F489804
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1087 | 538 | 2175 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300025914|Ga0207671_10347990|Ga0207671_103479902 |
| Length | 319 |
| Sequence | MAPALPAACRRSPPPRYFSRPVLPPPAWAAGRPDSTQRLGTIASPPATGYRAAGNVDFGFFILQAVILAGGMGTRIAEESHLRPKPMIEIGGRPILWHIMKIYGHFGVHDFIICLGYRGYMIKEYFSNYFLHNADVTIDTLTNHVTYHNTKAEPWRVTMVDTGEASMTGGRLKRVASYLQPGRPFCFTYGDGLADVDIAATIAFHKRHGRKATLTGVVPPGRYGSLSLDGDQITRFIEKPPGDNTLVNGGFFVLDPSVIDLIADDATSWEGAPLETLAASGELMVHRHAGFWQPMDTLRDKNHLEALWAGGKPPWKVWE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 112 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 235 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 242 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 244 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 245 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 246 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 250 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 251 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 252 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 254 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 255 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 256 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 258 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 260 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 261 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 263 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 264 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 265 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 272 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 273 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 279 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 294 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 295 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 296 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 297 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 298 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 299 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 302 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 303 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 304 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 305 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 306 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 307 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 308 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 309 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 310 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 311 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 312 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 313 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 314 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 315 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 316 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 317 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 318 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 319 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 320 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 321 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 322 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 323 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 324 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 325 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 326 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 327 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 328 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 329 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 330 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 406 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 407 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 408 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 409 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 410 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 411 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 412 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 413 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 414 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 415 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 416 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 417 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 418 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 419 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 420 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 421 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 422 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 423 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 427 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 445 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 447 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 448 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 451 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 452 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 453 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 455 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 457 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 466 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 469 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 472 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 473 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 474 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 475 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 476 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 477 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 478 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 479 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 480 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 481 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 483 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 484 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 485 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 486 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 487 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 488 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 489 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 490 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 492 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 494 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 495 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 496 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 497 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 498 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 499 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 500 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 501 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 502 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 503 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 504 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 505 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 506 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 507 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 508 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 509 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 510 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 511 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 512 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 513 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 514 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 515 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 516 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 517 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 518 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 519 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 520 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 521 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 522 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 523 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 524 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 525 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 526 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 527 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 528 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 529 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 530 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 531 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 532 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 533 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 534 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 535 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 536 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 537 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 538 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.22 |
| Metatranscriptomes | 0.74 |
| Isolates | 4.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.36 |
| Nodule | 0.74 |
| Rhizoplane | 1.75 |
| Rhizosphere | 71.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207671_10347990 | 3300025914 | Bacteria | 1175 |
| 2 | SwRhRL2b_contig_2410546 | 2162886007 | Bacteria | 2012 |
| 3 | SwRhRL2b_contig_3658071 | 2162886007 | Bacteria | 1138 |
| 4 | JGI24736J21556_1008511 | 3300001904 | Bacteria | 1704 |
| 5 | JGI24740J21852_10001139 | 3300001979 | Bacteria | 12026 |
| 6 | JGI24739J22299_10001771 | 3300001989 | Bacteria | 8219 |
| 7 | JGI24739J22299_10010873 | 3300001989 | Bacteria | 3368 |
| 8 | JGI24737J22298_10027737 | 3300001990 | Bacteria | 1784 |
| 9 | JGI24735J21928_10003349 | 3300002067 | Bacteria | 5466 |
| 10 | JGI24735J21928_10005690 | 3300002067 | Bacteria | 4122 |
| 11 | JGI24748J21848_1000023 | 3300002074 | Bacteria | 106523 |
| 12 | JGI24738J21930_10003984 | 3300002075 | Bacteria | 3670 |
| 13 | JGI24034J26672_10000010 | 3300002239 | Bacteria | 150746 |
| 14 | JGI24751J29686_10015855 | 3300002459 | Bacteria | 1554 |
| 15 | JGI25151J46595_10002312 | 3300003187 | Bacteria | 11632 |
| 16 | JGI25165J46597_1001250 | 3300003214 | Bacteria | 15019 |
| 17 | JGI25153J46596_10013055 | 3300003215 | Bacteria | 3538 |
| 18 | rootH1_10069913 | 3300003316 | Bacteria | 3118 |
| 19 | rootH2_10221868 | 3300003320 | Bacteria | 9511 |
| 20 | rootH2_10295353 | 3300003320 | Bacteria | 3205 |
| 21 | rootH1_10013795 | 3300003316 | Bacteria | 5255 |
| 22 | rootH1_10013795 | 3300003323 | Bacteria | 7318 |
| 23 | Ga0006562J51391_1051510 | 3300003578 | Bacteria | 2594 |
| 24 | Ga0055532_1000054 | 3300003758 | Bacteria | 161617 |
| 25 | Ga0055525_1000021 | 3300003759 | Bacteria | 370802 |
| 26 | Ga0055525_1000663 | 3300003759 | Bacteria | 13277 |
| 27 | Ga0055535_1000037 | 3300003761 | Bacteria | 161617 |
| 28 | Ga0055535_1000475 | 3300003761 | Bacteria | 36547 |
| 29 | Ga0055542_1000157 | 3300003762 | Bacteria | 85679 |
| 30 | Ga0055529_1000070 | 3300003763 | Bacteria | 161617 |
| 31 | Ga0055526_1000329 | 3300003771 | Bacteria | 39211 |
| 32 | Ga0055526_1004142 | 3300003771 | Bacteria | 8841 |
| 33 | Ga0055526_1011388 | 3300003771 | Bacteria | 4011 |
| 34 | Ga0055526_1025080 | 3300003771 | Bacteria | 1925 |
| 35 | Ga0055536_1000149 | 3300003781 | Bacteria | 59801 |
| 36 | Ga0055536_1004606 | 3300003781 | Bacteria | 6987 |
| 37 | Ga0055534_1000883 | 3300003784 | Bacteria | 13641 |
| 38 | Ga0055530_10002573 | 3300003791 | Bacteria | 11505 |
| 39 | Ga0055540_1000622 | 3300003792 | Bacteria | 25228 |
| 40 | Ga0055540_1017869 | 3300003792 | Bacteria | 1963 |
| 41 | Ga0055531_10001158 | 3300003794 | Bacteria | 20326 |
| 42 | Ga0055531_10006162 | 3300003794 | Bacteria | 6856 |
| 43 | Ga0055541_1003285 | 3300003841 | Bacteria | 3066 |
| 44 | Ga0065165_1000030 | 3300005262 | Bacteria | 218104 |
| 45 | Ga0065714_10021842 | 3300005288 | Bacteria | 1972 |
| 46 | Ga0065714_10098217 | 3300005288 | Bacteria | 1716 |
| 47 | Ga0065704_10000597 | 3300005289 | Bacteria | 15674 |
| 48 | Ga0065704_10173848 | 3300005289 | Bacteria | 1275 |
| 49 | Ga0065704_10178514 | 3300005289 | Bacteria | 1250 |
| 50 | Ga0065715_10001856 | 3300005293 | Bacteria | 6970 |
| 51 | Ga0065707_10087919 | 3300005295 | Bacteria | 4842 |
| 52 | Ga0070658_10001409 | 3300005327 | Bacteria | 20543 |
| 53 | Ga0070658_10004364 | 3300005327 | Bacteria | 11538 |
| 54 | Ga0070676_10111913 | 3300005328 | Bacteria | 1701 |
| 55 | Ga0070676_10131404 | 3300005328 | Bacteria | 1584 |
| 56 | Ga0070676_10207484 | 3300005328 | Bacteria | 1287 |
| 57 | Ga0070683_100319670 | 3300005329 | Bacteria | 1477 |
| 58 | Ga0070683_100439147 | 3300005329 | Bacteria | 1245 |
| 59 | Ga0070683_100478424 | 3300005329 | Bacteria | 1189 |
| 60 | Ga0070690_100000055 | 3300005330 | Bacteria | 55023 |
| 61 | Ga0070670_100068558 | 3300005331 | Bacteria | 3044 |
| 62 | Ga0068869_100065438 | 3300005334 | Bacteria | 2676 |
| 63 | Ga0068869_100093641 | 3300005334 | Bacteria | 2264 |
| 64 | Ga0070666_10000009 | 3300005335 | Bacteria | 279209 |
| 65 | Ga0070680_100294027 | 3300005336 | Bacteria | 1377 |
| 66 | Ga0068868_100008614 | 3300005338 | Bacteria | 7305 |
| 67 | Ga0070660_100201357 | 3300005339 | Bacteria | 1615 |
| 68 | Ga0070689_100094929 | 3300005340 | Bacteria | 2355 |
| 69 | Ga0070689_100261327 | 3300005340 | Bacteria | 1431 |
| 70 | Ga0070689_100438803 | 3300005340 | Bacteria | 1109 |
| 71 | Ga0070661_100000068 | 3300005344 | Bacteria | 83844 |
| 72 | Ga0070692_10066907 | 3300005345 | Bacteria | 1906 |
| 73 | Ga0070668_100000109 | 3300005347 | Bacteria | 50768 |
| 74 | Ga0070668_100020350 | 3300005347 | Bacteria | 5007 |
| 75 | Ga0070668_100025441 | 3300005347 | Bacteria | 4487 |
| 76 | Ga0070669_100006318 | 3300005353 | Bacteria | 8544 |
| 77 | Ga0070669_100129610 | 3300005353 | Bacteria | 1933 |
| 78 | Ga0070675_100003633 | 3300005354 | Bacteria | 11728 |
| 79 | Ga0070675_100060402 | 3300005354 | Bacteria | 3130 |
| 80 | Ga0070671_100099442 | 3300005355 | Bacteria | 2440 |
| 81 | Ga0070671_100114564 | 3300005355 | Bacteria | 2266 |
| 82 | Ga0070674_100002357 | 3300005356 | Bacteria | 10422 |
| 83 | Ga0070673_100229224 | 3300005364 | Bacteria | 1611 |
| 84 | Ga0070673_100557303 | 3300005364 | Bacteria | 1042 |
| 85 | Ga0070659_100000135 | 3300005366 | Bacteria | 56628 |
| 86 | Ga0070659_100000867 | 3300005366 | Bacteria | 22120 |
| 87 | Ga0070659_100002242 | 3300005366 | Bacteria | 13752 |
| 88 | Ga0070659_100135341 | 3300005366 | Bacteria | 2003 |
| 89 | Ga0070667_100000385 | 3300005367 | Bacteria | 47859 |
| 90 | Ga0070667_100003070 | 3300005367 | Bacteria | 14351 |
| 91 | Ga0070667_100015911 | 3300005367 | Bacteria | 6223 |
| 92 | Ga0070667_100263786 | 3300005367 | Bacteria | 1543 |
| 93 | Ga0070714_100121818 | 3300005435 | Bacteria | 2321 |
| 94 | Ga0070714_100305947 | 3300005435 | Bacteria | 1483 |
| 95 | Ga0070700_100055104 | 3300005441 | Bacteria | 2487 |
| 96 | Ga0070700_100207240 | 3300005441 | Bacteria | 1381 |
| 97 | Ga0070663_100000008 | 3300005455 | Bacteria | 188775 |
| 98 | Ga0070663_100137142 | 3300005455 | Bacteria | 1864 |
| 99 | Ga0070663_100250688 | 3300005455 | Bacteria | 1401 |
| 100 | Ga0070678_100027075 | 3300005456 | Bacteria | 3887 |
| 101 | Ga0070678_100559426 | 3300005456 | Bacteria | 1016 |
| 102 | Ga0070662_100006646 | 3300005457 | Bacteria | 7468 |
| 103 | Ga0070662_100022445 | 3300005457 | Bacteria | 4321 |
| 104 | Ga0070662_100157186 | 3300005457 | Bacteria | 1775 |
| 105 | Ga0070662_100533245 | 3300005457 | Bacteria | 982 |
| 106 | Ga0070681_10079866 | 3300005458 | Unclassified | 3227 |
| 107 | Ga0070681_10266915 | 3300005458 | Bacteria | 1623 |
| 108 | Ga0070681_10405649 | 3300005458 | Bacteria | 1274 |
| 109 | Ga0068867_100043843 | 3300005459 | Bacteria | 3275 |
| 110 | Ga0068867_100283078 | 3300005459 | Bacteria | 1360 |
| 111 | Ga0070685_10152786 | 3300005466 | Bacteria | 1464 |
| 112 | Ga0070707_100465665 | 3300005468 | Bacteria | 1225 |
| 113 | Ga0070698_100000489 | 3300005471 | Bacteria | 42118 |
| 114 | Ga0070698_100080822 | 3300005471 | Bacteria | 3245 |
| 115 | Ga0070698_100135130 | 3300005471 | Bacteria | 2421 |
| 116 | Ga0070698_100700802 | 3300005471 | Bacteria | 955 |
| 117 | Ga0070699_100070764 | 3300005518 | Bacteria | 3033 |
| 118 | Ga0070699_100110679 | 3300005518 | Bacteria | 2411 |
| 119 | Ga0070699_100381774 | 3300005518 | Bacteria | 1272 |
| 120 | Ga0070679_100004697 | 3300005530 | Bacteria | 12599 |
| 121 | Ga0070679_100097498 | 3300005530 | Bacteria | 2927 |
| 122 | Ga0070679_100183999 | 3300005530 | Bacteria | 2061 |
| 123 | Ga0070697_100016631 | 3300005536 | Bacteria | 5786 |
| 124 | Ga0070697_100824900 | 3300005536 | Bacteria | 821 |
| 125 | Ga0068853_100020311 | 3300005539 | Bacteria | 5523 |
| 126 | Ga0068853_100052107 | 3300005539 | Bacteria | 3524 |
| 127 | Ga0068853_100104158 | 3300005539 | Bacteria | 2512 |
| 128 | Ga0068853_100175136 | 3300005539 | Bacteria | 1943 |
| 129 | Ga0070672_100000409 | 3300005543 | Bacteria | 24906 |
| 130 | Ga0070672_100312494 | 3300005543 | Bacteria | 1334 |
| 131 | Ga0070686_100000041 | 3300005544 | Bacteria | 104174 |
| 132 | Ga0070686_100099002 | 3300005544 | Bacteria | 1966 |
| 133 | Ga0070695_100017307 | 3300005545 | Bacteria | 4370 |
| 134 | Ga0070696_100406706 | 3300005546 | Bacteria | 1066 |
| 135 | Ga0070665_100018737 | 3300005548 | Bacteria | 6939 |
| 136 | Ga0070665_100032348 | 3300005548 | Bacteria | 5265 |
| 137 | Ga0070665_100087832 | 3300005548 | Bacteria | 3115 |
| 138 | Ga0070665_100683176 | 3300005548 | Bacteria | 1040 |
| 139 | Ga0070704_100242736 | 3300005549 | Bacteria | 1475 |
| 140 | Ga0068855_100006481 | 3300005563 | Bacteria | 14234 |
| 141 | Ga0068855_100016802 | 3300005563 | Bacteria | 8799 |
| 142 | Ga0068855_100024389 | 3300005563 | Bacteria | 7236 |
| 143 | Ga0068855_100380428 | 3300005563 | Bacteria | 1550 |
| 144 | Ga0070664_100000009 | 3300005564 | Bacteria | 166396 |
| 145 | Ga0070664_100193602 | 3300005564 | Bacteria | 1812 |
| 146 | Ga0070664_100681236 | 3300005564 | Bacteria | 957 |
| 147 | Ga0068857_100007095 | 3300005577 | Bacteria | 9649 |
| 148 | Ga0068857_100179674 | 3300005577 | Bacteria | 1926 |
| 149 | Ga0068854_100000023 | 3300005578 | Bacteria | 127086 |
| 150 | Ga0068854_100000024 | 3300005578 | Bacteria | 124310 |
| 151 | Ga0068854_100028898 | 3300005578 | Bacteria | 3834 |
| 152 | Ga0068854_100057533 | 3300005578 | Bacteria | 2805 |
| 153 | Ga0068854_100075122 | 3300005578 | Bacteria | 2481 |
| 154 | Ga0068854_100229675 | 3300005578 | Bacteria | 1472 |
| 155 | Ga0068856_100000019 | 3300005614 | Bacteria | 150500 |
| 156 | Ga0068856_100002944 | 3300005614 | Bacteria | 17452 |
| 157 | Ga0068856_100109698 | 3300005614 | Bacteria | 2756 |
| 158 | Ga0068852_100012678 | 3300005616 | Bacteria | 6412 |
| 159 | Ga0068852_100048495 | 3300005616 | Bacteria | 3629 |
| 160 | Ga0068852_100340373 | 3300005616 | Bacteria | 1462 |
| 161 | Ga0068859_100002443 | 3300005617 | Bacteria | 18918 |
| 162 | Ga0068859_100002746 | 3300005617 | Bacteria | 17844 |
| 163 | Ga0068859_100016879 | 3300005617 | Bacteria | 7328 |
| 164 | Ga0068859_100163494 | 3300005617 | Bacteria | 2305 |
| 165 | Ga0068864_100000661 | 3300005618 | Bacteria | 28761 |
| 166 | Ga0068864_100241190 | 3300005618 | Bacteria | 1675 |
| 167 | Ga0068864_100388585 | 3300005618 | Bacteria | 1324 |
| 168 | Ga0068864_100562955 | 3300005618 | Bacteria | 1103 |
| 169 | Ga0068866_10004073 | 3300005718 | Bacteria | 5996 |
| 170 | Ga0068861_100000441 | 3300005719 | Bacteria | 24079 |
| 171 | Ga0068861_100002019 | 3300005719 | Bacteria | 13142 |
| 172 | Ga0068861_100019804 | 3300005719 | Bacteria | 4809 |
| 173 | Ga0068851_10078371 | 3300005834 | Bacteria | 1722 |
| 174 | Ga0068863_100000317 | 3300005841 | Bacteria | 48992 |
| 175 | Ga0068863_100000705 | 3300005841 | Bacteria | 33651 |
| 176 | Ga0068863_100003514 | 3300005841 | Bacteria | 15465 |
| 177 | Ga0068863_100008845 | 3300005841 | Bacteria | 9833 |
| 178 | Ga0068863_100076557 | 3300005841 | Bacteria | 3165 |
| 179 | Ga0068860_100000022 | 3300005843 | Bacteria | 279209 |
| 180 | Ga0068860_100003256 | 3300005843 | Bacteria | 16733 |
| 181 | Ga0068860_100065199 | 3300005843 | Bacteria | 3459 |
| 182 | Ga0068860_100119863 | 3300005843 | Bacteria | 2519 |
| 183 | Ga0068860_100197992 | 3300005843 | Bacteria | 1946 |
| 184 | Ga0068860_100657848 | 3300005843 | Bacteria | 1056 |
| 185 | Ga0068862_100000596 | 3300005844 | Bacteria | 37603 |
| 186 | Ga0068862_100020520 | 3300005844 | Bacteria | 5520 |
| 187 | Ga0081455_10049469 | 3300005937 | Bacteria | 3623 |
| 188 | Ga0075365_10000349 | 3300006038 | Bacteria | 16542 |
| 189 | Ga0075365_10000706 | 3300006038 | Bacteria | 13439 |
| 190 | Ga0075365_10004015 | 3300006038 | Bacteria | 7714 |
| 191 | Ga0075365_10027179 | 3300006038 | Bacteria | 3637 |
| 192 | Ga0075365_10368842 | 3300006038 | Bacteria | 1012 |
| 193 | Ga0075368_10011102 | 3300006042 | Unclassified | 3273 |
| 194 | Ga0075368_10091685 | 3300006042 | Bacteria | 1243 |
| 195 | Ga0075363_100011278 | 3300006048 | Bacteria | 4275 |
| 196 | Ga0075363_100015353 | 3300006048 | Bacteria | 3763 |
| 197 | Ga0075363_100018241 | 3300006048 | Bacteria | 3492 |
| 198 | Ga0075364_10001743 | 3300006051 | Bacteria | 11994 |
| 199 | Ga0075364_10002839 | 3300006051 | Bacteria | 9759 |
| 200 | Ga0075364_10048942 | 3300006051 | Bacteria | 2755 |
| 201 | Ga0075364_10054472 | 3300006051 | Unclassified | 2616 |
| 202 | Ga0070716_100129679 | 3300006173 | Bacteria | 1592 |
| 203 | Ga0075362_10009498 | 3300006177 | Bacteria | 3764 |
| 204 | Ga0075362_10036243 | 3300006177 | Bacteria | 2157 |
| 205 | Ga0075362_10154567 | 3300006177 | Unclassified | 1102 |
| 206 | Ga0075367_10003220 | 3300006178 | Bacteria | 7716 |
| 207 | Ga0075367_10012827 | 3300006178 | Bacteria | 4487 |
| 208 | Ga0075367_10020340 | 3300006178 | Bacteria | 3694 |
| 209 | Ga0075367_10031060 | 3300006178 | Bacteria | 3067 |
| 210 | Ga0075367_10051082 | 3300006178 | Bacteria | 2443 |
| 211 | Ga0075367_10129808 | 3300006178 | Bacteria | 1557 |
| 212 | Ga0075369_10002209 | 3300006186 | Bacteria | 6891 |
| 213 | Ga0075369_10002288 | 3300006186 | Bacteria | 6806 |
| 214 | Ga0075369_10080599 | 3300006186 | Bacteria | 1443 |
| 215 | Ga0075366_10003243 | 3300006195 | Bacteria | 8547 |
| 216 | Ga0075366_10029525 | 3300006195 | Bacteria | 3221 |
| 217 | Ga0075366_10030236 | 3300006195 | Bacteria | 3183 |
| 218 | Ga0097621_100021383 | 3300006237 | Bacteria | 5004 |
| 219 | Ga0097621_100076541 | 3300006237 | Bacteria | 2776 |
| 220 | Ga0075370_10004495 | 3300006353 | Bacteria | 6783 |
| 221 | Ga0075370_10012301 | 3300006353 | Bacteria | 4519 |
| 222 | Ga0075370_10078839 | 3300006353 | Bacteria | 1891 |
| 223 | Ga0075370_10127782 | 3300006353 | Bacteria | 1482 |
| 224 | Ga0068871_100001760 | 3300006358 | Bacteria | 14588 |
| 225 | Ga0075428_100001894 | 3300006844 | Bacteria | 22450 |
| 226 | Ga0075428_100037054 | 3300006844 | Bacteria | 5371 |
| 227 | Ga0075430_100003424 | 3300006846 | Bacteria | 13262 |
| 228 | Ga0075430_100013674 | 3300006846 | Bacteria | 6918 |
| 229 | Ga0075431_100000364 | 3300006847 | Bacteria | 35896 |
| 230 | Ga0075431_100021229 | 3300006847 | Bacteria | 6637 |
| 231 | Ga0075434_100020199 | 3300006871 | Bacteria | 6455 |
| 232 | Ga0075434_100133179 | 3300006871 | Bacteria | 2505 |
| 233 | Ga0075429_100005261 | 3300006880 | Bacteria | 11132 |
| 234 | Ga0075429_100008541 | 3300006880 | Bacteria | 8910 |
| 235 | Ga0075436_100000321 | 3300006914 | Bacteria | 30575 |
| 236 | Ga0075436_100119610 | 3300006914 | Bacteria | 1842 |
| 237 | Ga0097620_100002442 | 3300006931 | Bacteria | 18918 |
| 238 | Ga0097620_100002746 | 3300006931 | Bacteria | 17844 |
| 239 | Ga0097620_100016879 | 3300006931 | Bacteria | 7328 |
| 240 | Ga0097620_100163495 | 3300006931 | Bacteria | 2305 |
| 241 | Ga0079104_1000163 | 3300006946 | Bacteria | 94189 |
| 242 | Ga0099826_10000013 | 3300006948 | Bacteria | 265459 |
| 243 | Ga0099826_10000048 | 3300006948 | Bacteria | 74895 |
| 244 | Ga0099826_10048612 | 3300006948 | Bacteria | 2867 |
| 245 | Ga0075435_100008156 | 3300007076 | Bacteria | 7501 |
| 246 | Ga0075435_100059536 | 3300007076 | Bacteria | 3096 |
| 247 | Ga0105251_10059587 | 3300009011 | Bacteria | 1800 |
| 248 | Ga0105244_10000698 | 3300009036 | Bacteria | 29096 |
| 249 | Ga0105244_10073094 | 3300009036 | Bacteria | 1707 |
| 250 | Ga0105250_10014263 | 3300009092 | Bacteria | 3268 |
| 251 | Ga0105250_10054927 | 3300009092 | Bacteria | 1598 |
| 252 | Ga0105240_10001579 | 3300009093 | Bacteria | 38656 |
| 253 | Ga0105240_10006137 | 3300009093 | Bacteria | 17725 |
| 254 | Ga0105240_10017956 | 3300009093 | Bacteria | 9516 |
| 255 | Ga0105240_10057143 | 3300009093 | Bacteria | 4878 |
| 256 | Ga0105240_10100584 | 3300009093 | Bacteria | 3517 |
| 257 | Ga0105240_10563674 | 3300009093 | Bacteria | 1259 |
| 258 | Ga0111539_10027771 | 3300009094 | Bacteria | 6911 |
| 259 | Ga0111539_10080845 | 3300009094 | Bacteria | 3823 |
| 260 | Ga0111539_10303704 | 3300009094 | Bacteria | 1857 |
| 261 | Ga0111539_11364438 | 3300009094 | Bacteria | 822 |
| 262 | Ga0105245_10204915 | 3300009098 | Bacteria | 1896 |
| 263 | Ga0105247_10048675 | 3300009101 | Bacteria | 2604 |
| 264 | Ga0114129_10015902 | 3300009147 | Bacteria | 10703 |
| 265 | Ga0114129_10193241 | 3300009147 | Bacteria | 2762 |
| 266 | Ga0114129_10362065 | 3300009147 | Bacteria | 1919 |
| 267 | Ga0114129_10542149 | 3300009147 | Bacteria | 1514 |
| 268 | Ga0105243_10033187 | 3300009148 | Bacteria | 3991 |
| 269 | Ga0105243_10110900 | 3300009148 | Bacteria | 2295 |
| 270 | Ga0105241_10002815 | 3300009174 | Bacteria | 13015 |
| 271 | Ga0105241_10110745 | 3300009174 | Bacteria | 2197 |
| 272 | Ga0105241_10118112 | 3300009174 | Bacteria | 2132 |
| 273 | Ga0105241_10701495 | 3300009174 | Bacteria | 924 |
| 274 | Ga0105242_10008344 | 3300009176 | Bacteria | 7960 |
| 275 | Ga0105248_10001248 | 3300009177 | Bacteria | 28422 |
| 276 | Ga0105248_10001677 | 3300009177 | Bacteria | 24650 |
| 277 | Ga0105248_10002804 | 3300009177 | Bacteria | 19370 |
| 278 | Ga0105248_10010586 | 3300009177 | Bacteria | 10165 |
| 279 | Ga0105248_10028059 | 3300009177 | Bacteria | 6270 |
| 280 | Ga0105248_10300172 | 3300009177 | Bacteria | 1808 |
| 281 | Ga0105248_10624854 | 3300009177 | Bacteria | 1215 |
| 282 | Ga0105237_10003070 | 3300009545 | Bacteria | 20134 |
| 283 | Ga0105237_10065625 | 3300009545 | Bacteria | 3626 |
| 284 | Ga0105237_10086871 | 3300009545 | Bacteria | 3117 |
| 285 | Ga0105237_10130696 | 3300009545 | Bacteria | 2505 |
| 286 | Ga0105237_10367331 | 3300009545 | Bacteria | 1444 |
| 287 | Ga0105238_10070117 | 3300009551 | Bacteria | 3505 |
| 288 | Ga0105249_10000014 | 3300009553 | Bacteria | 283274 |
| 289 | Ga0105249_10002930 | 3300009553 | Bacteria | 14719 |
| 290 | Ga0105249_10003753 | 3300009553 | Bacteria | 13111 |
| 291 | Ga0105249_10269945 | 3300009553 | Bacteria | 1694 |
| 292 | Ga0105239_10001206 | 3300010375 | Bacteria | 35293 |
| 293 | Ga0105239_10009151 | 3300010375 | Bacteria | 11204 |
| 294 | Ga0105239_10020093 | 3300010375 | Bacteria | 7368 |
| 295 | Ga0105239_10022264 | 3300010375 | Bacteria | 6985 |
| 296 | Ga0105239_10261695 | 3300010375 | Bacteria | 1944 |
| 297 | Ga0105239_10325619 | 3300010375 | Bacteria | 1733 |
| 298 | Ga0105239_10342452 | 3300010375 | Bacteria | 1687 |
| 299 | Ga0105246_10577033 | 3300011119 | Bacteria | 968 |
| 300 | Ga0157326_1001295 | 3300012513 | Bacteria | 2771 |
| 301 | Ga0157373_10006717 | 3300013100 | Bacteria | 8566 |
| 302 | Ga0157373_10011249 | 3300013100 | Bacteria | 6584 |
| 303 | Ga0157373_10061387 | 3300013100 | Bacteria | 2662 |
| 304 | Ga0157373_10099741 | 3300013100 | Bacteria | 2044 |
| 305 | Ga0157371_10000047 | 3300013102 | Bacteria | 185590 |
| 306 | Ga0157371_10002969 | 3300013102 | Bacteria | 15746 |
| 307 | Ga0157371_10004449 | 3300013102 | Bacteria | 12229 |
| 308 | Ga0157371_10008594 | 3300013102 | Bacteria | 8115 |
| 309 | Ga0157370_10000004 | 3300013104 | Bacteria | 366426 |
| 310 | Ga0157370_10002004 | 3300013104 | Bacteria | 25038 |
| 311 | Ga0157370_10013356 | 3300013104 | Bacteria | 8460 |
| 312 | Ga0157370_10014211 | 3300013104 | Bacteria | 8159 |
| 313 | Ga0157370_10014608 | 3300013104 | Bacteria | 8024 |
| 314 | Ga0157370_10047662 | 3300013104 | Bacteria | 4107 |
| 315 | Ga0157370_10056784 | 3300013104 | Bacteria | 3725 |
| 316 | Ga0157369_10006530 | 3300013105 | Bacteria | 13505 |
| 317 | Ga0157369_10020204 | 3300013105 | Bacteria | 7447 |
| 318 | Ga0157374_10519518 | 3300013296 | Bacteria | 1196 |
| 319 | Ga0157374_10619616 | 3300013296 | Bacteria | 1093 |
| 320 | Ga0157378_10035146 | 3300013297 | Bacteria | 4432 |
| 321 | Ga0157378_10111102 | 3300013297 | Bacteria | 2513 |
| 322 | Ga0157378_10670415 | 3300013297 | Bacteria | 1054 |
| 323 | Ga0163162_10016338 | 3300013306 | Bacteria | 7255 |
| 324 | Ga0163162_10105499 | 3300013306 | Bacteria | 2912 |
| 325 | Ga0163162_10127587 | 3300013306 | Bacteria | 2651 |
| 326 | Ga0163162_10457492 | 3300013306 | Bacteria | 1408 |
| 327 | Ga0163162_10477272 | 3300013306 | Bacteria | 1378 |
| 328 | Ga0163162_10741644 | 3300013306 | Bacteria | 1102 |
| 329 | Ga0157372_10000362 | 3300013307 | Bacteria | 50100 |
| 330 | Ga0157372_10002551 | 3300013307 | Bacteria | 19751 |
| 331 | Ga0157372_10031659 | 3300013307 | Bacteria | 5791 |
| 332 | Ga0157372_10177662 | 3300013307 | Bacteria | 2464 |
| 333 | Ga0157375_10000055 | 3300013308 | Bacteria | 126704 |
| 334 | Ga0157375_10000541 | 3300013308 | Bacteria | 33927 |
| 335 | Ga0157375_10022569 | 3300013308 | Bacteria | 5794 |
| 336 | Ga0157375_10204597 | 3300013308 | Bacteria | 2130 |
| 337 | Ga0157375_10401610 | 3300013308 | Bacteria | 1537 |
| 338 | Ga0157375_11074087 | 3300013308 | Bacteria | 941 |
| 339 | Ga0163163_10129014 | 3300014325 | Bacteria | 2568 |
| 340 | Ga0157380_10000325 | 3300014326 | Bacteria | 28843 |
| 341 | Ga0157380_10007519 | 3300014326 | Bacteria | 7739 |
| 342 | Ga0157380_10347251 | 3300014326 | Bacteria | 1387 |
| 343 | Ga0182008_10002412 | 3300014497 | Bacteria | 11737 |
| 344 | Ga0182008_10013003 | 3300014497 | Bacteria | 4379 |
| 345 | Ga0182008_10047525 | 3300014497 | Bacteria | 2132 |
| 346 | Ga0157379_10020026 | 3300014968 | Bacteria | 5913 |
| 347 | Ga0157379_10200051 | 3300014968 | Bacteria | 1807 |
| 348 | Ga0157379_10228856 | 3300014968 | Bacteria | 1685 |
| 349 | Ga0157376_10002090 | 3300014969 | Bacteria | 13430 |
| 350 | Ga0157376_10039071 | 3300014969 | Bacteria | 3867 |
| 351 | Ga0157376_10059668 | 3300014969 | Bacteria | 3199 |
| 352 | Ga0182006_1002028 | 3300015261 | Bacteria | 11368 |
| 353 | Ga0182006_1043206 | 3300015261 | Bacteria | 1762 |
| 354 | Ga0182006_1059276 | 3300015261 | Bacteria | 1450 |
| 355 | Ga0182007_10001040 | 3300015262 | Bacteria | 15203 |
| 356 | Ga0182007_10010076 | 3300015262 | Bacteria | 3760 |
| 357 | Ga0182007_10010490 | 3300015262 | Bacteria | 3656 |
| 358 | Ga0182007_10010979 | 3300015262 | Bacteria | 3547 |
| 359 | Ga0182005_1031995 | 3300015265 | Bacteria | 1432 |
| 360 | Ga0163161_10000057 | 3300017792 | Bacteria | 114339 |
| 361 | Ga0163161_10030363 | 3300017792 | Bacteria | 3846 |
| 362 | Ga0163161_10101528 | 3300017792 | Bacteria | 2142 |
| 363 | Ga0206356_11628886 | 3300020070 | Bacteria | 5585 |
| 364 | Ga0206351_10745048 | 3300020077 | Bacteria | 9435 |
| 365 | Ga0154015_1245876 | 3300020610 | Bacteria | 30783 |
| 366 | Ga0213872_10000256 | 3300021361 | Bacteria | 46367 |
| 367 | Ga0213872_10020201 | 3300021361 | Bacteria | 3069 |
| 368 | Ga0213876_10098049 | 3300021384 | Bacteria | 1553 |
| 369 | Ga0209784_100029 | 3300025224 | Bacteria | 347315 |
| 370 | Ga0209566_100030 | 3300025225 | Bacteria | 347329 |
| 371 | Ga0209566_101369 | 3300025225 | Bacteria | 7596 |
| 372 | Ga0209566_102510 | 3300025225 | Bacteria | 3350 |
| 373 | Ga0209674_100075 | 3300025226 | Bacteria | 216004 |
| 374 | Ga0209672_100178 | 3300025228 | Bacteria | 52778 |
| 375 | Ga0209672_100721 | 3300025228 | Bacteria | 16329 |
| 376 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 377 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 378 | Ga0209563_100117 | 3300025230 | Bacteria | 132048 |
| 379 | Ga0209437_101870 | 3300025233 | Bacteria | 4430 |
| 380 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 381 | Ga0209258_100158 | 3300025242 | Bacteria | 156881 |
| 382 | Ga0209677_100030 | 3300025253 | Bacteria | 347314 |
| 383 | Ga0209677_100248 | 3300025253 | Bacteria | 36912 |
| 384 | Ga0209148_1000092 | 3300025254 | Bacteria | 249076 |
| 385 | Ga0209148_1002665 | 3300025254 | Bacteria | 5746 |
| 386 | Ga0209759_1002970 | 3300025256 | Bacteria | 7057 |
| 387 | Ga0209233_1000340 | 3300025261 | Bacteria | 45824 |
| 388 | Ga0209565_1001410 | 3300025263 | Bacteria | 10658 |
| 389 | Ga0209565_1018256 | 3300025263 | Bacteria | 1520 |
| 390 | Ga0209455_1000130 | 3300025272 | Bacteria | 161669 |
| 391 | Ga0209455_1005930 | 3300025272 | Bacteria | 3685 |
| 392 | Ga0209675_1000050 | 3300025291 | Bacteria | 212222 |
| 393 | Ga0209675_1018444 | 3300025291 | Bacteria | 1953 |
| 394 | Ga0209676_1000053 | 3300025292 | Bacteria | 370111 |
| 395 | Ga0209676_1001174 | 3300025292 | Bacteria | 28334 |
| 396 | Ga0209676_1006985 | 3300025292 | Bacteria | 5427 |
| 397 | Ga0209025_1000093 | 3300025294 | Bacteria | 241788 |
| 398 | Ga0209025_1004087 | 3300025294 | Bacteria | 13012 |
| 399 | Ga0209564_1000211 | 3300025295 | Bacteria | 133277 |
| 400 | Ga0209564_1002127 | 3300025295 | Bacteria | 16795 |
| 401 | Ga0209564_1002156 | 3300025295 | Bacteria | 16604 |
| 402 | Ga0209758_1000349 | 3300025297 | Bacteria | 84164 |
| 403 | Ga0209758_1036668 | 3300025297 | Bacteria | 1909 |
| 404 | Ga0209050_1001493 | 3300025298 | Bacteria | 24848 |
| 405 | Ga0209256_1000538 | 3300025299 | Bacteria | 54992 |
| 406 | Ga0209051_1000924 | 3300025303 | Bacteria | 29157 |
| 407 | Ga0209051_1006399 | 3300025303 | Bacteria | 6645 |
| 408 | Ga0209257_1000598 | 3300025304 | Bacteria | 59869 |
| 409 | Ga0207697_10103774 | 3300025315 | Bacteria | 1213 |
| 410 | Ga0207655_1000885 | 3300025728 | Bacteria | 31714 |
| 411 | Ga0207655_1030163 | 3300025728 | Bacteria | 2527 |
| 412 | Ga0207713_1046306 | 3300025735 | Bacteria | 1769 |
| 413 | Ga0207642_10008016 | 3300025899 | Bacteria | 3600 |
| 414 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 415 | Ga0207647_10016643 | 3300025904 | Bacteria | 5014 |
| 416 | Ga0207645_10004107 | 3300025907 | Bacteria | 10831 |
| 417 | Ga0207643_10061099 | 3300025908 | Bacteria | 2152 |
| 418 | Ga0207705_10011507 | 3300025909 | Bacteria | 6400 |
| 419 | Ga0207654_10003667 | 3300025911 | Bacteria | 7747 |
| 420 | Ga0207654_10085380 | 3300025911 | Bacteria | 1910 |
| 421 | Ga0207654_10208476 | 3300025911 | Bacteria | 1290 |
| 422 | Ga0207707_10007428 | 3300025912 | Bacteria | 9548 |
| 423 | Ga0207707_10046166 | 3300025912 | Bacteria | 3793 |
| 424 | Ga0207707_10300623 | 3300025912 | Bacteria | 1388 |
| 425 | Ga0207707_10314034 | 3300025912 | Bacteria | 1354 |
| 426 | Ga0207695_10005037 | 3300025913 | Bacteria | 17741 |
| 427 | Ga0207695_10009597 | 3300025913 | Bacteria | 11953 |
| 428 | Ga0207695_10021604 | 3300025913 | Bacteria | 7337 |
| 429 | Ga0207695_10082586 | 3300025913 | Plasmid | 3247 |
| 430 | Ga0207671_10001189 | 3300025914 | Bacteria | 30894 |
| 431 | Ga0207671_10157292 | 3300025914 | Bacteria | 1758 |
| 432 | Ga0207671_10264108 | 3300025914 | Bacteria | 1355 |
| 433 | Ga0207663_10346632 | 3300025916 | Bacteria | 1123 |
| 434 | Ga0207660_10009000 | 3300025917 | Bacteria | 6461 |
| 435 | Ga0207660_10128401 | 3300025917 | Bacteria | 1927 |
| 436 | Ga0207657_10078269 | 3300025919 | Bacteria | 2784 |
| 437 | Ga0207649_10000030 | 3300025920 | Bacteria | 154458 |
| 438 | Ga0207652_10010117 | 3300025921 | Bacteria | 7598 |
| 439 | Ga0207652_10026130 | 3300025921 | Bacteria | 4860 |
| 440 | Ga0207652_10699067 | 3300025921 | Bacteria | 905 |
| 441 | Ga0207681_10002214 | 3300025923 | Bacteria | 12380 |
| 442 | Ga0207694_10016307 | 3300025924 | Bacteria | 5608 |
| 443 | Ga0207650_10008268 | 3300025925 | Bacteria | 7104 |
| 444 | Ga0207650_10016778 | 3300025925 | Bacteria | 5121 |
| 445 | Ga0207659_10147503 | 3300025926 | Bacteria | 1833 |
| 446 | Ga0207687_10002040 | 3300025927 | Bacteria | 13851 |
| 447 | Ga0207687_10267913 | 3300025927 | Bacteria | 1364 |
| 448 | Ga0207664_10011490 | 3300025929 | Bacteria | 6299 |
| 449 | Ga0207664_10031159 | 3300025929 | Bacteria | 4077 |
| 450 | Ga0207644_10000121 | 3300025931 | Bacteria | 57269 |
| 451 | Ga0207644_10254077 | 3300025931 | Bacteria | 1403 |
| 452 | Ga0207690_10001021 | 3300025932 | Bacteria | 17926 |
| 453 | Ga0207690_10008695 | 3300025932 | Bacteria | 6024 |
| 454 | Ga0207690_10012406 | 3300025932 | Bacteria | 5096 |
| 455 | Ga0207706_10013054 | 3300025933 | Bacteria | 7559 |
| 456 | Ga0207706_10027735 | 3300025933 | Bacteria | 5062 |
| 457 | Ga0207706_10041302 | 3300025933 | Bacteria | 4089 |
| 458 | Ga0207706_10041900 | 3300025933 | Bacteria | 4057 |
| 459 | Ga0207706_10651558 | 3300025933 | Bacteria | 902 |
| 460 | Ga0207686_10070672 | 3300025934 | Bacteria | 2244 |
| 461 | Ga0207686_10591545 | 3300025934 | Bacteria | 872 |
| 462 | Ga0207709_10004576 | 3300025935 | Bacteria | 7962 |
| 463 | Ga0207704_10072113 | 3300025938 | Bacteria | 2194 |
| 464 | Ga0207665_10163772 | 3300025939 | Bacteria | 1601 |
| 465 | Ga0207691_10000575 | 3300025940 | Bacteria | 36701 |
| 466 | Ga0207691_10290528 | 3300025940 | Bacteria | 1406 |
| 467 | Ga0207711_10004771 | 3300025941 | Bacteria | 11509 |
| 468 | Ga0207711_10013297 | 3300025941 | Bacteria | 6837 |
| 469 | Ga0207711_10019873 | 3300025941 | Bacteria | 5598 |
| 470 | Ga0207711_10029581 | 3300025941 | Bacteria | 4622 |
| 471 | Ga0207689_10027859 | 3300025942 | Bacteria | 4727 |
| 472 | Ga0207689_10587338 | 3300025942 | Bacteria | 937 |
| 473 | Ga0207661_10040878 | 3300025944 | Bacteria | 3648 |
| 474 | Ga0207661_10266582 | 3300025944 | Bacteria | 1527 |
| 475 | Ga0207661_10398247 | 3300025944 | Bacteria | 1248 |
| 476 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 477 | Ga0207679_10094057 | 3300025945 | Bacteria | 2326 |
| 478 | Ga0207667_10004203 | 3300025949 | Bacteria | 17674 |
| 479 | Ga0207667_10007423 | 3300025949 | Bacteria | 13174 |
| 480 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 481 | Ga0207712_10042902 | 3300025961 | Bacteria | 3118 |
| 482 | Ga0207668_10000166 | 3300025972 | Bacteria | 45782 |
| 483 | Ga0207668_10054097 | 3300025972 | Bacteria | 2785 |
| 484 | Ga0207668_10078011 | 3300025972 | Bacteria | 2390 |
| 485 | Ga0207640_10000039 | 3300025981 | Bacteria | 107982 |
| 486 | Ga0207640_10000595 | 3300025981 | Bacteria | 21495 |
| 487 | Ga0207640_10139724 | 3300025981 | Bacteria | 1764 |
| 488 | Ga0207640_10197393 | 3300025981 | Bacteria | 1522 |
| 489 | Ga0207658_10000328 | 3300025986 | Bacteria | 47873 |
| 490 | Ga0207658_10000462 | 3300025986 | Bacteria | 38001 |
| 491 | Ga0207658_10212823 | 3300025986 | Bacteria | 1621 |
| 492 | Ga0207658_10437372 | 3300025986 | Bacteria | 1156 |
| 493 | Ga0207677_10384993 | 3300026023 | Bacteria | 1185 |
| 494 | Ga0207703_10126192 | 3300026035 | Bacteria | 2204 |
| 495 | Ga0207639_10139809 | 3300026041 | Bacteria | 2016 |
| 496 | Ga0207639_10173652 | 3300026041 | Bacteria | 1827 |
| 497 | Ga0207639_10262228 | 3300026041 | Bacteria | 1512 |
| 498 | Ga0207678_10000006 | 3300026067 | Bacteria | 188733 |
| 499 | Ga0207678_10066935 | 3300026067 | Bacteria | 3084 |
| 500 | Ga0207678_10428979 | 3300026067 | Bacteria | 1147 |
| 501 | Ga0207708_10073140 | 3300026075 | Bacteria | 2627 |
| 502 | Ga0207708_10155144 | 3300026075 | Bacteria | 1805 |
| 503 | Ga0207702_10000206 | 3300026078 | Bacteria | 70068 |
| 504 | Ga0207702_10009722 | 3300026078 | Bacteria | 8077 |
| 505 | Ga0207702_10083392 | 3300026078 | Bacteria | 2781 |
| 506 | Ga0207641_10000263 | 3300026088 | Bacteria | 66525 |
| 507 | Ga0207641_10000582 | 3300026088 | Bacteria | 40259 |
| 508 | Ga0207641_10013287 | 3300026088 | Bacteria | 6755 |
| 509 | Ga0207641_10016644 | 3300026088 | Bacteria | 6020 |
| 510 | Ga0207641_10137585 | 3300026088 | Bacteria | 2200 |
| 511 | Ga0207648_10250716 | 3300026089 | Bacteria | 1578 |
| 512 | Ga0207676_10000578 | 3300026095 | Bacteria | 30142 |
| 513 | Ga0207676_10056843 | 3300026095 | Bacteria | 3078 |
| 514 | Ga0207676_10121087 | 3300026095 | Bacteria | 2207 |
| 515 | Ga0207676_10176649 | 3300026095 | Bacteria | 1866 |
| 516 | Ga0207674_10016609 | 3300026116 | Bacteria | 8049 |
| 517 | Ga0207675_100000131 | 3300026118 | Bacteria | 62791 |
| 518 | Ga0207675_100001855 | 3300026118 | Bacteria | 21175 |
| 519 | Ga0207675_100002202 | 3300026118 | Bacteria | 19367 |
| 520 | Ga0207675_100003015 | 3300026118 | Bacteria | 16511 |
| 521 | Ga0207683_10034058 | 3300026121 | Bacteria | 4426 |
| 522 | Ga0207683_10042935 | 3300026121 | Bacteria | 3949 |
| 523 | Ga0207683_10400897 | 3300026121 | Bacteria | 1262 |
| 524 | Ga0207683_10527396 | 3300026121 | Bacteria | 1091 |
| 525 | Ga0207698_10011260 | 3300026142 | Bacteria | 5791 |
| 526 | Ga0207698_10062401 | 3300026142 | Bacteria | 2910 |
| 527 | Ga0207698_10266046 | 3300026142 | Bacteria | 1578 |
| 528 | Ga0207698_10286053 | 3300026142 | Bacteria | 1527 |
| 529 | Ga0209281_1000064 | 3300027111 | Bacteria | 287876 |
| 530 | Ga0209282_1000066 | 3300027666 | Bacteria | 87072 |
| 531 | Ga0209282_1000081 | 3300027666 | Bacteria | 71750 |
| 532 | Ga0207428_10139858 | 3300027907 | Bacteria | 1849 |
| 533 | Ga0265354_1000840 | 3300028016 | Bacteria | 4950 |
| 534 | Ga0265357_1000102 | 3300028023 | Bacteria | 3341 |
| 535 | Ga0268266_10015846 | 3300028379 | Bacteria | 6452 |
| 536 | Ga0268266_10058588 | 3300028379 | Bacteria | 3316 |
| 537 | Ga0268266_10089707 | 3300028379 | Bacteria | 2693 |
| 538 | Ga0268265_10000266 | 3300028380 | Bacteria | 59618 |
| 539 | Ga0268265_10035901 | 3300028380 | Bacteria | 3626 |
| 540 | Ga0268265_10037739 | 3300028380 | Bacteria | 3548 |
| 541 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 542 | Ga0268264_10002685 | 3300028381 | Bacteria | 15533 |
| 543 | Ga0268264_10108683 | 3300028381 | Bacteria | 2425 |
| 544 | Ga0268264_10245401 | 3300028381 | Bacteria | 1661 |
| 545 | Ga0265337_1027775 | 3300028556 | Bacteria | 1703 |
| 546 | Ga0265334_10026302 | 3300028573 | Bacteria | 2349 |
| 547 | Ga0265318_10004532 | 3300028577 | Bacteria | 6714 |
| 548 | Ga0265318_10035698 | 3300028577 | Bacteria | 1910 |
| 549 | Ga0265338_10008160 | 3300028800 | Bacteria | 12774 |
| 550 | Ga0265338_10047685 | 3300028800 | Bacteria | 3910 |
| 551 | Ga0265338_10056651 | 3300028800 | Bacteria | 3473 |
| 552 | Ga0265338_10114013 | 3300028800 | Bacteria | 2170 |
| 553 | Ga0237817_10015 | 3300030083 | Bacteria | 73147 |
| 554 | Ga0307511_10001633 | 3300030521 | Bacteria | 23697 |
| 555 | Ga0307511_10148041 | 3300030521 | Bacteria | 1357 |
| 556 | Ga0316183_1060816 | 3300030742 | Bacteria | 7885 |
| 557 | Ga0265771_1000126 | 3300031010 | Bacteria | 2037 |
| 558 | Ga0265760_10000274 | 3300031090 | Bacteria | 13951 |
| 559 | Ga0265760_10006202 | 3300031090 | Bacteria | 3418 |
| 560 | Ga0265332_10005747 | 3300031238 | Bacteria | 5697 |
| 561 | Ga0265320_10004192 | 3300031240 | Bacteria | 9473 |
| 562 | Ga0265325_10008191 | 3300031241 | Bacteria | 6190 |
| 563 | Ga0265327_10200214 | 3300031251 | Bacteria | 905 |
| 564 | Ga0265316_10217443 | 3300031344 | Bacteria | 1411 |
| 565 | Ga0307513_10000090 | 3300031456 | Bacteria | 129750 |
| 566 | Ga0307513_10122883 | 3300031456 | Bacteria | 2559 |
| 567 | Ga0307509_10235780 | 3300031507 | Bacteria | 1628 |
| 568 | Ga0307509_10332975 | 3300031507 | Bacteria | 1249 |
| 569 | Ga0307408_100000032 | 3300031548 | Bacteria | 213693 |
| 570 | Ga0307408_100000364 | 3300031548 | Bacteria | 41737 |
| 571 | Ga0307408_100000612 | 3300031548 | Bacteria | 30454 |
| 572 | Ga0307408_100004980 | 3300031548 | Bacteria | 8924 |
| 573 | Ga0307408_100005474 | 3300031548 | Bacteria | 8493 |
| 574 | Ga0307408_100281295 | 3300031548 | Bacteria | 1386 |
| 575 | Ga0265313_10000939 | 3300031595 | Bacteria | 28951 |
| 576 | Ga0307508_10066349 | 3300031616 | Bacteria | 3178 |
| 577 | Ga0307508_10206345 | 3300031616 | Bacteria | 1566 |
| 578 | Ga0265314_10103094 | 3300031711 | Bacteria | 1829 |
| 579 | Ga0316576_10024396 | 3300031727 | Bacteria | 4222 |
| 580 | Ga0316576_10215141 | 3300031727 | Unclassified | 1446 |
| 581 | Ga0307516_10362264 | 3300031730 | Bacteria | 1114 |
| 582 | Ga0307405_10007500 | 3300031731 | Bacteria | 5462 |
| 583 | Ga0307413_10010139 | 3300031824 | Bacteria | 4551 |
| 584 | Ga0307413_10406488 | 3300031824 | Bacteria | 1068 |
| 585 | Ga0307413_10444787 | 3300031824 | Bacteria | 1027 |
| 586 | Ga0307410_10000015 | 3300031852 | Bacteria | 73395 |
| 587 | Ga0307410_10001538 | 3300031852 | Bacteria | 10515 |
| 588 | Ga0307406_10000454 | 3300031901 | Bacteria | 23796 |
| 589 | Ga0307406_10022530 | 3300031901 | Bacteria | 3738 |
| 590 | Ga0307406_10033934 | 3300031901 | Bacteria | 3127 |
| 591 | Ga0307407_10004658 | 3300031903 | Bacteria | 5853 |
| 592 | Ga0307407_10029021 | 3300031903 | Bacteria | 2965 |
| 593 | Ga0307407_10063555 | 3300031903 | Bacteria | 2166 |
| 594 | Ga0307412_10012487 | 3300031911 | Bacteria | 4955 |
| 595 | Ga0307412_10037471 | 3300031911 | Bacteria | 3116 |
| 596 | Ga0307412_10195347 | 3300031911 | Unclassified | 1533 |
| 597 | Ga0307409_100000111 | 3300031995 | Bacteria | 30018 |
| 598 | Ga0307409_100014852 | 3300031995 | Bacteria | 5085 |
| 599 | Ga0307409_100024332 | 3300031995 | Bacteria | 4221 |
| 600 | Ga0307416_100000038 | 3300032002 | Bacteria | 136704 |
| 601 | Ga0307416_100003964 | 3300032002 | Bacteria | 8817 |
| 602 | Ga0307416_100006832 | 3300032002 | Bacteria | 7180 |
| 603 | Ga0307416_100007558 | 3300032002 | Bacteria | 6926 |
| 604 | Ga0307416_100035622 | 3300032002 | Bacteria | 3804 |
| 605 | Ga0307416_100193506 | 3300032002 | Bacteria | 1921 |
| 606 | Ga0307414_10002982 | 3300032004 | Bacteria | 8962 |
| 607 | Ga0307411_10002190 | 3300032005 | Bacteria | 8491 |
| 608 | Ga0307415_100001167 | 3300032126 | Bacteria | 12279 |
| 609 | Ga0307415_100668915 | 3300032126 | Bacteria | 933 |
| 610 | Ga0307510_10036531 | 3300033180 | Bacteria | 5466 |
| 611 | Ga0373926_0017293 | 3300035083 | Bacteria | 2474 |
| 612 | Ga0373923_0036587 | 3300035111 | Bacteria | 2004 |
| 613 | Ga0373932_0019569 | 3300035112 | Bacteria | 1766 |
| 614 | Ga0373945_0052762 | 3300035116 | Bacteria | 1499 |
| 615 | Ga0373954_0001145 | 3300035118 | Bacteria | 10665 |
| 616 | Ga0373954_0080525 | 3300035118 | Bacteria | 1556 |
| 617 | Ga0373957_0001986 | 3300035120 | Bacteria | 5711 |
| 618 | Ga0373943_0001477 | 3300035170 | Bacteria | 10643 |
| 619 | Ga0373955_0001023 | 3300035172 | Bacteria | 11872 |
| 620 | Ga0373924_0001191 | 3300035410 | Bacteria | 8373 |
| 621 | Ga0373931_0008709 | 3300035691 | Bacteria | 4827 |
| 622 | Ga0373935_0000161 | 3300035692 | Bacteria | 30905 |
| 623 | Ga0373935_0049948 | 3300035692 | Bacteria | 2653 |
| 624 | Ga0373927_0038675 | 3300035695 | Bacteria | 3097 |
| 625 | Ga0373927_0327213 | 3300035695 | Bacteria | 1009 |
| 626 | Ga0373947_0002132 | 3300035725 | Bacteria | 12049 |
| 627 | Ga0373947_0032276 | 3300035725 | Bacteria | 3085 |
| 628 | Ga0373937_0000256 | 3300036401 | Bacteria | 51768 |
| 629 | Ga0373937_0010619 | 3300036401 | Bacteria | 8047 |
| 630 | Ga0373937_0101869 | 3300036401 | Bacteria | 2665 |
| 631 | Ga0373937_0119531 | 3300036401 | Bacteria | 2455 |
| 632 | Ga0373937_0278798 | 3300036401 | Bacteria | 1578 |
| 633 | Ga0373937_0306755 | 3300036401 | Bacteria | 1501 |
| 634 | Ga0316584_0015557 | 3300036712 | Bacteria | 5442 |
| 635 | Ga0373925_0000087 | 3300037068 | Bacteria | 99043 |
| 636 | Ga0395899_0142327 | 3300037312 | Bacteria | 1705 |
| 637 | Ga0395900_0008015 | 3300037418 | Bacteria | 10869 |
| 638 | Ga0395900_0026342 | 3300037418 | Bacteria | 5955 |
| 639 | Ga0395900_0026620 | 3300037418 | Bacteria | 5922 |
| 640 | Ga0395900_0127410 | 3300037418 | Bacteria | 2610 |
| 641 | Ga0395898_0008110 | 3300037466 | Bacteria | 11117 |
| 642 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 643 | Ga0395905_0000678 | 3300037471 | Bacteria | 45181 |
| 644 | Ga0395905_0003795 | 3300037471 | Bacteria | 15977 |
| 645 | Ga0395905_0010178 | 3300037471 | Bacteria | 9165 |
| 646 | Ga0395905_0011428 | 3300037471 | Bacteria | 8579 |
| 647 | Ga0395905_0013029 | 3300037471 | Bacteria | 7988 |
| 648 | Ga0395901_0025008 | 3300038443 | Bacteria | 6129 |
| 649 | Ga0395901_0026526 | 3300038443 | Bacteria | 5949 |
| 650 | Ga0395901_0622179 | 3300038443 | Bacteria | 1086 |
| 651 | Ga0237819_01424 | 3300038705 | Bacteria | 6186 |
| 652 | Ga0237819_05966 | 3300038705 | Bacteria | 1869 |
| 653 | Ga0400490_13146 | 3300038726 | Bacteria | 15035 |
| 654 | Ga0400490_42190 | 3300038726 | Bacteria | 6698 |
| 655 | Ga0400488_36200 | 3300038741 | Bacteria | 5476 |
| 656 | Ga0400483_027285 | 3300039062 | Bacteria | 3313 |
| 657 | Ga0400489_45819 | 3300039093 | Bacteria | 3427 |
| 658 | Ga0400489_71985 | 3300039093 | Bacteria | 1929 |
| 659 | Ga0400487_43094 | 3300039110 | Bacteria | 17442 |
| 660 | Ga0436365_0827163 | 3300039437 | Bacteria | 2158 |
| 661 | Ga0436360_0549688 | 3300039438 | Bacteria | 1913 |
| 662 | Ga0436360_0757569 | 3300039438 | Bacteria | 1479 |
| 663 | Ga0436361_0051717 | 3300039447 | Bacteria | 5904 |
| 664 | Ga0436361_0151105 | 3300039447 | Bacteria | 6131 |
| 665 | Ga0436361_0295037 | 3300039447 | Bacteria | 2369 |
| 666 | Ga0436361_0677882 | 3300039447 | Bacteria | 228834 |
| 667 | Ga0436361_1123576 | 3300039447 | Bacteria | 2210 |
| 668 | Ga0451843_1071893 | 3300041509 | Bacteria | 1367 |
| 669 | Ga0439433_0002009 | 3300041999 | Bacteria | 4269 |
| 670 | Ga0439441_000192 | 3300042001 | Bacteria | 5560 |
| 671 | Ga0439445_0015704 | 3300042004 | Bacteria | 1857 |
| 672 | Ga0439449_0000154 | 3300042007 | Bacteria | 23362 |
| 673 | Ga0439451_000122 | 3300042009 | Bacteria | 14186 |
| 674 | Ga0439456_000640 | 3300042013 | Bacteria | 7263 |
| 675 | Ga0439462_0000779 | 3300042015 | Bacteria | 6620 |
| 676 | Ga0439463_000134 | 3300042016 | Bacteria | 18645 |
| 677 | Ga0450911_000168 | 3300042115 | Bacteria | 25689 |
| 678 | Ga0450913_007014 | 3300042117 | Bacteria | 840 |
| 679 | Ga0450923_003258 | 3300042125 | Bacteria | 2429 |
| 680 | Ga0450903_000726 | 3300042138 | Bacteria | 6518 |
| 681 | Ga0450905_003879 | 3300042142 | Bacteria | 1968 |
| 682 | Ga0439464_0002454 | 3300042439 | Bacteria | 4560 |
| 683 | Ga0439460_0000538 | 3300042461 | Bacteria | 8276 |
| 684 | Ga0451577_0000011 | 3300042876 | Bacteria | 597389 |
| 685 | Ga0451577_0000219 | 3300042876 | Bacteria | 118088 |
| 686 | Ga0451577_0000761 | 3300042876 | Bacteria | 49103 |
| 687 | Ga0451577_0013357 | 3300042876 | Bacteria | 7689 |
| 688 | Ga0451577_0016785 | 3300042876 | Bacteria | 6770 |
| 689 | Ga0451577_0037400 | 3300042876 | Bacteria | 4369 |
| 690 | Ga0451577_0068367 | 3300042876 | Bacteria | 3168 |
| 691 | Ga0451577_0073801 | 3300042876 | Bacteria | 3044 |
| 692 | Ga0439440_0000578 | 3300042993 | Bacteria | 6204 |
| 693 | Ga0466986_0015418 | 3300044650 | Bacteria | 4890 |
| 694 | Ga0453683_0000054 | 3300044673 | Bacteria | 194357 |
| 695 | Ga0453683_0000313 | 3300044673 | Bacteria | 60061 |
| 696 | Ga0453683_0097412 | 3300044673 | Bacteria | 1846 |
| 697 | Ga0466966_0155885 | 3300044684 | Bacteria | 1391 |
| 698 | Ga0466966_0213074 | 3300044684 | Bacteria | 1167 |
| 699 | Ga0466961_0000213 | 3300044693 | Bacteria | 39056 |
| 700 | Ga0453684_0000087 | 3300044712 | Bacteria | 395597 |
| 701 | Ga0453684_0000114 | 3300044712 | Bacteria | 356610 |
| 702 | Ga0453684_0000210 | 3300044712 | Bacteria | 255463 |
| 703 | Ga0453684_0000381 | 3300044712 | Bacteria | 181609 |
| 704 | Ga0453684_0000947 | 3300044712 | Bacteria | 95768 |
| 705 | Ga0453684_0001345 | 3300044712 | Bacteria | 72030 |
| 706 | Ga0453684_0007495 | 3300044712 | Archaea | 20020 |
| 707 | Ga0453684_0008486 | 3300044712 | Bacteria | 18374 |
| 708 | Ga0453684_0008826 | 3300044712 | Bacteria | 17873 |
| 709 | Ga0453684_0010397 | 3300044712 | Bacteria | 15923 |
| 710 | Ga0453684_0034369 | 3300044712 | Bacteria | 7037 |
| 711 | Ga0453684_0042573 | 3300044712 | Bacteria | 6121 |
| 712 | Ga0453684_0051916 | 3300044712 | Bacteria | 5368 |
| 713 | Ga0453684_0125685 | 3300044712 | Bacteria | 3087 |
| 714 | Ga0453684_0222068 | 3300044712 | Bacteria | 2188 |
| 715 | Ga0453684_0662980 | 3300044712 | Bacteria | 1137 |
| 716 | Ga0453684_0788165 | 3300044712 | Bacteria | 1026 |
| 717 | Ga0466959_0001157 | 3300045049 | Bacteria | 15891 |
| 718 | Ga0466959_0057462 | 3300045049 | Bacteria | 2836 |
| 719 | Ga0451576_0002484 | 3300045051 | Bacteria | 27384 |
| 720 | Ga0451576_0003256 | 3300045051 | Bacteria | 22524 |
| 721 | Ga0451576_0003616 | 3300045051 | Bacteria | 21008 |
| 722 | Ga0451576_0005653 | 3300045051 | Bacteria | 15615 |
| 723 | Ga0451576_0020607 | 3300045051 | Bacteria | 7176 |
| 724 | Ga0451576_0027071 | 3300045051 | Bacteria | 6162 |
| 725 | Ga0451576_0035954 | 3300045051 | Bacteria | 5253 |
| 726 | Ga0451576_0108140 | 3300045051 | Bacteria | 2894 |
| 727 | Ga0451576_0138209 | 3300045051 | Bacteria | 2541 |
| 728 | Ga0451576_0170525 | 3300045051 | Bacteria | 2271 |
| 729 | Ga0466958_0000259 | 3300045836 | Bacteria | 20492 |
| 730 | Ga0466967_0001151 | 3300045976 | Bacteria | 14779 |
| 731 | Ga0495617_016103 | 3300046452 | Bacteria | 2529 |
| 732 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 733 | Ga0495590_0037613 | 3300046457 | Bacteria | 1687 |
| 734 | Ga0495629_0036170 | 3300046459 | Bacteria | 3487 |
| 735 | Ga0495638_0008030 | 3300046460 | Bacteria | 7516 |
| 736 | Ga0495638_0011178 | 3300046460 | Bacteria | 6200 |
| 737 | Ga0495651_0000078 | 3300046462 | Bacteria | 71749 |
| 738 | Ga0495651_0062806 | 3300046462 | Bacteria | 2841 |
| 739 | Ga0495653_0000015 | 3300046463 | Bacteria | 213697 |
| 740 | Ga0495650_0001461 | 3300046471 | Bacteria | 22661 |
| 741 | Ga0495650_0039176 | 3300046471 | Bacteria | 2047 |
| 742 | Ga0495580_0000685 | 3300046472 | Bacteria | 28893 |
| 743 | Ga0495580_0114224 | 3300046472 | Bacteria | 1876 |
| 744 | Ga0495580_0293037 | 3300046472 | Bacteria | 1109 |
| 745 | Ga0495605_0000759 | 3300046474 | Bacteria | 23640 |
| 746 | Ga0495605_0001152 | 3300046474 | Bacteria | 17537 |
| 747 | Ga0495662_0013543 | 3300046476 | Bacteria | 3969 |
| 748 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 749 | Ga0495584_0140364 | 3300046491 | Bacteria | 1227 |
| 750 | Ga0495585_0090226 | 3300046492 | Bacteria | 1651 |
| 751 | Ga0495596_0000011 | 3300046500 | Bacteria | 129089 |
| 752 | Ga0495607_0003197 | 3300046501 | Bacteria | 12655 |
| 753 | Ga0495583_0006197 | 3300046506 | Bacteria | 7872 |
| 754 | Ga0495583_0010518 | 3300046506 | Bacteria | 5391 |
| 755 | Ga0495606_0001564 | 3300046507 | Bacteria | 30026 |
| 756 | Ga0495606_0014696 | 3300046507 | Bacteria | 6087 |
| 757 | Ga0495608_0000066 | 3300046511 | Bacteria | 81664 |
| 758 | Ga0495608_0060271 | 3300046511 | Bacteria | 2497 |
| 759 | Ga0495610_0000162 | 3300046512 | Bacteria | 74163 |
| 760 | Ga0495610_0161456 | 3300046512 | Bacteria | 947 |
| 761 | Ga0495616_0000024 | 3300046513 | Bacteria | 145530 |
| 762 | Ga0495616_0007343 | 3300046513 | Bacteria | 6593 |
| 763 | Ga0495616_0066090 | 3300046513 | Bacteria | 1760 |
| 764 | Ga0495618_0000021 | 3300046514 | Bacteria | 129750 |
| 765 | Ga0495620_0000002 | 3300046515 | Bacteria | 373737 |
| 766 | Ga0495620_0001167 | 3300046515 | Bacteria | 16094 |
| 767 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 768 | Ga0495630_0017055 | 3300046517 | Bacteria | 5315 |
| 769 | Ga0495631_0051146 | 3300046518 | Bacteria | 1806 |
| 770 | Ga0495632_0000955 | 3300046519 | Bacteria | 25262 |
| 771 | Ga0495637_0004602 | 3300046520 | Bacteria | 7127 |
| 772 | Ga0495643_0000782 | 3300046522 | Bacteria | 35381 |
| 773 | Ga0495643_0003464 | 3300046522 | Bacteria | 11525 |
| 774 | Ga0495643_0216728 | 3300046522 | Bacteria | 910 |
| 775 | Ga0495648_0000645 | 3300046524 | Bacteria | 37175 |
| 776 | Ga0495648_0001948 | 3300046524 | Bacteria | 19665 |
| 777 | Ga0495648_0003713 | 3300046524 | Bacteria | 13340 |
| 778 | Ga0495648_0009121 | 3300046524 | Bacteria | 7736 |
| 779 | Ga0495648_0183871 | 3300046524 | Bacteria | 1060 |
| 780 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 781 | Ga0495654_0000491 | 3300046530 | Bacteria | 32540 |
| 782 | Ga0495654_0011699 | 3300046530 | Bacteria | 4741 |
| 783 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 784 | Ga0495586_0249196 | 3300046535 | Bacteria | 1013 |
| 785 | Ga0495587_0000012 | 3300046536 | Bacteria | 197088 |
| 786 | Ga0495609_0001374 | 3300046538 | Bacteria | 16350 |
| 787 | Ga0495609_0004334 | 3300046538 | Bacteria | 7795 |
| 788 | Ga0495609_0058819 | 3300046538 | Bacteria | 1700 |
| 789 | Ga0495621_0023957 | 3300046539 | Bacteria | 2034 |
| 790 | Ga0495597_0019454 | 3300046542 | Bacteria | 3178 |
| 791 | Ga0495645_0000041 | 3300046543 | Bacteria | 92278 |
| 792 | Ga0495645_0052455 | 3300046543 | Bacteria | 2967 |
| 793 | Ga0495645_0092025 | 3300046543 | Bacteria | 2166 |
| 794 | Ga0495633_0209406 | 3300046558 | Bacteria | 894 |
| 795 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 796 | Ga0495656_0126005 | 3300046615 | Bacteria | 1214 |
| 797 | Ga0495668_0010122 | 3300046616 | Bacteria | 5735 |
| 798 | Ga0495668_0031780 | 3300046616 | Bacteria | 2974 |
| 799 | Ga0495668_0128632 | 3300046616 | Bacteria | 1386 |
| 800 | Ga0495634_0000313 | 3300046642 | Bacteria | 46617 |
| 801 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 802 | Ga0495625_0000037 | 3300046660 | Bacteria | 219383 |
| 803 | Ga0495625_0020728 | 3300046660 | Bacteria | 5068 |
| 804 | Ga0495625_0171373 | 3300046660 | Bacteria | 1449 |
| 805 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 806 | Ga0495661_0004835 | 3300046665 | Bacteria | 9654 |
| 807 | Ga0495588_0208404 | 3300046674 | Bacteria | 1032 |
| 808 | Ga0495657_0000047 | 3300046675 | Bacteria | 104362 |
| 809 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 810 | Ga0495623_0000023 | 3300046679 | Bacteria | 96650 |
| 811 | Ga0495646_0000024 | 3300046680 | Bacteria | 107836 |
| 812 | Ga0495658_0110150 | 3300046683 | Bacteria | 1655 |
| 813 | Ga0495658_0293126 | 3300046683 | Bacteria | 1028 |
| 814 | Ga0495669_0019329 | 3300046684 | Bacteria | 2940 |
| 815 | Ga0495669_0029553 | 3300046684 | Bacteria | 2404 |
| 816 | Ga0495613_0328771 | 3300046689 | Bacteria | 1054 |
| 817 | Ga0495670_0003337 | 3300046691 | Bacteria | 7903 |
| 818 | Ga0495670_0188104 | 3300046691 | Bacteria | 1091 |
| 819 | Ga0495671_0000925 | 3300046692 | Bacteria | 20789 |
| 820 | Ga0495671_0008172 | 3300046692 | Bacteria | 5904 |
| 821 | Ga0495649_0007649 | 3300046694 | Bacteria | 6563 |
| 822 | Ga0495589_0000366 | 3300046794 | Bacteria | 35102 |
| 823 | Ga0495600_0000013 | 3300046809 | Bacteria | 119404 |
| 824 | Ga0495600_0070662 | 3300046809 | Bacteria | 2281 |
| 825 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 826 | Ga0495604_0047820 | 3300047317 | Bacteria | 3330 |
| 827 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 828 | Ga0495674_0205187 | 3300047319 | Bacteria | 1634 |
| 829 | Ga0495674_0312800 | 3300047319 | Bacteria | 1281 |
| 830 | Ga0495672_0013927 | 3300047320 | Bacteria | 5528 |
| 831 | Ga0495680_0001662 | 3300047322 | Bacteria | 23652 |
| 832 | Ga0495683_0000194 | 3300047323 | Bacteria | 57773 |
| 833 | Ga0495675_0000014 | 3300047444 | Bacteria | 137646 |
| 834 | Ga0495675_0002266 | 3300047444 | Bacteria | 11482 |
| 835 | Ga0495677_0155694 | 3300047445 | Bacteria | 881 |
| 836 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 837 | Ga0495673_0000607 | 3300047469 | Bacteria | 35637 |
| 838 | Ga0495673_0036135 | 3300047469 | Bacteria | 2269 |
| 839 | Ga0495684_0000027 | 3300047471 | Bacteria | 124367 |
| 840 | Ga0495684_0410479 | 3300047471 | Bacteria | 949 |
| 841 | Ga0495593_0000830 | 3300047673 | Bacteria | 17953 |
| 842 | Ga0495602_0000004 | 3300048088 | Bacteria | 326932 |
| 843 | Ga0496100_0013011 | 3300048903 | Bacteria | 4788 |
| 844 | Ga0496100_0097304 | 3300048903 | Bacteria | 2021 |
| 845 | Ga0496101_0485972 | 3300048904 | Bacteria | 975 |
| 846 | Ga0496102_0011442 | 3300048905 | Bacteria | 7650 |
| 847 | Ga0496102_0035649 | 3300048905 | Bacteria | 4478 |
| 848 | Ga0496102_0273990 | 3300048905 | Bacteria | 1591 |
| 849 | Ga0496103_0001011 | 3300048906 | Bacteria | 19667 |
| 850 | Ga0496103_0082528 | 3300048906 | Bacteria | 2023 |
| 851 | Ga0496104_0003666 | 3300048907 | Bacteria | 13261 |
| 852 | Ga0496105_0207615 | 3300048908 | Bacteria | 1597 |
| 853 | Ga0496105_0282806 | 3300048908 | Bacteria | 1337 |
| 854 | Ga0496106_0088788 | 3300048909 | Bacteria | 2383 |
| 855 | Ga0496106_0492133 | 3300048909 | Bacteria | 985 |
| 856 | Ga0496110_0488163 | 3300048913 | Bacteria | 1122 |
| 857 | Ga0496115_0327296 | 3300048918 | Bacteria | 1252 |
| 858 | Ga0496116_0002738 | 3300048919 | Bacteria | 18106 |
| 859 | Ga0496116_0003529 | 3300048919 | Bacteria | 15396 |
| 860 | Ga0496116_0009769 | 3300048919 | Bacteria | 8139 |
| 861 | Ga0496116_0049115 | 3300048919 | Bacteria | 2825 |
| 862 | Ga0496117_0002061 | 3300048920 | Bacteria | 26591 |
| 863 | Ga0496117_0002856 | 3300048920 | Bacteria | 21010 |
| 864 | Ga0496117_0004128 | 3300048920 | Bacteria | 16255 |
| 865 | Ga0496117_0007412 | 3300048920 | Bacteria | 10729 |
| 866 | Ga0496117_0083164 | 3300048920 | Bacteria | 2094 |
| 867 | Ga0496118_0004752 | 3300048921 | Bacteria | 15892 |
| 868 | Ga0496118_0006005 | 3300048921 | Bacteria | 13541 |
| 869 | Ga0496118_0015795 | 3300048921 | Bacteria | 6964 |
| 870 | Ga0496118_0017662 | 3300048921 | Bacteria | 6478 |
| 871 | Ga0496118_0083503 | 3300048921 | Bacteria | 2233 |
| 872 | Ga0496119_0000049 | 3300048922 | Bacteria | 185482 |
| 873 | Ga0496119_0003046 | 3300048922 | Bacteria | 17734 |
| 874 | Ga0496119_0019062 | 3300048922 | Bacteria | 5073 |
| 875 | Ga0496119_0066281 | 3300048922 | Bacteria | 2134 |
| 876 | Ga0496120_0001178 | 3300048923 | Bacteria | 33301 |
| 877 | Ga0496120_0001489 | 3300048923 | Bacteria | 27770 |
| 878 | Ga0496120_0078867 | 3300048923 | Bacteria | 1789 |
| 879 | Ga0496120_0227841 | 3300048923 | Bacteria | 886 |
| 880 | Ga0496121_0002612 | 3300048924 | Bacteria | 27213 |
| 881 | Ga0496121_0011198 | 3300048924 | Bacteria | 9997 |
| 882 | Ga0496121_0011520 | 3300048924 | Bacteria | 9800 |
| 883 | Ga0496121_0029865 | 3300048924 | Bacteria | 5023 |
| 884 | Ga0496121_0049678 | 3300048924 | Bacteria | 3553 |
| 885 | Ga0496121_0079495 | 3300048924 | Bacteria | 2603 |
| 886 | Ga0496121_0085981 | 3300048924 | Bacteria | 2473 |
| 887 | Ga0496121_0307949 | 3300048924 | Bacteria | 1072 |
| 888 | Ga0496122_0004704 | 3300048925 | Bacteria | 16763 |
| 889 | Ga0496122_0007770 | 3300048925 | Bacteria | 11795 |
| 890 | Ga0496122_0011176 | 3300048925 | Bacteria | 9143 |
| 891 | Ga0496122_0048982 | 3300048925 | Bacteria | 3243 |
| 892 | Ga0496122_0084041 | 3300048925 | Bacteria | 2204 |
| 893 | Ga0496123_0007892 | 3300048926 | Bacteria | 9891 |
| 894 | Ga0496123_0063982 | 3300048926 | Bacteria | 2346 |
| 895 | Ga0496123_0072684 | 3300048926 | Bacteria | 2138 |
| 896 | Ga0496124_0002268 | 3300048927 | Bacteria | 25494 |
| 897 | Ga0496124_0003913 | 3300048927 | Bacteria | 17798 |
| 898 | Ga0496124_0006624 | 3300048927 | Bacteria | 12571 |
| 899 | Ga0496124_0028679 | 3300048927 | Bacteria | 4976 |
| 900 | Ga0496124_0079040 | 3300048927 | Bacteria | 2709 |
| 901 | Ga0496124_0200297 | 3300048927 | Bacteria | 1519 |
| 902 | Ga0496125_0003624 | 3300048928 | Bacteria | 18533 |
| 903 | Ga0496125_0006720 | 3300048928 | Bacteria | 12368 |
| 904 | Ga0496125_0006748 | 3300048928 | Bacteria | 12334 |
| 905 | Ga0496125_0009915 | 3300048928 | Bacteria | 9686 |
| 906 | Ga0496125_0012895 | 3300048928 | Bacteria | 8255 |
| 907 | Ga0496125_0015028 | 3300048928 | Bacteria | 7518 |
| 908 | Ga0496125_0021749 | 3300048928 | Bacteria | 5970 |
| 909 | Ga0496125_0036054 | 3300048928 | Bacteria | 4326 |
| 910 | Ga0496125_0048634 | 3300048928 | Bacteria | 3534 |
| 911 | Ga0496126_0005826 | 3300048929 | Bacteria | 13933 |
| 912 | Ga0496126_0018668 | 3300048929 | Bacteria | 6863 |
| 913 | Ga0496126_0085799 | 3300048929 | Bacteria | 2775 |
| 914 | Ga0496126_0189715 | 3300048929 | Bacteria | 1742 |
| 915 | Ga0496126_0223815 | 3300048929 | Bacteria | 1579 |
| 916 | Ga0496126_0271330 | 3300048929 | Bacteria | 1408 |
| 917 | Ga0496126_0505738 | 3300048929 | Bacteria | 965 |
| 918 | Ga0501307_006741 | 3300049162 | Bacteria | 1249 |
| 919 | Ga0495678_000028 | 3300049459 | Bacteria | 220080 |
| 920 | Ga0495682_0000265 | 3300049460 | Bacteria | 41386 |
| 921 | Ga0495682_0061543 | 3300049460 | Bacteria | 1355 |
| 922 | Ga0501300_000569 | 3300049523 | Bacteria | 5528 |
| 923 | Ga0501300_009079 | 3300049523 | Bacteria | 1453 |
| 924 | Ga0501031_0043942 | 3300049568 | Bacteria | 2915 |
| 925 | Ga0501032_0024784 | 3300049569 | Bacteria | 4139 |
| 926 | Ga0501033_0004466 | 3300049570 | Bacteria | 11188 |
| 927 | Ga0501033_0320932 | 3300049570 | Bacteria | 1088 |
| 928 | Ga0501034_0014595 | 3300049571 | Bacteria | 8088 |
| 929 | Ga0501034_0129722 | 3300049571 | Bacteria | 2505 |
| 930 | Ga0501034_0140064 | 3300049571 | Bacteria | 2399 |
| 931 | Ga0501036_0045926 | 3300049572 | Bacteria | 3699 |
| 932 | Ga0501041_0022949 | 3300049577 | Bacteria | 3740 |
| 933 | Ga0501041_0079675 | 3300049577 | Bacteria | 2016 |
| 934 | Ga0501042_0013949 | 3300049578 | Bacteria | 5475 |
| 935 | Ga0501042_0167048 | 3300049578 | Bacteria | 1587 |
| 936 | Ga0501043_0054085 | 3300049579 | Bacteria | 3153 |
| 937 | Ga0501046_0165870 | 3300049580 | Bacteria | 1660 |
| 938 | Ga0501047_0329837 | 3300049581 | Bacteria | 1365 |
| 939 | Ga0501048_0086169 | 3300049582 | Bacteria | 2216 |
| 940 | Ga0501070_0059333 | 3300049586 | Bacteria | 3172 |
| 941 | Ga0501071_0263139 | 3300049587 | Bacteria | 1303 |
| 942 | Ga0501072_0019483 | 3300049588 | Bacteria | 5246 |
| 943 | Ga0501073_0022929 | 3300049589 | Bacteria | 4490 |
| 944 | Ga0501076_0033043 | 3300049592 | Bacteria | 4039 |
| 945 | Ga0501077_0131186 | 3300049593 | Bacteria | 1589 |
| 946 | Ga0501259_000005 | 3300049688 | Bacteria | 33928 |
| 947 | Ga0501081_0010148 | 3300049743 | Bacteria | 6146 |
| 948 | Ga0501081_0018659 | 3300049743 | Bacteria | 4610 |
| 949 | Ga0501241_023293 | 3300049758 | Bacteria | 1146 |
| 950 | Ga0501266_000721 | 3300049763 | Bacteria | 4293 |
| 951 | Ga0501035_0033080 | 3300049822 | Bacteria | 4702 |
| 952 | Ga0501035_0199989 | 3300049822 | Bacteria | 1714 |
| 953 | Ga0501044_0047218 | 3300049823 | Bacteria | 4455 |
| 954 | nmdc:mga03683_17782_c1 | 3300050489 | Bacteria | 2696 |
| 955 | nmdc:mga03683_49148_c1 | 3300050489 | Bacteria | 1755 |
| 956 | nmdc:mga03683_58651_c1 | 3300050489 | Bacteria | 1099 |
| 957 | nmdc:mga03n38_10895_c1 | 3300050490 | Bacteria | 3367 |
| 958 | nmdc:mga03n38_130933_c1 | 3300050490 | Bacteria | 1243 |
| 959 | nmdc:mga03n38_176098_c1 | 3300050490 | Bacteria | 1093 |
| 960 | nmdc:mga03n38_20430_c1 | 3300050490 | Bacteria | 2649 |
| 961 | nmdc:mga03n38_2106_c1 | 3300050490 | Bacteria | 6036 |
| 962 | nmdc:mga00v17_16532_c1 | 3300050491 | Bacteria | 4157 |
| 963 | nmdc:mga00v17_21160_c1 | 3300050491 | Bacteria | 3737 |
| 964 | nmdc:mga00v17_550_c1 | 3300050491 | Bacteria | 20960 |
| 965 | nmdc:mga00v17_76047_c1 | 3300050491 | Bacteria | 2088 |
| 966 | nmdc:mga00v17_858_c1 | 3300050491 | Bacteria | 16444 |
| 967 | nmdc:mga0yw44_115007_c1 | 3300050492 | Bacteria | 1425 |
| 968 | nmdc:mga0yw44_164_c1 | 3300050492 | Bacteria | 23001 |
| 969 | nmdc:mga0yw44_323_c1 | 3300050492 | Bacteria | 16681 |
| 970 | nmdc:mga0yw44_5027_c1 | 3300050492 | Bacteria | 6177 |
| 971 | nmdc:mga0yw44_6841_c1 | 3300050492 | Bacteria | 5547 |
| 972 | nmdc:mga0yw44_85225_c1 | 3300050492 | Bacteria | 1988 |
| 973 | nmdc:mga0k408_124283_c1 | 3300050493 | Bacteria | 1530 |
| 974 | nmdc:mga0k408_15132_c1 | 3300050493 | Bacteria | 4264 |
| 975 | nmdc:mga0k408_30968_c1 | 3300050493 | Bacteria | 3052 |
| 976 | nmdc:mga0k408_54101_c1 | 3300050493 | Bacteria | 2327 |
| 977 | nmdc:mga06z11_16137_c1 | 3300050494 | Bacteria | 3355 |
| 978 | nmdc:mga06z11_26827_c1 | 3300050494 | Bacteria | 2747 |
| 979 | nmdc:mga06z11_30013_c1 | 3300050494 | Bacteria | 2626 |
| 980 | nmdc:mga06z11_7315_c1 | 3300050494 | Bacteria | 4535 |
| 981 | nmdc:mga07m45_108967_c1 | 3300050496 | Bacteria | 1594 |
| 982 | nmdc:mga07m45_16144_c1 | 3300050496 | Bacteria | 3996 |
| 983 | nmdc:mga07m45_217778_c1 | 3300050496 | Bacteria | 1111 |
| 984 | nmdc:mga07m45_6347_c1 | 3300050496 | Bacteria | 5968 |
| 985 | nmdc:mga05p37_802106_c1 | 3300050507 | Bacteria | 1030 |
| 986 | nmdc:mga05p37_9734_c1 | 3300050507 | Bacteria | 11396 |
| 987 | nmdc:mga09592_54930_c1 | 3300050508 | Bacteria | 3365 |
| 988 | nmdc:mga09592_7400_c1 | 3300050508 | Bacteria | 8924 |
| 989 | nmdc:mga0qj67_26674_c1 | 3300050509 | Bacteria | 4473 |
| 990 | nmdc:mga0qj67_27823_c1 | 3300050509 | Bacteria | 4384 |
| 991 | nmdc:mga0qj67_609106_c1 | 3300050509 | Bacteria | 873 |
| 992 | nmdc:mga06r32_2236_c1 | 3300050510 | Bacteria | 17323 |
| 993 | nmdc:mga08y16_197348_c1 | 3300050511 | Bacteria | 2086 |
| 994 | nmdc:mga0n895_9979_c1 | 3300050512 | Bacteria | 8355 |
| 995 | nmdc:mga0rr50_6938_c1 | 3300050513 | Bacteria | 3119 |
| 996 | nmdc:mga08x19_364727_c1 | 3300050514 | Bacteria | 1010 |
| 997 | nmdc:mga08x19_4_c1 | 3300050514 | Bacteria | 335979 |
| 998 | nmdc:mga0sz30_344_c1 | 3300050516 | Bacteria | 17753 |
| 999 | nmdc:mga0sz30_47_c2 | 3300050516 | Bacteria | 30262 |
| 1000 | nmdc:mga0sz30_59488_c1 | 3300050516 | Bacteria | 1141 |
| 1001 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 1002 | Ga0495601_0285975 | 3300053077 | Bacteria | 1075 |
| 1003 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 1004 | Ga0500610_0000109 | 3300053079 | Bacteria | 24958 |
| 1005 | Ga0495595_0000006 | 3300053084 | Bacteria | 231295 |
| 1006 | Ga0495619_0000011 | 3300053085 | Bacteria | 287128 |
| 1007 | Ga0500643_000053 | 3300053087 | Bacteria | 142202 |
| 1008 | Ga0500643_000439 | 3300053087 | Bacteria | 31314 |
| 1009 | Ga0500643_000774 | 3300053087 | Bacteria | 20768 |
| 1010 | Ga0500643_015298 | 3300053087 | Bacteria | 2635 |
| 1011 | Ga0500643_021960 | 3300053087 | Bacteria | 2063 |
| 1012 | Ga0500646_0000182 | 3300053090 | Bacteria | 18791 |
| 1013 | Ga0500583_0000160 | 3300053092 | Bacteria | 27705 |
| 1014 | Ga0500583_0005083 | 3300053092 | Bacteria | 4366 |
| 1015 | Ga0500651_0082441 | 3300053093 | Bacteria | 1991 |
| 1016 | Ga0500641_0012315 | 3300053096 | Bacteria | 3122 |
| 1017 | Ga0500555_002225 | 3300053103 | Bacteria | 5663 |
| 1018 | Ga0500592_010042 | 3300053116 | Bacteria | 1507 |
| 1019 | Ga0500595_006413 | 3300053119 | Bacteria | 4993 |
| 1020 | Ga0500595_027558 | 3300053119 | Bacteria | 1945 |
| 1021 | Ga0500607_000386 | 3300053121 | Bacteria | 42198 |
| 1022 | Ga0500607_000706 | 3300053121 | Bacteria | 32099 |
| 1023 | Ga0500642_0001986 | 3300053130 | Bacteria | 5939 |
| 1024 | Ga0500642_0027983 | 3300053130 | Bacteria | 2320 |
| 1025 | Ga0500642_0123938 | 3300053130 | Bacteria | 1210 |
| 1026 | Ga0500658_0047352 | 3300053134 | Bacteria | 1745 |
| 1027 | Ga0500659_0000749 | 3300053135 | Bacteria | 20870 |
| 1028 | Ga0500559_0000174 | 3300053136 | Bacteria | 50893 |
| 1029 | Ga0500559_0007572 | 3300053136 | Bacteria | 4799 |
| 1030 | Ga0500559_0218521 | 3300053136 | Bacteria | 899 |
| 1031 | Ga0500568_0003968 | 3300053139 | Bacteria | 8044 |
| 1032 | Ga0500573_0173075 | 3300053140 | Bacteria | 1166 |
| 1033 | Ga0500590_110041 | 3300053148 | Bacteria | 1308 |
| 1034 | Ga0500604_0000941 | 3300053151 | Bacteria | 8056 |
| 1035 | Ga0500604_0008879 | 3300053151 | Bacteria | 2670 |
| 1036 | Ga0500616_0001605 | 3300053153 | Bacteria | 21079 |
| 1037 | Ga0500616_0183242 | 3300053153 | Bacteria | 941 |
| 1038 | Ga0500622_0001570 | 3300053156 | Bacteria | 18004 |
| 1039 | Ga0500627_0002950 | 3300053158 | Bacteria | 5161 |
| 1040 | Ga0500627_0003538 | 3300053158 | Bacteria | 4851 |
| 1041 | Ga0500645_000291 | 3300053730 | Bacteria | 35819 |
| 1042 | Ga0501084_0018285 | 3300054114 | Bacteria | 5836 |
| 1043 | Ga0500661_000076 | 3300055283 | Bacteria | 15473 |
| 1044 | Ga0530510_0016714 | 3300061734 | Bacteria | 5195 |
| 1045 | 2548501250 | 2547132374 | Bacteria | 5530232 |
| 1046 | 2585282675 | 2582581308 | Bacteria | 7413247 |
| 1047 | 2585327848 | 2582581315 | Bacteria | 7318924 |
| 1048 | 2585555542 | 2585427530 | Bacteria | 7383882 |
| 1049 | 2599965322 | 2599185306 | Bacteria | 6637356 |
| 1050 | 2599978539 | 2599185308 | Bacteria | 6621546 |
| 1051 | 2600010554 | 2599185314 | Bacteria | 6621749 |
| 1052 | 2616310214 | 2615840626 | Bacteria | 7921970 |
| 1053 | 2617914983 | 2617270889 | Bacteria | 9064343 |
| 1054 | 2644649206 | 2643221717 | Bacteria | 5676132 |
| 1055 | 2685151340 | 2684622632 | Bacteria | 5380049 |
| 1056 | 2698321921 | 2695420987 | Bacteria | 6152737 |
| 1057 | 2721506506 | 2718218445 | Bacteria | 5113413 |
| 1058 | 2729148841 | 2728369097 | Bacteria | 4333476 |
| 1059 | 2739212055 | 2738543006 | Bacteria | 5904091 |
| 1060 | 2807409491 | 2806310737 | Bacteria | 5751088 |
| 1061 | 2807457792 | 2806310745 | Bacteria | 5742165 |
| 1062 | 2808856069 | 2808606361 | Bacteria | 6136259 |
| 1063 | 2808923536 | 2808606376 | Bacteria | 6248667 |
| 1064 | 2808936180 | 2808606378 | Bacteria | 6177535 |
| 1065 | 2808945701 | 2808606380 | Bacteria | 6248705 |
| 1066 | 2808964574 | 2808606383 | Bacteria | 6138645 |
| 1067 | 2808999462 | 2808606389 | Bacteria | 6138126 |
| 1068 | 2823423205 | 2823421272 | Bacteria | 5372474 |
| 1069 | 2831428821 | 2831426010 | Bacteria | 8662725 |
| 1070 | 2848702254 | 2848694841 | Bacteria | 9205737 |
| 1071 | 2849668013 | 2849660919 | Bacteria | 8251853 |
| 1072 | 2885215250 | 2885211737 | Bacteria | 7212420 |
| 1073 | 2886633781 | 2886627955 | Bacteria | 7618130 |
| 1074 | 2904762777 | 2904755435 | Bacteria | 7986759 |
| 1075 | 2913846980 | 2913844669 | Bacteria | 8381711 |
| 1076 | 2913916642 | 2913912277 | Bacteria | 9037797 |
| 1077 | 2913944457 | 2913939268 | Bacteria | 8559644 |
| 1078 | 2929145879 | 2929144301 | Bacteria | 6622272 |
| 1079 | 2929237011 | 2929233124 | Bacteria | 5948380 |
| 1080 | 2939618292 | 2939617950 | Bacteria | 4820956 |
| 1081 | 2947430048 | 2947426588 | Bacteria | 5357194 |
| 1082 | 2978971165 | 2978969890 | Bacteria | 5400756 |
| 1083 | 2979086957 | 2979083700 | Bacteria | 5894929 |
| 1084 | 3007400754 | 3007395558 | Bacteria | 6755444 |
| 1085 | 642600354 | 642555144 | Bacteria | 9059191 |
| 1086 | 8023440115 | 8023438354 | Bacteria | 5779374 |
| 1087 | 8023447006 | 8023444577 | Bacteria | 5661597 |
| 1088 | 8055636865 | 8055632911 | Bacteria | 5283357 |
| 1089 | Ga0207671_10347990 | |||
| 1090 | SwRhRL2b_contig_2410546 | |||
| 1091 | SwRhRL2b_contig_3658071 | |||
| 1092 | JGI24736J21556_1008511 | |||
| 1093 | JGI24740J21852_10001139 | |||
| 1094 | JGI24739J22299_10001771 | |||
| 1095 | JGI24739J22299_10010873 | |||
| 1096 | JGI24737J22298_10027737 | |||
| 1097 | JGI24735J21928_10003349 | |||
| 1098 | JGI24735J21928_10005690 | |||
| 1099 | JGI24748J21848_1000023 | |||
| 1100 | JGI24738J21930_10003984 | |||
| 1101 | JGI24034J26672_10000010 | |||
| 1102 | JGI24751J29686_10015855 | |||
| 1103 | JGI25151J46595_10002312 | |||
| 1104 | JGI25165J46597_1001250 | |||
| 1105 | JGI25153J46596_10013055 | |||
| 1106 | rootH1_10069913 | |||
| 1107 | rootH2_10221868 | |||
| 1108 | rootH2_10295353 | |||
| 1109 | rootH1_10013795 | |||
| 1110 | Ga0006562J51391_1051510 | |||
| 1111 | Ga0055532_1000054 | |||
| 1112 | Ga0055525_1000021 | |||
| 1113 | Ga0055525_1000663 | |||
| 1114 | Ga0055535_1000037 | |||
| 1115 | Ga0055535_1000475 | |||
| 1116 | Ga0055542_1000157 | |||
| 1117 | Ga0055529_1000070 | |||
| 1118 | Ga0055526_1000329 | |||
| 1119 | Ga0055526_1004142 | |||
| 1120 | Ga0055526_1011388 | |||
| 1121 | Ga0055526_1025080 | |||
| 1122 | Ga0055536_1000149 | |||
| 1123 | Ga0055536_1004606 | |||
| 1124 | Ga0055534_1000883 | |||
| 1125 | Ga0055530_10002573 | |||
| 1126 | Ga0055540_1000622 | |||
| 1127 | Ga0055540_1017869 | |||
| 1128 | Ga0055531_10001158 | |||
| 1129 | Ga0055531_10006162 | |||
| 1130 | Ga0055541_1003285 | |||
| 1131 | Ga0065165_1000030 | |||
| 1132 | Ga0065714_10021842 | |||
| 1133 | Ga0065714_10098217 | |||
| 1134 | Ga0065704_10000597 | |||
| 1135 | Ga0065704_10173848 | |||
| 1136 | Ga0065704_10178514 | |||
| 1137 | Ga0065715_10001856 | |||
| 1138 | Ga0065707_10087919 | |||
| 1139 | Ga0070658_10001409 | |||
| 1140 | Ga0070658_10004364 | |||
| 1141 | Ga0070676_10111913 | |||
| 1142 | Ga0070676_10131404 | |||
| 1143 | Ga0070676_10207484 | |||
| 1144 | Ga0070683_100319670 | |||
| 1145 | Ga0070683_100439147 | |||
| 1146 | Ga0070683_100478424 | |||
| 1147 | Ga0070690_100000055 | |||
| 1148 | Ga0070670_100068558 | |||
| 1149 | Ga0068869_100065438 | |||
| 1150 | Ga0068869_100093641 | |||
| 1151 | Ga0070666_10000009 | |||
| 1152 | Ga0070680_100294027 | |||
| 1153 | Ga0068868_100008614 | |||
| 1154 | Ga0070660_100201357 | |||
| 1155 | Ga0070689_100094929 | |||
| 1156 | Ga0070689_100261327 | |||
| 1157 | Ga0070689_100438803 | |||
| 1158 | Ga0070661_100000068 | |||
| 1159 | Ga0070692_10066907 | |||
| 1160 | Ga0070668_100000109 | |||
| 1161 | Ga0070668_100020350 | |||
| 1162 | Ga0070668_100025441 | |||
| 1163 | Ga0070669_100006318 | |||
| 1164 | Ga0070669_100129610 | |||
| 1165 | Ga0070675_100003633 | |||
| 1166 | Ga0070675_100060402 | |||
| 1167 | Ga0070671_100099442 | |||
| 1168 | Ga0070671_100114564 | |||
| 1169 | Ga0070674_100002357 | |||
| 1170 | Ga0070673_100229224 | |||
| 1171 | Ga0070673_100557303 | |||
| 1172 | Ga0070659_100000135 | |||
| 1173 | Ga0070659_100000867 | |||
| 1174 | Ga0070659_100002242 | |||
| 1175 | Ga0070659_100135341 | |||
| 1176 | Ga0070667_100000385 | |||
| 1177 | Ga0070667_100003070 | |||
| 1178 | Ga0070667_100015911 | |||
| 1179 | Ga0070667_100263786 | |||
| 1180 | Ga0070714_100121818 | |||
| 1181 | Ga0070714_100305947 | |||
| 1182 | Ga0070700_100055104 | |||
| 1183 | Ga0070700_100207240 | |||
| 1184 | Ga0070663_100000008 | |||
| 1185 | Ga0070663_100137142 | |||
| 1186 | Ga0070663_100250688 | |||
| 1187 | Ga0070678_100027075 | |||
| 1188 | Ga0070678_100559426 | |||
| 1189 | Ga0070662_100006646 | |||
| 1190 | Ga0070662_100022445 | |||
| 1191 | Ga0070662_100157186 | |||
| 1192 | Ga0070662_100533245 | |||
| 1193 | Ga0070681_10079866 | |||
| 1194 | Ga0070681_10266915 | |||
| 1195 | Ga0070681_10405649 | |||
| 1196 | Ga0068867_100043843 | |||
| 1197 | Ga0068867_100283078 | |||
| 1198 | Ga0070685_10152786 | |||
| 1199 | Ga0070707_100465665 | |||
| 1200 | Ga0070698_100000489 | |||
| 1201 | Ga0070698_100080822 | |||
| 1202 | Ga0070698_100135130 | |||
| 1203 | Ga0070698_100700802 | |||
| 1204 | Ga0070699_100070764 | |||
| 1205 | Ga0070699_100110679 | |||
| 1206 | Ga0070699_100381774 | |||
| 1207 | Ga0070679_100004697 | |||
| 1208 | Ga0070679_100097498 | |||
| 1209 | Ga0070679_100183999 | |||
| 1210 | Ga0070697_100016631 | |||
| 1211 | Ga0070697_100824900 | |||
| 1212 | Ga0068853_100020311 | |||
| 1213 | Ga0068853_100052107 | |||
| 1214 | Ga0068853_100104158 | |||
| 1215 | Ga0068853_100175136 | |||
| 1216 | Ga0070672_100000409 | |||
| 1217 | Ga0070672_100312494 | |||
| 1218 | Ga0070686_100000041 | |||
| 1219 | Ga0070686_100099002 | |||
| 1220 | Ga0070695_100017307 | |||
| 1221 | Ga0070696_100406706 | |||
| 1222 | Ga0070665_100018737 | |||
| 1223 | Ga0070665_100032348 | |||
| 1224 | Ga0070665_100087832 | |||
| 1225 | Ga0070665_100683176 | |||
| 1226 | Ga0070704_100242736 | |||
| 1227 | Ga0068855_100006481 | |||
| 1228 | Ga0068855_100016802 | |||
| 1229 | Ga0068855_100024389 | |||
| 1230 | Ga0068855_100380428 | |||
| 1231 | Ga0070664_100000009 | |||
| 1232 | Ga0070664_100193602 | |||
| 1233 | Ga0070664_100681236 | |||
| 1234 | Ga0068857_100007095 | |||
| 1235 | Ga0068857_100179674 | |||
| 1236 | Ga0068854_100000023 | |||
| 1237 | Ga0068854_100000024 | |||
| 1238 | Ga0068854_100028898 | |||
| 1239 | Ga0068854_100057533 | |||
| 1240 | Ga0068854_100075122 | |||
| 1241 | Ga0068854_100229675 | |||
| 1242 | Ga0068856_100000019 | |||
| 1243 | Ga0068856_100002944 | |||
| 1244 | Ga0068856_100109698 | |||
| 1245 | Ga0068852_100012678 | |||
| 1246 | Ga0068852_100048495 | |||
| 1247 | Ga0068852_100340373 | |||
| 1248 | Ga0068859_100002443 | |||
| 1249 | Ga0068859_100002746 | |||
| 1250 | Ga0068859_100016879 | |||
| 1251 | Ga0068859_100163494 | |||
| 1252 | Ga0068864_100000661 | |||
| 1253 | Ga0068864_100241190 | |||
| 1254 | Ga0068864_100388585 | |||
| 1255 | Ga0068864_100562955 | |||
| 1256 | Ga0068866_10004073 | |||
| 1257 | Ga0068861_100000441 | |||
| 1258 | Ga0068861_100002019 | |||
| 1259 | Ga0068861_100019804 | |||
| 1260 | Ga0068851_10078371 | |||
| 1261 | Ga0068863_100000317 | |||
| 1262 | Ga0068863_100000705 | |||
| 1263 | Ga0068863_100003514 | |||
| 1264 | Ga0068863_100008845 | |||
| 1265 | Ga0068863_100076557 | |||
| 1266 | Ga0068860_100000022 | |||
| 1267 | Ga0068860_100003256 | |||
| 1268 | Ga0068860_100065199 | |||
| 1269 | Ga0068860_100119863 | |||
| 1270 | Ga0068860_100197992 | |||
| 1271 | Ga0068860_100657848 | |||
| 1272 | Ga0068862_100000596 | |||
| 1273 | Ga0068862_100020520 | |||
| 1274 | Ga0081455_10049469 | |||
| 1275 | Ga0075365_10000349 | |||
| 1276 | Ga0075365_10000706 | |||
| 1277 | Ga0075365_10004015 | |||
| 1278 | Ga0075365_10027179 | |||
| 1279 | Ga0075365_10368842 | |||
| 1280 | Ga0075368_10011102 | |||
| 1281 | Ga0075368_10091685 | |||
| 1282 | Ga0075363_100011278 | |||
| 1283 | Ga0075363_100015353 | |||
| 1284 | Ga0075363_100018241 | |||
| 1285 | Ga0075364_10001743 | |||
| 1286 | Ga0075364_10002839 | |||
| 1287 | Ga0075364_10048942 | |||
| 1288 | Ga0075364_10054472 | |||
| 1289 | Ga0070716_100129679 | |||
| 1290 | Ga0075362_10009498 | |||
| 1291 | Ga0075362_10036243 | |||
| 1292 | Ga0075362_10154567 | |||
| 1293 | Ga0075367_10003220 | |||
| 1294 | Ga0075367_10012827 | |||
| 1295 | Ga0075367_10020340 | |||
| 1296 | Ga0075367_10031060 | |||
| 1297 | Ga0075367_10051082 | |||
| 1298 | Ga0075367_10129808 | |||
| 1299 | Ga0075369_10002209 | |||
| 1300 | Ga0075369_10002288 | |||
| 1301 | Ga0075369_10080599 | |||
| 1302 | Ga0075366_10003243 | |||
| 1303 | Ga0075366_10029525 | |||
| 1304 | Ga0075366_10030236 | |||
| 1305 | Ga0097621_100021383 | |||
| 1306 | Ga0097621_100076541 | |||
| 1307 | Ga0075370_10004495 | |||
| 1308 | Ga0075370_10012301 | |||
| 1309 | Ga0075370_10078839 | |||
| 1310 | Ga0075370_10127782 | |||
| 1311 | Ga0068871_100001760 | |||
| 1312 | Ga0075428_100001894 | |||
| 1313 | Ga0075428_100037054 | |||
| 1314 | Ga0075430_100003424 | |||
| 1315 | Ga0075430_100013674 | |||
| 1316 | Ga0075431_100000364 | |||
| 1317 | Ga0075431_100021229 | |||
| 1318 | Ga0075434_100020199 | |||
| 1319 | Ga0075434_100133179 | |||
| 1320 | Ga0075429_100005261 | |||
| 1321 | Ga0075429_100008541 | |||
| 1322 | Ga0075436_100000321 | |||
| 1323 | Ga0075436_100119610 | |||
| 1324 | Ga0097620_100002442 | |||
| 1325 | Ga0097620_100002746 | |||
| 1326 | Ga0097620_100016879 | |||
| 1327 | Ga0097620_100163495 | |||
| 1328 | Ga0079104_1000163 | |||
| 1329 | Ga0099826_10000013 | |||
| 1330 | Ga0099826_10000048 | |||
| 1331 | Ga0099826_10048612 | |||
| 1332 | Ga0075435_100008156 | |||
| 1333 | Ga0075435_100059536 | |||
| 1334 | Ga0105251_10059587 | |||
| 1335 | Ga0105244_10000698 | |||
| 1336 | Ga0105244_10073094 | |||
| 1337 | Ga0105250_10014263 | |||
| 1338 | Ga0105250_10054927 | |||
| 1339 | Ga0105240_10001579 | |||
| 1340 | Ga0105240_10006137 | |||
| 1341 | Ga0105240_10017956 | |||
| 1342 | Ga0105240_10057143 | |||
| 1343 | Ga0105240_10100584 | |||
| 1344 | Ga0105240_10563674 | |||
| 1345 | Ga0111539_10027771 | |||
| 1346 | Ga0111539_10080845 | |||
| 1347 | Ga0111539_10303704 | |||
| 1348 | Ga0111539_11364438 | |||
| 1349 | Ga0105245_10204915 | |||
| 1350 | Ga0105247_10048675 | |||
| 1351 | Ga0114129_10015902 | |||
| 1352 | Ga0114129_10193241 | |||
| 1353 | Ga0114129_10362065 | |||
| 1354 | Ga0114129_10542149 | |||
| 1355 | Ga0105243_10033187 | |||
| 1356 | Ga0105243_10110900 | |||
| 1357 | Ga0105241_10002815 | |||
| 1358 | Ga0105241_10110745 | |||
| 1359 | Ga0105241_10118112 | |||
| 1360 | Ga0105241_10701495 | |||
| 1361 | Ga0105242_10008344 | |||
| 1362 | Ga0105248_10001248 | |||
| 1363 | Ga0105248_10001677 | |||
| 1364 | Ga0105248_10002804 | |||
| 1365 | Ga0105248_10010586 | |||
| 1366 | Ga0105248_10028059 | |||
| 1367 | Ga0105248_10300172 | |||
| 1368 | Ga0105248_10624854 | |||
| 1369 | Ga0105237_10003070 | |||
| 1370 | Ga0105237_10065625 | |||
| 1371 | Ga0105237_10086871 | |||
| 1372 | Ga0105237_10130696 | |||
| 1373 | Ga0105237_10367331 | |||
| 1374 | Ga0105238_10070117 | |||
| 1375 | Ga0105249_10000014 | |||
| 1376 | Ga0105249_10002930 | |||
| 1377 | Ga0105249_10003753 | |||
| 1378 | Ga0105249_10269945 | |||
| 1379 | Ga0105239_10001206 | |||
| 1380 | Ga0105239_10009151 | |||
| 1381 | Ga0105239_10020093 | |||
| 1382 | Ga0105239_10022264 | |||
| 1383 | Ga0105239_10261695 | |||
| 1384 | Ga0105239_10325619 | |||
| 1385 | Ga0105239_10342452 | |||
| 1386 | Ga0105246_10577033 | |||
| 1387 | Ga0157326_1001295 | |||
| 1388 | Ga0157373_10006717 | |||
| 1389 | Ga0157373_10011249 | |||
| 1390 | Ga0157373_10061387 | |||
| 1391 | Ga0157373_10099741 | |||
| 1392 | Ga0157371_10000047 | |||
| 1393 | Ga0157371_10002969 | |||
| 1394 | Ga0157371_10004449 | |||
| 1395 | Ga0157371_10008594 | |||
| 1396 | Ga0157370_10000004 | |||
| 1397 | Ga0157370_10002004 | |||
| 1398 | Ga0157370_10013356 | |||
| 1399 | Ga0157370_10014211 | |||
| 1400 | Ga0157370_10014608 | |||
| 1401 | Ga0157370_10047662 | |||
| 1402 | Ga0157370_10056784 | |||
| 1403 | Ga0157369_10006530 | |||
| 1404 | Ga0157369_10020204 | |||
| 1405 | Ga0157374_10519518 | |||
| 1406 | Ga0157374_10619616 | |||
| 1407 | Ga0157378_10035146 | |||
| 1408 | Ga0157378_10111102 | |||
| 1409 | Ga0157378_10670415 | |||
| 1410 | Ga0163162_10016338 | |||
| 1411 | Ga0163162_10105499 | |||
| 1412 | Ga0163162_10127587 | |||
| 1413 | Ga0163162_10457492 | |||
| 1414 | Ga0163162_10477272 | |||
| 1415 | Ga0163162_10741644 | |||
| 1416 | Ga0157372_10000362 | |||
| 1417 | Ga0157372_10002551 | |||
| 1418 | Ga0157372_10031659 | |||
| 1419 | Ga0157372_10177662 | |||
| 1420 | Ga0157375_10000055 | |||
| 1421 | Ga0157375_10000541 | |||
| 1422 | Ga0157375_10022569 | |||
| 1423 | Ga0157375_10204597 | |||
| 1424 | Ga0157375_10401610 | |||
| 1425 | Ga0157375_11074087 | |||
| 1426 | Ga0163163_10129014 | |||
| 1427 | Ga0157380_10000325 | |||
| 1428 | Ga0157380_10007519 | |||
| 1429 | Ga0157380_10347251 | |||
| 1430 | Ga0182008_10002412 | |||
| 1431 | Ga0182008_10013003 | |||
| 1432 | Ga0182008_10047525 | |||
| 1433 | Ga0157379_10020026 | |||
| 1434 | Ga0157379_10200051 | |||
| 1435 | Ga0157379_10228856 | |||
| 1436 | Ga0157376_10002090 | |||
| 1437 | Ga0157376_10039071 | |||
| 1438 | Ga0157376_10059668 | |||
| 1439 | Ga0182006_1002028 | |||
| 1440 | Ga0182006_1043206 | |||
| 1441 | Ga0182006_1059276 | |||
| 1442 | Ga0182007_10001040 | |||
| 1443 | Ga0182007_10010076 | |||
| 1444 | Ga0182007_10010490 | |||
| 1445 | Ga0182007_10010979 | |||
| 1446 | Ga0182005_1031995 | |||
| 1447 | Ga0163161_10000057 | |||
| 1448 | Ga0163161_10030363 | |||
| 1449 | Ga0163161_10101528 | |||
| 1450 | Ga0206356_11628886 | |||
| 1451 | Ga0206351_10745048 | |||
| 1452 | Ga0154015_1245876 | |||
| 1453 | Ga0213872_10000256 | |||
| 1454 | Ga0213872_10020201 | |||
| 1455 | Ga0213876_10098049 | |||
| 1456 | Ga0209784_100029 | |||
| 1457 | Ga0209566_100030 | |||
| 1458 | Ga0209566_101369 | |||
| 1459 | Ga0209566_102510 | |||
| 1460 | Ga0209674_100075 | |||
| 1461 | Ga0209672_100178 | |||
| 1462 | Ga0209672_100721 | |||
| 1463 | Ga0209147_100008 | |||
| 1464 | Ga0209563_100005 | |||
| 1465 | Ga0209563_100117 | |||
| 1466 | Ga0209437_101870 | |||
| 1467 | Ga0209258_100013 | |||
| 1468 | Ga0209258_100158 | |||
| 1469 | Ga0209677_100030 | |||
| 1470 | Ga0209677_100248 | |||
| 1471 | Ga0209148_1000092 | |||
| 1472 | Ga0209148_1002665 | |||
| 1473 | Ga0209759_1002970 | |||
| 1474 | Ga0209233_1000340 | |||
| 1475 | Ga0209565_1001410 | |||
| 1476 | Ga0209565_1018256 | |||
| 1477 | Ga0209455_1000130 | |||
| 1478 | Ga0209455_1005930 | |||
| 1479 | Ga0209675_1000050 | |||
| 1480 | Ga0209675_1018444 | |||
| 1481 | Ga0209676_1000053 | |||
| 1482 | Ga0209676_1001174 | |||
| 1483 | Ga0209676_1006985 | |||
| 1484 | Ga0209025_1000093 | |||
| 1485 | Ga0209025_1004087 | |||
| 1486 | Ga0209564_1000211 | |||
| 1487 | Ga0209564_1002127 | |||
| 1488 | Ga0209564_1002156 | |||
| 1489 | Ga0209758_1000349 | |||
| 1490 | Ga0209758_1036668 | |||
| 1491 | Ga0209050_1001493 | |||
| 1492 | Ga0209256_1000538 | |||
| 1493 | Ga0209051_1000924 | |||
| 1494 | Ga0209051_1006399 | |||
| 1495 | Ga0209257_1000598 | |||
| 1496 | Ga0207697_10103774 | |||
| 1497 | Ga0207655_1000885 | |||
| 1498 | Ga0207655_1030163 | |||
| 1499 | Ga0207713_1046306 | |||
| 1500 | Ga0207642_10008016 | |||
| 1501 | Ga0207680_10000007 | |||
| 1502 | Ga0207647_10016643 | |||
| 1503 | Ga0207645_10004107 | |||
| 1504 | Ga0207643_10061099 | |||
| 1505 | Ga0207705_10011507 | |||
| 1506 | Ga0207654_10003667 | |||
| 1507 | Ga0207654_10085380 | |||
| 1508 | Ga0207654_10208476 | |||
| 1509 | Ga0207707_10007428 | |||
| 1510 | Ga0207707_10046166 | |||
| 1511 | Ga0207707_10300623 | |||
| 1512 | Ga0207707_10314034 | |||
| 1513 | Ga0207695_10005037 | |||
| 1514 | Ga0207695_10009597 | |||
| 1515 | Ga0207695_10021604 | |||
| 1516 | Ga0207695_10082586 | |||
| 1517 | Ga0207671_10001189 | |||
| 1518 | Ga0207671_10157292 | |||
| 1519 | Ga0207671_10264108 | |||
| 1520 | Ga0207663_10346632 | |||
| 1521 | Ga0207660_10009000 | |||
| 1522 | Ga0207660_10128401 | |||
| 1523 | Ga0207657_10078269 | |||
| 1524 | Ga0207649_10000030 | |||
| 1525 | Ga0207652_10010117 | |||
| 1526 | Ga0207652_10026130 | |||
| 1527 | Ga0207652_10699067 | |||
| 1528 | Ga0207681_10002214 | |||
| 1529 | Ga0207694_10016307 | |||
| 1530 | Ga0207650_10008268 | |||
| 1531 | Ga0207650_10016778 | |||
| 1532 | Ga0207659_10147503 | |||
| 1533 | Ga0207687_10002040 | |||
| 1534 | Ga0207687_10267913 | |||
| 1535 | Ga0207664_10011490 | |||
| 1536 | Ga0207664_10031159 | |||
| 1537 | Ga0207644_10000121 | |||
| 1538 | Ga0207644_10254077 | |||
| 1539 | Ga0207690_10001021 | |||
| 1540 | Ga0207690_10008695 | |||
| 1541 | Ga0207690_10012406 | |||
| 1542 | Ga0207706_10013054 | |||
| 1543 | Ga0207706_10027735 | |||
| 1544 | Ga0207706_10041302 | |||
| 1545 | Ga0207706_10041900 | |||
| 1546 | Ga0207706_10651558 | |||
| 1547 | Ga0207686_10070672 | |||
| 1548 | Ga0207686_10591545 | |||
| 1549 | Ga0207709_10004576 | |||
| 1550 | Ga0207704_10072113 | |||
| 1551 | Ga0207665_10163772 | |||
| 1552 | Ga0207691_10000575 | |||
| 1553 | Ga0207691_10290528 | |||
| 1554 | Ga0207711_10004771 | |||
| 1555 | Ga0207711_10013297 | |||
| 1556 | Ga0207711_10019873 | |||
| 1557 | Ga0207711_10029581 | |||
| 1558 | Ga0207689_10027859 | |||
| 1559 | Ga0207689_10587338 | |||
| 1560 | Ga0207661_10040878 | |||
| 1561 | Ga0207661_10266582 | |||
| 1562 | Ga0207661_10398247 | |||
| 1563 | Ga0207679_10000004 | |||
| 1564 | Ga0207679_10094057 | |||
| 1565 | Ga0207667_10004203 | |||
| 1566 | Ga0207667_10007423 | |||
| 1567 | Ga0207712_10000004 | |||
| 1568 | Ga0207712_10042902 | |||
| 1569 | Ga0207668_10000166 | |||
| 1570 | Ga0207668_10054097 | |||
| 1571 | Ga0207668_10078011 | |||
| 1572 | Ga0207640_10000039 | |||
| 1573 | Ga0207640_10000595 | |||
| 1574 | Ga0207640_10139724 | |||
| 1575 | Ga0207640_10197393 | |||
| 1576 | Ga0207658_10000328 | |||
| 1577 | Ga0207658_10000462 | |||
| 1578 | Ga0207658_10212823 | |||
| 1579 | Ga0207658_10437372 | |||
| 1580 | Ga0207677_10384993 | |||
| 1581 | Ga0207703_10126192 | |||
| 1582 | Ga0207639_10139809 | |||
| 1583 | Ga0207639_10173652 | |||
| 1584 | Ga0207639_10262228 | |||
| 1585 | Ga0207678_10000006 | |||
| 1586 | Ga0207678_10066935 | |||
| 1587 | Ga0207678_10428979 | |||
| 1588 | Ga0207708_10073140 | |||
| 1589 | Ga0207708_10155144 | |||
| 1590 | Ga0207702_10000206 | |||
| 1591 | Ga0207702_10009722 | |||
| 1592 | Ga0207702_10083392 | |||
| 1593 | Ga0207641_10000263 | |||
| 1594 | Ga0207641_10000582 | |||
| 1595 | Ga0207641_10013287 | |||
| 1596 | Ga0207641_10016644 | |||
| 1597 | Ga0207641_10137585 | |||
| 1598 | Ga0207648_10250716 | |||
| 1599 | Ga0207676_10000578 | |||
| 1600 | Ga0207676_10056843 | |||
| 1601 | Ga0207676_10121087 | |||
| 1602 | Ga0207676_10176649 | |||
| 1603 | Ga0207674_10016609 | |||
| 1604 | Ga0207675_100000131 | |||
| 1605 | Ga0207675_100001855 | |||
| 1606 | Ga0207675_100002202 | |||
| 1607 | Ga0207675_100003015 | |||
| 1608 | Ga0207683_10034058 | |||
| 1609 | Ga0207683_10042935 | |||
| 1610 | Ga0207683_10400897 | |||
| 1611 | Ga0207683_10527396 | |||
| 1612 | Ga0207698_10011260 | |||
| 1613 | Ga0207698_10062401 | |||
| 1614 | Ga0207698_10266046 | |||
| 1615 | Ga0207698_10286053 | |||
| 1616 | Ga0209281_1000064 | |||
| 1617 | Ga0209282_1000066 | |||
| 1618 | Ga0209282_1000081 | |||
| 1619 | Ga0207428_10139858 | |||
| 1620 | Ga0265354_1000840 | |||
| 1621 | Ga0265357_1000102 | |||
| 1622 | Ga0268266_10015846 | |||
| 1623 | Ga0268266_10058588 | |||
| 1624 | Ga0268266_10089707 | |||
| 1625 | Ga0268265_10000266 | |||
| 1626 | Ga0268265_10035901 | |||
| 1627 | Ga0268265_10037739 | |||
| 1628 | Ga0268264_10000003 | |||
| 1629 | Ga0268264_10002685 | |||
| 1630 | Ga0268264_10108683 | |||
| 1631 | Ga0268264_10245401 | |||
| 1632 | Ga0265337_1027775 | |||
| 1633 | Ga0265334_10026302 | |||
| 1634 | Ga0265318_10004532 | |||
| 1635 | Ga0265318_10035698 | |||
| 1636 | Ga0265338_10008160 | |||
| 1637 | Ga0265338_10047685 | |||
| 1638 | Ga0265338_10056651 | |||
| 1639 | Ga0265338_10114013 | |||
| 1640 | Ga0237817_10015 | |||
| 1641 | Ga0307511_10001633 | |||
| 1642 | Ga0307511_10148041 | |||
| 1643 | Ga0316183_1060816 | |||
| 1644 | Ga0265771_1000126 | |||
| 1645 | Ga0265760_10000274 | |||
| 1646 | Ga0265760_10006202 | |||
| 1647 | Ga0265332_10005747 | |||
| 1648 | Ga0265320_10004192 | |||
| 1649 | Ga0265325_10008191 | |||
| 1650 | Ga0265327_10200214 | |||
| 1651 | Ga0265316_10217443 | |||
| 1652 | Ga0307513_10000090 | |||
| 1653 | Ga0307513_10122883 | |||
| 1654 | Ga0307509_10235780 | |||
| 1655 | Ga0307509_10332975 | |||
| 1656 | Ga0307408_100000032 | |||
| 1657 | Ga0307408_100000364 | |||
| 1658 | Ga0307408_100000612 | |||
| 1659 | Ga0307408_100004980 | |||
| 1660 | Ga0307408_100005474 | |||
| 1661 | Ga0307408_100281295 | |||
| 1662 | Ga0265313_10000939 | |||
| 1663 | Ga0307508_10066349 | |||
| 1664 | Ga0307508_10206345 | |||
| 1665 | Ga0265314_10103094 | |||
| 1666 | Ga0316576_10024396 | |||
| 1667 | Ga0316576_10215141 | |||
| 1668 | Ga0307516_10362264 | |||
| 1669 | Ga0307405_10007500 | |||
| 1670 | Ga0307413_10010139 | |||
| 1671 | Ga0307413_10406488 | |||
| 1672 | Ga0307413_10444787 | |||
| 1673 | Ga0307410_10000015 | |||
| 1674 | Ga0307410_10001538 | |||
| 1675 | Ga0307406_10000454 | |||
| 1676 | Ga0307406_10022530 | |||
| 1677 | Ga0307406_10033934 | |||
| 1678 | Ga0307407_10004658 | |||
| 1679 | Ga0307407_10029021 | |||
| 1680 | Ga0307407_10063555 | |||
| 1681 | Ga0307412_10012487 | |||
| 1682 | Ga0307412_10037471 | |||
| 1683 | Ga0307412_10195347 | |||
| 1684 | Ga0307409_100000111 | |||
| 1685 | Ga0307409_100014852 | |||
| 1686 | Ga0307409_100024332 | |||
| 1687 | Ga0307416_100000038 | |||
| 1688 | Ga0307416_100003964 | |||
| 1689 | Ga0307416_100006832 | |||
| 1690 | Ga0307416_100007558 | |||
| 1691 | Ga0307416_100035622 | |||
| 1692 | Ga0307416_100193506 | |||
| 1693 | Ga0307414_10002982 | |||
| 1694 | Ga0307411_10002190 | |||
| 1695 | Ga0307415_100001167 | |||
| 1696 | Ga0307415_100668915 | |||
| 1697 | Ga0307510_10036531 | |||
| 1698 | Ga0373926_0017293 | |||
| 1699 | Ga0373923_0036587 | |||
| 1700 | Ga0373932_0019569 | |||
| 1701 | Ga0373945_0052762 | |||
| 1702 | Ga0373954_0001145 | |||
| 1703 | Ga0373954_0080525 | |||
| 1704 | Ga0373957_0001986 | |||
| 1705 | Ga0373943_0001477 | |||
| 1706 | Ga0373955_0001023 | |||
| 1707 | Ga0373924_0001191 | |||
| 1708 | Ga0373931_0008709 | |||
| 1709 | Ga0373935_0000161 | |||
| 1710 | Ga0373935_0049948 | |||
| 1711 | Ga0373927_0038675 | |||
| 1712 | Ga0373927_0327213 | |||
| 1713 | Ga0373947_0002132 | |||
| 1714 | Ga0373947_0032276 | |||
| 1715 | Ga0373937_0000256 | |||
| 1716 | Ga0373937_0010619 | |||
| 1717 | Ga0373937_0101869 | |||
| 1718 | Ga0373937_0119531 | |||
| 1719 | Ga0373937_0278798 | |||
| 1720 | Ga0373937_0306755 | |||
| 1721 | Ga0316584_0015557 | |||
| 1722 | Ga0373925_0000087 | |||
| 1723 | Ga0395899_0142327 | |||
| 1724 | Ga0395900_0008015 | |||
| 1725 | Ga0395900_0026342 | |||
| 1726 | Ga0395900_0026620 | |||
| 1727 | Ga0395900_0127410 | |||
| 1728 | Ga0395898_0008110 | |||
| 1729 | Ga0395905_0000003 | |||
| 1730 | Ga0395905_0000678 | |||
| 1731 | Ga0395905_0003795 | |||
| 1732 | Ga0395905_0010178 | |||
| 1733 | Ga0395905_0011428 | |||
| 1734 | Ga0395905_0013029 | |||
| 1735 | Ga0395901_0025008 | |||
| 1736 | Ga0395901_0026526 | |||
| 1737 | Ga0395901_0622179 | |||
| 1738 | Ga0237819_01424 | |||
| 1739 | Ga0237819_05966 | |||
| 1740 | Ga0400490_13146 | |||
| 1741 | Ga0400490_42190 | |||
| 1742 | Ga0400488_36200 | |||
| 1743 | Ga0400483_027285 | |||
| 1744 | Ga0400489_45819 | |||
| 1745 | Ga0400489_71985 | |||
| 1746 | Ga0400487_43094 | |||
| 1747 | Ga0436365_0827163 | |||
| 1748 | Ga0436360_0549688 | |||
| 1749 | Ga0436360_0757569 | |||
| 1750 | Ga0436361_0051717 | |||
| 1751 | Ga0436361_0151105 | |||
| 1752 | Ga0436361_0295037 | |||
| 1753 | Ga0436361_0677882 | |||
| 1754 | Ga0436361_1123576 | |||
| 1755 | Ga0451843_1071893 | |||
| 1756 | Ga0439433_0002009 | |||
| 1757 | Ga0439441_000192 | |||
| 1758 | Ga0439445_0015704 | |||
| 1759 | Ga0439449_0000154 | |||
| 1760 | Ga0439451_000122 | |||
| 1761 | Ga0439456_000640 | |||
| 1762 | Ga0439462_0000779 | |||
| 1763 | Ga0439463_000134 | |||
| 1764 | Ga0450911_000168 | |||
| 1765 | Ga0450913_007014 | |||
| 1766 | Ga0450923_003258 | |||
| 1767 | Ga0450903_000726 | |||
| 1768 | Ga0450905_003879 | |||
| 1769 | Ga0439464_0002454 | |||
| 1770 | Ga0439460_0000538 | |||
| 1771 | Ga0451577_0000011 | |||
| 1772 | Ga0451577_0000219 | |||
| 1773 | Ga0451577_0000761 | |||
| 1774 | Ga0451577_0013357 | |||
| 1775 | Ga0451577_0016785 | |||
| 1776 | Ga0451577_0037400 | |||
| 1777 | Ga0451577_0068367 | |||
| 1778 | Ga0451577_0073801 | |||
| 1779 | Ga0439440_0000578 | |||
| 1780 | Ga0466986_0015418 | |||
| 1781 | Ga0453683_0000054 | |||
| 1782 | Ga0453683_0000313 | |||
| 1783 | Ga0453683_0097412 | |||
| 1784 | Ga0466966_0155885 | |||
| 1785 | Ga0466966_0213074 | |||
| 1786 | Ga0466961_0000213 | |||
| 1787 | Ga0453684_0000087 | |||
| 1788 | Ga0453684_0000114 | |||
| 1789 | Ga0453684_0000210 | |||
| 1790 | Ga0453684_0000381 | |||
| 1791 | Ga0453684_0000947 | |||
| 1792 | Ga0453684_0001345 | |||
| 1793 | Ga0453684_0007495 | |||
| 1794 | Ga0453684_0008486 | |||
| 1795 | Ga0453684_0008826 | |||
| 1796 | Ga0453684_0010397 | |||
| 1797 | Ga0453684_0034369 | |||
| 1798 | Ga0453684_0042573 | |||
| 1799 | Ga0453684_0051916 | |||
| 1800 | Ga0453684_0125685 | |||
| 1801 | Ga0453684_0222068 | |||
| 1802 | Ga0453684_0662980 | |||
| 1803 | Ga0453684_0788165 | |||
| 1804 | Ga0466959_0001157 | |||
| 1805 | Ga0466959_0057462 | |||
| 1806 | Ga0451576_0002484 | |||
| 1807 | Ga0451576_0003256 | |||
| 1808 | Ga0451576_0003616 | |||
| 1809 | Ga0451576_0005653 | |||
| 1810 | Ga0451576_0020607 | |||
| 1811 | Ga0451576_0027071 | |||
| 1812 | Ga0451576_0035954 | |||
| 1813 | Ga0451576_0108140 | |||
| 1814 | Ga0451576_0138209 | |||
| 1815 | Ga0451576_0170525 | |||
| 1816 | Ga0466958_0000259 | |||
| 1817 | Ga0466967_0001151 | |||
| 1818 | Ga0495617_016103 | |||
| 1819 | Ga0495592_0000001 | |||
| 1820 | Ga0495590_0037613 | |||
| 1821 | Ga0495629_0036170 | |||
| 1822 | Ga0495638_0008030 | |||
| 1823 | Ga0495638_0011178 | |||
| 1824 | Ga0495651_0000078 | |||
| 1825 | Ga0495651_0062806 | |||
| 1826 | Ga0495653_0000015 | |||
| 1827 | Ga0495650_0001461 | |||
| 1828 | Ga0495650_0039176 | |||
| 1829 | Ga0495580_0000685 | |||
| 1830 | Ga0495580_0114224 | |||
| 1831 | Ga0495580_0293037 | |||
| 1832 | Ga0495605_0000759 | |||
| 1833 | Ga0495605_0001152 | |||
| 1834 | Ga0495662_0013543 | |||
| 1835 | Ga0495664_0000001 | |||
| 1836 | Ga0495584_0140364 | |||
| 1837 | Ga0495585_0090226 | |||
| 1838 | Ga0495596_0000011 | |||
| 1839 | Ga0495607_0003197 | |||
| 1840 | Ga0495583_0006197 | |||
| 1841 | Ga0495583_0010518 | |||
| 1842 | Ga0495606_0001564 | |||
| 1843 | Ga0495606_0014696 | |||
| 1844 | Ga0495608_0000066 | |||
| 1845 | Ga0495608_0060271 | |||
| 1846 | Ga0495610_0000162 | |||
| 1847 | Ga0495610_0161456 | |||
| 1848 | Ga0495616_0000024 | |||
| 1849 | Ga0495616_0007343 | |||
| 1850 | Ga0495616_0066090 | |||
| 1851 | Ga0495618_0000021 | |||
| 1852 | Ga0495620_0000002 | |||
| 1853 | Ga0495620_0001167 | |||
| 1854 | Ga0495628_0000005 | |||
| 1855 | Ga0495630_0017055 | |||
| 1856 | Ga0495631_0051146 | |||
| 1857 | Ga0495632_0000955 | |||
| 1858 | Ga0495637_0004602 | |||
| 1859 | Ga0495643_0000782 | |||
| 1860 | Ga0495643_0003464 | |||
| 1861 | Ga0495643_0216728 | |||
| 1862 | Ga0495648_0000645 | |||
| 1863 | Ga0495648_0001948 | |||
| 1864 | Ga0495648_0003713 | |||
| 1865 | Ga0495648_0009121 | |||
| 1866 | Ga0495648_0183871 | |||
| 1867 | Ga0495652_0000001 | |||
| 1868 | Ga0495654_0000491 | |||
| 1869 | Ga0495654_0011699 | |||
| 1870 | Ga0495640_0000006 | |||
| 1871 | Ga0495586_0249196 | |||
| 1872 | Ga0495587_0000012 | |||
| 1873 | Ga0495609_0001374 | |||
| 1874 | Ga0495609_0004334 | |||
| 1875 | Ga0495609_0058819 | |||
| 1876 | Ga0495621_0023957 | |||
| 1877 | Ga0495597_0019454 | |||
| 1878 | Ga0495645_0000041 | |||
| 1879 | Ga0495645_0052455 | |||
| 1880 | Ga0495645_0092025 | |||
| 1881 | Ga0495633_0209406 | |||
| 1882 | Ga0495667_0000001 | |||
| 1883 | Ga0495656_0126005 | |||
| 1884 | Ga0495668_0010122 | |||
| 1885 | Ga0495668_0031780 | |||
| 1886 | Ga0495668_0128632 | |||
| 1887 | Ga0495634_0000313 | |||
| 1888 | Ga0495611_0000001 | |||
| 1889 | Ga0495625_0000037 | |||
| 1890 | Ga0495625_0020728 | |||
| 1891 | Ga0495625_0171373 | |||
| 1892 | Ga0495635_0000007 | |||
| 1893 | Ga0495661_0004835 | |||
| 1894 | Ga0495588_0208404 | |||
| 1895 | Ga0495657_0000047 | |||
| 1896 | Ga0495599_0000002 | |||
| 1897 | Ga0495623_0000023 | |||
| 1898 | Ga0495646_0000024 | |||
| 1899 | Ga0495658_0110150 | |||
| 1900 | Ga0495658_0293126 | |||
| 1901 | Ga0495669_0019329 | |||
| 1902 | Ga0495669_0029553 | |||
| 1903 | Ga0495613_0328771 | |||
| 1904 | Ga0495670_0003337 | |||
| 1905 | Ga0495670_0188104 | |||
| 1906 | Ga0495671_0000925 | |||
| 1907 | Ga0495671_0008172 | |||
| 1908 | Ga0495649_0007649 | |||
| 1909 | Ga0495589_0000366 | |||
| 1910 | Ga0495600_0000013 | |||
| 1911 | Ga0495600_0070662 | |||
| 1912 | Ga0495604_0000007 | |||
| 1913 | Ga0495604_0047820 | |||
| 1914 | Ga0495674_0000001 | |||
| 1915 | Ga0495674_0205187 | |||
| 1916 | Ga0495674_0312800 | |||
| 1917 | Ga0495672_0013927 | |||
| 1918 | Ga0495680_0001662 | |||
| 1919 | Ga0495683_0000194 | |||
| 1920 | Ga0495675_0000014 | |||
| 1921 | Ga0495675_0002266 | |||
| 1922 | Ga0495677_0155694 | |||
| 1923 | Ga0495679_000001 | |||
| 1924 | Ga0495673_0000607 | |||
| 1925 | Ga0495673_0036135 | |||
| 1926 | Ga0495684_0000027 | |||
| 1927 | Ga0495684_0410479 | |||
| 1928 | Ga0495593_0000830 | |||
| 1929 | Ga0495602_0000004 | |||
| 1930 | Ga0496100_0013011 | |||
| 1931 | Ga0496100_0097304 | |||
| 1932 | Ga0496101_0485972 | |||
| 1933 | Ga0496102_0011442 | |||
| 1934 | Ga0496102_0035649 | |||
| 1935 | Ga0496102_0273990 | |||
| 1936 | Ga0496103_0001011 | |||
| 1937 | Ga0496103_0082528 | |||
| 1938 | Ga0496104_0003666 | |||
| 1939 | Ga0496105_0207615 | |||
| 1940 | Ga0496105_0282806 | |||
| 1941 | Ga0496106_0088788 | |||
| 1942 | Ga0496106_0492133 | |||
| 1943 | Ga0496110_0488163 | |||
| 1944 | Ga0496115_0327296 | |||
| 1945 | Ga0496116_0002738 | |||
| 1946 | Ga0496116_0003529 | |||
| 1947 | Ga0496116_0009769 | |||
| 1948 | Ga0496116_0049115 | |||
| 1949 | Ga0496117_0002061 | |||
| 1950 | Ga0496117_0002856 | |||
| 1951 | Ga0496117_0004128 | |||
| 1952 | Ga0496117_0007412 | |||
| 1953 | Ga0496117_0083164 | |||
| 1954 | Ga0496118_0004752 | |||
| 1955 | Ga0496118_0006005 | |||
| 1956 | Ga0496118_0015795 | |||
| 1957 | Ga0496118_0017662 | |||
| 1958 | Ga0496118_0083503 | |||
| 1959 | Ga0496119_0000049 | |||
| 1960 | Ga0496119_0003046 | |||
| 1961 | Ga0496119_0019062 | |||
| 1962 | Ga0496119_0066281 | |||
| 1963 | Ga0496120_0001178 | |||
| 1964 | Ga0496120_0001489 | |||
| 1965 | Ga0496120_0078867 | |||
| 1966 | Ga0496120_0227841 | |||
| 1967 | Ga0496121_0002612 | |||
| 1968 | Ga0496121_0011198 | |||
| 1969 | Ga0496121_0011520 | |||
| 1970 | Ga0496121_0029865 | |||
| 1971 | Ga0496121_0049678 | |||
| 1972 | Ga0496121_0079495 | |||
| 1973 | Ga0496121_0085981 | |||
| 1974 | Ga0496121_0307949 | |||
| 1975 | Ga0496122_0004704 | |||
| 1976 | Ga0496122_0007770 | |||
| 1977 | Ga0496122_0011176 | |||
| 1978 | Ga0496122_0048982 | |||
| 1979 | Ga0496122_0084041 | |||
| 1980 | Ga0496123_0007892 | |||
| 1981 | Ga0496123_0063982 | |||
| 1982 | Ga0496123_0072684 | |||
| 1983 | Ga0496124_0002268 | |||
| 1984 | Ga0496124_0003913 | |||
| 1985 | Ga0496124_0006624 | |||
| 1986 | Ga0496124_0028679 | |||
| 1987 | Ga0496124_0079040 | |||
| 1988 | Ga0496124_0200297 | |||
| 1989 | Ga0496125_0003624 | |||
| 1990 | Ga0496125_0006720 | |||
| 1991 | Ga0496125_0006748 | |||
| 1992 | Ga0496125_0009915 | |||
| 1993 | Ga0496125_0012895 | |||
| 1994 | Ga0496125_0015028 | |||
| 1995 | Ga0496125_0021749 | |||
| 1996 | Ga0496125_0036054 | |||
| 1997 | Ga0496125_0048634 | |||
| 1998 | Ga0496126_0005826 | |||
| 1999 | Ga0496126_0018668 | |||
| 2000 | Ga0496126_0085799 | |||
| 2001 | Ga0496126_0189715 | |||
| 2002 | Ga0496126_0223815 | |||
| 2003 | Ga0496126_0271330 | |||
| 2004 | Ga0496126_0505738 | |||
| 2005 | Ga0501307_006741 | |||
| 2006 | Ga0495678_000028 | |||
| 2007 | Ga0495682_0000265 | |||
| 2008 | Ga0495682_0061543 | |||
| 2009 | Ga0501300_000569 | |||
| 2010 | Ga0501300_009079 | |||
| 2011 | Ga0501031_0043942 | |||
| 2012 | Ga0501032_0024784 | |||
| 2013 | Ga0501033_0004466 | |||
| 2014 | Ga0501033_0320932 | |||
| 2015 | Ga0501034_0014595 | |||
| 2016 | Ga0501034_0129722 | |||
| 2017 | Ga0501034_0140064 | |||
| 2018 | Ga0501036_0045926 | |||
| 2019 | Ga0501041_0022949 | |||
| 2020 | Ga0501041_0079675 | |||
| 2021 | Ga0501042_0013949 | |||
| 2022 | Ga0501042_0167048 | |||
| 2023 | Ga0501043_0054085 | |||
| 2024 | Ga0501046_0165870 | |||
| 2025 | Ga0501047_0329837 | |||
| 2026 | Ga0501048_0086169 | |||
| 2027 | Ga0501070_0059333 | |||
| 2028 | Ga0501071_0263139 | |||
| 2029 | Ga0501072_0019483 | |||
| 2030 | Ga0501073_0022929 | |||
| 2031 | Ga0501076_0033043 | |||
| 2032 | Ga0501077_0131186 | |||
| 2033 | Ga0501259_000005 | |||
| 2034 | Ga0501081_0010148 | |||
| 2035 | Ga0501081_0018659 | |||
| 2036 | Ga0501241_023293 | |||
| 2037 | Ga0501266_000721 | |||
| 2038 | Ga0501035_0033080 | |||
| 2039 | Ga0501035_0199989 | |||
| 2040 | Ga0501044_0047218 | |||
| 2041 | nmdc:mga03683_17782_c1 | |||
| 2042 | nmdc:mga03683_49148_c1 | |||
| 2043 | nmdc:mga03683_58651_c1 | |||
| 2044 | nmdc:mga03n38_10895_c1 | |||
| 2045 | nmdc:mga03n38_130933_c1 | |||
| 2046 | nmdc:mga03n38_176098_c1 | |||
| 2047 | nmdc:mga03n38_20430_c1 | |||
| 2048 | nmdc:mga03n38_2106_c1 | |||
| 2049 | nmdc:mga00v17_16532_c1 | |||
| 2050 | nmdc:mga00v17_21160_c1 | |||
| 2051 | nmdc:mga00v17_550_c1 | |||
| 2052 | nmdc:mga00v17_76047_c1 | |||
| 2053 | nmdc:mga00v17_858_c1 | |||
| 2054 | nmdc:mga0yw44_115007_c1 | |||
| 2055 | nmdc:mga0yw44_164_c1 | |||
| 2056 | nmdc:mga0yw44_323_c1 | |||
| 2057 | nmdc:mga0yw44_5027_c1 | |||
| 2058 | nmdc:mga0yw44_6841_c1 | |||
| 2059 | nmdc:mga0yw44_85225_c1 | |||
| 2060 | nmdc:mga0k408_124283_c1 | |||
| 2061 | nmdc:mga0k408_15132_c1 | |||
| 2062 | nmdc:mga0k408_30968_c1 | |||
| 2063 | nmdc:mga0k408_54101_c1 | |||
| 2064 | nmdc:mga06z11_16137_c1 | |||
| 2065 | nmdc:mga06z11_26827_c1 | |||
| 2066 | nmdc:mga06z11_30013_c1 | |||
| 2067 | nmdc:mga06z11_7315_c1 | |||
| 2068 | nmdc:mga07m45_108967_c1 | |||
| 2069 | nmdc:mga07m45_16144_c1 | |||
| 2070 | nmdc:mga07m45_217778_c1 | |||
| 2071 | nmdc:mga07m45_6347_c1 | |||
| 2072 | nmdc:mga05p37_802106_c1 | |||
| 2073 | nmdc:mga05p37_9734_c1 | |||
| 2074 | nmdc:mga09592_54930_c1 | |||
| 2075 | nmdc:mga09592_7400_c1 | |||
| 2076 | nmdc:mga0qj67_26674_c1 | |||
| 2077 | nmdc:mga0qj67_27823_c1 | |||
| 2078 | nmdc:mga0qj67_609106_c1 | |||
| 2079 | nmdc:mga06r32_2236_c1 | |||
| 2080 | nmdc:mga08y16_197348_c1 | |||
| 2081 | nmdc:mga0n895_9979_c1 | |||
| 2082 | nmdc:mga0rr50_6938_c1 | |||
| 2083 | nmdc:mga08x19_364727_c1 | |||
| 2084 | nmdc:mga08x19_4_c1 | |||
| 2085 | nmdc:mga0sz30_344_c1 | |||
| 2086 | nmdc:mga0sz30_47_c2 | |||
| 2087 | nmdc:mga0sz30_59488_c1 | |||
| 2088 | Ga0495601_0000006 | |||
| 2089 | Ga0495601_0285975 | |||
| 2090 | Ga0495612_0000004 | |||
| 2091 | Ga0500610_0000109 | |||
| 2092 | Ga0495595_0000006 | |||
| 2093 | Ga0495619_0000011 | |||
| 2094 | Ga0500643_000053 | |||
| 2095 | Ga0500643_000439 | |||
| 2096 | Ga0500643_000774 | |||
| 2097 | Ga0500643_015298 | |||
| 2098 | Ga0500643_021960 | |||
| 2099 | Ga0500646_0000182 | |||
| 2100 | Ga0500583_0000160 | |||
| 2101 | Ga0500583_0005083 | |||
| 2102 | Ga0500651_0082441 | |||
| 2103 | Ga0500641_0012315 | |||
| 2104 | Ga0500555_002225 | |||
| 2105 | Ga0500592_010042 | |||
| 2106 | Ga0500595_006413 | |||
| 2107 | Ga0500595_027558 | |||
| 2108 | Ga0500607_000386 | |||
| 2109 | Ga0500607_000706 | |||
| 2110 | Ga0500642_0001986 | |||
| 2111 | Ga0500642_0027983 | |||
| 2112 | Ga0500642_0123938 | |||
| 2113 | Ga0500658_0047352 | |||
| 2114 | Ga0500659_0000749 | |||
| 2115 | Ga0500559_0000174 | |||
| 2116 | Ga0500559_0007572 | |||
| 2117 | Ga0500559_0218521 | |||
| 2118 | Ga0500568_0003968 | |||
| 2119 | Ga0500573_0173075 | |||
| 2120 | Ga0500590_110041 | |||
| 2121 | Ga0500604_0000941 | |||
| 2122 | Ga0500604_0008879 | |||
| 2123 | Ga0500616_0001605 | |||
| 2124 | Ga0500616_0183242 | |||
| 2125 | Ga0500622_0001570 | |||
| 2126 | Ga0500627_0002950 | |||
| 2127 | Ga0500627_0003538 | |||
| 2128 | Ga0500645_000291 | |||
| 2129 | Ga0501084_0018285 | |||
| 2130 | Ga0500661_000076 | |||
| 2131 | Ga0530510_0016714 | |||
| 2132 | 2548501250 | |||
| 2133 | 2585282675 | |||
| 2134 | 2585327848 | |||
| 2135 | 2585555542 | |||
| 2136 | 2599965322 | |||
| 2137 | 2599978539 | |||
| 2138 | 2600010554 | |||
| 2139 | 2616310214 | |||
| 2140 | 2617914983 | |||
| 2141 | 2644649206 | |||
| 2142 | 2685151340 | |||
| 2143 | 2698321921 | |||
| 2144 | 2721506506 | |||
| 2145 | 2729148841 | |||
| 2146 | 2739212055 | |||
| 2147 | 2807409491 | |||
| 2148 | 2807457792 | |||
| 2149 | 2808856069 | |||
| 2150 | 2808923536 | |||
| 2151 | 2808936180 | |||
| 2152 | 2808945701 | |||
| 2153 | 2808964574 | |||
| 2154 | 2808999462 | |||
| 2155 | 2823423205 | |||
| 2156 | 2831428821 | |||
| 2157 | 2848702254 | |||
| 2158 | 2849668013 | |||
| 2159 | 2885215250 | |||
| 2160 | 2886633781 | |||
| 2161 | 2904762777 | |||
| 2162 | 2913846980 | |||
| 2163 | 2913916642 | |||
| 2164 | 2913944457 | |||
| 2165 | 2929145879 | |||
| 2166 | 2929237011 | |||
| 2167 | 2939618292 | |||
| 2168 | 2947430048 | |||
| 2169 | 2978971165 | |||
| 2170 | 2979086957 | |||
| 2171 | 3007400754 | |||
| 2172 | 642600354 | |||
| 2173 | 8023440115 | |||
| 2174 | 8023447006 | |||
| 2175 | 8055636865 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tzf-assembly1.cif.gz_A | x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi | 0.941 | 2 | 256 |
| 1wvc-assembly1.cif.gz_A | alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp | 0.9301 | 2 | 256 |
| 1tzf-assembly1.cif.gz_A | x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi | 0.9266 | 2 | 256 |
| 1wvc-assembly1.cif.gz_A | alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp | 0.9197 | 2 | 256 |
| 7d73-assembly1.cif.gz_F | cryo-em structure of gmppa/gmppb complex bound to gtp (state i) | 0.851 | 1 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tzfA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.941 | 2 | 256 | 3.90.550.10 |
| 1tzfA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9266 | 2 | 256 | 3.90.550.10 |
| af_A4I3X5_10_117_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8374 | 1 | 117 | 3.90.550.10 |
| af_K7LRM0_18_167_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8317 | 94 | 232 | 3.90.550.10 |
| 4y7vA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8093 | 1 | 246 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A136Q9E8-F1-model_v4 | deleted | 0.9925 | 125 | 256 |
|
| AF-A0A3M9YZN7-F1-model_v4 | Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) | 0.9913 | 1 | 255 |
GO:0009243
GO:0047343 |
| AF-A0A517T7C1-F1-model_v4 | Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) | 0.9902 | 1 | 256 |
GO:0009243
GO:0047343 |
| AF-E8U3G0-F1-model_v4 | Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) | 0.9888 | 1 | 255 |
GO:0009243
GO:0047343 |
| AF-A0A1U9NNG5-F1-model_v4 | Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) | 0.9876 | 1 | 256 |
GO:0009243
GO:0047343 |