2143 2698321921
2144 2721506506
2145 2729148841
2146 2739212055
2147 2807409491
2148 2807457792
2149 2808856069
2150 2808923536
2151 2808936180
2152 2808945701
2153 2808964574
2154 2808999462
2155 2823423205
2156 2831428821
2157 2848702254
2158 2849668013
2159 2885215250
2160 2886633781
2161 2904762777
2162 2913846980
2163 2913916642
2164 2913944457
2165 2929145879
2166 2929237011
2167 2939618292
2168 2947430048
2169 2978971165
2170 2979086957
2171 3007400754
2172 642600354
2173 8023440115
2174 8023447006
2175 8055636865

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

65

162

0.85

PF00483

NTP_transferase

Nucleotidyl transferase

64

289

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.941 2 256
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.9301 2 256
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9266 2 256
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.9197 2 256
7d73-assembly1.cif.gz_F cryo-em structure of gmppa/gmppb complex bound to gtp (state i) 0.851 1 240
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.941 2 256 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9266 2 256 3.90.550.10
af_A4I3X5_10_117_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8374 1 117 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8317 94 232 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8093 1 246 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A136Q9E8-F1-model_v4 deleted 0.9925 125 256
AF-A0A3M9YZN7-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9913 1 255 GO:0009243
GO:0047343
AF-A0A517T7C1-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9902 1 256 GO:0009243
GO:0047343
AF-E8U3G0-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9888 1 255 GO:0009243
GO:0047343
AF-A0A1U9NNG5-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9876 1 256 GO:0009243
GO:0047343

Map