F489874

General Info

Members Datasets Scaffolds Average Seq Length
1091 371 1091 126

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100272381|Ga0070706_1002723813
Length 146
Sequence VAGERVLVVEDNEKNMKLFRDVLQAKGYRTLEATTGSRAVELAAEHSPDLVLMDIQLPDIDGVEALGRLRADARTASLPVLALTAQAMQGDRERFLAAGFDGYLSKPLNIAELVATVRQYCDGRGRCDTQAALGGAGEQQTEDGER

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
194 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
217 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
218 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
219 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
337 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
338 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
341 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
358 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
359 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
362 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
363 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
364 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 9.72
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1006440 3300001978 Bacteria 1110
2 JGI24744J21845_10002681 3300002077 Bacteria 3630
3 JGI24033J26618_1001669 3300002155 Bacteria 2207
4 JGI24742J22300_10021071 3300002244 Bacteria 1112
5 JGI24751J29686_10000223 3300002459 Bacteria 23798
6 JGI24751J29686_10007378 3300002459 Bacteria 2246
7 JGI25407J50210_10000425 3300003373 Bacteria 8216
8 Ga0070676_10516119 3300005328 Bacteria 850
9 Ga0070683_100013383 3300005329 Bacteria 7154
10 Ga0070683_100042976 3300005329 Bacteria 4163
11 Ga0070690_100586048 3300005330 Bacteria 845
12 Ga0070690_100810082 3300005330 Bacteria 727
13 Ga0070670_100011290 3300005331 Bacteria 7635
14 Ga0070670_100349551 3300005331 Bacteria 1299
15 Ga0068869_100669261 3300005334 Bacteria 883
16 Ga0070666_10039778 3300005335 Bacteria 3136
17 Ga0070680_100010728 3300005336 Bacteria 7074
18 Ga0070680_100213008 3300005336 Bacteria 1630
19 Ga0070682_100005203 3300005337 Bacteria 7237
20 Ga0070682_100809160 3300005337 Bacteria 762
21 Ga0068868_100029932 3300005338 Bacteria 4173
22 Ga0070660_100126703 3300005339 Bacteria 2041
23 Ga0070660_100370265 3300005339 Bacteria 1182
24 Ga0070660_100625583 3300005339 Bacteria 901
25 Ga0070689_100013742 3300005340 Bacteria 5865
26 Ga0070689_100180355 3300005340 Bacteria 1715
27 Ga0070687_100537140 3300005343 Bacteria 793
28 Ga0070687_101156369 3300005343 Bacteria 569
29 Ga0070661_100159774 3300005344 Bacteria 1706
30 Ga0070661_100677212 3300005344 Bacteria 839
31 Ga0070661_101577090 3300005344 Unclassified 555
32 Ga0070692_10073774 3300005345 Bacteria 1824
33 Ga0070692_10119108 3300005345 Bacteria 1470
34 Ga0070692_10302373 3300005345 Bacteria 977
35 Ga0070668_100177352 3300005347 Bacteria 1738
36 Ga0070675_100187551 3300005354 Bacteria 1791
37 Ga0070675_100430778 3300005354 Bacteria 1180
38 Ga0070675_101374675 3300005354 Bacteria 651
39 Ga0070671_100303644 3300005355 Bacteria 1359
40 Ga0070671_100308743 3300005355 Unclassified 1347
41 Ga0070674_100006099 3300005356 Bacteria 7009
42 Ga0070674_100014513 3300005356 Bacteria 4898
43 Ga0070674_101115884 3300005356 Bacteria 697
44 Ga0070673_100036857 3300005364 Bacteria 3722
45 Ga0070673_100421497 3300005364 Bacteria 1197
46 Ga0070688_100008183 3300005365 Bacteria 5665
47 Ga0070688_100009091 3300005365 Bacteria 5419
48 Ga0070688_100581586 3300005365 Bacteria 855
49 Ga0070688_101057459 3300005365 Bacteria 647
50 Ga0070659_100040224 3300005366 Bacteria 3652
51 Ga0070659_100954389 3300005366 Unclassified 751
52 Ga0070659_101573745 3300005366 Bacteria 586
53 Ga0070667_101844135 3300005367 Unclassified 569
54 Ga0070703_10003075 3300005406 Bacteria 4772
55 Ga0070709_10860137 3300005434 Bacteria 715
56 Ga0070714_100002672 3300005435 Bacteria 13132
57 Ga0070714_100365206 3300005435 Bacteria 1358
58 Ga0070714_100549090 3300005435 Bacteria 1106
59 Ga0070714_100872673 3300005435 Bacteria 873
60 Ga0070713_100034470 3300005436 Bacteria 4067
61 Ga0070713_100226203 3300005436 Bacteria 1699
62 Ga0070710_10007082 3300005437 Bacteria 5414
63 Ga0070710_10573179 3300005437 Bacteria 782
64 Ga0070701_10175250 3300005438 Bacteria 1251
65 Ga0070701_10575077 3300005438 Unclassified 743
66 Ga0070701_10667068 3300005438 Bacteria 696
67 Ga0070711_100018382 3300005439 Bacteria 4462
68 Ga0070711_100020235 3300005439 Bacteria 4285
69 Ga0070711_100053883 3300005439 Bacteria 2774
70 Ga0070711_100081384 3300005439 Bacteria 2308
71 Ga0070705_100009626 3300005440 Bacteria 4809
72 Ga0070705_100050491 3300005440 Bacteria 2420
73 Ga0070705_100200159 3300005440 Bacteria 1368
74 Ga0070705_100221055 3300005440 Bacteria 1311
75 Ga0070705_100638081 3300005440 Bacteria 829
76 Ga0070705_100702064 3300005440 Unclassified 795
77 Ga0070700_100001522 3300005441 Bacteria 11542
78 Ga0070700_100019689 3300005441 Bacteria 3899
79 Ga0070700_100683667 3300005441 Bacteria 814
80 Ga0070694_100019660 3300005444 Bacteria 4298
81 Ga0070694_100306859 3300005444 Unclassified 1218
82 Ga0070708_100006168 3300005445 Bacteria 9533
83 Ga0070708_100010959 3300005445 Bacteria 7365
84 Ga0070708_100173553 3300005445 Bacteria 2014
85 Ga0070708_101247196 3300005445 Bacteria 695
86 Ga0070663_100007368 3300005455 Bacteria 6693
87 Ga0070663_100508960 3300005455 Bacteria 1001
88 Ga0070663_100529554 3300005455 Bacteria 982
89 Ga0070663_100952762 3300005455 Bacteria 744
90 Ga0070678_100001885 3300005456 Bacteria 11318
91 Ga0070678_100080894 3300005456 Bacteria 2461
92 Ga0070678_100900398 3300005456 Bacteria 809
93 Ga0070662_100024483 3300005457 Bacteria 4159
94 Ga0070662_100054330 3300005457 Bacteria 2902
95 Ga0068867_100002812 3300005459 Bacteria 12234
96 Ga0068867_100025980 3300005459 Bacteria 4201
97 Ga0068867_100037053 3300005459 Bacteria 3543
98 Ga0070685_10014113 3300005466 Bacteria 4225
99 Ga0070685_10099905 3300005466 Bacteria 1771
100 Ga0070685_10482302 3300005466 Bacteria 874
101 Ga0070685_10529601 3300005466 Bacteria 838
102 Ga0070706_100000265 3300005467 Bacteria 63782
103 Ga0070706_100016294 3300005467 Bacteria 6867
104 Ga0070706_100258090 3300005467 Bacteria 1627
105 Ga0070706_100272381 3300005467 Bacteria 1580
106 Ga0070706_100335891 3300005467 Bacteria 1409
107 Ga0070706_101339102 3300005467 Bacteria 656
108 Ga0070707_100003506 3300005468 Bacteria 14806
109 Ga0070707_100328567 3300005468 Bacteria 1486
110 Ga0070707_101989904 3300005468 Unclassified 548
111 Ga0070698_100054382 3300005471 Bacteria 4064
112 Ga0070698_100206090 3300005471 Bacteria 1901
113 Ga0070698_100424142 3300005471 Bacteria 1265
114 Ga0070698_100656962 3300005471 Bacteria 990
115 Ga0070698_100905513 3300005471 Unclassified 828
116 Ga0070698_101499891 3300005471 Bacteria 626
117 Ga0070699_100040001 3300005518 Bacteria 4060
118 Ga0070699_100205509 3300005518 Bacteria 1752
119 Ga0070699_100670809 3300005518 Bacteria 947
120 Ga0070679_100191341 3300005530 Bacteria 2015
121 Ga0070679_101635771 3300005530 Bacteria 592
122 Ga0070684_100000718 3300005535 Bacteria 22923
123 Ga0070684_100008288 3300005535 Bacteria 8118
124 Ga0070684_100042878 3300005535 Bacteria 3907
125 Ga0070697_100021631 3300005536 Bacteria 5098
126 Ga0070697_100076109 3300005536 Bacteria 2760
127 Ga0070697_100140243 3300005536 Unclassified 2033
128 Ga0070697_101403352 3300005536 Unclassified 624
129 Ga0068853_100299142 3300005539 Bacteria 1487
130 Ga0070672_100011868 3300005543 Bacteria 6088
131 Ga0070686_100004420 3300005544 Bacteria 7758
132 Ga0070686_100021094 3300005544 Bacteria 3866
133 Ga0070686_100581643 3300005544 Bacteria 880
134 Ga0070695_100746980 3300005545 Bacteria 780
135 Ga0070696_100018988 3300005546 Bacteria 4653
136 Ga0070696_100019404 3300005546 Bacteria 4604
137 Ga0070696_100293958 3300005546 Bacteria 1242
138 Ga0070696_100328636 3300005546 Bacteria 1179
139 Ga0070696_100729915 3300005546 Bacteria 810
140 Ga0070696_101462719 3300005546 Bacteria 584
141 Ga0070693_100183653 3300005547 Bacteria 1348
142 Ga0070665_100108249 3300005548 Bacteria 2782
143 Ga0070704_100001582 3300005549 Bacteria 12291
144 Ga0070704_100239069 3300005549 Bacteria 1485
145 Ga0070704_100691769 3300005549 Bacteria 903
146 Ga0068855_102283690 3300005563 Bacteria 542
147 Ga0070664_100019961 3300005564 Bacteria 5517
148 Ga0070664_100098038 3300005564 Bacteria 2546
149 Ga0070664_100233888 3300005564 Bacteria 1648
150 Ga0070664_100605125 3300005564 Unclassified 1017
151 Ga0070664_101297518 3300005564 Bacteria 687
152 Ga0068857_100022262 3300005577 Bacteria 5575
153 Ga0068857_100027256 3300005577 Bacteria 5039
154 Ga0068857_100158141 3300005577 Bacteria 2055
155 Ga0068857_100705252 3300005577 Bacteria 959
156 Ga0068854_100489844 3300005578 Bacteria 1034
157 Ga0068854_100758406 3300005578 Unclassified 842
158 Ga0068856_100051292 3300005614 Bacteria 4068
159 Ga0068856_100087246 3300005614 Bacteria 3102
160 Ga0068856_100577133 3300005614 Bacteria 1146
161 Ga0070702_100145703 3300005615 Bacteria 1514
162 Ga0070702_100186433 3300005615 Bacteria 1362
163 Ga0070702_100236549 3300005615 Bacteria 1230
164 Ga0070702_100680672 3300005615 Bacteria 782
165 Ga0070702_100835249 3300005615 Bacteria 715
166 Ga0068852_101768244 3300005616 Bacteria 641
167 Ga0068859_100042738 3300005617 Bacteria 4553
168 Ga0068859_100653203 3300005617 Bacteria 1144
169 Ga0068859_100797774 3300005617 Bacteria 1032
170 Ga0068859_101013963 3300005617 Bacteria 912
171 Ga0068864_100103778 3300005618 Bacteria 2524
172 Ga0068864_101295310 3300005618 Bacteria 729
173 Ga0068866_10004917 3300005718 Bacteria 5494
174 Ga0068861_100004620 3300005719 Bacteria 9242
175 Ga0068861_100066704 3300005719 Bacteria 2775
176 Ga0068861_100608497 3300005719 Unclassified 1004
177 Ga0068861_100842984 3300005719 Bacteria 863
178 Ga0068851_10429055 3300005834 Unclassified 782
179 Ga0068870_10004753 3300005840 Bacteria 5871
180 Ga0068870_10007440 3300005840 Bacteria 4881
181 Ga0068870_10095903 3300005840 Bacteria 1667
182 Ga0068870_10327392 3300005840 Bacteria 975
183 Ga0068863_100028952 3300005841 Bacteria 5290
184 Ga0068863_100468397 3300005841 Unclassified 1238
185 Ga0068863_100858325 3300005841 Bacteria 907
186 Ga0068863_101947726 3300005841 Bacteria 598
187 Ga0068858_100040973 3300005842 Bacteria 4296
188 Ga0068860_100136828 3300005843 Bacteria 2353
189 Ga0068860_100331602 3300005843 Bacteria 1495
190 Ga0068860_100391942 3300005843 Bacteria 1372
191 Ga0068862_100076290 3300005844 Bacteria 2901
192 Ga0068862_102402452 3300005844 Bacteria 539
193 Ga0081455_10003184 3300005937 Bacteria 19049
194 Ga0081455_10014560 3300005937 Bacteria 7700
195 Ga0081455_10023102 3300005937 Bacteria 5793
196 Ga0081455_10033620 3300005937 Bacteria 4606
197 Ga0081455_10051279 3300005937 Bacteria 3540
198 Ga0081455_10052811 3300005937 Bacteria 3476
199 Ga0081455_10146895 3300005937 Bacteria 1823
200 Ga0081455_10240217 3300005937 Bacteria 1332
201 Ga0081455_10258194 3300005937 Bacteria 1270
202 Ga0081455_10303955 3300005937 Bacteria 1143
203 Ga0081455_10596483 3300005937 Bacteria 721
204 Ga0081538_10003208 3300005981 Bacteria 15541
205 Ga0081538_10098095 3300005981 Bacteria 1486
206 Ga0081538_10191186 3300005981 Bacteria 858
207 Ga0081540_1000879 3300005983 Bacteria 27145
208 Ga0081539_10002754 3300005985 Bacteria 23660
209 Ga0081539_10167839 3300005985 Bacteria 1040
210 Ga0070717_10020221 3300006028 Bacteria 5232
211 Ga0070717_10120096 3300006028 Bacteria 2251
212 Ga0070717_10335052 3300006028 Bacteria 1350
213 Ga0075365_10015406 3300006038 Bacteria 4625
214 Ga0075365_10109483 3300006038 Bacteria 1898
215 Ga0075364_10116426 3300006051 Bacteria 1787
216 Ga0075432_10001799 3300006058 Bacteria 7065
217 Ga0075432_10142691 3300006058 Bacteria 915
218 Ga0070716_100377196 3300006173 Bacteria 1012
219 Ga0070716_100708124 3300006173 Bacteria 770
220 Ga0070712_100003758 3300006175 Bacteria 9352
221 Ga0070712_100057122 3300006175 Bacteria 2740
222 Ga0070712_100172051 3300006175 Bacteria 1681
223 Ga0070712_101461121 3300006175 Bacteria 597
224 Ga0075367_10324660 3300006178 Bacteria 970
225 Ga0097621_100120527 3300006237 Bacteria 2224
226 Ga0097621_100124068 3300006237 Bacteria 2193
227 Ga0097621_100563304 3300006237 Bacteria 1038
228 Ga0068871_100039897 3300006358 Bacteria 3759
229 Ga0068871_100066036 3300006358 Bacteria 2965
230 Ga0068871_100452313 3300006358 Bacteria 1151
231 Ga0075428_100033997 3300006844 Bacteria 5624
232 Ga0075428_100039421 3300006844 Bacteria 5199
233 Ga0075428_102433309 3300006844 Unclassified 537
234 Ga0075430_100010189 3300006846 Bacteria 7960
235 Ga0075430_100052967 3300006846 Bacteria 3417
236 Ga0075431_100010011 3300006847 Bacteria 9525
237 Ga0075431_100140156 3300006847 Bacteria 2493
238 Ga0075433_10000149 3300006852 Bacteria 37279
239 Ga0075433_10011686 3300006852 Bacteria 7070
240 Ga0075433_10021142 3300006852 Bacteria 5454
241 Ga0075433_10088345 3300006852 Bacteria 2739
242 Ga0075433_10714073 3300006852 Bacteria 878
243 Ga0075434_100005828 3300006871 Bacteria 11253
244 Ga0075434_100007538 3300006871 Bacteria 10078
245 Ga0075429_100149373 3300006880 Bacteria 2046
246 Ga0075429_100250488 3300006880 Bacteria 1551
247 Ga0068865_100011942 3300006881 Bacteria 5453
248 Ga0068865_100109842 3300006881 Bacteria 2033
249 Ga0068865_100205728 3300006881 Bacteria 1531
250 Ga0075436_100064663 3300006914 Bacteria 2529
251 Ga0097620_100042737 3300006931 Bacteria 4553
252 Ga0097620_100653186 3300006931 Bacteria 1144
253 Ga0097620_100797881 3300006931 Bacteria 1032
254 Ga0097620_101013765 3300006931 Bacteria 912
255 Ga0075435_100032344 3300007076 Bacteria 4130
256 Ga0105251_10050465 3300009011 Bacteria 1987
257 Ga0111539_10080744 3300009094 Bacteria 3825
258 Ga0111539_10082138 3300009094 Bacteria 3790
259 Ga0111539_10177989 3300009094 Bacteria 2484
260 Ga0111539_10284180 3300009094 Bacteria 1925
261 Ga0111539_10295246 3300009094 Bacteria 1886
262 Ga0105245_10044957 3300009098 Bacteria 3943
263 Ga0105245_10046136 3300009098 Bacteria 3894
264 Ga0105245_10063865 3300009098 Bacteria 3326
265 Ga0105245_10554196 3300009098 Bacteria 1172
266 Ga0105245_10617585 3300009098 Bacteria 1112
267 Ga0105245_10623096 3300009098 Bacteria 1107
268 Ga0105245_11075661 3300009098 Bacteria 850
269 Ga0105245_11786312 3300009098 Bacteria 668
270 Ga0105247_11249689 3300009101 Bacteria 594
271 Ga0114129_10000667 3300009147 Bacteria 43086
272 Ga0114129_10020441 3300009147 Bacteria 9415
273 Ga0114129_10123275 3300009147 Bacteria 3565
274 Ga0114129_10197914 3300009147 Bacteria 2724
275 Ga0114129_10641285 3300009147 Bacteria 1372
276 Ga0114129_10720348 3300009147 Bacteria 1280
277 Ga0114129_10913986 3300009147 Bacteria 1111
278 Ga0105243_10003824 3300009148 Bacteria 12041
279 Ga0105243_10006839 3300009148 Bacteria 8790
280 Ga0105243_10079721 3300009148 Bacteria 2669
281 Ga0105243_10270750 3300009148 Bacteria 1525
282 Ga0105243_10277012 3300009148 Bacteria 1509
283 Ga0105243_10813467 3300009148 Bacteria 922
284 Ga0105243_11332978 3300009148 Unclassified 736
285 Ga0105243_11545768 3300009148 Bacteria 689
286 Ga0105243_12675507 3300009148 Bacteria 539
287 Ga0105241_10517329 3300009174 Bacteria 1067
288 Ga0105241_10563126 3300009174 Unclassified 1025
289 Ga0105241_10828537 3300009174 Bacteria 854
290 Ga0105242_10003423 3300009176 Bacteria 12337
291 Ga0105242_10009376 3300009176 Bacteria 7511
292 Ga0105242_10029108 3300009176 Bacteria 4403
293 Ga0105242_10410948 3300009176 Bacteria 1266
294 Ga0105242_10678008 3300009176 Bacteria 1006
295 Ga0105242_10679999 3300009176 Bacteria 1004
296 Ga0105242_12569020 3300009176 Bacteria 558
297 Ga0105248_10031295 3300009177 Bacteria 5947
298 Ga0105248_10413998 3300009177 Bacteria 1518
299 Ga0105248_10753334 3300009177 Bacteria 1099
300 Ga0105248_11982503 3300009177 Bacteria 661
301 Ga0105237_11507369 3300009545 Bacteria 679
302 Ga0105238_10015628 3300009551 Bacteria 7682
303 Ga0105238_12327621 3300009551 Bacteria 571
304 Ga0105249_10001792 3300009553 Bacteria 18700
305 Ga0105249_10059717 3300009553 Bacteria 3498
306 Ga0105249_10123526 3300009553 Bacteria 2463
307 Ga0105249_10606560 3300009553 Bacteria 1150
308 Ga0105249_10703427 3300009553 Bacteria 1071
309 Ga0105239_10170095 3300010375 Bacteria 2436
310 Ga0105239_10224033 3300010375 Bacteria 2109
311 Ga0105239_10258081 3300010375 Bacteria 1958
312 Ga0105239_10501726 3300010375 Bacteria 1379
313 Ga0105246_10022863 3300011119 Bacteria 4040
314 Ga0105246_10298873 3300011119 Bacteria 1299
315 Ga0105246_10556720 3300011119 Bacteria 984
316 Ga0105246_10903332 3300011119 Bacteria 792
317 Ga0105246_10983809 3300011119 Bacteria 763
318 Ga0157373_10106315 3300013100 Bacteria 1973
319 Ga0157371_10624445 3300013102 Bacteria 803
320 Ga0157369_12455320 3300013105 Unclassified 528
321 Ga0157374_10175068 3300013296 Bacteria 2094
322 Ga0157374_10458172 3300013296 Bacteria 1277
323 Ga0157374_10491150 3300013296 Bacteria 1231
324 Ga0157374_10983492 3300013296 Bacteria 863
325 Ga0157378_10004712 3300013297 Bacteria 11959
326 Ga0157378_10179344 3300013297 Bacteria 1992
327 Ga0157378_10376892 3300013297 Bacteria 1392
328 Ga0157378_11334808 3300013297 Bacteria 759
329 Ga0163162_10005507 3300013306 Bacteria 12239
330 Ga0163162_10201780 3300013306 Bacteria 2117
331 Ga0163162_11793284 3300013306 Bacteria 701
332 Ga0163162_11821100 3300013306 Unclassified 696
333 Ga0163162_12488470 3300013306 Bacteria 595
334 Ga0157372_10722465 3300013307 Bacteria 1159
335 Ga0157375_10234330 3300013308 Bacteria 1995
336 Ga0157375_10540395 3300013308 Bacteria 1328
337 Ga0157375_10655271 3300013308 Unclassified 1206
338 Ga0157375_11554919 3300013308 Unclassified 781
339 Ga0163163_10263831 3300014325 Bacteria 1773
340 Ga0163163_10738138 3300014325 Bacteria 1048
341 Ga0157380_10025600 3300014326 Bacteria 4476
342 Ga0157380_10141442 3300014326 Unclassified 2068
343 Ga0157380_11062905 3300014326 Bacteria 846
344 Ga0157380_11130707 3300014326 Bacteria 824
345 Ga0157380_11343311 3300014326 Bacteria 763
346 Ga0157380_11825536 3300014326 Bacteria 667
347 Ga0182008_10172334 3300014497 Bacteria 1093
348 Ga0182008_10605403 3300014497 Bacteria 615
349 Ga0157377_10004589 3300014745 Bacteria 6382
350 Ga0157377_10037023 3300014745 Bacteria 2687
351 Ga0157377_10319413 3300014745 Bacteria 1031
352 Ga0157377_10397180 3300014745 Bacteria 938
353 Ga0157377_10782750 3300014745 Unclassified 701
354 Ga0157377_11062873 3300014745 Bacteria 617
355 Ga0157379_10101297 3300014968 Bacteria 2585
356 Ga0157379_10567811 3300014968 Bacteria 1057
357 Ga0157379_10914341 3300014968 Bacteria 833
358 Ga0157379_11483912 3300014968 Bacteria 659
359 Ga0157376_10195562 3300014969 Bacteria 1857
360 Ga0157376_10323551 3300014969 Bacteria 1467
361 Ga0157376_11042648 3300014969 Bacteria 842
362 Ga0157376_12870617 3300014969 Unclassified 521
363 Ga0163161_10177907 3300017792 Bacteria 1629
364 Ga0207656_10011064 3300025321 Bacteria 3399
365 Ga0207656_10464349 3300025321 Unclassified 640
366 Ga0207653_10001669 3300025885 Bacteria 7115
367 Ga0207692_10003480 3300025898 Bacteria 6153
368 Ga0207692_10164973 3300025898 Bacteria 1280
369 Ga0207642_10011346 3300025899 Bacteria 3174
370 Ga0207642_10488668 3300025899 Bacteria 752
371 Ga0207710_10005058 3300025900 Bacteria 5714
372 Ga0207710_10282202 3300025900 Bacteria 836
373 Ga0207688_10010940 3300025901 Bacteria 4937
374 Ga0207688_10026972 3300025901 Bacteria 3159
375 Ga0207688_10177738 3300025901 Bacteria 1268
376 Ga0207647_10031056 3300025904 Bacteria 3441
377 Ga0207647_10075408 3300025904 Bacteria 2030
378 Ga0207647_10193082 3300025904 Bacteria 1179
379 Ga0207647_10408605 3300025904 Bacteria 764
380 Ga0207645_10443085 3300025907 Bacteria 876
381 Ga0207643_10002088 3300025908 Bacteria 11006
382 Ga0207643_10005135 3300025908 Bacteria 7003
383 Ga0207643_10046922 3300025908 Bacteria 2442
384 Ga0207684_10000221 3300025910 Bacteria 87708
385 Ga0207684_10034243 3300025910 Bacteria 4317
386 Ga0207684_10259573 3300025910 Bacteria 1499
387 Ga0207654_10475632 3300025911 Bacteria 879
388 Ga0207693_10002613 3300025915 Bacteria 15647
389 Ga0207693_10011416 3300025915 Bacteria 7192
390 Ga0207693_10034709 3300025915 Bacteria 3978
391 Ga0207693_10185557 3300025915 Bacteria 1637
392 Ga0207693_10294814 3300025915 Bacteria 1271
393 Ga0207693_10607360 3300025915 Bacteria 851
394 Ga0207663_10010873 3300025916 Bacteria 4861
395 Ga0207663_10464508 3300025916 Bacteria 978
396 Ga0207663_11069062 3300025916 Unclassified 648
397 Ga0207660_10015411 3300025917 Bacteria 5044
398 Ga0207660_10657613 3300025917 Bacteria 854
399 Ga0207662_10018938 3300025918 Bacteria 3910
400 Ga0207662_10576610 3300025918 Bacteria 781
401 Ga0207657_10025802 3300025919 Bacteria 5412
402 Ga0207657_10067512 3300025919 Bacteria 3041
403 Ga0207649_10202552 3300025920 Bacteria 1403
404 Ga0207649_10280891 3300025920 Bacteria 1210
405 Ga0207649_10473698 3300025920 Bacteria 948
406 Ga0207652_10212966 3300025921 Bacteria 1740
407 Ga0207646_10004631 3300025922 Bacteria 14854
408 Ga0207646_10185660 3300025922 Bacteria 1878
409 Ga0207646_10398543 3300025922 Bacteria 1243
410 Ga0207646_10738101 3300025922 Bacteria 879
411 Ga0207650_10023167 3300025925 Bacteria 4403
412 Ga0207650_10045211 3300025925 Bacteria 3239
413 Ga0207650_10750071 3300025925 Bacteria 826
414 Ga0207659_10067135 3300025926 Bacteria 2605
415 Ga0207659_10448620 3300025926 Bacteria 1086
416 Ga0207659_11040329 3300025926 Bacteria 705
417 Ga0207687_10032206 3300025927 Bacteria 3549
418 Ga0207687_10072029 3300025927 Bacteria 2471
419 Ga0207687_10120279 3300025927 Bacteria 1963
420 Ga0207687_10202043 3300025927 Bacteria 1554
421 Ga0207687_10232817 3300025927 Bacteria 1456
422 Ga0207687_10379874 3300025927 Bacteria 1157
423 Ga0207687_10604053 3300025927 Bacteria 925
424 Ga0207687_11152570 3300025927 Bacteria 666
425 Ga0207687_11488249 3300025927 Unclassified 582
426 Ga0207700_10216674 3300025928 Bacteria 1621
427 Ga0207700_10270200 3300025928 Bacteria 1459
428 Ga0207700_10600136 3300025928 Bacteria 980
429 Ga0207664_10011571 3300025929 Bacteria 6282
430 Ga0207664_10564380 3300025929 Bacteria 1022
431 Ga0207664_10578017 3300025929 Bacteria 1009
432 Ga0207644_10311452 3300025931 Unclassified 1271
433 Ga0207644_10700074 3300025931 Bacteria 845
434 Ga0207644_10818342 3300025931 Bacteria 779
435 Ga0207690_10104757 3300025932 Bacteria 2027
436 Ga0207690_10198315 3300025932 Bacteria 1522
437 Ga0207690_10285803 3300025932 Bacteria 1286
438 Ga0207690_10442364 3300025932 Bacteria 1043
439 Ga0207690_10980249 3300025932 Bacteria 703
440 Ga0207706_10037083 3300025933 Bacteria 4329
441 Ga0207706_10399290 3300025933 Bacteria 1192
442 Ga0207686_10007592 3300025934 Bacteria 5842
443 Ga0207686_10229718 3300025934 Bacteria 1344
444 Ga0207686_10471918 3300025934 Bacteria 969
445 Ga0207686_10818529 3300025934 Bacteria 747
446 Ga0207709_10002377 3300025935 Bacteria 11868
447 Ga0207709_10106544 3300025935 Bacteria 1865
448 Ga0207709_10313048 3300025935 Bacteria 1172
449 Ga0207709_10488070 3300025935 Bacteria 959
450 Ga0207670_10017826 3300025936 Bacteria 4300
451 Ga0207670_10038535 3300025936 Bacteria 3123
452 Ga0207670_10115103 3300025936 Bacteria 1945
453 Ga0207670_11639789 3300025936 Bacteria 547
454 Ga0207669_10082283 3300025937 Bacteria 2066
455 Ga0207669_10224725 3300025937 Bacteria 1380
456 Ga0207704_10022125 3300025938 Bacteria 3400
457 Ga0207704_10163764 3300025938 Bacteria 1586
458 Ga0207691_10012079 3300025940 Bacteria 8282
459 Ga0207691_10350923 3300025940 Bacteria 1262
460 Ga0207711_10118660 3300025941 Bacteria 2360
461 Ga0207711_10206620 3300025941 Bacteria 1793
462 Ga0207711_10544796 3300025941 Bacteria 1082
463 Ga0207711_10959266 3300025941 Bacteria 794
464 Ga0207689_10024119 3300025942 Bacteria 5104
465 Ga0207689_10063355 3300025942 Bacteria 3042
466 Ga0207689_10169291 3300025942 Bacteria 1800
467 Ga0207689_10432260 3300025942 Bacteria 1099
468 Ga0207661_10032234 3300025944 Bacteria 4058
469 Ga0207661_10163071 3300025944 Bacteria 1935
470 Ga0207661_10287839 3300025944 Bacteria 1470
471 Ga0207661_10442349 3300025944 Bacteria 1183
472 Ga0207661_10513505 3300025944 Bacteria 1095
473 Ga0207661_11240526 3300025944 Bacteria 686
474 Ga0207679_10048806 3300025945 Bacteria 3084
475 Ga0207679_10103742 3300025945 Bacteria 2229
476 Ga0207679_10154960 3300025945 Bacteria 1869
477 Ga0207679_10185449 3300025945 Bacteria 1725
478 Ga0207667_10559100 3300025949 Bacteria 1156
479 Ga0207667_11821802 3300025949 Bacteria 572
480 Ga0207651_10263577 3300025960 Bacteria 1416
481 Ga0207651_10266872 3300025960 Bacteria 1408
482 Ga0207651_10338122 3300025960 Bacteria 1264
483 Ga0207712_10032732 3300025961 Bacteria 3511
484 Ga0207712_10037324 3300025961 Bacteria 3314
485 Ga0207712_10088490 3300025961 Bacteria 2274
486 Ga0207712_10516187 3300025961 Bacteria 1023
487 Ga0207712_11889811 3300025961 Bacteria 535
488 Ga0207712_11961828 3300025961 Bacteria 524
489 Ga0207668_10302377 3300025972 Bacteria 1321
490 Ga0207668_10363536 3300025972 Bacteria 1213
491 Ga0207668_10413093 3300025972 Bacteria 1144
492 Ga0207658_10414449 3300025986 Bacteria 1187
493 Ga0207677_10272599 3300026023 Bacteria 1385
494 Ga0207703_10059681 3300026035 Bacteria 3116
495 Ga0207703_10114999 3300026035 Bacteria 2301
496 Ga0207639_10023770 3300026041 Bacteria 4427
497 Ga0207639_10470421 3300026041 Bacteria 1144
498 Ga0207678_10007086 3300026067 Bacteria 9947
499 Ga0207678_10043858 3300026067 Bacteria 3869
500 Ga0207678_10126560 3300026067 Bacteria 2179
501 Ga0207678_10735579 3300026067 Bacteria 869
502 Ga0207678_11555841 3300026067 Bacteria 583
503 Ga0207708_10001783 3300026075 Bacteria 15882
504 Ga0207708_10011411 3300026075 Bacteria 6616
505 Ga0207708_10019504 3300026075 Bacteria 5113
506 Ga0207708_11030232 3300026075 Bacteria 716
507 Ga0207702_10062068 3300026078 Bacteria 3190
508 Ga0207702_10209821 3300026078 Bacteria 1810
509 Ga0207702_11848342 3300026078 Bacteria 596
510 Ga0207641_10441195 3300026088 Bacteria 1256
511 Ga0207641_10446731 3300026088 Bacteria 1249
512 Ga0207641_12163260 3300026088 Bacteria 557
513 Ga0207648_10002707 3300026089 Bacteria 18858
514 Ga0207648_10012528 3300026089 Bacteria 7936
515 Ga0207648_10024149 3300026089 Bacteria 5431
516 Ga0207648_10529525 3300026089 Bacteria 1080
517 Ga0207648_10835564 3300026089 Unclassified 859
518 Ga0207648_11843272 3300026089 Bacteria 566
519 Ga0207676_10001154 3300026095 Bacteria 19868
520 Ga0207676_10267394 3300026095 Bacteria 1547
521 Ga0207676_10367621 3300026095 Bacteria 1335
522 Ga0207676_10556431 3300026095 Bacteria 1096
523 Ga0207674_10000474 3300026116 Bacteria 52766
524 Ga0207674_10002131 3300026116 Bacteria 25008
525 Ga0207674_10012869 3300026116 Bacteria 9337
526 Ga0207674_10037497 3300026116 Bacteria 5041
527 Ga0207675_100036836 3300026118 Bacteria 4563
528 Ga0207675_100094356 3300026118 Bacteria 2815
529 Ga0207675_100621125 3300026118 Bacteria 1085
530 Ga0207675_100711041 3300026118 Bacteria 1014
531 Ga0207683_10000699 3300026121 Bacteria 30634
532 Ga0207683_10021066 3300026121 Bacteria 5579
533 Ga0207698_10112080 3300026142 Bacteria 2289
534 Ga0207698_11209321 3300026142 Bacteria 770
535 Ga0207428_10000597 3300027907 Bacteria 42692
536 Ga0207428_10000612 3300027907 Bacteria 42181
537 Ga0207428_10066471 3300027907 Bacteria 2841
538 Ga0207428_10089011 3300027907 Bacteria 2400
539 Ga0268266_11646311 3300028379 Bacteria 617
540 Ga0268265_10152651 3300028380 Bacteria 1950
541 Ga0268265_11237521 3300028380 Bacteria 745
542 Ga0268265_12282750 3300028380 Bacteria 548
543 Ga0268264_10068874 3300028381 Bacteria 2992
544 Ga0307405_10089568 3300031731 Bacteria 2033
545 Ga0307407_10241833 3300031903 Bacteria 1232
546 Ga0307412_10185058 3300031911 Bacteria 1570
547 Ga0307412_11177980 3300031911 Bacteria 685
548 Ga0307416_100028459 3300032002 Bacteria 4156
549 Ga0307416_100041206 3300032002 Bacteria 3594
550 Ga0307415_100006911 3300032126 Bacteria 6162
551 Ga0373948_0161398 3300034817 Bacteria 566
552 Ga0373938_0111988 3300034957 Bacteria 696
553 Ga0373928_0130745 3300035084 Bacteria 681
554 Ga0373944_0368160 3300035089 Unclassified 549
555 Ga0373951_0035340 3300035091 Bacteria 1190
556 Ga0373951_0288988 3300035091 Bacteria 503
557 Ga0373952_0087683 3300035092 Bacteria 804
558 Ga0373932_0058294 3300035112 Bacteria 1167
559 Ga0373939_0162653 3300035114 Bacteria 821
560 Ga0373941_0067724 3300035115 Bacteria 1178
561 Ga0373960_0037178 3300035121 Bacteria 1390
562 Ga0373942_0269420 3300035207 Bacteria 584
563 Ga0373961_0133670 3300035241 Bacteria 833
564 Ga0373962_0038836 3300035242 Bacteria 1334
565 Ga0373947_0402726 3300035725 Bacteria 923
566 Ga0373947_0787417 3300035725 Unclassified 649
567 Ga0395899_0003576 3300037312 Bacteria 12306
568 Ga0395899_0005616 3300037312 Bacteria 9733
569 Ga0395899_0020638 3300037312 Bacteria 4994
570 Ga0395899_0024678 3300037312 Bacteria 4544
571 Ga0395899_0225812 3300037312 Bacteria 1295
572 Ga0395899_0334085 3300037312 Bacteria 1018
573 Ga0395900_0002509 3300037418 Bacteria 20165
574 Ga0395900_0003754 3300037418 Bacteria 16317
575 Ga0395900_0003775 3300037418 Bacteria 16230
576 Ga0395900_0006012 3300037418 Bacteria 12662
577 Ga0395900_0011358 3300037418 Bacteria 9111
578 Ga0395900_0020004 3300037418 Bacteria 6824
579 Ga0395900_0025384 3300037418 Bacteria 6067
580 Ga0395900_0031122 3300037418 Bacteria 5482
581 Ga0395900_0044769 3300037418 Bacteria 4559
582 Ga0395900_0209549 3300037418 Bacteria 1968
583 Ga0395900_0235300 3300037418 Bacteria 1840
584 Ga0395900_0489151 3300037418 Bacteria 1182
585 Ga0395900_0585106 3300037418 Bacteria 1058
586 Ga0395900_1262029 3300037418 Bacteria 653
587 Ga0395900_1367117 3300037418 Bacteria 621
588 Ga0395898_0008185 3300037466 Bacteria 11064
589 Ga0395898_0010957 3300037466 Bacteria 9454
590 Ga0395898_0027496 3300037466 Bacteria 5709
591 Ga0395898_0031515 3300037466 Bacteria 5296
592 Ga0395898_0091366 3300037466 Bacteria 2929
593 Ga0395898_0104246 3300037466 Unclassified 2720
594 Ga0395898_0192447 3300037466 Bacteria 1949
595 Ga0395898_0364212 3300037466 Bacteria 1378
596 Ga0395898_0383795 3300037466 Bacteria 1340
597 Ga0395898_0575775 3300037466 Bacteria 1068
598 Ga0395905_0014012 3300037471 Bacteria 7667
599 Ga0395905_0017698 3300037471 Bacteria 6766
600 Ga0395905_0020103 3300037471 Bacteria 6326
601 Ga0395905_0021749 3300037471 Bacteria 6067
602 Ga0395905_0024628 3300037471 Bacteria 5678
603 Ga0395905_0073888 3300037471 Bacteria 3196
604 Ga0395905_0520628 3300037471 Bacteria 1090
605 Ga0395905_1167395 3300037471 Bacteria 673
606 Ga0395905_1246160 3300037471 Bacteria 647
607 Ga0395901_0004795 3300038443 Bacteria 13643
608 Ga0395901_0014998 3300038443 Bacteria 7876
609 Ga0395901_0017966 3300038443 Bacteria 7218
610 Ga0395901_0019865 3300038443 Bacteria 6872
611 Ga0395901_0027705 3300038443 Bacteria 5825
612 Ga0395901_0031459 3300038443 Bacteria 5472
613 Ga0395901_0031768 3300038443 Bacteria 5444
614 Ga0395901_0036290 3300038443 Bacteria 5094
615 Ga0395901_0054431 3300038443 Bacteria 4159
616 Ga0395901_0087819 3300038443 Bacteria 3251
617 Ga0395901_0127656 3300038443 Bacteria 2673
618 Ga0395901_0246330 3300038443 Bacteria 1863
619 Ga0395901_0262734 3300038443 Bacteria 1796
620 Ga0395901_0386844 3300038443 Bacteria 1439
621 Ga0395901_0582458 3300038443 Bacteria 1130
622 Ga0395901_1440121 3300038443 Bacteria 646
623 Ga0451849_1075940 3300041505 Bacteria 757
624 Ga0451853_1930551 3300041512 Bacteria 532
625 Ga0439443_016560 3300042003 Bacteria 1127
626 Ga0439448_0021437 3300042005 Bacteria 2003
627 Ga0439450_071670 3300042008 Bacteria 851
628 Ga0450920_009120 3300042122 Bacteria 1824
629 Ga0450920_058579 3300042122 Bacteria 777
630 Ga0450906_015742 3300042145 Bacteria 1373
631 Ga0450906_110120 3300042145 Bacteria 505
632 Ga0450907_013730 3300042146 Bacteria 1350
633 Ga0439460_0017901 3300042461 Bacteria 1903
634 Ga0439440_0024431 3300042993 Bacteria 1385
635 Ga0466969_0067182 3300044656 Bacteria 1730
636 Ga0466965_0036296 3300044683 Bacteria 2418
637 Ga0466965_0345930 3300044683 Bacteria 814
638 Ga0466966_0011436 3300044684 Bacteria 5887
639 Ga0466966_0044418 3300044684 Bacteria 2845
640 Ga0466966_0184826 3300044684 Bacteria 1264
641 Ga0466961_0004553 3300044693 Bacteria 8695
642 Ga0466961_0037677 3300044693 Bacteria 3102
643 Ga0466961_0044985 3300044693 Bacteria 2825
644 Ga0466963_0094222 3300044694 Bacteria 2042
645 Ga0466963_0175132 3300044694 Bacteria 1496
646 Ga0466964_0057224 3300044706 Bacteria 1614
647 Ga0466964_0121569 3300044706 Bacteria 1178
648 Ga0466964_0133093 3300044706 Bacteria 1135
649 Ga0466971_0000452 3300044719 Bacteria 16030
650 Ga0466968_0016592 3300044735 Bacteria 2934
651 Ga0466957_0000958 3300044842 Bacteria 14798
652 Ga0466957_0246332 3300044842 Bacteria 1187
653 Ga0466957_0934443 3300044842 Bacteria 621
654 Ga0466960_0359287 3300044901 Bacteria 832
655 Ga0466959_0000902 3300045049 Bacteria 17530
656 Ga0466959_0080834 3300045049 Bacteria 2342
657 Ga0466959_0135158 3300045049 Bacteria 1746
658 Ga0451576_0584423 3300045051 Bacteria 1174
659 Ga0451576_1375856 3300045051 Bacteria 735
660 Ga0466958_0034865 3300045836 Bacteria 3004
661 Ga0466958_0084621 3300045836 Bacteria 1956
662 Ga0466958_0092580 3300045836 Bacteria 1871
663 Ga0466958_0154390 3300045836 Bacteria 1448
664 Ga0466967_0000142 3300045976 Bacteria 27844
665 Ga0466967_0014924 3300045976 Bacteria 6074
666 Ga0466967_0082101 3300045976 Bacteria 2912
667 Ga0466967_0111152 3300045976 Bacteria 2518
668 Ga0466967_0201087 3300045976 Bacteria 1887
669 Ga0466967_0263629 3300045976 Bacteria 1649
670 Ga0466967_0501610 3300045976 Bacteria 1191
671 Ga0466967_0661874 3300045976 Bacteria 1033
672 Ga0495617_173736 3300046452 Bacteria 680
673 Ga0495592_0127989 3300046454 Bacteria 1779
674 Ga0495592_0172142 3300046454 Bacteria 1482
675 Ga0495592_0605910 3300046454 Bacteria 667
676 Ga0495603_0014627 3300046455 Bacteria 4744
677 Ga0495603_0039194 3300046455 Bacteria 2840
678 Ga0495603_0574502 3300046455 Unclassified 645
679 Ga0495629_0094156 3300046459 Bacteria 2090
680 Ga0495629_0161708 3300046459 Bacteria 1555
681 Ga0495641_0055750 3300046461 Bacteria 1793
682 Ga0495641_0211658 3300046461 Bacteria 869
683 Ga0495651_0005992 3300046462 Bacteria 9277
684 Ga0495651_0311671 3300046462 Bacteria 1052
685 Ga0495653_0130012 3300046463 Bacteria 1784
686 Ga0495653_0391872 3300046463 Bacteria 885
687 Ga0495580_0285974 3300046472 Bacteria 1124
688 Ga0495580_0988039 3300046472 Bacteria 537
689 Ga0495582_0107285 3300046473 Bacteria 1567
690 Ga0495582_0274367 3300046473 Bacteria 968
691 Ga0495605_0297518 3300046474 Bacteria 683
692 Ga0495639_0138250 3300046475 Bacteria 1170
693 Ga0495639_0649754 3300046475 Unclassified 544
694 Ga0495662_0122826 3300046476 Bacteria 1275
695 Ga0495662_0236512 3300046476 Unclassified 900
696 Ga0495664_0006619 3300046477 Bacteria 6408
697 Ga0495584_0013798 3300046491 Bacteria 4119
698 Ga0495584_0048320 3300046491 Bacteria 2145
699 Ga0495584_0330213 3300046491 Bacteria 774
700 Ga0495584_0335132 3300046491 Bacteria 768
701 Ga0495584_0434421 3300046491 Bacteria 668
702 Ga0495585_0074859 3300046492 Bacteria 1842
703 Ga0495585_0146263 3300046492 Bacteria 1235
704 Ga0495585_0245988 3300046492 Bacteria 894
705 Ga0495585_0420552 3300046492 Bacteria 642
706 Ga0495594_0511504 3300046499 Unclassified 682
707 Ga0495596_0083610 3300046500 Bacteria 1239
708 Ga0495596_0217884 3300046500 Bacteria 741
709 Ga0495607_0224132 3300046501 Bacteria 918
710 Ga0495583_0195840 3300046506 Bacteria 823
711 Ga0495608_0046272 3300046511 Bacteria 2896
712 Ga0495608_0180345 3300046511 Bacteria 1336
713 Ga0495618_0433444 3300046514 Bacteria 800
714 Ga0495618_0672433 3300046514 Bacteria 611
715 Ga0495620_0047100 3300046515 Bacteria 1858
716 Ga0495628_0075440 3300046516 Bacteria 2626
717 Ga0495628_0657180 3300046516 Bacteria 744
718 Ga0495630_0010704 3300046517 Bacteria 6624
719 Ga0495630_1085894 3300046517 Unclassified 607
720 Ga0495631_0156102 3300046518 Bacteria 979
721 Ga0495637_0072574 3300046520 Bacteria 1386
722 Ga0495644_0102583 3300046523 Bacteria 1083
723 Ga0495663_0011429 3300046525 Bacteria 2471
724 Ga0495663_0041467 3300046525 Bacteria 1400
725 Ga0495663_0070572 3300046525 Bacteria 1112
726 Ga0495642_0023025 3300046528 Bacteria 2458
727 Ga0495642_0056089 3300046528 Bacteria 1627
728 Ga0495652_0035321 3300046529 Bacteria 4351
729 Ga0495652_0110752 3300046529 Bacteria 2208
730 Ga0495652_0129156 3300046529 Bacteria 2003
731 Ga0495652_0186799 3300046529 Bacteria 1585
732 Ga0495652_0403108 3300046529 Bacteria 968
733 Ga0495652_0476426 3300046529 Bacteria 869
734 Ga0495665_0150471 3300046531 Bacteria 1215
735 Ga0495640_0045573 3300046533 Bacteria 3042
736 Ga0495587_0045090 3300046536 Bacteria 2622
737 Ga0495587_0100727 3300046536 Bacteria 1665
738 Ga0495587_0101219 3300046536 Bacteria 1660
739 Ga0495609_0043616 3300046538 Bacteria 2014
740 Ga0495609_0054158 3300046538 Unclassified 1782
741 Ga0495621_0060833 3300046539 Bacteria 1371
742 Ga0495645_0340194 3300046543 Bacteria 969
743 Ga0495633_0110125 3300046558 Bacteria 1277
744 Ga0495633_0426512 3300046558 Bacteria 599
745 Ga0495667_0005465 3300046559 Bacteria 8585
746 Ga0495667_0406283 3300046559 Bacteria 858
747 Ga0495656_0104993 3300046615 Bacteria 1313
748 Ga0495656_0330394 3300046615 Unclassified 787
749 Ga0495656_0377606 3300046615 Bacteria 738
750 Ga0495656_0450022 3300046615 Bacteria 678
751 Ga0495656_0815039 3300046615 Unclassified 505
752 Ga0495668_0104482 3300046616 Bacteria 1550
753 Ga0495634_0012463 3300046642 Bacteria 6152
754 Ga0495634_0020500 3300046642 Bacteria 4688
755 Ga0495611_0034649 3300046648 Bacteria 2233
756 Ga0495611_0089792 3300046648 Bacteria 1420
757 Ga0495635_0106627 3300046663 Bacteria 1914
758 Ga0495659_0023816 3300046664 Bacteria 2083
759 Ga0495659_0145953 3300046664 Bacteria 947
760 Ga0495659_0271383 3300046664 Unclassified 711
761 Ga0495659_0538171 3300046664 Bacteria 514
762 Ga0495661_0371786 3300046665 Bacteria 700
763 Ga0495588_0283207 3300046674 Bacteria 873
764 Ga0495588_0290126 3300046674 Bacteria 862
765 Ga0495657_0013412 3300046675 Bacteria 6050
766 Ga0495599_0154472 3300046678 Bacteria 1420
767 Ga0495599_0224241 3300046678 Bacteria 1149
768 Ga0495646_0234523 3300046680 Bacteria 988
769 Ga0495647_0021653 3300046681 Bacteria 2316
770 Ga0495658_0948368 3300046683 Bacteria 550
771 Ga0495613_0173792 3300046689 Bacteria 1528
772 Ga0495613_0238465 3300046689 Bacteria 1272
773 Ga0495624_0183391 3300046690 Bacteria 1275
774 Ga0495624_0256094 3300046690 Bacteria 1058
775 Ga0495670_0640964 3300046691 Unclassified 579
776 Ga0495671_0108319 3300046692 Bacteria 1357
777 Ga0495671_0282953 3300046692 Bacteria 799
778 Ga0495589_0212575 3300046794 Bacteria 910
779 Ga0495589_0217321 3300046794 Unclassified 899
780 Ga0495589_0217617 3300046794 Bacteria 898
781 Ga0495660_0308475 3300046810 Bacteria 715
782 Ga0495581_0001437 3300047315 Bacteria 13221
783 Ga0495604_0254207 3300047317 Archaea 1197
784 Ga0495636_0247876 3300047318 Bacteria 823
785 Ga0495636_0371607 3300047318 Bacteria 677
786 Ga0495674_0001759 3300047319 Bacteria 21327
787 Ga0495674_0014529 3300047319 Bacteria 7368
788 Ga0495676_0016250 3300047321 Bacteria 6609
789 Ga0495676_0099145 3300047321 Bacteria 2160
790 Ga0495676_0331094 3300047321 Bacteria 1021
791 Ga0495680_0004490 3300047322 Bacteria 13338
792 Ga0495680_0134885 3300047322 Bacteria 1811
793 Ga0495683_0081310 3300047323 Bacteria 1580
794 Ga0495675_0617487 3300047444 Bacteria 613
795 Ga0495685_075380 3300047447 Bacteria 1127
796 Ga0495684_0012761 3300047471 Bacteria 6485
797 Ga0495684_0031156 3300047471 Bacteria 4094
798 Ga0495602_0056568 3300048088 Bacteria 3448
799 Ga0495602_0118922 3300048088 Bacteria 2130
800 Ga0495602_0606539 3300048088 Bacteria 752
801 Ga0495626_0233957 3300048091 Bacteria 742
802 Ga0496100_0020900 3300048903 Bacteria 3933
803 Ga0496100_0025820 3300048903 Bacteria 3595
804 Ga0496100_0124230 3300048903 Bacteria 1810
805 Ga0496100_0153973 3300048903 Bacteria 1642
806 Ga0496100_0215911 3300048903 Bacteria 1405
807 Ga0496100_0245633 3300048903 Bacteria 1322
808 Ga0496100_0742605 3300048903 Unclassified 767
809 Ga0496101_0001238 3300048904 Bacteria 15269
810 Ga0496101_0006620 3300048904 Bacteria 7465
811 Ga0496101_0039764 3300048904 Bacteria 3346
812 Ga0496101_0056633 3300048904 Bacteria 2834
813 Ga0496101_0116970 3300048904 Bacteria 2012
814 Ga0496101_0246479 3300048904 Bacteria 1391
815 Ga0496101_0486173 3300048904 Bacteria 975
816 Ga0496101_0605690 3300048904 Bacteria 866
817 Ga0496101_1235124 3300048904 Bacteria 585
818 Ga0496102_0011268 3300048905 Bacteria 7704
819 Ga0496102_0021057 3300048905 Bacteria 5766
820 Ga0496102_0189247 3300048905 Bacteria 1939
821 Ga0496102_0471145 3300048905 Bacteria 1177
822 Ga0496103_0010249 3300048906 Bacteria 5543
823 Ga0496103_0065969 3300048906 Bacteria 2259
824 Ga0496103_0086272 3300048906 Bacteria 1979
825 Ga0496103_0304712 3300048906 Bacteria 1025
826 Ga0496103_0854503 3300048906 Bacteria 572
827 Ga0496104_0023003 3300048907 Bacteria 5728
828 Ga0496104_0049875 3300048907 Bacteria 3948
829 Ga0496104_0060932 3300048907 Bacteria 3575
830 Ga0496104_0085119 3300048907 Bacteria 3018
831 Ga0496104_0156791 3300048907 Bacteria 2184
832 Ga0496104_0208489 3300048907 Bacteria 1866
833 Ga0496104_0432369 3300048907 Bacteria 1228
834 Ga0496104_1692141 3300048907 Bacteria 535
835 Ga0496105_0019124 3300048908 Bacteria 5521
836 Ga0496105_0055464 3300048908 Bacteria 3272
837 Ga0496105_0066335 3300048908 Bacteria 2979
838 Ga0496105_0074201 3300048908 Bacteria 2810
839 Ga0496105_0140198 3300048908 Bacteria 1990
840 Ga0496105_0477793 3300048908 Bacteria 981
841 Ga0496106_0047257 3300048909 Bacteria 3239
842 Ga0496106_0125317 3300048909 Bacteria 2010
843 Ga0496106_0213534 3300048909 Bacteria 1537
844 Ga0496106_0367567 3300048909 Bacteria 1156
845 Ga0496106_0803852 3300048909 Bacteria 746
846 Ga0496107_0003998 3300048910 Bacteria 9928
847 Ga0496107_0017318 3300048910 Bacteria 5067
848 Ga0496107_0025181 3300048910 Bacteria 4210
849 Ga0496107_0038996 3300048910 Bacteria 3408
850 Ga0496108_0012078 3300048911 Bacteria 7023
851 Ga0496108_0037636 3300048911 Bacteria 4031
852 Ga0496108_0057536 3300048911 Bacteria 3267
853 Ga0496108_0061648 3300048911 Bacteria 3156
854 Ga0496108_0072694 3300048911 Bacteria 2903
855 Ga0496108_0113713 3300048911 Bacteria 2317
856 Ga0496108_0155986 3300048911 Bacteria 1971
857 Ga0496108_0197021 3300048911 Bacteria 1747
858 Ga0496109_0002264 3300048912 Bacteria 15994
859 Ga0496109_0021245 3300048912 Bacteria 5739
860 Ga0496109_0032706 3300048912 Bacteria 4677
861 Ga0496109_0038096 3300048912 Bacteria 4345
862 Ga0496109_0043225 3300048912 Bacteria 4084
863 Ga0496109_0177711 3300048912 Bacteria 1998
864 Ga0496109_0277415 3300048912 Bacteria 1579
865 Ga0496109_0289482 3300048912 Bacteria 1544
866 Ga0496109_1884196 3300048912 Bacteria 530
867 Ga0496109_1904458 3300048912 Bacteria 527
868 Ga0496110_0015243 3300048913 Bacteria 6392
869 Ga0496110_0018263 3300048913 Bacteria 5879
870 Ga0496110_0036616 3300048913 Bacteria 4261
871 Ga0496110_0038011 3300048913 Bacteria 4186
872 Ga0496110_0153191 3300048913 Bacteria 2088
873 Ga0496110_0182804 3300048913 Bacteria 1904
874 Ga0496110_0225600 3300048913 Bacteria 1703
875 Ga0496111_0001469 3300048914 Bacteria 13485
876 Ga0496111_0022743 3300048914 Bacteria 4392
877 Ga0496111_0203192 3300048914 Bacteria 1473
878 Ga0496111_0289112 3300048914 Bacteria 1215
879 Ga0496111_0440531 3300048914 Bacteria 962
880 Ga0496111_0590905 3300048914 Bacteria 813
881 Ga0496112_0037870 3300048915 Bacteria 4709
882 Ga0496112_0048819 3300048915 Bacteria 4147
883 Ga0496112_0903943 3300048915 Bacteria 805
884 Ga0496112_0908541 3300048915 Bacteria 802
885 Ga0496113_0016652 3300048916 Bacteria 5082
886 Ga0496113_0102528 3300048916 Bacteria 2219
887 Ga0496113_0152345 3300048916 Bacteria 1825
888 Ga0496113_0309601 3300048916 Bacteria 1265
889 Ga0496113_0409871 3300048916 Bacteria 1088
890 Ga0496113_0775558 3300048916 Bacteria 762
891 Ga0496114_0001682 3300048917 Bacteria 16779
892 Ga0496114_0003284 3300048917 Bacteria 12414
893 Ga0496114_0014618 3300048917 Bacteria 6306
894 Ga0496114_0033628 3300048917 Bacteria 4225
895 Ga0496114_0156454 3300048917 Bacteria 1979
896 Ga0496114_0176375 3300048917 Bacteria 1865
897 Ga0496114_0243907 3300048917 Bacteria 1580
898 Ga0496114_0319927 3300048917 Bacteria 1371
899 Ga0496114_0361246 3300048917 Bacteria 1284
900 Ga0496114_0438352 3300048917 Bacteria 1157
901 Ga0496114_1669636 3300048917 Bacteria 525
902 Ga0496115_0007909 3300048918 Bacteria 7843
903 Ga0496115_0025154 3300048918 Bacteria 4633
904 Ga0496115_0077306 3300048918 Bacteria 2706
905 Ga0496115_0384849 3300048918 Bacteria 1140
906 Ga0496115_0425118 3300048918 Bacteria 1076
907 Ga0496115_0679169 3300048918 Unclassified 811
908 Ga0501031_0003942 3300049568 Bacteria 9557
909 Ga0501031_0010352 3300049568 Bacteria 6075
910 Ga0501031_0017160 3300049568 Bacteria 4704
911 Ga0501031_0104696 3300049568 Bacteria 1846
912 Ga0501032_0009499 3300049569 Bacteria 7048
913 Ga0501032_0067535 3300049569 Bacteria 2388
914 Ga0501032_0715991 3300049569 Bacteria 634
915 Ga0501033_0002792 3300049570 Bacteria 14638
916 Ga0501033_0019169 3300049570 Bacteria 5173
917 Ga0501033_0022135 3300049570 Bacteria 4796
918 Ga0501033_0271976 3300049570 Bacteria 1197
919 Ga0501034_0308270 3300049571 Bacteria 1518
920 Ga0501034_0331298 3300049571 Bacteria 1454
921 Ga0501036_0002911 3300049572 Bacteria 13584
922 Ga0501036_0004301 3300049572 Bacteria 11503
923 Ga0501036_0023454 3300049572 Bacteria 5199
924 Ga0501036_0025742 3300049572 Bacteria 4965
925 Ga0501037_0015949 3300049573 Bacteria 5530
926 Ga0501037_0017091 3300049573 Bacteria 5338
927 Ga0501037_0068516 3300049573 Bacteria 2583
928 Ga0501038_0016158 3300049574 Bacteria 6771
929 Ga0501038_0030196 3300049574 Bacteria 4798
930 Ga0501038_0031091 3300049574 Bacteria 4720
931 Ga0501039_0005424 3300049575 Bacteria 9641
932 Ga0501039_0031596 3300049575 Bacteria 4082
933 Ga0501039_0037989 3300049575 Bacteria 3718
934 Ga0501039_0621323 3300049575 Bacteria 846
935 Ga0501040_0008288 3300049576 Bacteria 6760
936 Ga0501040_0008921 3300049576 Bacteria 6522
937 Ga0501040_0054609 3300049576 Bacteria 2738
938 Ga0501040_0085324 3300049576 Bacteria 2191
939 Ga0501040_0437399 3300049576 Bacteria 941
940 Ga0501040_1041498 3300049576 Bacteria 593
941 Ga0501041_0006011 3300049577 Bacteria 7101
942 Ga0501041_0008515 3300049577 Bacteria 6037
943 Ga0501041_0028061 3300049577 Bacteria 3394
944 Ga0501041_0030363 3300049577 Bacteria 3261
945 Ga0501041_0075454 3300049577 Bacteria 2073
946 Ga0501041_0651929 3300049577 Bacteria 673
947 Ga0501042_0003550 3300049578 Bacteria 9815
948 Ga0501042_0012945 3300049578 Bacteria 5666
949 Ga0501042_0037872 3300049578 Bacteria 3423
950 Ga0501042_0886850 3300049578 Bacteria 649
951 Ga0501043_0027956 3300049579 Bacteria 4427
952 Ga0501043_0034990 3300049579 Bacteria 3950
953 Ga0501043_0074284 3300049579 Bacteria 2670
954 Ga0501043_0269576 3300049579 Bacteria 1307
955 Ga0501046_0005418 3300049580 Bacteria 11404
956 Ga0501046_0006355 3300049580 Bacteria 10477
957 Ga0501046_0016160 3300049580 Bacteria 6258
958 Ga0501047_0084848 3300049581 Bacteria 3044
959 Ga0501047_0489418 3300049581 Bacteria 1057
960 Ga0501048_0010744 3300049582 Bacteria 6827
961 Ga0501048_0044270 3300049582 Bacteria 3183
962 Ga0501048_0061804 3300049582 Bacteria 2651
963 Ga0501067_0000723 3300049583 Bacteria 17781
964 Ga0501067_0025932 3300049583 Bacteria 3248
965 Ga0501067_0082087 3300049583 Bacteria 1787
966 Ga0501068_0003171 3300049584 Bacteria 8803
967 Ga0501068_0004263 3300049584 Bacteria 7764
968 Ga0501068_0005313 3300049584 Bacteria 7037
969 Ga0501068_0012067 3300049584 Bacteria 4890
970 Ga0501068_0312893 3300049584 Bacteria 1006
971 Ga0501069_0003377 3300049585 Bacteria 8191
972 Ga0501069_0074044 3300049585 Bacteria 1910
973 Ga0501069_0198357 3300049585 Bacteria 1162
974 Ga0501069_0273745 3300049585 Bacteria 987
975 Ga0501069_0344213 3300049585 Bacteria 878
976 Ga0501070_0003251 3300049586 Bacteria 14104
977 Ga0501070_0128405 3300049586 Bacteria 2095
978 Ga0501070_0131948 3300049586 Bacteria 2063
979 Ga0501071_0002637 3300049587 Bacteria 10978
980 Ga0501071_0008478 3300049587 Bacteria 6797
981 Ga0501071_0011103 3300049587 Bacteria 6054
982 Ga0501071_0034242 3300049587 Bacteria 3613
983 Ga0501071_0090807 3300049587 Bacteria 2243
984 Ga0501072_0001947 3300049588 Bacteria 15381
985 Ga0501072_0022731 3300049588 Bacteria 4865
986 Ga0501072_0022807 3300049588 Bacteria 4857
987 Ga0501072_0028314 3300049588 Bacteria 4374
988 Ga0501072_0127626 3300049588 Bacteria 2026
989 Ga0501073_0016904 3300049589 Bacteria 5283
990 Ga0501073_0023276 3300049589 Bacteria 4450
991 Ga0501074_0013222 3300049590 Bacteria 6001
992 Ga0501074_0020299 3300049590 Bacteria 4828
993 Ga0501074_0029295 3300049590 Bacteria 3988
994 Ga0501074_1008096 3300049590 Bacteria 585
995 Ga0501075_0030898 3300049591 Bacteria 3971
996 Ga0501075_0047023 3300049591 Bacteria 3242
997 Ga0501075_0143708 3300049591 Bacteria 1818
998 Ga0501075_0157933 3300049591 Bacteria 1729
999 Ga0501075_0907903 3300049591 Unclassified 670
1000 Ga0501076_0002533 3300049592 Bacteria 12573
1001 Ga0501076_0024282 3300049592 Bacteria 4683
1002 Ga0501076_0089336 3300049592 Bacteria 2476
1003 Ga0501076_0163553 3300049592 Bacteria 1813
1004 Ga0501076_0589976 3300049592 Bacteria 916
1005 Ga0501077_0002613 3300049593 Bacteria 10786
1006 Ga0501077_0020436 3300049593 Bacteria 4191
1007 Ga0501077_0030214 3300049593 Bacteria 3447
1008 Ga0501077_0298122 3300049593 Bacteria 1027
1009 Ga0501077_0539274 3300049593 Bacteria 748
1010 Ga0501079_0003011 3300049741 Bacteria 12323
1011 Ga0501079_0004898 3300049741 Bacteria 9923
1012 Ga0501079_0037053 3300049741 Bacteria 3757
1013 Ga0501079_0661213 3300049741 Bacteria 822
1014 Ga0501080_0006559 3300049742 Bacteria 10460
1015 Ga0501080_0055563 3300049742 Bacteria 3688
1016 Ga0501080_0084119 3300049742 Bacteria 2956
1017 Ga0501080_0149099 3300049742 Bacteria 2162
1018 Ga0501081_0003248 3300049743 Bacteria 10349
1019 Ga0501081_0008667 3300049743 Bacteria 6607
1020 Ga0501081_0009207 3300049743 Bacteria 6431
1021 Ga0501081_0028566 3300049743 Bacteria 3764
1022 Ga0501081_0516528 3300049743 Bacteria 891
1023 Ga0501083_0006107 3300049744 Bacteria 8538
1024 Ga0501083_0017440 3300049744 Bacteria 5004
1025 Ga0501083_0059737 3300049744 Bacteria 2549
1026 Ga0501035_0033143 3300049822 Bacteria 4698
1027 Ga0501035_0044775 3300049822 Bacteria 3983
1028 Ga0501035_0098605 3300049822 Bacteria 2565
1029 Ga0501035_0222690 3300049822 Bacteria 1610
1030 Ga0501044_0042478 3300049823 Bacteria 4728
1031 Ga0501044_0157716 3300049823 Bacteria 2248
1032 Ga0501045_0004481 3300049824 Bacteria 9648
1033 Ga0501045_0012686 3300049824 Bacteria 5933
1034 Ga0501045_0013202 3300049824 Bacteria 5826
1035 Ga0501045_0041391 3300049824 Bacteria 3352
1036 Ga0501212_072943 3300049851 Bacteria 610
1037 nmdc:mga0yw44_19648_c1 3300050492 Bacteria 3730
1038 nmdc:mga0yw44_94113_c1 3300050492 Bacteria 1898
1039 nmdc:mga05p37_134912_c1 3300050507 Bacteria 3028
1040 nmdc:mga05p37_223309_c1 3300050507 Bacteria 2273
1041 nmdc:mga05p37_260641_c1 3300050507 Bacteria 2075
1042 nmdc:mga05p37_37438_c1 3300050507 Bacteria 5947
1043 nmdc:mga05p37_4582_c1 3300050507 Bacteria 16162
1044 nmdc:mga05p37_70019_c1 3300050507 Bacteria 4315
1045 nmdc:mga05p37_97110_c1 3300050507 Bacteria 3630
1046 nmdc:mga09592_111660_c1 3300050508 Bacteria 2345
1047 nmdc:mga09592_144158_c1 3300050508 Bacteria 2054
1048 nmdc:mga09592_48952_c1 3300050508 Bacteria 3563
1049 nmdc:mga0qj67_375781_c1 3300050509 Bacteria 1148
1050 nmdc:mga0qj67_4158_c1 3300050509 Bacteria 10490
1051 nmdc:mga06r32_213841_c1 3300050510 Bacteria 1916
1052 nmdc:mga06r32_30480_c1 3300050510 Bacteria 5061
1053 nmdc:mga08y16_126060_c1 3300050511 Bacteria 2664
1054 nmdc:mga08y16_17248_c1 3300050511 Bacteria 7601
1055 nmdc:mga08y16_443118_c1 3300050511 Bacteria 1325
1056 nmdc:mga08y16_60836_c1 3300050511 Bacteria 3944
1057 nmdc:mga08y16_65593_c1 3300050511 Bacteria 3790
1058 nmdc:mga0n895_14265_c1 3300050512 Bacteria 7210
1059 nmdc:mga0n895_1688258_c1 3300050512 Bacteria 596
1060 nmdc:mga0rr50_1847713_c1 3300050513 Bacteria 508
1061 nmdc:mga0rr50_203522_c1 3300050513 Bacteria 1628
1062 nmdc:mga08x19_151142_c1 3300050514 Bacteria 1572
1063 nmdc:mga0a205_193435_c1 3300050515 Bacteria 1926
1064 nmdc:mga0a205_24400_c1 3300050515 Bacteria 5750
1065 nmdc:mga0a205_265860_c1 3300050515 Bacteria 1592
1066 nmdc:mga0a205_51265_c1 3300050515 Bacteria 3984
1067 nmdc:mga0a205_695225_c1 3300050515 Bacteria 867
1068 Ga0495612_0039540 3300053078 Bacteria 1919
1069 Ga0495655_0179386 3300053083 Unclassified 682
1070 Ga0495619_0007565 3300053085 Bacteria 6878
1071 Ga0495619_0017932 3300053085 Bacteria 4488
1072 Ga0495619_0111441 3300053085 Bacteria 1870
1073 Ga0501084_0009530 3300054114 Bacteria 8036
1074 Ga0501084_0040993 3300054114 Bacteria 3873
1075 Ga0501084_0064556 3300054114 Bacteria 3063
1076 Ga0501084_0186756 3300054114 Bacteria 1749
1077 Ga0501084_0556022 3300054114 Bacteria 969
1078 Ga0501084_0880737 3300054114 Bacteria 753
1079 Ga0501082_0006790 3300060353 Bacteria 9890
1080 Ga0501082_0025916 3300060353 Bacteria 5053
1081 Ga0501082_0046122 3300060353 Bacteria 3757
1082 Ga0501082_0148669 3300060353 Bacteria 2034
1083 Ga0501082_0182839 3300060353 Bacteria 1823
1084 Ga0466962_0001047 3300061719 Bacteria 12699
1085 Ga0466962_0026892 3300061719 Bacteria 2762
1086 Ga0530510_0003120 3300061734 Bacteria 11372
1087 Ga0530510_0009782 3300061734 Bacteria 6728
1088 Ga0530510_0069435 3300061734 Bacteria 2557
1089 Ga0530510_0288108 3300061734 Bacteria 1227
1090 Ga0530510_0768076 3300061734 Bacteria 735
1091 Ga0530510_1355551 3300061734 Bacteria 546

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100900398 Ga0070678_1009003981 117
2 3300046491 Ga0495584_0013798 Ga0495584_0013798_2514_2873 117
3 3300046538 Ga0495609_0043616 Ga0495609_0043616_35_394 117
4 3300046459 Ga0495629_0161708 Ga0495629_0161708_988_1344 118
5 3300005439 Ga0070711_100053883 Ga0070711_1000538832 119
6 3300005536 Ga0070697_100140243 Ga0070697_1001402433 119
7 3300006175 Ga0070712_100003758 Ga0070712_10000375811 119
8 3300025915 Ga0207693_10002613 Ga0207693_1000261315 119
9 3300025916 Ga0207663_10464508 Ga0207663_104645082 119
10 3300026089 Ga0207648_11843272 Ga0207648_118432722 119
11 3300048912 Ga0496109_1904458 Ga0496109_1904458_16_414 119
12 3300053083 Ga0495655_0179386 Ga0495655_0179386_21_380 119
13 3300009148 Ga0105243_12675507 Ga0105243_126755071 120
14 3300031911 Ga0307412_11177980 Ga0307412_111779802 120
15 3300032002 Ga0307416_100041206 Ga0307416_1000412063 120
16 3300032126 Ga0307415_100006911 Ga0307415_1000069118 120
17 3300048088 Ga0495602_0056568 Ga0495602_0056568_1736_2098 120
18 3300044684 Ga0466966_0044418 Ga0466966_0044418_1526_1897 121
19 3300044693 Ga0466961_0044985 Ga0466961_0044985_1609_1980 121
20 3300014497 Ga0182008_10172334 Ga0182008_101723342 122
21 3300014497 Ga0182008_10605403 Ga0182008_106054031 122
22 3300041505 Ga0451849_1075940 Ga0451849_1075940_306_680 122
23 3300047317 Ga0495604_0254207 Ga0495604_0254207_793_1167 122
24 3300048915 Ga0496112_0908541 Ga0496112_0908541_264_638 122
25 3300005339 Ga0070660_100625583 Ga0070660_1006255832 123
26 3300005355 Ga0070671_100303644 Ga0070671_1003036442 123
27 3300005367 Ga0070667_101844135 Ga0070667_1018441352 123
28 3300005437 Ga0070710_10573179 Ga0070710_105731791 123
29 3300005439 Ga0070711_100018382 Ga0070711_1000183822 123
30 3300005614 Ga0068856_100051292 Ga0068856_1000512924 123
31 3300005719 Ga0068861_100608497 Ga0068861_1006084972 123
32 3300006175 Ga0070712_100057122 Ga0070712_1000571222 123
33 3300006237 Ga0097621_100563304 Ga0097621_1005633041 123
34 3300009148 Ga0105243_11545768 Ga0105243_115457682 123
35 3300013296 Ga0157374_10458172 Ga0157374_104581722 123
36 3300013297 Ga0157378_10376892 Ga0157378_103768922 123
37 3300014968 Ga0157379_11483912 Ga0157379_114839121 123
38 3300014969 Ga0157376_10195562 Ga0157376_101955621 123
39 3300025898 Ga0207692_10164973 Ga0207692_101649732 123
40 3300025915 Ga0207693_10034709 Ga0207693_100347093 123
41 3300025916 Ga0207663_10010873 Ga0207663_100108732 123
42 3300025927 Ga0207687_11152570 Ga0207687_111525701 123
43 3300025931 Ga0207644_10311452 Ga0207644_103114522 123
44 3300025935 Ga0207709_10488070 Ga0207709_104880702 123
45 3300025944 Ga0207661_10442349 Ga0207661_104423491 123
46 3300026078 Ga0207702_10209821 Ga0207702_102098212 123
47 3300026118 Ga0207675_100621125 Ga0207675_1006211251 123
48 3300044683 Ga0466965_0036296 Ga0466965_0036296_703_1074 123
49 3300044684 Ga0466966_0184826 Ga0466966_0184826_686_1057 123
50 3300044693 Ga0466961_0004553 Ga0466961_0004553_6687_7058 123
51 3300044694 Ga0466963_0175132 Ga0466963_0175132_320_691 123
52 3300044706 Ga0466964_0057224 Ga0466964_0057224_686_1057 123
53 3300044719 Ga0466971_0000452 Ga0466971_0000452_12581_12952 123
54 3300044842 Ga0466957_0000958 Ga0466957_0000958_12585_12956 123
55 3300045049 Ga0466959_0000902 Ga0466959_0000902_9162_9533 123
56 3300045836 Ga0466958_0154390 Ga0466958_0154390_559_930 123
57 3300045976 Ga0466967_0000142 Ga0466967_0000142_25631_26002 123
58 3300045976 Ga0466967_0082101 Ga0466967_0082101_1661_2032 123
59 3300045976 Ga0466967_0263629 Ga0466967_0263629_716_1087 123
60 3300046461 Ga0495641_0055750 Ga0495641_0055750_1295_1666 123
61 3300046463 Ga0495653_0391872 Ga0495653_0391872_332_703 123
62 3300046529 Ga0495652_0129156 Ga0495652_0129156_1053_1424 123
63 3300046536 Ga0495587_0101219 Ga0495587_0101219_1258_1629 123
64 3300046678 Ga0495599_0154472 Ga0495599_0154472_722_1093 123
65 3300048903 Ga0496100_0020900 Ga0496100_0020900_2415_2786 123
66 3300048904 Ga0496101_0001238 Ga0496101_0001238_9035_9406 123
67 3300048905 Ga0496102_0021057 Ga0496102_0021057_1831_2202 123
68 3300048907 Ga0496104_0060932 Ga0496104_0060932_345_716 123
69 3300048908 Ga0496105_0019124 Ga0496105_0019124_2909_3280 123
70 3300048910 Ga0496107_0003998 Ga0496107_0003998_8269_8640 123
71 3300048911 Ga0496108_0037636 Ga0496108_0037636_3102_3473 123
72 3300048911 Ga0496108_0197021 Ga0496108_0197021_1102_1473 123
73 3300048912 Ga0496109_0038096 Ga0496109_0038096_1787_2158 123
74 3300048912 Ga0496109_1884196 Ga0496109_1884196_22_393 123
75 3300048913 Ga0496110_0038011 Ga0496110_0038011_1819_2190 123
76 3300048914 Ga0496111_0440531 Ga0496111_0440531_397_768 123
77 3300048915 Ga0496112_0903943 Ga0496112_0903943_18_389 123
78 3300048916 Ga0496113_0152345 Ga0496113_0152345_364_735 123
79 3300048917 Ga0496114_0014618 Ga0496114_0014618_3716_4087 123
80 3300048918 Ga0496115_0077306 Ga0496115_0077306_101_472 123
81 3300049583 Ga0501067_0000723 Ga0501067_0000723_8890_9261 123
82 3300049584 Ga0501068_0003171 Ga0501068_0003171_2102_2473 123
83 3300049586 Ga0501070_0128405 Ga0501070_0128405_1070_1441 123
84 3300049587 Ga0501071_0090807 Ga0501071_0090807_592_963 123
85 3300061719 Ga0466962_0001047 Ga0466962_0001047_3595_3966 123
86 3300061734 Ga0530510_0069435 Ga0530510_0069435_102_473 123
87 3300003373 JGI25407J50210_10000425 JGI25407J50210_100004258 124
88 3300005435 Ga0070714_100549090 Ga0070714_1005490901 124
89 3300005436 Ga0070713_100226203 Ga0070713_1002262032 124
90 3300005439 Ga0070711_100081384 Ga0070711_1000813844 124
91 3300005844 Ga0068862_102402452 Ga0068862_1024024521 124
92 3300005981 Ga0081538_10003208 Ga0081538_100032088 124
93 3300006028 Ga0070717_10020221 Ga0070717_100202214 124
94 3300006175 Ga0070712_101461121 Ga0070712_1014611212 124
95 3300006358 Ga0068871_100452313 Ga0068871_1004523132 124
96 3300009553 Ga0105249_10606560 Ga0105249_106065602 124
97 3300011119 Ga0105246_10298873 Ga0105246_102988732 124
98 3300014745 Ga0157377_10319413 Ga0157377_103194132 124
99 3300025915 Ga0207693_10185557 Ga0207693_101855572 124
100 3300025915 Ga0207693_10294814 Ga0207693_102948142 124
101 3300025922 Ga0207646_10185660 Ga0207646_101856602 124
102 3300025928 Ga0207700_10216674 Ga0207700_102166742 124
103 3300025928 Ga0207700_10600136 Ga0207700_106001362 124
104 3300025936 Ga0207670_11639789 Ga0207670_116397892 124
105 3300026088 Ga0207641_12163260 Ga0207641_121632602 124
106 3300028380 Ga0268265_12282750 Ga0268265_122827501 124
107 3300044656 Ga0466969_0067182 Ga0466969_0067182_722_1096 124
108 3300044735 Ga0466968_0016592 Ga0466968_0016592_1857_2231 124
109 3300044842 Ga0466957_0246332 Ga0466957_0246332_471_845 124
110 3300045049 Ga0466959_0080834 Ga0466959_0080834_209_583 124
111 3300045836 Ga0466958_0084621 Ga0466958_0084621_797_1171 124
112 3300045976 Ga0466967_0111152 Ga0466967_0111152_1833_2207 124
113 3300045976 Ga0466967_0501610 Ga0466967_0501610_114_488 124
114 3300046454 Ga0495592_0172142 Ga0495592_0172142_528_902 124
115 3300046454 Ga0495592_0605910 Ga0495592_0605910_122_496 124
116 3300046459 Ga0495629_0094156 Ga0495629_0094156_381_755 124
117 3300046462 Ga0495651_0005992 Ga0495651_0005992_5788_6162 124
118 3300046462 Ga0495651_0311671 Ga0495651_0311671_526_900 124
119 3300046463 Ga0495653_0130012 Ga0495653_0130012_592_966 124
120 3300046473 Ga0495582_0274367 Ga0495582_0274367_472_846 124
121 3300046475 Ga0495639_0138250 Ga0495639_0138250_20_394 124
122 3300046476 Ga0495662_0122826 Ga0495662_0122826_402_776 124
123 3300046477 Ga0495664_0006619 Ga0495664_0006619_5536_5910 124
124 3300046511 Ga0495608_0046272 Ga0495608_0046272_1773_2147 124
125 3300046511 Ga0495608_0180345 Ga0495608_0180345_192_566 124
126 3300046514 Ga0495618_0433444 Ga0495618_0433444_23_397 124
127 3300046514 Ga0495618_0672433 Ga0495618_0672433_29_403 124
128 3300046516 Ga0495628_0075440 Ga0495628_0075440_1488_1862 124
129 3300046517 Ga0495630_0010704 Ga0495630_0010704_558_932 124
130 3300046525 Ga0495663_0011429 Ga0495663_0011429_1964_2344 124
131 3300046528 Ga0495642_0056089 Ga0495642_0056089_1234_1614 124
132 3300046529 Ga0495652_0110752 Ga0495652_0110752_764_1138 124
133 3300046529 Ga0495652_0186799 Ga0495652_0186799_994_1368 124
134 3300046529 Ga0495652_0403108 Ga0495652_0403108_192_566 124
135 3300046531 Ga0495665_0150471 Ga0495665_0150471_830_1204 124
136 3300046536 Ga0495587_0045090 Ga0495587_0045090_1308_1682 124
137 3300046543 Ga0495645_0340194 Ga0495645_0340194_458_832 124
138 3300046559 Ga0495667_0005465 Ga0495667_0005465_6086_6460 124
139 3300046559 Ga0495667_0406283 Ga0495667_0406283_437_811 124
140 3300046615 Ga0495656_0104993 Ga0495656_0104993_193_573 124
141 3300046642 Ga0495634_0012463 Ga0495634_0012463_133_507 124
142 3300046642 Ga0495634_0020500 Ga0495634_0020500_233_607 124
143 3300046663 Ga0495635_0106627 Ga0495635_0106627_26_400 124
144 3300046664 Ga0495659_0023816 Ga0495659_0023816_43_423 124
145 3300046675 Ga0495657_0013412 Ga0495657_0013412_5028_5402 124
146 3300046678 Ga0495599_0224241 Ga0495599_0224241_609_983 124
147 3300046683 Ga0495658_0948368 Ga0495658_0948368_67_441 124
148 3300046689 Ga0495613_0238465 Ga0495613_0238465_757_1131 124
149 3300046690 Ga0495624_0256094 Ga0495624_0256094_447_821 124
150 3300046692 Ga0495671_0108319 Ga0495671_0108319_280_660 124
151 3300046794 Ga0495589_0217321 Ga0495589_0217321_274_654 124
152 3300047318 Ga0495636_0371607 Ga0495636_0371607_52_432 124
153 3300047319 Ga0495674_0001759 Ga0495674_0001759_6466_6840 124
154 3300047321 Ga0495676_0331094 Ga0495676_0331094_208_582 124
155 3300047322 Ga0495680_0004490 Ga0495680_0004490_4415_4789 124
156 3300047322 Ga0495680_0134885 Ga0495680_0134885_632_1006 124
157 3300047447 Ga0495685_075380 Ga0495685_075380_588_968 124
158 3300047471 Ga0495684_0012761 Ga0495684_0012761_5245_5619 124
159 3300047471 Ga0495684_0031156 Ga0495684_0031156_2871_3245 124
160 3300048088 Ga0495602_0118922 Ga0495602_0118922_460_834 124
161 3300048088 Ga0495602_0606539 Ga0495602_0606539_295_669 124
162 3300048903 Ga0496100_0742605 Ga0496100_0742605_52_426 124
163 3300048904 Ga0496101_1235124 Ga0496101_1235124_160_534 124
164 3300048907 Ga0496104_0208489 Ga0496104_0208489_187_561 124
165 3300048907 Ga0496104_1692141 Ga0496104_1692141_16_390 124
166 3300048908 Ga0496105_0074201 Ga0496105_0074201_2197_2571 124
167 3300048912 Ga0496109_0289482 Ga0496109_0289482_949_1323 124
168 3300048913 Ga0496110_0153191 Ga0496110_0153191_1149_1523 124
169 3300048913 Ga0496110_0182804 Ga0496110_0182804_743_1117 124
170 3300048916 Ga0496113_0309601 Ga0496113_0309601_717_1091 124
171 3300048917 Ga0496114_0001682 Ga0496114_0001682_14857_15231 124
172 3300048917 Ga0496114_0438352 Ga0496114_0438352_626_1000 124
173 3300048917 Ga0496114_1669636 Ga0496114_1669636_72_446 124
174 3300048918 Ga0496115_0425118 Ga0496115_0425118_296_676 124
175 3300048918 Ga0496115_0679169 Ga0496115_0679169_64_438 124
176 3300053078 Ga0495612_0039540 Ga0495612_0039540_879_1253 124
177 3300053085 Ga0495619_0007565 Ga0495619_0007565_5804_6178 124
178 3300053085 Ga0495619_0017932 Ga0495619_0017932_3834_4208 124
179 3300053085 Ga0495619_0111441 Ga0495619_0111441_690_1064 124
180 3300005329 Ga0070683_100042976 Ga0070683_1000429764 125
181 3300005334 Ga0068869_100669261 Ga0068869_1006692611 125
182 3300005440 Ga0070705_100638081 Ga0070705_1006380812 125
183 3300005445 Ga0070708_100006168 Ga0070708_1000061683 125
184 3300005467 Ga0070706_100000265 Ga0070706_10000026518 125
185 3300005467 Ga0070706_100016294 Ga0070706_1000162944 125
186 3300005468 Ga0070707_100003506 Ga0070707_1000035063 125
187 3300005471 Ga0070698_100054382 Ga0070698_1000543824 125
188 3300005471 Ga0070698_100424142 Ga0070698_1004241422 125
189 3300005471 Ga0070698_100656962 Ga0070698_1006569622 125
190 3300005518 Ga0070699_100670809 Ga0070699_1006708092 125
191 3300005535 Ga0070684_100042878 Ga0070684_1000428782 125
192 3300005536 Ga0070697_100076109 Ga0070697_1000761091 125
193 3300005937 Ga0081455_10014560 Ga0081455_100145609 125
194 3300005983 Ga0081540_1000879 Ga0081540_100087927 125
195 3300005985 Ga0081539_10002754 Ga0081539_1000275411 125
196 3300006038 Ga0075365_10109483 Ga0075365_101094832 125
197 3300006058 Ga0075432_10142691 Ga0075432_101426912 125
198 3300009094 Ga0111539_10082138 Ga0111539_100821383 125
199 3300009098 Ga0105245_10623096 Ga0105245_106230962 125
200 3300011119 Ga0105246_10556720 Ga0105246_105567202 125
201 3300025899 Ga0207642_10488668 Ga0207642_104886682 125
202 3300025910 Ga0207684_10000221 Ga0207684_1000022160 125
203 3300025910 Ga0207684_10034243 Ga0207684_100342433 125
204 3300025920 Ga0207649_10473698 Ga0207649_104736982 125
205 3300025922 Ga0207646_10004631 Ga0207646_1000463115 125
206 3300025942 Ga0207689_10432260 Ga0207689_104322602 125
207 3300025944 Ga0207661_10032234 Ga0207661_100322345 125
208 3300035089 Ga0373944_0368160 Ga0373944_0368160_158_535 125
209 3300035725 Ga0373947_0402726 Ga0373947_0402726_406_783 125
210 3300037418 Ga0395900_0025384 Ga0395900_0025384_3266_3643 125
211 3300037471 Ga0395905_1246160 Ga0395905_1246160_68_445 125
212 3300038443 Ga0395901_0054431 Ga0395901_0054431_772_1149 125
213 3300042122 Ga0450920_058579 Ga0450920_058579_138_518 125
214 3300042145 Ga0450906_110120 Ga0450906_110120_39_419 125
215 3300044683 Ga0466965_0345930 Ga0466965_0345930_162_539 125
216 3300044684 Ga0466966_0011436 Ga0466966_0011436_2322_2699 125
217 3300044693 Ga0466961_0037677 Ga0466961_0037677_2390_2767 125
218 3300044694 Ga0466963_0094222 Ga0466963_0094222_712_1107 125
219 3300044706 Ga0466964_0121569 Ga0466964_0121569_676_1053 125
220 3300045049 Ga0466959_0135158 Ga0466959_0135158_80_457 125
221 3300045051 Ga0451576_0584423 Ga0451576_0584423_698_1075 125
222 3300045836 Ga0466958_0092580 Ga0466958_0092580_1459_1839 125
223 3300049568 Ga0501031_0017160 Ga0501031_0017160_200_577 125
224 3300049569 Ga0501032_0715991 Ga0501032_0715991_200_577 125
225 3300049570 Ga0501033_0271976 Ga0501033_0271976_355_732 125
226 3300049572 Ga0501036_0023454 Ga0501036_0023454_2541_2918 125
227 3300049574 Ga0501038_0030196 Ga0501038_0030196_3964_4341 125
228 3300049575 Ga0501039_0031596 Ga0501039_0031596_1842_2219 125
229 3300049576 Ga0501040_0085324 Ga0501040_0085324_1445_1822 125
230 3300049577 Ga0501041_0008515 Ga0501041_0008515_2671_3048 125
231 3300049578 Ga0501042_0012945 Ga0501042_0012945_4582_4959 125
232 3300049579 Ga0501043_0269576 Ga0501043_0269576_189_566 125
233 3300049582 Ga0501048_0061804 Ga0501048_0061804_725_1102 125
234 3300049585 Ga0501069_0074044 Ga0501069_0074044_851_1228 125
235 3300049587 Ga0501071_0011103 Ga0501071_0011103_4074_4451 125
236 3300049588 Ga0501072_0022731 Ga0501072_0022731_2698_3075 125
237 3300049590 Ga0501074_0029295 Ga0501074_0029295_1863_2240 125
238 3300049591 Ga0501075_0047023 Ga0501075_0047023_1281_1658 125
239 3300049592 Ga0501076_0024282 Ga0501076_0024282_4107_4484 125
240 3300049593 Ga0501077_0020436 Ga0501077_0020436_1649_2026 125
241 3300049741 Ga0501079_0037053 Ga0501079_0037053_2522_2899 125
242 3300049742 Ga0501080_0055563 Ga0501080_0055563_2651_3028 125
243 3300049743 Ga0501081_0028566 Ga0501081_0028566_317_694 125
244 3300049822 Ga0501035_0222690 Ga0501035_0222690_510_887 125
245 3300049824 Ga0501045_0013202 Ga0501045_0013202_3179_3556 125
246 3300050492 nmdc:mga0yw44_94113_c1 nmdc:mga0yw44_94113_c1_1248_1625 125
247 3300050511 nmdc:mga08y16_65593_c1 nmdc:mga08y16_65593_c1_409_786 125
248 3300054114 Ga0501084_0064556 Ga0501084_0064556_1376_1753 125
249 3300054114 Ga0501084_0880737 Ga0501084_0880737_17_397 125
250 3300060353 Ga0501082_0182839 Ga0501082_0182839_462_839 125
251 3300061719 Ga0466962_0026892 Ga0466962_0026892_250_627 125
252 3300001978 JGI24747J21853_1006440 JGI24747J21853_10064402 126
253 3300002077 JGI24744J21845_10002681 JGI24744J21845_100026812 126
254 3300002155 JGI24033J26618_1001669 JGI24033J26618_10016693 126
255 3300002244 JGI24742J22300_10021071 JGI24742J22300_100210712 126
256 3300002459 JGI24751J29686_10000223 JGI24751J29686_100002232 126
257 3300002459 JGI24751J29686_10007378 JGI24751J29686_100073783 126
258 3300005328 Ga0070676_10516119 Ga0070676_105161192 126
259 3300005329 Ga0070683_100013383 Ga0070683_1000133834 126
260 3300005330 Ga0070690_100586048 Ga0070690_1005860482 126
261 3300005330 Ga0070690_100810082 Ga0070690_1008100821 126
262 3300005331 Ga0070670_100011290 Ga0070670_1000112904 126
263 3300005331 Ga0070670_100349551 Ga0070670_1003495512 126
264 3300005335 Ga0070666_10039778 Ga0070666_100397785 126
265 3300005336 Ga0070680_100010728 Ga0070680_1000107287 126
266 3300005336 Ga0070680_100213008 Ga0070680_1002130082 126
267 3300005337 Ga0070682_100005203 Ga0070682_1000052032 126
268 3300005337 Ga0070682_100809160 Ga0070682_1008091602 126
269 3300005338 Ga0068868_100029932 Ga0068868_1000299322 126
270 3300005339 Ga0070660_100126703 Ga0070660_1001267032 126
271 3300005339 Ga0070660_100370265 Ga0070660_1003702652 126
272 3300005340 Ga0070689_100013742 Ga0070689_1000137422 126
273 3300005340 Ga0070689_100180355 Ga0070689_1001803552 126
274 3300005343 Ga0070687_100537140 Ga0070687_1005371402 126
275 3300005343 Ga0070687_101156369 Ga0070687_1011563691 126
276 3300005344 Ga0070661_100159774 Ga0070661_1001597742 126
277 3300005344 Ga0070661_100677212 Ga0070661_1006772121 126
278 3300005344 Ga0070661_101577090 Ga0070661_1015770901 126
279 3300005345 Ga0070692_10073774 Ga0070692_100737742 126
280 3300005345 Ga0070692_10119108 Ga0070692_101191081 126
281 3300005345 Ga0070692_10302373 Ga0070692_103023732 126
282 3300005347 Ga0070668_100177352 Ga0070668_1001773521 126
283 3300005354 Ga0070675_100187551 Ga0070675_1001875512 126
284 3300005354 Ga0070675_100430778 Ga0070675_1004307782 126
285 3300005354 Ga0070675_101374675 Ga0070675_1013746751 126
286 3300005355 Ga0070671_100308743 Ga0070671_1003087431 126
287 3300005356 Ga0070674_100006099 Ga0070674_1000060994 126
288 3300005356 Ga0070674_100014513 Ga0070674_1000145136 126
289 3300005356 Ga0070674_101115884 Ga0070674_1011158842 126
290 3300005364 Ga0070673_100036857 Ga0070673_1000368572 126
291 3300005364 Ga0070673_100421497 Ga0070673_1004214972 126
292 3300005365 Ga0070688_100008183 Ga0070688_1000081837 126
293 3300005365 Ga0070688_100009091 Ga0070688_1000090914 126
294 3300005365 Ga0070688_100581586 Ga0070688_1005815862 126
295 3300005365 Ga0070688_101057459 Ga0070688_1010574591 126
296 3300005366 Ga0070659_100040224 Ga0070659_1000402242 126
297 3300005366 Ga0070659_100954389 Ga0070659_1009543892 126
298 3300005366 Ga0070659_101573745 Ga0070659_1015737451 126
299 3300005406 Ga0070703_10003075 Ga0070703_100030752 126
300 3300005434 Ga0070709_10860137 Ga0070709_108601371 126
301 3300005435 Ga0070714_100002672 Ga0070714_10000267211 126
302 3300005435 Ga0070714_100365206 Ga0070714_1003652061 126
303 3300005435 Ga0070714_100872673 Ga0070714_1008726731 126
304 3300005436 Ga0070713_100034470 Ga0070713_1000344702 126
305 3300005437 Ga0070710_10007082 Ga0070710_100070827 126
306 3300005438 Ga0070701_10175250 Ga0070701_101752502 126
307 3300005438 Ga0070701_10575077 Ga0070701_105750772 126
308 3300005438 Ga0070701_10667068 Ga0070701_106670682 126
309 3300005439 Ga0070711_100020235 Ga0070711_1000202356 126
310 3300005440 Ga0070705_100009626 Ga0070705_1000096261 126
311 3300005440 Ga0070705_100050491 Ga0070705_1000504912 126
312 3300005440 Ga0070705_100200159 Ga0070705_1002001592 126
313 3300005440 Ga0070705_100221055 Ga0070705_1002210552 126
314 3300005440 Ga0070705_100702064 Ga0070705_1007020642 126
315 3300005441 Ga0070700_100001522 Ga0070700_10000152212 126
316 3300005441 Ga0070700_100019689 Ga0070700_1000196892 126
317 3300005441 Ga0070700_100683667 Ga0070700_1006836672 126
318 3300005444 Ga0070694_100019660 Ga0070694_1000196602 126
319 3300005444 Ga0070694_100306859 Ga0070694_1003068591 126
320 3300005445 Ga0070708_100010959 Ga0070708_1000109591 126
321 3300005445 Ga0070708_100173553 Ga0070708_1001735532 126
322 3300005445 Ga0070708_101247196 Ga0070708_1012471962 126
323 3300005455 Ga0070663_100007368 Ga0070663_1000073681 126
324 3300005455 Ga0070663_100508960 Ga0070663_1005089602 126
325 3300005455 Ga0070663_100529554 Ga0070663_1005295541 126
326 3300005455 Ga0070663_100952762 Ga0070663_1009527622 126
327 3300005456 Ga0070678_100001885 Ga0070678_1000018854 126
328 3300005456 Ga0070678_100080894 Ga0070678_1000808944 126
329 3300005457 Ga0070662_100024483 Ga0070662_1000244834 126
330 3300005457 Ga0070662_100054330 Ga0070662_1000543302 126
331 3300005459 Ga0068867_100002812 Ga0068867_10000281212 126
332 3300005459 Ga0068867_100025980 Ga0068867_1000259804 126
333 3300005459 Ga0068867_100037053 Ga0068867_1000370533 126
334 3300005466 Ga0070685_10014113 Ga0070685_100141134 126
335 3300005466 Ga0070685_10099905 Ga0070685_100999052 126
336 3300005466 Ga0070685_10482302 Ga0070685_104823022 126
337 3300005466 Ga0070685_10529601 Ga0070685_105296012 126
338 3300005467 Ga0070706_100258090 Ga0070706_1002580902 126
339 3300005467 Ga0070706_100272381 Ga0070706_1002723813 126
340 3300005467 Ga0070706_100335891 Ga0070706_1003358912 126
341 3300005467 Ga0070706_101339102 Ga0070706_1013391021 126
342 3300005468 Ga0070707_100328567 Ga0070707_1003285672 126
343 3300005468 Ga0070707_101989904 Ga0070707_1019899041 126
344 3300005471 Ga0070698_100206090 Ga0070698_1002060902 126
345 3300005471 Ga0070698_100905513 Ga0070698_1009055131 126
346 3300005471 Ga0070698_101499891 Ga0070698_1014998912 126
347 3300005518 Ga0070699_100040001 Ga0070699_1000400014 126
348 3300005518 Ga0070699_100205509 Ga0070699_1002055092 126
349 3300005530 Ga0070679_100191341 Ga0070679_1001913412 126
350 3300005530 Ga0070679_101635771 Ga0070679_1016357712 126
351 3300005535 Ga0070684_100000718 Ga0070684_1000007182 126
352 3300005535 Ga0070684_100008288 Ga0070684_1000082887 126
353 3300005536 Ga0070697_100021631 Ga0070697_1000216313 126
354 3300005536 Ga0070697_101403352 Ga0070697_1014033522 126
355 3300005539 Ga0068853_100299142 Ga0068853_1002991422 126
356 3300005543 Ga0070672_100011868 Ga0070672_1000118682 126
357 3300005544 Ga0070686_100004420 Ga0070686_1000044203 126
358 3300005544 Ga0070686_100021094 Ga0070686_1000210942 126
359 3300005544 Ga0070686_100581643 Ga0070686_1005816432 126
360 3300005545 Ga0070695_100746980 Ga0070695_1007469802 126
361 3300005546 Ga0070696_100018988 Ga0070696_1000189883 126
362 3300005546 Ga0070696_100019404 Ga0070696_1000194045 126
363 3300005546 Ga0070696_100293958 Ga0070696_1002939582 126
364 3300005546 Ga0070696_100328636 Ga0070696_1003286362 126
365 3300005546 Ga0070696_100729915 Ga0070696_1007299152 126
366 3300005546 Ga0070696_101462719 Ga0070696_1014627192 126
367 3300005547 Ga0070693_100183653 Ga0070693_1001836532 126
368 3300005548 Ga0070665_100108249 Ga0070665_1001082492 126
369 3300005549 Ga0070704_100001582 Ga0070704_10000158211 126
370 3300005549 Ga0070704_100239069 Ga0070704_1002390691 126
371 3300005549 Ga0070704_100691769 Ga0070704_1006917692 126
372 3300005563 Ga0068855_102283690 Ga0068855_1022836901 126
373 3300005564 Ga0070664_100019961 Ga0070664_1000199613 126
374 3300005564 Ga0070664_100098038 Ga0070664_1000980382 126
375 3300005564 Ga0070664_100233888 Ga0070664_1002338882 126
376 3300005564 Ga0070664_100605125 Ga0070664_1006051252 126
377 3300005564 Ga0070664_101297518 Ga0070664_1012975182 126
378 3300005577 Ga0068857_100022262 Ga0068857_1000222622 126
379 3300005577 Ga0068857_100027256 Ga0068857_1000272562 126
380 3300005577 Ga0068857_100158141 Ga0068857_1001581412 126
381 3300005577 Ga0068857_100705252 Ga0068857_1007052522 126
382 3300005578 Ga0068854_100489844 Ga0068854_1004898442 126
383 3300005578 Ga0068854_100758406 Ga0068854_1007584062 126
384 3300005614 Ga0068856_100087246 Ga0068856_1000872462 126
385 3300005614 Ga0068856_100577133 Ga0068856_1005771332 126
386 3300005615 Ga0070702_100145703 Ga0070702_1001457031 126
387 3300005615 Ga0070702_100186433 Ga0070702_1001864332 126
388 3300005615 Ga0070702_100236549 Ga0070702_1002365492 126
389 3300005615 Ga0070702_100680672 Ga0070702_1006806722 126
390 3300005615 Ga0070702_100835249 Ga0070702_1008352492 126
391 3300005616 Ga0068852_101768244 Ga0068852_1017682441 126
392 3300005617 Ga0068859_100042738 Ga0068859_1000427384 126
393 3300005617 Ga0068859_100653203 Ga0068859_1006532032 126
394 3300005617 Ga0068859_100797774 Ga0068859_1007977742 126
395 3300005617 Ga0068859_101013963 Ga0068859_1010139632 126
396 3300005618 Ga0068864_100103778 Ga0068864_1001037782 126
397 3300005618 Ga0068864_101295310 Ga0068864_1012953102 126
398 3300005718 Ga0068866_10004917 Ga0068866_100049177 126
399 3300005719 Ga0068861_100004620 Ga0068861_1000046204 126
400 3300005719 Ga0068861_100066704 Ga0068861_1000667043 126
401 3300005719 Ga0068861_100842984 Ga0068861_1008429842 126
402 3300005834 Ga0068851_10429055 Ga0068851_104290552 126
403 3300005840 Ga0068870_10004753 Ga0068870_100047532 126
404 3300005840 Ga0068870_10007440 Ga0068870_100074404 126
405 3300005840 Ga0068870_10095903 Ga0068870_100959032 126
406 3300005840 Ga0068870_10327392 Ga0068870_103273922 126
407 3300005841 Ga0068863_100028952 Ga0068863_1000289523 126
408 3300005841 Ga0068863_100468397 Ga0068863_1004683972 126
409 3300005841 Ga0068863_100858325 Ga0068863_1008583251 126
410 3300005841 Ga0068863_101947726 Ga0068863_1019477261 126
411 3300005842 Ga0068858_100040973 Ga0068858_1000409735 126
412 3300005843 Ga0068860_100136828 Ga0068860_1001368283 126
413 3300005843 Ga0068860_100331602 Ga0068860_1003316022 126
414 3300005843 Ga0068860_100391942 Ga0068860_1003919422 126
415 3300005844 Ga0068862_100076290 Ga0068862_1000762904 126
416 3300005937 Ga0081455_10003184 Ga0081455_1000318412 126
417 3300005937 Ga0081455_10023102 Ga0081455_100231023 126
418 3300005937 Ga0081455_10033620 Ga0081455_100336204 126
419 3300005937 Ga0081455_10051279 Ga0081455_100512792 126
420 3300005937 Ga0081455_10052811 Ga0081455_100528112 126
421 3300005937 Ga0081455_10146895 Ga0081455_101468952 126
422 3300005937 Ga0081455_10240217 Ga0081455_102402172 126
423 3300005937 Ga0081455_10258194 Ga0081455_102581942 126
424 3300005937 Ga0081455_10303955 Ga0081455_103039552 126
425 3300005937 Ga0081455_10596483 Ga0081455_105964832 126
426 3300005981 Ga0081538_10098095 Ga0081538_100980951 126
427 3300005981 Ga0081538_10191186 Ga0081538_101911862 126
428 3300005985 Ga0081539_10167839 Ga0081539_101678392 126
429 3300006028 Ga0070717_10120096 Ga0070717_101200962 126
430 3300006028 Ga0070717_10335052 Ga0070717_103350523 126
431 3300006038 Ga0075365_10015406 Ga0075365_100154063 126
432 3300006051 Ga0075364_10116426 Ga0075364_101164262 126
433 3300006058 Ga0075432_10001799 Ga0075432_100017995 126
434 3300006173 Ga0070716_100377196 Ga0070716_1003771962 126
435 3300006173 Ga0070716_100708124 Ga0070716_1007081242 126
436 3300006175 Ga0070712_100172051 Ga0070712_1001720512 126
437 3300006178 Ga0075367_10324660 Ga0075367_103246602 126
438 3300006237 Ga0097621_100120527 Ga0097621_1001205273 126
439 3300006237 Ga0097621_100124068 Ga0097621_1001240682 126
440 3300006358 Ga0068871_100039897 Ga0068871_1000398974 126
441 3300006358 Ga0068871_100066036 Ga0068871_1000660361 126
442 3300006844 Ga0075428_100033997 Ga0075428_1000339973 126
443 3300006844 Ga0075428_100039421 Ga0075428_1000394213 126
444 3300006844 Ga0075428_102433309 Ga0075428_1024333091 126
445 3300006846 Ga0075430_100010189 Ga0075430_1000101895 126
446 3300006846 Ga0075430_100052967 Ga0075430_1000529675 126
447 3300006847 Ga0075431_100010011 Ga0075431_1000100115 126
448 3300006847 Ga0075431_100140156 Ga0075431_1001401562 126
449 3300006852 Ga0075433_10000149 Ga0075433_1000014935 126
450 3300006852 Ga0075433_10011686 Ga0075433_100116865 126
451 3300006852 Ga0075433_10021142 Ga0075433_100211423 126
452 3300006852 Ga0075433_10088345 Ga0075433_100883452 126
453 3300006852 Ga0075433_10714073 Ga0075433_107140732 126
454 3300006871 Ga0075434_100005828 Ga0075434_1000058283 126
455 3300006871 Ga0075434_100007538 Ga0075434_1000075382 126
456 3300006880 Ga0075429_100149373 Ga0075429_1001493732 126
457 3300006880 Ga0075429_100250488 Ga0075429_1002504882 126
458 3300006881 Ga0068865_100011942 Ga0068865_1000119425 126
459 3300006881 Ga0068865_100109842 Ga0068865_1001098421 126
460 3300006881 Ga0068865_100205728 Ga0068865_1002057282 126
461 3300006914 Ga0075436_100064663 Ga0075436_1000646632 126
462 3300006931 Ga0097620_100042737 Ga0097620_1000427374 126
463 3300006931 Ga0097620_100653186 Ga0097620_1006531862 126
464 3300006931 Ga0097620_100797881 Ga0097620_1007978812 126
465 3300006931 Ga0097620_101013765 Ga0097620_1010137652 126
466 3300007076 Ga0075435_100032344 Ga0075435_1000323444 126
467 3300009011 Ga0105251_10050465 Ga0105251_100504652 126
468 3300009094 Ga0111539_10080744 Ga0111539_100807445 126
469 3300009094 Ga0111539_10177989 Ga0111539_101779892 126
470 3300009094 Ga0111539_10284180 Ga0111539_102841802 126
471 3300009094 Ga0111539_10295246 Ga0111539_102952462 126
472 3300009098 Ga0105245_10044957 Ga0105245_100449572 126
473 3300009098 Ga0105245_10046136 Ga0105245_100461363 126
474 3300009098 Ga0105245_10063865 Ga0105245_100638652 126
475 3300009098 Ga0105245_10554196 Ga0105245_105541962 126
476 3300009098 Ga0105245_10617585 Ga0105245_106175852 126
477 3300009098 Ga0105245_11075661 Ga0105245_110756612 126
478 3300009098 Ga0105245_11786312 Ga0105245_117863121 126
479 3300009101 Ga0105247_11249689 Ga0105247_112496891 126
480 3300009147 Ga0114129_10000667 Ga0114129_1000066737 126
481 3300009147 Ga0114129_10020441 Ga0114129_100204412 126
482 3300009147 Ga0114129_10123275 Ga0114129_101232752 126
483 3300009147 Ga0114129_10197914 Ga0114129_101979142 126
484 3300009147 Ga0114129_10641285 Ga0114129_106412852 126
485 3300009147 Ga0114129_10720348 Ga0114129_107203482 126
486 3300009147 Ga0114129_10913986 Ga0114129_109139862 126
487 3300009148 Ga0105243_10003824 Ga0105243_1000382412 126
488 3300009148 Ga0105243_10006839 Ga0105243_100068397 126
489 3300009148 Ga0105243_10079721 Ga0105243_100797212 126
490 3300009148 Ga0105243_10270750 Ga0105243_102707502 126
491 3300009148 Ga0105243_10277012 Ga0105243_102770122 126
492 3300009148 Ga0105243_10813467 Ga0105243_108134672 126
493 3300009148 Ga0105243_11332978 Ga0105243_113329782 126
494 3300009174 Ga0105241_10517329 Ga0105241_105173292 126
495 3300009174 Ga0105241_10563126 Ga0105241_105631263 126
496 3300009174 Ga0105241_10828537 Ga0105241_108285371 126
497 3300009176 Ga0105242_10003423 Ga0105242_100034234 126
498 3300009176 Ga0105242_10009376 Ga0105242_100093762 126
499 3300009176 Ga0105242_10029108 Ga0105242_100291087 126
500 3300009176 Ga0105242_10410948 Ga0105242_104109482 126
501 3300009176 Ga0105242_10678008 Ga0105242_106780082 126
502 3300009176 Ga0105242_10679999 Ga0105242_106799992 126
503 3300009176 Ga0105242_12569020 Ga0105242_125690201 126
504 3300009177 Ga0105248_10031295 Ga0105248_100312954 126
505 3300009177 Ga0105248_10413998 Ga0105248_104139982 126
506 3300009177 Ga0105248_10753334 Ga0105248_107533342 126
507 3300009177 Ga0105248_11982503 Ga0105248_119825031 126
508 3300009545 Ga0105237_11507369 Ga0105237_115073692 126
509 3300009551 Ga0105238_10015628 Ga0105238_100156282 126
510 3300009551 Ga0105238_12327621 Ga0105238_123276211 126
511 3300009553 Ga0105249_10001792 Ga0105249_100017923 126
512 3300009553 Ga0105249_10059717 Ga0105249_100597175 126
513 3300009553 Ga0105249_10123526 Ga0105249_101235262 126
514 3300009553 Ga0105249_10703427 Ga0105249_107034272 126
515 3300010375 Ga0105239_10170095 Ga0105239_101700954 126
516 3300010375 Ga0105239_10224033 Ga0105239_102240332 126
517 3300010375 Ga0105239_10258081 Ga0105239_102580812 126
518 3300010375 Ga0105239_10501726 Ga0105239_105017262 126
519 3300011119 Ga0105246_10022863 Ga0105246_100228633 126
520 3300011119 Ga0105246_10903332 Ga0105246_109033321 126
521 3300011119 Ga0105246_10983809 Ga0105246_109838092 126
522 3300013100 Ga0157373_10106315 Ga0157373_101063152 126
523 3300013102 Ga0157371_10624445 Ga0157371_106244452 126
524 3300013105 Ga0157369_12455320 Ga0157369_124553201 126
525 3300013296 Ga0157374_10175068 Ga0157374_101750682 126
526 3300013296 Ga0157374_10491150 Ga0157374_104911502 126
527 3300013296 Ga0157374_10983492 Ga0157374_109834922 126
528 3300013297 Ga0157378_10004712 Ga0157378_100047122 126
529 3300013297 Ga0157378_10179344 Ga0157378_101793443 126
530 3300013297 Ga0157378_11334808 Ga0157378_113348082 126
531 3300013306 Ga0163162_10005507 Ga0163162_1000550713 126
532 3300013306 Ga0163162_10201780 Ga0163162_102017803 126
533 3300013306 Ga0163162_11793284 Ga0163162_117932842 126
534 3300013306 Ga0163162_11821100 Ga0163162_118211002 126
535 3300013306 Ga0163162_12488470 Ga0163162_124884702 126
536 3300013307 Ga0157372_10722465 Ga0157372_107224652 126
537 3300013308 Ga0157375_10234330 Ga0157375_102343303 126
538 3300013308 Ga0157375_10540395 Ga0157375_105403952 126
539 3300013308 Ga0157375_10655271 Ga0157375_106552711 126
540 3300013308 Ga0157375_11554919 Ga0157375_115549191 126
541 3300014325 Ga0163163_10263831 Ga0163163_102638311 126
542 3300014325 Ga0163163_10738138 Ga0163163_107381382 126
543 3300014326 Ga0157380_10025600 Ga0157380_100256005 126
544 3300014326 Ga0157380_10141442 Ga0157380_101414422 126
545 3300014326 Ga0157380_11062905 Ga0157380_110629052 126
546 3300014326 Ga0157380_11130707 Ga0157380_111307072 126
547 3300014326 Ga0157380_11343311 Ga0157380_113433112 126
548 3300014326 Ga0157380_11825536 Ga0157380_118255362 126
549 3300014745 Ga0157377_10004589 Ga0157377_100045892 126
550 3300014745 Ga0157377_10037023 Ga0157377_100370233 126
551 3300014745 Ga0157377_10397180 Ga0157377_103971802 126
552 3300014745 Ga0157377_10782750 Ga0157377_107827502 126
553 3300014745 Ga0157377_11062873 Ga0157377_110628732 126
554 3300014968 Ga0157379_10101297 Ga0157379_101012973 126
555 3300014968 Ga0157379_10567811 Ga0157379_105678112 126
556 3300014968 Ga0157379_10914341 Ga0157379_109143412 126
557 3300014969 Ga0157376_10323551 Ga0157376_103235512 126
558 3300014969 Ga0157376_11042648 Ga0157376_110426482 126
559 3300014969 Ga0157376_12870617 Ga0157376_128706172 126
560 3300017792 Ga0163161_10177907 Ga0163161_101779072 126
561 3300025321 Ga0207656_10011064 Ga0207656_100110644 126
562 3300025321 Ga0207656_10464349 Ga0207656_104643492 126
563 3300025885 Ga0207653_10001669 Ga0207653_100016695 126
564 3300025898 Ga0207692_10003480 Ga0207692_100034806 126
565 3300025899 Ga0207642_10011346 Ga0207642_100113461 126
566 3300025900 Ga0207710_10005058 Ga0207710_100050585 126
567 3300025900 Ga0207710_10282202 Ga0207710_102822021 126
568 3300025901 Ga0207688_10010940 Ga0207688_100109404 126
569 3300025901 Ga0207688_10026972 Ga0207688_100269723 126
570 3300025901 Ga0207688_10177738 Ga0207688_101777381 126
571 3300025904 Ga0207647_10031056 Ga0207647_100310564 126
572 3300025904 Ga0207647_10075408 Ga0207647_100754081 126
573 3300025904 Ga0207647_10193082 Ga0207647_101930822 126
574 3300025904 Ga0207647_10408605 Ga0207647_104086052 126
575 3300025907 Ga0207645_10443085 Ga0207645_104430852 126
576 3300025908 Ga0207643_10002088 Ga0207643_100020882 126
577 3300025908 Ga0207643_10005135 Ga0207643_100051355 126
578 3300025908 Ga0207643_10046922 Ga0207643_100469222 126
579 3300025910 Ga0207684_10259573 Ga0207684_102595732 126
580 3300025911 Ga0207654_10475632 Ga0207654_104756322 126
581 3300025915 Ga0207693_10011416 Ga0207693_100114167 126
582 3300025915 Ga0207693_10607360 Ga0207693_106073603 126
583 3300025916 Ga0207663_11069062 Ga0207663_110690621 126
584 3300025917 Ga0207660_10015411 Ga0207660_100154114 126
585 3300025917 Ga0207660_10657613 Ga0207660_106576132 126
586 3300025918 Ga0207662_10018938 Ga0207662_100189386 126
587 3300025918 Ga0207662_10576610 Ga0207662_105766101 126
588 3300025919 Ga0207657_10025802 Ga0207657_100258025 126
589 3300025919 Ga0207657_10067512 Ga0207657_100675122 126
590 3300025920 Ga0207649_10202552 Ga0207649_102025522 126
591 3300025920 Ga0207649_10280891 Ga0207649_102808912 126
592 3300025921 Ga0207652_10212966 Ga0207652_102129661 126
593 3300025922 Ga0207646_10398543 Ga0207646_103985432 126
594 3300025922 Ga0207646_10738101 Ga0207646_107381012 126
595 3300025925 Ga0207650_10023167 Ga0207650_100231672 126
596 3300025925 Ga0207650_10045211 Ga0207650_100452113 126
597 3300025925 Ga0207650_10750071 Ga0207650_107500712 126
598 3300025926 Ga0207659_10067135 Ga0207659_100671353 126
599 3300025926 Ga0207659_10448620 Ga0207659_104486202 126
600 3300025926 Ga0207659_11040329 Ga0207659_110403292 126
601 3300025927 Ga0207687_10032206 Ga0207687_100322062 126
602 3300025927 Ga0207687_10072029 Ga0207687_100720292 126
603 3300025927 Ga0207687_10120279 Ga0207687_101202792 126
604 3300025927 Ga0207687_10202043 Ga0207687_102020432 126
605 3300025927 Ga0207687_10232817 Ga0207687_102328172 126
606 3300025927 Ga0207687_10379874 Ga0207687_103798742 126
607 3300025927 Ga0207687_10604053 Ga0207687_106040532 126
608 3300025927 Ga0207687_11488249 Ga0207687_114882491 126
609 3300025928 Ga0207700_10270200 Ga0207700_102702003 126
610 3300025929 Ga0207664_10011571 Ga0207664_100115715 126
611 3300025929 Ga0207664_10564380 Ga0207664_105643801 126
612 3300025929 Ga0207664_10578017 Ga0207664_105780172 126
613 3300025931 Ga0207644_10700074 Ga0207644_107000742 126
614 3300025931 Ga0207644_10818342 Ga0207644_108183422 126
615 3300025932 Ga0207690_10104757 Ga0207690_101047572 126
616 3300025932 Ga0207690_10198315 Ga0207690_101983152 126
617 3300025932 Ga0207690_10285803 Ga0207690_102858032 126
618 3300025932 Ga0207690_10442364 Ga0207690_104423642 126
619 3300025932 Ga0207690_10980249 Ga0207690_109802492 126
620 3300025933 Ga0207706_10037083 Ga0207706_100370833 126
621 3300025933 Ga0207706_10399290 Ga0207706_103992902 126
622 3300025934 Ga0207686_10007592 Ga0207686_100075926 126
623 3300025934 Ga0207686_10229718 Ga0207686_102297182 126
624 3300025934 Ga0207686_10471918 Ga0207686_104719182 126
625 3300025934 Ga0207686_10818529 Ga0207686_108185292 126
626 3300025935 Ga0207709_10002377 Ga0207709_100023774 126
627 3300025935 Ga0207709_10106544 Ga0207709_101065442 126
628 3300025935 Ga0207709_10313048 Ga0207709_103130482 126
629 3300025936 Ga0207670_10017826 Ga0207670_100178264 126
630 3300025936 Ga0207670_10038535 Ga0207670_100385354 126
631 3300025936 Ga0207670_10115103 Ga0207670_101151032 126
632 3300025937 Ga0207669_10082283 Ga0207669_100822832 126
633 3300025937 Ga0207669_10224725 Ga0207669_102247252 126
634 3300025938 Ga0207704_10022125 Ga0207704_100221252 126
635 3300025938 Ga0207704_10163764 Ga0207704_101637642 126
636 3300025940 Ga0207691_10012079 Ga0207691_100120794 126
637 3300025940 Ga0207691_10350923 Ga0207691_103509232 126
638 3300025941 Ga0207711_10118660 Ga0207711_101186603 126
639 3300025941 Ga0207711_10206620 Ga0207711_102066202 126
640 3300025941 Ga0207711_10544796 Ga0207711_105447961 126
641 3300025941 Ga0207711_10959266 Ga0207711_109592662 126
642 3300025942 Ga0207689_10024119 Ga0207689_100241193 126
643 3300025942 Ga0207689_10063355 Ga0207689_100633552 126
644 3300025942 Ga0207689_10169291 Ga0207689_101692912 126
645 3300025944 Ga0207661_10163071 Ga0207661_101630712 126
646 3300025944 Ga0207661_10287839 Ga0207661_102878392 126
647 3300025944 Ga0207661_10513505 Ga0207661_105135052 126
648 3300025944 Ga0207661_11240526 Ga0207661_112405262 126
649 3300025945 Ga0207679_10048806 Ga0207679_100488062 126
650 3300025945 Ga0207679_10103742 Ga0207679_101037422 126
651 3300025945 Ga0207679_10154960 Ga0207679_101549602 126
652 3300025945 Ga0207679_10185449 Ga0207679_101854492 126
653 3300025949 Ga0207667_10559100 Ga0207667_105591001 126
654 3300025949 Ga0207667_11821802 Ga0207667_118218022 126
655 3300025960 Ga0207651_10263577 Ga0207651_102635773 126
656 3300025960 Ga0207651_10266872 Ga0207651_102668721 126
657 3300025960 Ga0207651_10338122 Ga0207651_103381222 126
658 3300025961 Ga0207712_10032732 Ga0207712_100327324 126
659 3300025961 Ga0207712_10037324 Ga0207712_100373243 126
660 3300025961 Ga0207712_10088490 Ga0207712_100884902 126
661 3300025961 Ga0207712_10516187 Ga0207712_105161872 126
662 3300025961 Ga0207712_11889811 Ga0207712_118898111 126
663 3300025961 Ga0207712_11961828 Ga0207712_119618282 126
664 3300025972 Ga0207668_10302377 Ga0207668_103023773 126
665 3300025972 Ga0207668_10363536 Ga0207668_103635361 126
666 3300025972 Ga0207668_10413093 Ga0207668_104130932 126
667 3300025986 Ga0207658_10414449 Ga0207658_104144492 126
668 3300026023 Ga0207677_10272599 Ga0207677_102725992 126
669 3300026035 Ga0207703_10059681 Ga0207703_100596813 126
670 3300026035 Ga0207703_10114999 Ga0207703_101149992 126
671 3300026041 Ga0207639_10023770 Ga0207639_100237705 126
672 3300026041 Ga0207639_10470421 Ga0207639_104704212 126
673 3300026067 Ga0207678_10007086 Ga0207678_100070863 126
674 3300026067 Ga0207678_10043858 Ga0207678_100438582 126
675 3300026067 Ga0207678_10126560 Ga0207678_101265602 126
676 3300026067 Ga0207678_10735579 Ga0207678_107355792 126
677 3300026067 Ga0207678_11555841 Ga0207678_115558412 126
678 3300026075 Ga0207708_10001783 Ga0207708_100017833 126
679 3300026075 Ga0207708_10011411 Ga0207708_100114116 126
680 3300026075 Ga0207708_10019504 Ga0207708_100195044 126
681 3300026075 Ga0207708_11030232 Ga0207708_110302322 126
682 3300026078 Ga0207702_10062068 Ga0207702_100620684 126
683 3300026078 Ga0207702_11848342 Ga0207702_118483422 126
684 3300026088 Ga0207641_10441195 Ga0207641_104411952 126
685 3300026088 Ga0207641_10446731 Ga0207641_104467312 126
686 3300026089 Ga0207648_10002707 Ga0207648_100027074 126
687 3300026089 Ga0207648_10012528 Ga0207648_100125289 126
688 3300026089 Ga0207648_10024149 Ga0207648_100241492 126
689 3300026089 Ga0207648_10529525 Ga0207648_105295252 126
690 3300026089 Ga0207648_10835564 Ga0207648_108355642 126
691 3300026095 Ga0207676_10001154 Ga0207676_100011542 126
692 3300026095 Ga0207676_10267394 Ga0207676_102673942 126
693 3300026095 Ga0207676_10367621 Ga0207676_103676212 126
694 3300026095 Ga0207676_10556431 Ga0207676_105564312 126
695 3300026116 Ga0207674_10000474 Ga0207674_100004742 126
696 3300026116 Ga0207674_10002131 Ga0207674_1000213122 126
697 3300026116 Ga0207674_10012869 Ga0207674_1001286911 126
698 3300026116 Ga0207674_10037497 Ga0207674_100374972 126
699 3300026118 Ga0207675_100036836 Ga0207675_1000368362 126
700 3300026118 Ga0207675_100094356 Ga0207675_1000943562 126
701 3300026118 Ga0207675_100711041 Ga0207675_1007110412 126
702 3300026121 Ga0207683_10000699 Ga0207683_1000069933 126
703 3300026121 Ga0207683_10021066 Ga0207683_100210662 126
704 3300026142 Ga0207698_10112080 Ga0207698_101120802 126
705 3300026142 Ga0207698_11209321 Ga0207698_112093211 126
706 3300027907 Ga0207428_10000597 Ga0207428_1000059729 126
707 3300027907 Ga0207428_10000612 Ga0207428_1000061220 126
708 3300027907 Ga0207428_10066471 Ga0207428_100664713 126
709 3300027907 Ga0207428_10089011 Ga0207428_100890113 126
710 3300028379 Ga0268266_11646311 Ga0268266_116463112 126
711 3300028380 Ga0268265_10152651 Ga0268265_101526512 126
712 3300028380 Ga0268265_11237521 Ga0268265_112375212 126
713 3300028381 Ga0268264_10068874 Ga0268264_100688742 126
714 3300031731 Ga0307405_10089568 Ga0307405_100895682 126
715 3300031903 Ga0307407_10241833 Ga0307407_102418332 126
716 3300031911 Ga0307412_10185058 Ga0307412_101850582 126
717 3300032002 Ga0307416_100028459 Ga0307416_1000284594 126
718 3300034817 Ga0373948_0161398 Ga0373948_0161398_172_552 126
719 3300034957 Ga0373938_0111988 Ga0373938_0111988_100_480 126
720 3300035084 Ga0373928_0130745 Ga0373928_0130745_232_612 126
721 3300035091 Ga0373951_0035340 Ga0373951_0035340_239_619 126
722 3300035091 Ga0373951_0288988 Ga0373951_0288988_111_491 126
723 3300035092 Ga0373952_0087683 Ga0373952_0087683_136_516 126
724 3300035112 Ga0373932_0058294 Ga0373932_0058294_10_390 126
725 3300035114 Ga0373939_0162653 Ga0373939_0162653_368_748 126
726 3300035115 Ga0373941_0067724 Ga0373941_0067724_476_856 126
727 3300035121 Ga0373960_0037178 Ga0373960_0037178_541_921 126
728 3300035207 Ga0373942_0269420 Ga0373942_0269420_87_467 126
729 3300035241 Ga0373961_0133670 Ga0373961_0133670_376_756 126
730 3300035242 Ga0373962_0038836 Ga0373962_0038836_340_720 126
731 3300035725 Ga0373947_0787417 Ga0373947_0787417_166_546 126
732 3300037312 Ga0395899_0003576 Ga0395899_0003576_3276_3659 126
733 3300037312 Ga0395899_0005616 Ga0395899_0005616_1230_1613 126
734 3300037312 Ga0395899_0020638 Ga0395899_0020638_2381_2761 126
735 3300037312 Ga0395899_0024678 Ga0395899_0024678_3815_4195 126
736 3300037312 Ga0395899_0225812 Ga0395899_0225812_138_518 126
737 3300037312 Ga0395899_0334085 Ga0395899_0334085_273_653 126
738 3300037418 Ga0395900_0002509 Ga0395900_0002509_8959_9342 126
739 3300037418 Ga0395900_0003754 Ga0395900_0003754_14564_14944 126
740 3300037418 Ga0395900_0003775 Ga0395900_0003775_2676_3056 126
741 3300037418 Ga0395900_0006012 Ga0395900_0006012_6528_6908 126
742 3300037418 Ga0395900_0011358 Ga0395900_0011358_3466_3846 126
743 3300037418 Ga0395900_0020004 Ga0395900_0020004_3115_3498 126
744 3300037418 Ga0395900_0031122 Ga0395900_0031122_1062_1442 126
745 3300037418 Ga0395900_0044769 Ga0395900_0044769_3473_3853 126
746 3300037418 Ga0395900_0209549 Ga0395900_0209549_766_1146 126
747 3300037418 Ga0395900_0235300 Ga0395900_0235300_492_872 126
748 3300037418 Ga0395900_0489151 Ga0395900_0489151_10_390 126
749 3300037418 Ga0395900_0585106 Ga0395900_0585106_565_945 126
750 3300037418 Ga0395900_1262029 Ga0395900_1262029_109_489 126
751 3300037418 Ga0395900_1367117 Ga0395900_1367117_81_461 126
752 3300037466 Ga0395898_0008185 Ga0395898_0008185_5737_6117 126
753 3300037466 Ga0395898_0010957 Ga0395898_0010957_6012_6395 126
754 3300037466 Ga0395898_0027496 Ga0395898_0027496_3640_4020 126
755 3300037466 Ga0395898_0031515 Ga0395898_0031515_4865_5248 126
756 3300037466 Ga0395898_0091366 Ga0395898_0091366_1808_2188 126
757 3300037466 Ga0395898_0104246 Ga0395898_0104246_2177_2557 126
758 3300037466 Ga0395898_0192447 Ga0395898_0192447_164_544 126
759 3300037466 Ga0395898_0364212 Ga0395898_0364212_407_787 126
760 3300037466 Ga0395898_0383795 Ga0395898_0383795_909_1289 126
761 3300037466 Ga0395898_0575775 Ga0395898_0575775_580_960 126
762 3300037471 Ga0395905_0014012 Ga0395905_0014012_3521_3904 126
763 3300037471 Ga0395905_0017698 Ga0395905_0017698_4648_5028 126
764 3300037471 Ga0395905_0020103 Ga0395905_0020103_4725_5108 126
765 3300037471 Ga0395905_0021749 Ga0395905_0021749_2964_3344 126
766 3300037471 Ga0395905_0024628 Ga0395905_0024628_5053_5433 126
767 3300037471 Ga0395905_0073888 Ga0395905_0073888_1436_1816 126
768 3300037471 Ga0395905_0520628 Ga0395905_0520628_312_692 126
769 3300037471 Ga0395905_1167395 Ga0395905_1167395_160_540 126
770 3300038443 Ga0395901_0004795 Ga0395901_0004795_4873_5253 126
771 3300038443 Ga0395901_0014998 Ga0395901_0014998_3973_4356 126
772 3300038443 Ga0395901_0017966 Ga0395901_0017966_113_493 126
773 3300038443 Ga0395901_0019865 Ga0395901_0019865_3247_3627 126
774 3300038443 Ga0395901_0027705 Ga0395901_0027705_2207_2587 126
775 3300038443 Ga0395901_0031459 Ga0395901_0031459_2878_3258 126
776 3300038443 Ga0395901_0031768 Ga0395901_0031768_4678_5058 126
777 3300038443 Ga0395901_0036290 Ga0395901_0036290_952_1332 126
778 3300038443 Ga0395901_0087819 Ga0395901_0087819_2130_2510 126
779 3300038443 Ga0395901_0127656 Ga0395901_0127656_2213_2593 126
780 3300038443 Ga0395901_0246330 Ga0395901_0246330_140_520 126
781 3300038443 Ga0395901_0262734 Ga0395901_0262734_1326_1706 126
782 3300038443 Ga0395901_0386844 Ga0395901_0386844_315_695 126
783 3300038443 Ga0395901_0582458 Ga0395901_0582458_609_989 126
784 3300038443 Ga0395901_1440121 Ga0395901_1440121_40_420 126
785 3300041512 Ga0451853_1930551 Ga0451853_1930551_47_427 126
786 3300042003 Ga0439443_016560 Ga0439443_016560_280_660 126
787 3300042005 Ga0439448_0021437 Ga0439448_0021437_592_975 126
788 3300042008 Ga0439450_071670 Ga0439450_071670_101_481 126
789 3300042122 Ga0450920_009120 Ga0450920_009120_854_1234 126
790 3300042145 Ga0450906_015742 Ga0450906_015742_849_1229 126
791 3300042146 Ga0450907_013730 Ga0450907_013730_145_525 126
792 3300042461 Ga0439460_0017901 Ga0439460_0017901_1465_1845 126
793 3300042993 Ga0439440_0024431 Ga0439440_0024431_472_852 126
794 3300044706 Ga0466964_0133093 Ga0466964_0133093_682_1062 126
795 3300044842 Ga0466957_0934443 Ga0466957_0934443_45_485 126
796 3300044901 Ga0466960_0359287 Ga0466960_0359287_104_544 126
797 3300045051 Ga0451576_1375856 Ga0451576_1375856_80_460 126
798 3300045836 Ga0466958_0034865 Ga0466958_0034865_2365_2805 126
799 3300045976 Ga0466967_0014924 Ga0466967_0014924_5001_5441 126
800 3300045976 Ga0466967_0201087 Ga0466967_0201087_123_503 126
801 3300045976 Ga0466967_0661874 Ga0466967_0661874_41_421 126
802 3300046452 Ga0495617_173736 Ga0495617_173736_45_428 126
803 3300046454 Ga0495592_0127989 Ga0495592_0127989_466_846 126
804 3300046455 Ga0495603_0014627 Ga0495603_0014627_2908_3288 126
805 3300046455 Ga0495603_0039194 Ga0495603_0039194_996_1376 126
806 3300046455 Ga0495603_0574502 Ga0495603_0574502_73_453 126
807 3300046461 Ga0495641_0211658 Ga0495641_0211658_33_413 126
808 3300046472 Ga0495580_0285974 Ga0495580_0285974_128_508 126
809 3300046472 Ga0495580_0988039 Ga0495580_0988039_49_429 126
810 3300046473 Ga0495582_0107285 Ga0495582_0107285_708_1088 126
811 3300046474 Ga0495605_0297518 Ga0495605_0297518_270_653 126
812 3300046475 Ga0495639_0649754 Ga0495639_0649754_93_473 126
813 3300046476 Ga0495662_0236512 Ga0495662_0236512_370_750 126
814 3300046491 Ga0495584_0048320 Ga0495584_0048320_855_1235 126
815 3300046491 Ga0495584_0330213 Ga0495584_0330213_114_494 126
816 3300046491 Ga0495584_0335132 Ga0495584_0335132_63_446 126
817 3300046491 Ga0495584_0434421 Ga0495584_0434421_37_417 126
818 3300046492 Ga0495585_0074859 Ga0495585_0074859_1419_1802 126
819 3300046492 Ga0495585_0146263 Ga0495585_0146263_775_1155 126
820 3300046492 Ga0495585_0245988 Ga0495585_0245988_166_546 126
821 3300046492 Ga0495585_0420552 Ga0495585_0420552_18_398 126
822 3300046499 Ga0495594_0511504 Ga0495594_0511504_74_454 126
823 3300046500 Ga0495596_0083610 Ga0495596_0083610_783_1163 126
824 3300046500 Ga0495596_0217884 Ga0495596_0217884_307_690 126
825 3300046501 Ga0495607_0224132 Ga0495607_0224132_429_818 126
826 3300046506 Ga0495583_0195840 Ga0495583_0195840_328_711 126
827 3300046515 Ga0495620_0047100 Ga0495620_0047100_1288_1671 126
828 3300046516 Ga0495628_0657180 Ga0495628_0657180_34_420 126
829 3300046517 Ga0495630_1085894 Ga0495630_1085894_180_560 126
830 3300046518 Ga0495631_0156102 Ga0495631_0156102_187_570 126
831 3300046520 Ga0495637_0072574 Ga0495637_0072574_554_934 126
832 3300046523 Ga0495644_0102583 Ga0495644_0102583_673_1056 126
833 3300046525 Ga0495663_0041467 Ga0495663_0041467_863_1246 126
834 3300046525 Ga0495663_0070572 Ga0495663_0070572_633_1013 126
835 3300046528 Ga0495642_0023025 Ga0495642_0023025_1746_2126 126
836 3300046529 Ga0495652_0035321 Ga0495652_0035321_2396_2782 126
837 3300046529 Ga0495652_0476426 Ga0495652_0476426_224_604 126
838 3300046533 Ga0495640_0045573 Ga0495640_0045573_2406_2792 126
839 3300046536 Ga0495587_0100727 Ga0495587_0100727_619_1005 126
840 3300046538 Ga0495609_0054158 Ga0495609_0054158_1349_1732 126
841 3300046539 Ga0495621_0060833 Ga0495621_0060833_491_871 126
842 3300046558 Ga0495633_0110125 Ga0495633_0110125_140_520 126
843 3300046558 Ga0495633_0426512 Ga0495633_0426512_73_456 126
844 3300046615 Ga0495656_0330394 Ga0495656_0330394_273_680 126
845 3300046615 Ga0495656_0377606 Ga0495656_0377606_205_585 126
846 3300046615 Ga0495656_0450022 Ga0495656_0450022_257_649 126
847 3300046615 Ga0495656_0815039 Ga0495656_0815039_98_478 126
848 3300046616 Ga0495668_0104482 Ga0495668_0104482_822_1205 126
849 3300046648 Ga0495611_0034649 Ga0495611_0034649_1099_1482 126
850 3300046648 Ga0495611_0089792 Ga0495611_0089792_549_929 126
851 3300046664 Ga0495659_0145953 Ga0495659_0145953_468_848 126
852 3300046664 Ga0495659_0271383 Ga0495659_0271383_86_466 126
853 3300046664 Ga0495659_0538171 Ga0495659_0538171_87_467 126
854 3300046665 Ga0495661_0371786 Ga0495661_0371786_301_681 126
855 3300046674 Ga0495588_0283207 Ga0495588_0283207_139_519 126
856 3300046674 Ga0495588_0290126 Ga0495588_0290126_37_417 126
857 3300046680 Ga0495646_0234523 Ga0495646_0234523_93_479 126
858 3300046681 Ga0495647_0021653 Ga0495647_0021653_1724_2104 126
859 3300046689 Ga0495613_0173792 Ga0495613_0173792_1070_1450 126
860 3300046690 Ga0495624_0183391 Ga0495624_0183391_11_391 126
861 3300046691 Ga0495670_0640964 Ga0495670_0640964_158_538 126
862 3300046692 Ga0495671_0282953 Ga0495671_0282953_219_599 126
863 3300046794 Ga0495589_0212575 Ga0495589_0212575_177_560 126
864 3300046794 Ga0495589_0217617 Ga0495589_0217617_47_427 126
865 3300046810 Ga0495660_0308475 Ga0495660_0308475_228_611 126
866 3300047315 Ga0495581_0001437 Ga0495581_0001437_719_1099 126
867 3300047318 Ga0495636_0247876 Ga0495636_0247876_232_615 126
868 3300047319 Ga0495674_0014529 Ga0495674_0014529_321_707 126
869 3300047321 Ga0495676_0016250 Ga0495676_0016250_6156_6536 126
870 3300047321 Ga0495676_0099145 Ga0495676_0099145_1035_1415 126
871 3300047323 Ga0495683_0081310 Ga0495683_0081310_1043_1426 126
872 3300047444 Ga0495675_0617487 Ga0495675_0617487_54_434 126
873 3300048091 Ga0495626_0233957 Ga0495626_0233957_62_442 126
874 3300048903 Ga0496100_0025820 Ga0496100_0025820_378_758 126
875 3300048903 Ga0496100_0124230 Ga0496100_0124230_994_1374 126
876 3300048903 Ga0496100_0153973 Ga0496100_0153973_848_1228 126
877 3300048903 Ga0496100_0215911 Ga0496100_0215911_556_936 126
878 3300048903 Ga0496100_0245633 Ga0496100_0245633_190_570 126
879 3300048904 Ga0496101_0006620 Ga0496101_0006620_2628_3008 126
880 3300048904 Ga0496101_0039764 Ga0496101_0039764_524_904 126
881 3300048904 Ga0496101_0056633 Ga0496101_0056633_2410_2790 126
882 3300048904 Ga0496101_0116970 Ga0496101_0116970_523_903 126
883 3300048904 Ga0496101_0246479 Ga0496101_0246479_99_485 126
884 3300048904 Ga0496101_0486173 Ga0496101_0486173_356_736 126
885 3300048904 Ga0496101_0605690 Ga0496101_0605690_34_417 126
886 3300048905 Ga0496102_0011268 Ga0496102_0011268_5066_5446 126
887 3300048905 Ga0496102_0189247 Ga0496102_0189247_1159_1539 126
888 3300048905 Ga0496102_0471145 Ga0496102_0471145_197_577 126
889 3300048906 Ga0496103_0010249 Ga0496103_0010249_2745_3125 126
890 3300048906 Ga0496103_0065969 Ga0496103_0065969_959_1339 126
891 3300048906 Ga0496103_0086272 Ga0496103_0086272_1026_1406 126
892 3300048906 Ga0496103_0304712 Ga0496103_0304712_436_822 126
893 3300048906 Ga0496103_0854503 Ga0496103_0854503_157_537 126
894 3300048907 Ga0496104_0023003 Ga0496104_0023003_2918_3298 126
895 3300048907 Ga0496104_0049875 Ga0496104_0049875_144_524 126
896 3300048907 Ga0496104_0085119 Ga0496104_0085119_1260_1640 126
897 3300048907 Ga0496104_0156791 Ga0496104_0156791_163_543 126
898 3300048907 Ga0496104_0432369 Ga0496104_0432369_276_656 126
899 3300048908 Ga0496105_0055464 Ga0496105_0055464_579_959 126
900 3300048908 Ga0496105_0066335 Ga0496105_0066335_1606_1986 126
901 3300048908 Ga0496105_0140198 Ga0496105_0140198_594_974 126
902 3300048908 Ga0496105_0477793 Ga0496105_0477793_319_699 126
903 3300048909 Ga0496106_0047257 Ga0496106_0047257_343_723 126
904 3300048909 Ga0496106_0125317 Ga0496106_0125317_139_519 126
905 3300048909 Ga0496106_0213534 Ga0496106_0213534_225_605 126
906 3300048909 Ga0496106_0367567 Ga0496106_0367567_247_627 126
907 3300048909 Ga0496106_0803852 Ga0496106_0803852_308_688 126
908 3300048910 Ga0496107_0017318 Ga0496107_0017318_3891_4271 126
909 3300048910 Ga0496107_0025181 Ga0496107_0025181_2567_2947 126
910 3300048910 Ga0496107_0038996 Ga0496107_0038996_89_469 126
911 3300048911 Ga0496108_0012078 Ga0496108_0012078_513_893 126
912 3300048911 Ga0496108_0057536 Ga0496108_0057536_1329_1748 126
913 3300048911 Ga0496108_0061648 Ga0496108_0061648_281_661 126
914 3300048911 Ga0496108_0072694 Ga0496108_0072694_2399_2782 126
915 3300048911 Ga0496108_0113713 Ga0496108_0113713_1912_2292 126
916 3300048911 Ga0496108_0155986 Ga0496108_0155986_987_1367 126
917 3300048912 Ga0496109_0002264 Ga0496109_0002264_655_1035 126
918 3300048912 Ga0496109_0021245 Ga0496109_0021245_422_802 126
919 3300048912 Ga0496109_0032706 Ga0496109_0032706_795_1178 126
920 3300048912 Ga0496109_0043225 Ga0496109_0043225_1173_1556 126
921 3300048912 Ga0496109_0177711 Ga0496109_0177711_869_1249 126
922 3300048912 Ga0496109_0277415 Ga0496109_0277415_601_981 126
923 3300048913 Ga0496110_0015243 Ga0496110_0015243_2459_2842 126
924 3300048913 Ga0496110_0018263 Ga0496110_0018263_2737_3117 126
925 3300048913 Ga0496110_0036616 Ga0496110_0036616_1190_1570 126
926 3300048913 Ga0496110_0225600 Ga0496110_0225600_319_699 126
927 3300048914 Ga0496111_0001469 Ga0496111_0001469_9117_9497 126
928 3300048914 Ga0496111_0022743 Ga0496111_0022743_485_868 126
929 3300048914 Ga0496111_0203192 Ga0496111_0203192_104_484 126
930 3300048914 Ga0496111_0289112 Ga0496111_0289112_104_484 126
931 3300048914 Ga0496111_0590905 Ga0496111_0590905_235_615 126
932 3300048915 Ga0496112_0037870 Ga0496112_0037870_580_960 126
933 3300048915 Ga0496112_0048819 Ga0496112_0048819_3116_3496 126
934 3300048916 Ga0496113_0016652 Ga0496113_0016652_503_883 126
935 3300048916 Ga0496113_0102528 Ga0496113_0102528_927_1307 126
936 3300048916 Ga0496113_0409871 Ga0496113_0409871_567_947 126
937 3300048916 Ga0496113_0775558 Ga0496113_0775558_139_519 126
938 3300048917 Ga0496114_0003284 Ga0496114_0003284_9397_9777 126
939 3300048917 Ga0496114_0033628 Ga0496114_0033628_2917_3297 126
940 3300048917 Ga0496114_0156454 Ga0496114_0156454_1006_1386 126
941 3300048917 Ga0496114_0176375 Ga0496114_0176375_492_872 126
942 3300048917 Ga0496114_0243907 Ga0496114_0243907_667_1053 126
943 3300048917 Ga0496114_0319927 Ga0496114_0319927_251_634 126
944 3300048917 Ga0496114_0361246 Ga0496114_0361246_23_403 126
945 3300048918 Ga0496115_0007909 Ga0496115_0007909_1944_2324 126
946 3300048918 Ga0496115_0025154 Ga0496115_0025154_1746_2126 126
947 3300048918 Ga0496115_0384849 Ga0496115_0384849_703_1083 126
948 3300049568 Ga0501031_0003942 Ga0501031_0003942_8868_9248 126
949 3300049568 Ga0501031_0010352 Ga0501031_0010352_5396_5776 126
950 3300049568 Ga0501031_0104696 Ga0501031_0104696_1409_1789 126
951 3300049569 Ga0501032_0009499 Ga0501032_0009499_1669_2049 126
952 3300049569 Ga0501032_0067535 Ga0501032_0067535_1993_2373 126
953 3300049570 Ga0501033_0002792 Ga0501033_0002792_3211_3591 126
954 3300049570 Ga0501033_0019169 Ga0501033_0019169_737_1117 126
955 3300049570 Ga0501033_0022135 Ga0501033_0022135_1024_1404 126
956 3300049571 Ga0501034_0308270 Ga0501034_0308270_553_933 126
957 3300049571 Ga0501034_0331298 Ga0501034_0331298_1028_1408 126
958 3300049572 Ga0501036_0002911 Ga0501036_0002911_9521_9901 126
959 3300049572 Ga0501036_0004301 Ga0501036_0004301_3143_3523 126
960 3300049572 Ga0501036_0025742 Ga0501036_0025742_1733_2113 126
961 3300049573 Ga0501037_0015949 Ga0501037_0015949_298_678 126
962 3300049573 Ga0501037_0017091 Ga0501037_0017091_4797_5177 126
963 3300049573 Ga0501037_0068516 Ga0501037_0068516_877_1257 126
964 3300049574 Ga0501038_0016158 Ga0501038_0016158_208_588 126
965 3300049574 Ga0501038_0031091 Ga0501038_0031091_4206_4586 126
966 3300049575 Ga0501039_0005424 Ga0501039_0005424_2035_2415 126
967 3300049575 Ga0501039_0037989 Ga0501039_0037989_2064_2444 126
968 3300049575 Ga0501039_0621323 Ga0501039_0621323_334_714 126
969 3300049576 Ga0501040_0008288 Ga0501040_0008288_583_963 126
970 3300049576 Ga0501040_0008921 Ga0501040_0008921_5476_5856 126
971 3300049576 Ga0501040_0054609 Ga0501040_0054609_625_1005 126
972 3300049576 Ga0501040_0437399 Ga0501040_0437399_374_754 126
973 3300049576 Ga0501040_1041498 Ga0501040_1041498_187_576 126
974 3300049577 Ga0501041_0006011 Ga0501041_0006011_5975_6355 126
975 3300049577 Ga0501041_0028061 Ga0501041_0028061_1856_2236 126
976 3300049577 Ga0501041_0030363 Ga0501041_0030363_1705_2085 126
977 3300049577 Ga0501041_0075454 Ga0501041_0075454_1019_1399 126
978 3300049577 Ga0501041_0651929 Ga0501041_0651929_89_478 126
979 3300049578 Ga0501042_0003550 Ga0501042_0003550_3870_4250 126
980 3300049578 Ga0501042_0037872 Ga0501042_0037872_2220_2600 126
981 3300049578 Ga0501042_0886850 Ga0501042_0886850_107_487 126
982 3300049579 Ga0501043_0027956 Ga0501043_0027956_4013_4393 126
983 3300049579 Ga0501043_0034990 Ga0501043_0034990_1733_2113 126
984 3300049579 Ga0501043_0074284 Ga0501043_0074284_876_1256 126
985 3300049580 Ga0501046_0005418 Ga0501046_0005418_9625_10005 126
986 3300049580 Ga0501046_0006355 Ga0501046_0006355_8598_8978 126
987 3300049580 Ga0501046_0016160 Ga0501046_0016160_2333_2713 126
988 3300049581 Ga0501047_0084848 Ga0501047_0084848_292_672 126
989 3300049581 Ga0501047_0489418 Ga0501047_0489418_339_719 126
990 3300049582 Ga0501048_0010744 Ga0501048_0010744_5798_6178 126
991 3300049582 Ga0501048_0044270 Ga0501048_0044270_625_1005 126
992 3300049583 Ga0501067_0025932 Ga0501067_0025932_952_1332 126
993 3300049583 Ga0501067_0082087 Ga0501067_0082087_524_904 126
994 3300049584 Ga0501068_0004263 Ga0501068_0004263_4858_5238 126
995 3300049584 Ga0501068_0005313 Ga0501068_0005313_5874_6254 126
996 3300049584 Ga0501068_0012067 Ga0501068_0012067_1249_1629 126
997 3300049584 Ga0501068_0312893 Ga0501068_0312893_36_416 126
998 3300049585 Ga0501069_0003377 Ga0501069_0003377_5633_6013 126
999 3300049585 Ga0501069_0198357 Ga0501069_0198357_460_840 126
1000 3300049585 Ga0501069_0273745 Ga0501069_0273745_204_584 126
1001 3300049585 Ga0501069_0344213 Ga0501069_0344213_484_864 126
1002 3300049586 Ga0501070_0003251 Ga0501070_0003251_3366_3746 126
1003 3300049586 Ga0501070_0131948 Ga0501070_0131948_1419_1799 126
1004 3300049587 Ga0501071_0002637 Ga0501071_0002637_9375_9755 126
1005 3300049587 Ga0501071_0008478 Ga0501071_0008478_5671_6051 126
1006 3300049587 Ga0501071_0034242 Ga0501071_0034242_1215_1595 126
1007 3300049588 Ga0501072_0001947 Ga0501072_0001947_263_643 126
1008 3300049588 Ga0501072_0022807 Ga0501072_0022807_339_719 126
1009 3300049588 Ga0501072_0028314 Ga0501072_0028314_747_1127 126
1010 3300049588 Ga0501072_0127626 Ga0501072_0127626_695_1075 126
1011 3300049589 Ga0501073_0016904 Ga0501073_0016904_1906_2286 126
1012 3300049589 Ga0501073_0023276 Ga0501073_0023276_3394_3774 126
1013 3300049590 Ga0501074_0013222 Ga0501074_0013222_3770_4150 126
1014 3300049590 Ga0501074_0020299 Ga0501074_0020299_2715_3095 126
1015 3300049590 Ga0501074_1008096 Ga0501074_1008096_159_539 126
1016 3300049591 Ga0501075_0030898 Ga0501075_0030898_3556_3936 126
1017 3300049591 Ga0501075_0143708 Ga0501075_0143708_171_551 126
1018 3300049591 Ga0501075_0157933 Ga0501075_0157933_560_940 126
1019 3300049591 Ga0501075_0907903 Ga0501075_0907903_202_591 126
1020 3300049592 Ga0501076_0002533 Ga0501076_0002533_8540_8920 126
1021 3300049592 Ga0501076_0089336 Ga0501076_0089336_335_715 126
1022 3300049592 Ga0501076_0163553 Ga0501076_0163553_831_1211 126
1023 3300049592 Ga0501076_0589976 Ga0501076_0589976_22_402 126
1024 3300049593 Ga0501077_0002613 Ga0501077_0002613_4401_4781 126
1025 3300049593 Ga0501077_0030214 Ga0501077_0030214_2861_3241 126
1026 3300049593 Ga0501077_0298122 Ga0501077_0298122_504_884 126
1027 3300049593 Ga0501077_0539274 Ga0501077_0539274_34_414 126
1028 3300049741 Ga0501079_0003011 Ga0501079_0003011_8058_8438 126
1029 3300049741 Ga0501079_0004898 Ga0501079_0004898_1758_2138 126
1030 3300049741 Ga0501079_0661213 Ga0501079_0661213_153_533 126
1031 3300049742 Ga0501080_0006559 Ga0501080_0006559_7931_8311 126
1032 3300049742 Ga0501080_0084119 Ga0501080_0084119_795_1175 126
1033 3300049742 Ga0501080_0149099 Ga0501080_0149099_824_1204 126
1034 3300049743 Ga0501081_0003248 Ga0501081_0003248_7937_8317 126
1035 3300049743 Ga0501081_0008667 Ga0501081_0008667_5061_5441 126
1036 3300049743 Ga0501081_0009207 Ga0501081_0009207_5799_6179 126
1037 3300049743 Ga0501081_0516528 Ga0501081_0516528_115_495 126
1038 3300049744 Ga0501083_0006107 Ga0501083_0006107_5610_5990 126
1039 3300049744 Ga0501083_0017440 Ga0501083_0017440_2880_3260 126
1040 3300049744 Ga0501083_0059737 Ga0501083_0059737_23_403 126
1041 3300049822 Ga0501035_0033143 Ga0501035_0033143_339_719 126
1042 3300049822 Ga0501035_0044775 Ga0501035_0044775_378_758 126
1043 3300049822 Ga0501035_0098605 Ga0501035_0098605_428_808 126
1044 3300049823 Ga0501044_0042478 Ga0501044_0042478_2147_2527 126
1045 3300049823 Ga0501044_0157716 Ga0501044_0157716_1308_1688 126
1046 3300049824 Ga0501045_0004481 Ga0501045_0004481_1751_2131 126
1047 3300049824 Ga0501045_0012686 Ga0501045_0012686_335_715 126
1048 3300049824 Ga0501045_0041391 Ga0501045_0041391_2348_2728 126
1049 3300049851 Ga0501212_072943 Ga0501212_072943_46_429 126
1050 3300050492 nmdc:mga0yw44_19648_c1 nmdc:mga0yw44_19648_c1_661_1041 126
1051 3300050507 nmdc:mga05p37_134912_c1 nmdc:mga05p37_134912_c1_1440_1820 126
1052 3300050507 nmdc:mga05p37_223309_c1 nmdc:mga05p37_223309_c1_617_997 126
1053 3300050507 nmdc:mga05p37_260641_c1 nmdc:mga05p37_260641_c1_249_629 126
1054 3300050507 nmdc:mga05p37_37438_c1 nmdc:mga05p37_37438_c1_225_605 126
1055 3300050507 nmdc:mga05p37_4582_c1 nmdc:mga05p37_4582_c1_490_870 126
1056 3300050507 nmdc:mga05p37_70019_c1 nmdc:mga05p37_70019_c1_3200_3580 126
1057 3300050507 nmdc:mga05p37_97110_c1 nmdc:mga05p37_97110_c1_2108_2488 126
1058 3300050508 nmdc:mga09592_111660_c1 nmdc:mga09592_111660_c1_1650_2030 126
1059 3300050508 nmdc:mga09592_144158_c1 nmdc:mga09592_144158_c1_993_1373 126
1060 3300050508 nmdc:mga09592_48952_c1 nmdc:mga09592_48952_c1_1400_1780 126
1061 3300050509 nmdc:mga0qj67_375781_c1 nmdc:mga0qj67_375781_c1_178_558 126
1062 3300050509 nmdc:mga0qj67_4158_c1 nmdc:mga0qj67_4158_c1_8338_8718 126
1063 3300050510 nmdc:mga06r32_213841_c1 nmdc:mga06r32_213841_c1_353_733 126
1064 3300050510 nmdc:mga06r32_30480_c1 nmdc:mga06r32_30480_c1_1430_1810 126
1065 3300050511 nmdc:mga08y16_126060_c1 nmdc:mga08y16_126060_c1_1121_1501 126
1066 3300050511 nmdc:mga08y16_17248_c1 nmdc:mga08y16_17248_c1_4802_5182 126
1067 3300050511 nmdc:mga08y16_443118_c1 nmdc:mga08y16_443118_c1_118_498 126
1068 3300050511 nmdc:mga08y16_60836_c1 nmdc:mga08y16_60836_c1_825_1205 126
1069 3300050512 nmdc:mga0n895_14265_c1 nmdc:mga0n895_14265_c1_5433_5813 126
1070 3300050512 nmdc:mga0n895_1688258_c1 nmdc:mga0n895_1688258_c1_31_411 126
1071 3300050513 nmdc:mga0rr50_1847713_c1 nmdc:mga0rr50_1847713_c1_114_497 126
1072 3300050513 nmdc:mga0rr50_203522_c1 nmdc:mga0rr50_203522_c1_840_1220 126
1073 3300050514 nmdc:mga08x19_151142_c1 nmdc:mga08x19_151142_c1_1018_1398 126
1074 3300050515 nmdc:mga0a205_193435_c1 nmdc:mga0a205_193435_c1_993_1373 126
1075 3300050515 nmdc:mga0a205_24400_c1 nmdc:mga0a205_24400_c1_2690_3070 126
1076 3300050515 nmdc:mga0a205_265860_c1 nmdc:mga0a205_265860_c1_1041_1421 126
1077 3300050515 nmdc:mga0a205_51265_c1 nmdc:mga0a205_51265_c1_1586_1966 126
1078 3300050515 nmdc:mga0a205_695225_c1 nmdc:mga0a205_695225_c1_340_720 126
1079 3300054114 Ga0501084_0009530 Ga0501084_0009530_424_804 126
1080 3300054114 Ga0501084_0040993 Ga0501084_0040993_1762_2142 126
1081 3300054114 Ga0501084_0186756 Ga0501084_0186756_616_996 126
1082 3300054114 Ga0501084_0556022 Ga0501084_0556022_212_592 126
1083 3300060353 Ga0501082_0006790 Ga0501082_0006790_2121_2501 126
1084 3300060353 Ga0501082_0025916 Ga0501082_0025916_4227_4607 126
1085 3300060353 Ga0501082_0046122 Ga0501082_0046122_130_510 126
1086 3300060353 Ga0501082_0148669 Ga0501082_0148669_824_1204 126
1087 3300061734 Ga0530510_0003120 Ga0530510_0003120_7390_7770 126
1088 3300061734 Ga0530510_0009782 Ga0530510_0009782_4593_4973 126
1089 3300061734 Ga0530510_0288108 Ga0530510_0288108_695_1075 126
1090 3300061734 Ga0530510_0768076 Ga0530510_0768076_304_693 126
1091 3300061734 Ga0530510_1355551 Ga0530510_1355551_145_525 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

6

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.9816 4 121
1mav-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ 0.9756 4 121
1m5t-assembly1.cif.gz_A crystal structure of the response regulator divk 0.9744 4 122
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.974 4 121
1m5u-assembly1.cif.gz_A crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form 0.9676 4 121
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9787 4 84 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9707 3 84 3.40.50.2300
1m5uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9676 4 121 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.967 5 84 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9643 4 87 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0E3NMV5-F1-model_v4 Two-component response regulator 0.9868 4 121 GO:0000160
AF-A0A0F8Z828-F1-model_v4 Response regulatory domain-containing protein 0.9868 3 121 GO:0000160
AF-A0A2V6Q3I5-F1-model_v4 Response regulatory domain-containing protein 0.9863 2 122 GO:0000160
AF-A0A4R5DVV8-F1-model_v4 Response regulator 0.9859 4 122 GO:0000160
AF-A0A1G1FBP9-F1-model_v4 Two-component system response regulator 0.9848 2 119 GO:0000160

Feature Viewer

pLDDT pTM Quality
89.54 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map