F489874
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1091 | 371 | 1091 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100272381|Ga0070706_1002723813 |
| Length | 146 |
| Sequence | VAGERVLVVEDNEKNMKLFRDVLQAKGYRTLEATTGSRAVELAAEHSPDLVLMDIQLPDIDGVEALGRLRADARTASLPVLALTAQAMQGDRERFLAAGFDGYLSKPLNIAELVATVRQYCDGRGRCDTQAALGGAGEQQTEDGER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 194 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 195 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 213 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 214 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 215 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 216 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 217 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 218 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 219 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 220 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 221 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 355 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 371 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 9.72 |
| Rhizosphere | 89.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1006440 | 3300001978 | Bacteria | 1110 |
| 2 | JGI24744J21845_10002681 | 3300002077 | Bacteria | 3630 |
| 3 | JGI24033J26618_1001669 | 3300002155 | Bacteria | 2207 |
| 4 | JGI24742J22300_10021071 | 3300002244 | Bacteria | 1112 |
| 5 | JGI24751J29686_10000223 | 3300002459 | Bacteria | 23798 |
| 6 | JGI24751J29686_10007378 | 3300002459 | Bacteria | 2246 |
| 7 | JGI25407J50210_10000425 | 3300003373 | Bacteria | 8216 |
| 8 | Ga0070676_10516119 | 3300005328 | Bacteria | 850 |
| 9 | Ga0070683_100013383 | 3300005329 | Bacteria | 7154 |
| 10 | Ga0070683_100042976 | 3300005329 | Bacteria | 4163 |
| 11 | Ga0070690_100586048 | 3300005330 | Bacteria | 845 |
| 12 | Ga0070690_100810082 | 3300005330 | Bacteria | 727 |
| 13 | Ga0070670_100011290 | 3300005331 | Bacteria | 7635 |
| 14 | Ga0070670_100349551 | 3300005331 | Bacteria | 1299 |
| 15 | Ga0068869_100669261 | 3300005334 | Bacteria | 883 |
| 16 | Ga0070666_10039778 | 3300005335 | Bacteria | 3136 |
| 17 | Ga0070680_100010728 | 3300005336 | Bacteria | 7074 |
| 18 | Ga0070680_100213008 | 3300005336 | Bacteria | 1630 |
| 19 | Ga0070682_100005203 | 3300005337 | Bacteria | 7237 |
| 20 | Ga0070682_100809160 | 3300005337 | Bacteria | 762 |
| 21 | Ga0068868_100029932 | 3300005338 | Bacteria | 4173 |
| 22 | Ga0070660_100126703 | 3300005339 | Bacteria | 2041 |
| 23 | Ga0070660_100370265 | 3300005339 | Bacteria | 1182 |
| 24 | Ga0070660_100625583 | 3300005339 | Bacteria | 901 |
| 25 | Ga0070689_100013742 | 3300005340 | Bacteria | 5865 |
| 26 | Ga0070689_100180355 | 3300005340 | Bacteria | 1715 |
| 27 | Ga0070687_100537140 | 3300005343 | Bacteria | 793 |
| 28 | Ga0070687_101156369 | 3300005343 | Bacteria | 569 |
| 29 | Ga0070661_100159774 | 3300005344 | Bacteria | 1706 |
| 30 | Ga0070661_100677212 | 3300005344 | Bacteria | 839 |
| 31 | Ga0070661_101577090 | 3300005344 | Unclassified | 555 |
| 32 | Ga0070692_10073774 | 3300005345 | Bacteria | 1824 |
| 33 | Ga0070692_10119108 | 3300005345 | Bacteria | 1470 |
| 34 | Ga0070692_10302373 | 3300005345 | Bacteria | 977 |
| 35 | Ga0070668_100177352 | 3300005347 | Bacteria | 1738 |
| 36 | Ga0070675_100187551 | 3300005354 | Bacteria | 1791 |
| 37 | Ga0070675_100430778 | 3300005354 | Bacteria | 1180 |
| 38 | Ga0070675_101374675 | 3300005354 | Bacteria | 651 |
| 39 | Ga0070671_100303644 | 3300005355 | Bacteria | 1359 |
| 40 | Ga0070671_100308743 | 3300005355 | Unclassified | 1347 |
| 41 | Ga0070674_100006099 | 3300005356 | Bacteria | 7009 |
| 42 | Ga0070674_100014513 | 3300005356 | Bacteria | 4898 |
| 43 | Ga0070674_101115884 | 3300005356 | Bacteria | 697 |
| 44 | Ga0070673_100036857 | 3300005364 | Bacteria | 3722 |
| 45 | Ga0070673_100421497 | 3300005364 | Bacteria | 1197 |
| 46 | Ga0070688_100008183 | 3300005365 | Bacteria | 5665 |
| 47 | Ga0070688_100009091 | 3300005365 | Bacteria | 5419 |
| 48 | Ga0070688_100581586 | 3300005365 | Bacteria | 855 |
| 49 | Ga0070688_101057459 | 3300005365 | Bacteria | 647 |
| 50 | Ga0070659_100040224 | 3300005366 | Bacteria | 3652 |
| 51 | Ga0070659_100954389 | 3300005366 | Unclassified | 751 |
| 52 | Ga0070659_101573745 | 3300005366 | Bacteria | 586 |
| 53 | Ga0070667_101844135 | 3300005367 | Unclassified | 569 |
| 54 | Ga0070703_10003075 | 3300005406 | Bacteria | 4772 |
| 55 | Ga0070709_10860137 | 3300005434 | Bacteria | 715 |
| 56 | Ga0070714_100002672 | 3300005435 | Bacteria | 13132 |
| 57 | Ga0070714_100365206 | 3300005435 | Bacteria | 1358 |
| 58 | Ga0070714_100549090 | 3300005435 | Bacteria | 1106 |
| 59 | Ga0070714_100872673 | 3300005435 | Bacteria | 873 |
| 60 | Ga0070713_100034470 | 3300005436 | Bacteria | 4067 |
| 61 | Ga0070713_100226203 | 3300005436 | Bacteria | 1699 |
| 62 | Ga0070710_10007082 | 3300005437 | Bacteria | 5414 |
| 63 | Ga0070710_10573179 | 3300005437 | Bacteria | 782 |
| 64 | Ga0070701_10175250 | 3300005438 | Bacteria | 1251 |
| 65 | Ga0070701_10575077 | 3300005438 | Unclassified | 743 |
| 66 | Ga0070701_10667068 | 3300005438 | Bacteria | 696 |
| 67 | Ga0070711_100018382 | 3300005439 | Bacteria | 4462 |
| 68 | Ga0070711_100020235 | 3300005439 | Bacteria | 4285 |
| 69 | Ga0070711_100053883 | 3300005439 | Bacteria | 2774 |
| 70 | Ga0070711_100081384 | 3300005439 | Bacteria | 2308 |
| 71 | Ga0070705_100009626 | 3300005440 | Bacteria | 4809 |
| 72 | Ga0070705_100050491 | 3300005440 | Bacteria | 2420 |
| 73 | Ga0070705_100200159 | 3300005440 | Bacteria | 1368 |
| 74 | Ga0070705_100221055 | 3300005440 | Bacteria | 1311 |
| 75 | Ga0070705_100638081 | 3300005440 | Bacteria | 829 |
| 76 | Ga0070705_100702064 | 3300005440 | Unclassified | 795 |
| 77 | Ga0070700_100001522 | 3300005441 | Bacteria | 11542 |
| 78 | Ga0070700_100019689 | 3300005441 | Bacteria | 3899 |
| 79 | Ga0070700_100683667 | 3300005441 | Bacteria | 814 |
| 80 | Ga0070694_100019660 | 3300005444 | Bacteria | 4298 |
| 81 | Ga0070694_100306859 | 3300005444 | Unclassified | 1218 |
| 82 | Ga0070708_100006168 | 3300005445 | Bacteria | 9533 |
| 83 | Ga0070708_100010959 | 3300005445 | Bacteria | 7365 |
| 84 | Ga0070708_100173553 | 3300005445 | Bacteria | 2014 |
| 85 | Ga0070708_101247196 | 3300005445 | Bacteria | 695 |
| 86 | Ga0070663_100007368 | 3300005455 | Bacteria | 6693 |
| 87 | Ga0070663_100508960 | 3300005455 | Bacteria | 1001 |
| 88 | Ga0070663_100529554 | 3300005455 | Bacteria | 982 |
| 89 | Ga0070663_100952762 | 3300005455 | Bacteria | 744 |
| 90 | Ga0070678_100001885 | 3300005456 | Bacteria | 11318 |
| 91 | Ga0070678_100080894 | 3300005456 | Bacteria | 2461 |
| 92 | Ga0070678_100900398 | 3300005456 | Bacteria | 809 |
| 93 | Ga0070662_100024483 | 3300005457 | Bacteria | 4159 |
| 94 | Ga0070662_100054330 | 3300005457 | Bacteria | 2902 |
| 95 | Ga0068867_100002812 | 3300005459 | Bacteria | 12234 |
| 96 | Ga0068867_100025980 | 3300005459 | Bacteria | 4201 |
| 97 | Ga0068867_100037053 | 3300005459 | Bacteria | 3543 |
| 98 | Ga0070685_10014113 | 3300005466 | Bacteria | 4225 |
| 99 | Ga0070685_10099905 | 3300005466 | Bacteria | 1771 |
| 100 | Ga0070685_10482302 | 3300005466 | Bacteria | 874 |
| 101 | Ga0070685_10529601 | 3300005466 | Bacteria | 838 |
| 102 | Ga0070706_100000265 | 3300005467 | Bacteria | 63782 |
| 103 | Ga0070706_100016294 | 3300005467 | Bacteria | 6867 |
| 104 | Ga0070706_100258090 | 3300005467 | Bacteria | 1627 |
| 105 | Ga0070706_100272381 | 3300005467 | Bacteria | 1580 |
| 106 | Ga0070706_100335891 | 3300005467 | Bacteria | 1409 |
| 107 | Ga0070706_101339102 | 3300005467 | Bacteria | 656 |
| 108 | Ga0070707_100003506 | 3300005468 | Bacteria | 14806 |
| 109 | Ga0070707_100328567 | 3300005468 | Bacteria | 1486 |
| 110 | Ga0070707_101989904 | 3300005468 | Unclassified | 548 |
| 111 | Ga0070698_100054382 | 3300005471 | Bacteria | 4064 |
| 112 | Ga0070698_100206090 | 3300005471 | Bacteria | 1901 |
| 113 | Ga0070698_100424142 | 3300005471 | Bacteria | 1265 |
| 114 | Ga0070698_100656962 | 3300005471 | Bacteria | 990 |
| 115 | Ga0070698_100905513 | 3300005471 | Unclassified | 828 |
| 116 | Ga0070698_101499891 | 3300005471 | Bacteria | 626 |
| 117 | Ga0070699_100040001 | 3300005518 | Bacteria | 4060 |
| 118 | Ga0070699_100205509 | 3300005518 | Bacteria | 1752 |
| 119 | Ga0070699_100670809 | 3300005518 | Bacteria | 947 |
| 120 | Ga0070679_100191341 | 3300005530 | Bacteria | 2015 |
| 121 | Ga0070679_101635771 | 3300005530 | Bacteria | 592 |
| 122 | Ga0070684_100000718 | 3300005535 | Bacteria | 22923 |
| 123 | Ga0070684_100008288 | 3300005535 | Bacteria | 8118 |
| 124 | Ga0070684_100042878 | 3300005535 | Bacteria | 3907 |
| 125 | Ga0070697_100021631 | 3300005536 | Bacteria | 5098 |
| 126 | Ga0070697_100076109 | 3300005536 | Bacteria | 2760 |
| 127 | Ga0070697_100140243 | 3300005536 | Unclassified | 2033 |
| 128 | Ga0070697_101403352 | 3300005536 | Unclassified | 624 |
| 129 | Ga0068853_100299142 | 3300005539 | Bacteria | 1487 |
| 130 | Ga0070672_100011868 | 3300005543 | Bacteria | 6088 |
| 131 | Ga0070686_100004420 | 3300005544 | Bacteria | 7758 |
| 132 | Ga0070686_100021094 | 3300005544 | Bacteria | 3866 |
| 133 | Ga0070686_100581643 | 3300005544 | Bacteria | 880 |
| 134 | Ga0070695_100746980 | 3300005545 | Bacteria | 780 |
| 135 | Ga0070696_100018988 | 3300005546 | Bacteria | 4653 |
| 136 | Ga0070696_100019404 | 3300005546 | Bacteria | 4604 |
| 137 | Ga0070696_100293958 | 3300005546 | Bacteria | 1242 |
| 138 | Ga0070696_100328636 | 3300005546 | Bacteria | 1179 |
| 139 | Ga0070696_100729915 | 3300005546 | Bacteria | 810 |
| 140 | Ga0070696_101462719 | 3300005546 | Bacteria | 584 |
| 141 | Ga0070693_100183653 | 3300005547 | Bacteria | 1348 |
| 142 | Ga0070665_100108249 | 3300005548 | Bacteria | 2782 |
| 143 | Ga0070704_100001582 | 3300005549 | Bacteria | 12291 |
| 144 | Ga0070704_100239069 | 3300005549 | Bacteria | 1485 |
| 145 | Ga0070704_100691769 | 3300005549 | Bacteria | 903 |
| 146 | Ga0068855_102283690 | 3300005563 | Bacteria | 542 |
| 147 | Ga0070664_100019961 | 3300005564 | Bacteria | 5517 |
| 148 | Ga0070664_100098038 | 3300005564 | Bacteria | 2546 |
| 149 | Ga0070664_100233888 | 3300005564 | Bacteria | 1648 |
| 150 | Ga0070664_100605125 | 3300005564 | Unclassified | 1017 |
| 151 | Ga0070664_101297518 | 3300005564 | Bacteria | 687 |
| 152 | Ga0068857_100022262 | 3300005577 | Bacteria | 5575 |
| 153 | Ga0068857_100027256 | 3300005577 | Bacteria | 5039 |
| 154 | Ga0068857_100158141 | 3300005577 | Bacteria | 2055 |
| 155 | Ga0068857_100705252 | 3300005577 | Bacteria | 959 |
| 156 | Ga0068854_100489844 | 3300005578 | Bacteria | 1034 |
| 157 | Ga0068854_100758406 | 3300005578 | Unclassified | 842 |
| 158 | Ga0068856_100051292 | 3300005614 | Bacteria | 4068 |
| 159 | Ga0068856_100087246 | 3300005614 | Bacteria | 3102 |
| 160 | Ga0068856_100577133 | 3300005614 | Bacteria | 1146 |
| 161 | Ga0070702_100145703 | 3300005615 | Bacteria | 1514 |
| 162 | Ga0070702_100186433 | 3300005615 | Bacteria | 1362 |
| 163 | Ga0070702_100236549 | 3300005615 | Bacteria | 1230 |
| 164 | Ga0070702_100680672 | 3300005615 | Bacteria | 782 |
| 165 | Ga0070702_100835249 | 3300005615 | Bacteria | 715 |
| 166 | Ga0068852_101768244 | 3300005616 | Bacteria | 641 |
| 167 | Ga0068859_100042738 | 3300005617 | Bacteria | 4553 |
| 168 | Ga0068859_100653203 | 3300005617 | Bacteria | 1144 |
| 169 | Ga0068859_100797774 | 3300005617 | Bacteria | 1032 |
| 170 | Ga0068859_101013963 | 3300005617 | Bacteria | 912 |
| 171 | Ga0068864_100103778 | 3300005618 | Bacteria | 2524 |
| 172 | Ga0068864_101295310 | 3300005618 | Bacteria | 729 |
| 173 | Ga0068866_10004917 | 3300005718 | Bacteria | 5494 |
| 174 | Ga0068861_100004620 | 3300005719 | Bacteria | 9242 |
| 175 | Ga0068861_100066704 | 3300005719 | Bacteria | 2775 |
| 176 | Ga0068861_100608497 | 3300005719 | Unclassified | 1004 |
| 177 | Ga0068861_100842984 | 3300005719 | Bacteria | 863 |
| 178 | Ga0068851_10429055 | 3300005834 | Unclassified | 782 |
| 179 | Ga0068870_10004753 | 3300005840 | Bacteria | 5871 |
| 180 | Ga0068870_10007440 | 3300005840 | Bacteria | 4881 |
| 181 | Ga0068870_10095903 | 3300005840 | Bacteria | 1667 |
| 182 | Ga0068870_10327392 | 3300005840 | Bacteria | 975 |
| 183 | Ga0068863_100028952 | 3300005841 | Bacteria | 5290 |
| 184 | Ga0068863_100468397 | 3300005841 | Unclassified | 1238 |
| 185 | Ga0068863_100858325 | 3300005841 | Bacteria | 907 |
| 186 | Ga0068863_101947726 | 3300005841 | Bacteria | 598 |
| 187 | Ga0068858_100040973 | 3300005842 | Bacteria | 4296 |
| 188 | Ga0068860_100136828 | 3300005843 | Bacteria | 2353 |
| 189 | Ga0068860_100331602 | 3300005843 | Bacteria | 1495 |
| 190 | Ga0068860_100391942 | 3300005843 | Bacteria | 1372 |
| 191 | Ga0068862_100076290 | 3300005844 | Bacteria | 2901 |
| 192 | Ga0068862_102402452 | 3300005844 | Bacteria | 539 |
| 193 | Ga0081455_10003184 | 3300005937 | Bacteria | 19049 |
| 194 | Ga0081455_10014560 | 3300005937 | Bacteria | 7700 |
| 195 | Ga0081455_10023102 | 3300005937 | Bacteria | 5793 |
| 196 | Ga0081455_10033620 | 3300005937 | Bacteria | 4606 |
| 197 | Ga0081455_10051279 | 3300005937 | Bacteria | 3540 |
| 198 | Ga0081455_10052811 | 3300005937 | Bacteria | 3476 |
| 199 | Ga0081455_10146895 | 3300005937 | Bacteria | 1823 |
| 200 | Ga0081455_10240217 | 3300005937 | Bacteria | 1332 |
| 201 | Ga0081455_10258194 | 3300005937 | Bacteria | 1270 |
| 202 | Ga0081455_10303955 | 3300005937 | Bacteria | 1143 |
| 203 | Ga0081455_10596483 | 3300005937 | Bacteria | 721 |
| 204 | Ga0081538_10003208 | 3300005981 | Bacteria | 15541 |
| 205 | Ga0081538_10098095 | 3300005981 | Bacteria | 1486 |
| 206 | Ga0081538_10191186 | 3300005981 | Bacteria | 858 |
| 207 | Ga0081540_1000879 | 3300005983 | Bacteria | 27145 |
| 208 | Ga0081539_10002754 | 3300005985 | Bacteria | 23660 |
| 209 | Ga0081539_10167839 | 3300005985 | Bacteria | 1040 |
| 210 | Ga0070717_10020221 | 3300006028 | Bacteria | 5232 |
| 211 | Ga0070717_10120096 | 3300006028 | Bacteria | 2251 |
| 212 | Ga0070717_10335052 | 3300006028 | Bacteria | 1350 |
| 213 | Ga0075365_10015406 | 3300006038 | Bacteria | 4625 |
| 214 | Ga0075365_10109483 | 3300006038 | Bacteria | 1898 |
| 215 | Ga0075364_10116426 | 3300006051 | Bacteria | 1787 |
| 216 | Ga0075432_10001799 | 3300006058 | Bacteria | 7065 |
| 217 | Ga0075432_10142691 | 3300006058 | Bacteria | 915 |
| 218 | Ga0070716_100377196 | 3300006173 | Bacteria | 1012 |
| 219 | Ga0070716_100708124 | 3300006173 | Bacteria | 770 |
| 220 | Ga0070712_100003758 | 3300006175 | Bacteria | 9352 |
| 221 | Ga0070712_100057122 | 3300006175 | Bacteria | 2740 |
| 222 | Ga0070712_100172051 | 3300006175 | Bacteria | 1681 |
| 223 | Ga0070712_101461121 | 3300006175 | Bacteria | 597 |
| 224 | Ga0075367_10324660 | 3300006178 | Bacteria | 970 |
| 225 | Ga0097621_100120527 | 3300006237 | Bacteria | 2224 |
| 226 | Ga0097621_100124068 | 3300006237 | Bacteria | 2193 |
| 227 | Ga0097621_100563304 | 3300006237 | Bacteria | 1038 |
| 228 | Ga0068871_100039897 | 3300006358 | Bacteria | 3759 |
| 229 | Ga0068871_100066036 | 3300006358 | Bacteria | 2965 |
| 230 | Ga0068871_100452313 | 3300006358 | Bacteria | 1151 |
| 231 | Ga0075428_100033997 | 3300006844 | Bacteria | 5624 |
| 232 | Ga0075428_100039421 | 3300006844 | Bacteria | 5199 |
| 233 | Ga0075428_102433309 | 3300006844 | Unclassified | 537 |
| 234 | Ga0075430_100010189 | 3300006846 | Bacteria | 7960 |
| 235 | Ga0075430_100052967 | 3300006846 | Bacteria | 3417 |
| 236 | Ga0075431_100010011 | 3300006847 | Bacteria | 9525 |
| 237 | Ga0075431_100140156 | 3300006847 | Bacteria | 2493 |
| 238 | Ga0075433_10000149 | 3300006852 | Bacteria | 37279 |
| 239 | Ga0075433_10011686 | 3300006852 | Bacteria | 7070 |
| 240 | Ga0075433_10021142 | 3300006852 | Bacteria | 5454 |
| 241 | Ga0075433_10088345 | 3300006852 | Bacteria | 2739 |
| 242 | Ga0075433_10714073 | 3300006852 | Bacteria | 878 |
| 243 | Ga0075434_100005828 | 3300006871 | Bacteria | 11253 |
| 244 | Ga0075434_100007538 | 3300006871 | Bacteria | 10078 |
| 245 | Ga0075429_100149373 | 3300006880 | Bacteria | 2046 |
| 246 | Ga0075429_100250488 | 3300006880 | Bacteria | 1551 |
| 247 | Ga0068865_100011942 | 3300006881 | Bacteria | 5453 |
| 248 | Ga0068865_100109842 | 3300006881 | Bacteria | 2033 |
| 249 | Ga0068865_100205728 | 3300006881 | Bacteria | 1531 |
| 250 | Ga0075436_100064663 | 3300006914 | Bacteria | 2529 |
| 251 | Ga0097620_100042737 | 3300006931 | Bacteria | 4553 |
| 252 | Ga0097620_100653186 | 3300006931 | Bacteria | 1144 |
| 253 | Ga0097620_100797881 | 3300006931 | Bacteria | 1032 |
| 254 | Ga0097620_101013765 | 3300006931 | Bacteria | 912 |
| 255 | Ga0075435_100032344 | 3300007076 | Bacteria | 4130 |
| 256 | Ga0105251_10050465 | 3300009011 | Bacteria | 1987 |
| 257 | Ga0111539_10080744 | 3300009094 | Bacteria | 3825 |
| 258 | Ga0111539_10082138 | 3300009094 | Bacteria | 3790 |
| 259 | Ga0111539_10177989 | 3300009094 | Bacteria | 2484 |
| 260 | Ga0111539_10284180 | 3300009094 | Bacteria | 1925 |
| 261 | Ga0111539_10295246 | 3300009094 | Bacteria | 1886 |
| 262 | Ga0105245_10044957 | 3300009098 | Bacteria | 3943 |
| 263 | Ga0105245_10046136 | 3300009098 | Bacteria | 3894 |
| 264 | Ga0105245_10063865 | 3300009098 | Bacteria | 3326 |
| 265 | Ga0105245_10554196 | 3300009098 | Bacteria | 1172 |
| 266 | Ga0105245_10617585 | 3300009098 | Bacteria | 1112 |
| 267 | Ga0105245_10623096 | 3300009098 | Bacteria | 1107 |
| 268 | Ga0105245_11075661 | 3300009098 | Bacteria | 850 |
| 269 | Ga0105245_11786312 | 3300009098 | Bacteria | 668 |
| 270 | Ga0105247_11249689 | 3300009101 | Bacteria | 594 |
| 271 | Ga0114129_10000667 | 3300009147 | Bacteria | 43086 |
| 272 | Ga0114129_10020441 | 3300009147 | Bacteria | 9415 |
| 273 | Ga0114129_10123275 | 3300009147 | Bacteria | 3565 |
| 274 | Ga0114129_10197914 | 3300009147 | Bacteria | 2724 |
| 275 | Ga0114129_10641285 | 3300009147 | Bacteria | 1372 |
| 276 | Ga0114129_10720348 | 3300009147 | Bacteria | 1280 |
| 277 | Ga0114129_10913986 | 3300009147 | Bacteria | 1111 |
| 278 | Ga0105243_10003824 | 3300009148 | Bacteria | 12041 |
| 279 | Ga0105243_10006839 | 3300009148 | Bacteria | 8790 |
| 280 | Ga0105243_10079721 | 3300009148 | Bacteria | 2669 |
| 281 | Ga0105243_10270750 | 3300009148 | Bacteria | 1525 |
| 282 | Ga0105243_10277012 | 3300009148 | Bacteria | 1509 |
| 283 | Ga0105243_10813467 | 3300009148 | Bacteria | 922 |
| 284 | Ga0105243_11332978 | 3300009148 | Unclassified | 736 |
| 285 | Ga0105243_11545768 | 3300009148 | Bacteria | 689 |
| 286 | Ga0105243_12675507 | 3300009148 | Bacteria | 539 |
| 287 | Ga0105241_10517329 | 3300009174 | Bacteria | 1067 |
| 288 | Ga0105241_10563126 | 3300009174 | Unclassified | 1025 |
| 289 | Ga0105241_10828537 | 3300009174 | Bacteria | 854 |
| 290 | Ga0105242_10003423 | 3300009176 | Bacteria | 12337 |
| 291 | Ga0105242_10009376 | 3300009176 | Bacteria | 7511 |
| 292 | Ga0105242_10029108 | 3300009176 | Bacteria | 4403 |
| 293 | Ga0105242_10410948 | 3300009176 | Bacteria | 1266 |
| 294 | Ga0105242_10678008 | 3300009176 | Bacteria | 1006 |
| 295 | Ga0105242_10679999 | 3300009176 | Bacteria | 1004 |
| 296 | Ga0105242_12569020 | 3300009176 | Bacteria | 558 |
| 297 | Ga0105248_10031295 | 3300009177 | Bacteria | 5947 |
| 298 | Ga0105248_10413998 | 3300009177 | Bacteria | 1518 |
| 299 | Ga0105248_10753334 | 3300009177 | Bacteria | 1099 |
| 300 | Ga0105248_11982503 | 3300009177 | Bacteria | 661 |
| 301 | Ga0105237_11507369 | 3300009545 | Bacteria | 679 |
| 302 | Ga0105238_10015628 | 3300009551 | Bacteria | 7682 |
| 303 | Ga0105238_12327621 | 3300009551 | Bacteria | 571 |
| 304 | Ga0105249_10001792 | 3300009553 | Bacteria | 18700 |
| 305 | Ga0105249_10059717 | 3300009553 | Bacteria | 3498 |
| 306 | Ga0105249_10123526 | 3300009553 | Bacteria | 2463 |
| 307 | Ga0105249_10606560 | 3300009553 | Bacteria | 1150 |
| 308 | Ga0105249_10703427 | 3300009553 | Bacteria | 1071 |
| 309 | Ga0105239_10170095 | 3300010375 | Bacteria | 2436 |
| 310 | Ga0105239_10224033 | 3300010375 | Bacteria | 2109 |
| 311 | Ga0105239_10258081 | 3300010375 | Bacteria | 1958 |
| 312 | Ga0105239_10501726 | 3300010375 | Bacteria | 1379 |
| 313 | Ga0105246_10022863 | 3300011119 | Bacteria | 4040 |
| 314 | Ga0105246_10298873 | 3300011119 | Bacteria | 1299 |
| 315 | Ga0105246_10556720 | 3300011119 | Bacteria | 984 |
| 316 | Ga0105246_10903332 | 3300011119 | Bacteria | 792 |
| 317 | Ga0105246_10983809 | 3300011119 | Bacteria | 763 |
| 318 | Ga0157373_10106315 | 3300013100 | Bacteria | 1973 |
| 319 | Ga0157371_10624445 | 3300013102 | Bacteria | 803 |
| 320 | Ga0157369_12455320 | 3300013105 | Unclassified | 528 |
| 321 | Ga0157374_10175068 | 3300013296 | Bacteria | 2094 |
| 322 | Ga0157374_10458172 | 3300013296 | Bacteria | 1277 |
| 323 | Ga0157374_10491150 | 3300013296 | Bacteria | 1231 |
| 324 | Ga0157374_10983492 | 3300013296 | Bacteria | 863 |
| 325 | Ga0157378_10004712 | 3300013297 | Bacteria | 11959 |
| 326 | Ga0157378_10179344 | 3300013297 | Bacteria | 1992 |
| 327 | Ga0157378_10376892 | 3300013297 | Bacteria | 1392 |
| 328 | Ga0157378_11334808 | 3300013297 | Bacteria | 759 |
| 329 | Ga0163162_10005507 | 3300013306 | Bacteria | 12239 |
| 330 | Ga0163162_10201780 | 3300013306 | Bacteria | 2117 |
| 331 | Ga0163162_11793284 | 3300013306 | Bacteria | 701 |
| 332 | Ga0163162_11821100 | 3300013306 | Unclassified | 696 |
| 333 | Ga0163162_12488470 | 3300013306 | Bacteria | 595 |
| 334 | Ga0157372_10722465 | 3300013307 | Bacteria | 1159 |
| 335 | Ga0157375_10234330 | 3300013308 | Bacteria | 1995 |
| 336 | Ga0157375_10540395 | 3300013308 | Bacteria | 1328 |
| 337 | Ga0157375_10655271 | 3300013308 | Unclassified | 1206 |
| 338 | Ga0157375_11554919 | 3300013308 | Unclassified | 781 |
| 339 | Ga0163163_10263831 | 3300014325 | Bacteria | 1773 |
| 340 | Ga0163163_10738138 | 3300014325 | Bacteria | 1048 |
| 341 | Ga0157380_10025600 | 3300014326 | Bacteria | 4476 |
| 342 | Ga0157380_10141442 | 3300014326 | Unclassified | 2068 |
| 343 | Ga0157380_11062905 | 3300014326 | Bacteria | 846 |
| 344 | Ga0157380_11130707 | 3300014326 | Bacteria | 824 |
| 345 | Ga0157380_11343311 | 3300014326 | Bacteria | 763 |
| 346 | Ga0157380_11825536 | 3300014326 | Bacteria | 667 |
| 347 | Ga0182008_10172334 | 3300014497 | Bacteria | 1093 |
| 348 | Ga0182008_10605403 | 3300014497 | Bacteria | 615 |
| 349 | Ga0157377_10004589 | 3300014745 | Bacteria | 6382 |
| 350 | Ga0157377_10037023 | 3300014745 | Bacteria | 2687 |
| 351 | Ga0157377_10319413 | 3300014745 | Bacteria | 1031 |
| 352 | Ga0157377_10397180 | 3300014745 | Bacteria | 938 |
| 353 | Ga0157377_10782750 | 3300014745 | Unclassified | 701 |
| 354 | Ga0157377_11062873 | 3300014745 | Bacteria | 617 |
| 355 | Ga0157379_10101297 | 3300014968 | Bacteria | 2585 |
| 356 | Ga0157379_10567811 | 3300014968 | Bacteria | 1057 |
| 357 | Ga0157379_10914341 | 3300014968 | Bacteria | 833 |
| 358 | Ga0157379_11483912 | 3300014968 | Bacteria | 659 |
| 359 | Ga0157376_10195562 | 3300014969 | Bacteria | 1857 |
| 360 | Ga0157376_10323551 | 3300014969 | Bacteria | 1467 |
| 361 | Ga0157376_11042648 | 3300014969 | Bacteria | 842 |
| 362 | Ga0157376_12870617 | 3300014969 | Unclassified | 521 |
| 363 | Ga0163161_10177907 | 3300017792 | Bacteria | 1629 |
| 364 | Ga0207656_10011064 | 3300025321 | Bacteria | 3399 |
| 365 | Ga0207656_10464349 | 3300025321 | Unclassified | 640 |
| 366 | Ga0207653_10001669 | 3300025885 | Bacteria | 7115 |
| 367 | Ga0207692_10003480 | 3300025898 | Bacteria | 6153 |
| 368 | Ga0207692_10164973 | 3300025898 | Bacteria | 1280 |
| 369 | Ga0207642_10011346 | 3300025899 | Bacteria | 3174 |
| 370 | Ga0207642_10488668 | 3300025899 | Bacteria | 752 |
| 371 | Ga0207710_10005058 | 3300025900 | Bacteria | 5714 |
| 372 | Ga0207710_10282202 | 3300025900 | Bacteria | 836 |
| 373 | Ga0207688_10010940 | 3300025901 | Bacteria | 4937 |
| 374 | Ga0207688_10026972 | 3300025901 | Bacteria | 3159 |
| 375 | Ga0207688_10177738 | 3300025901 | Bacteria | 1268 |
| 376 | Ga0207647_10031056 | 3300025904 | Bacteria | 3441 |
| 377 | Ga0207647_10075408 | 3300025904 | Bacteria | 2030 |
| 378 | Ga0207647_10193082 | 3300025904 | Bacteria | 1179 |
| 379 | Ga0207647_10408605 | 3300025904 | Bacteria | 764 |
| 380 | Ga0207645_10443085 | 3300025907 | Bacteria | 876 |
| 381 | Ga0207643_10002088 | 3300025908 | Bacteria | 11006 |
| 382 | Ga0207643_10005135 | 3300025908 | Bacteria | 7003 |
| 383 | Ga0207643_10046922 | 3300025908 | Bacteria | 2442 |
| 384 | Ga0207684_10000221 | 3300025910 | Bacteria | 87708 |
| 385 | Ga0207684_10034243 | 3300025910 | Bacteria | 4317 |
| 386 | Ga0207684_10259573 | 3300025910 | Bacteria | 1499 |
| 387 | Ga0207654_10475632 | 3300025911 | Bacteria | 879 |
| 388 | Ga0207693_10002613 | 3300025915 | Bacteria | 15647 |
| 389 | Ga0207693_10011416 | 3300025915 | Bacteria | 7192 |
| 390 | Ga0207693_10034709 | 3300025915 | Bacteria | 3978 |
| 391 | Ga0207693_10185557 | 3300025915 | Bacteria | 1637 |
| 392 | Ga0207693_10294814 | 3300025915 | Bacteria | 1271 |
| 393 | Ga0207693_10607360 | 3300025915 | Bacteria | 851 |
| 394 | Ga0207663_10010873 | 3300025916 | Bacteria | 4861 |
| 395 | Ga0207663_10464508 | 3300025916 | Bacteria | 978 |
| 396 | Ga0207663_11069062 | 3300025916 | Unclassified | 648 |
| 397 | Ga0207660_10015411 | 3300025917 | Bacteria | 5044 |
| 398 | Ga0207660_10657613 | 3300025917 | Bacteria | 854 |
| 399 | Ga0207662_10018938 | 3300025918 | Bacteria | 3910 |
| 400 | Ga0207662_10576610 | 3300025918 | Bacteria | 781 |
| 401 | Ga0207657_10025802 | 3300025919 | Bacteria | 5412 |
| 402 | Ga0207657_10067512 | 3300025919 | Bacteria | 3041 |
| 403 | Ga0207649_10202552 | 3300025920 | Bacteria | 1403 |
| 404 | Ga0207649_10280891 | 3300025920 | Bacteria | 1210 |
| 405 | Ga0207649_10473698 | 3300025920 | Bacteria | 948 |
| 406 | Ga0207652_10212966 | 3300025921 | Bacteria | 1740 |
| 407 | Ga0207646_10004631 | 3300025922 | Bacteria | 14854 |
| 408 | Ga0207646_10185660 | 3300025922 | Bacteria | 1878 |
| 409 | Ga0207646_10398543 | 3300025922 | Bacteria | 1243 |
| 410 | Ga0207646_10738101 | 3300025922 | Bacteria | 879 |
| 411 | Ga0207650_10023167 | 3300025925 | Bacteria | 4403 |
| 412 | Ga0207650_10045211 | 3300025925 | Bacteria | 3239 |
| 413 | Ga0207650_10750071 | 3300025925 | Bacteria | 826 |
| 414 | Ga0207659_10067135 | 3300025926 | Bacteria | 2605 |
| 415 | Ga0207659_10448620 | 3300025926 | Bacteria | 1086 |
| 416 | Ga0207659_11040329 | 3300025926 | Bacteria | 705 |
| 417 | Ga0207687_10032206 | 3300025927 | Bacteria | 3549 |
| 418 | Ga0207687_10072029 | 3300025927 | Bacteria | 2471 |
| 419 | Ga0207687_10120279 | 3300025927 | Bacteria | 1963 |
| 420 | Ga0207687_10202043 | 3300025927 | Bacteria | 1554 |
| 421 | Ga0207687_10232817 | 3300025927 | Bacteria | 1456 |
| 422 | Ga0207687_10379874 | 3300025927 | Bacteria | 1157 |
| 423 | Ga0207687_10604053 | 3300025927 | Bacteria | 925 |
| 424 | Ga0207687_11152570 | 3300025927 | Bacteria | 666 |
| 425 | Ga0207687_11488249 | 3300025927 | Unclassified | 582 |
| 426 | Ga0207700_10216674 | 3300025928 | Bacteria | 1621 |
| 427 | Ga0207700_10270200 | 3300025928 | Bacteria | 1459 |
| 428 | Ga0207700_10600136 | 3300025928 | Bacteria | 980 |
| 429 | Ga0207664_10011571 | 3300025929 | Bacteria | 6282 |
| 430 | Ga0207664_10564380 | 3300025929 | Bacteria | 1022 |
| 431 | Ga0207664_10578017 | 3300025929 | Bacteria | 1009 |
| 432 | Ga0207644_10311452 | 3300025931 | Unclassified | 1271 |
| 433 | Ga0207644_10700074 | 3300025931 | Bacteria | 845 |
| 434 | Ga0207644_10818342 | 3300025931 | Bacteria | 779 |
| 435 | Ga0207690_10104757 | 3300025932 | Bacteria | 2027 |
| 436 | Ga0207690_10198315 | 3300025932 | Bacteria | 1522 |
| 437 | Ga0207690_10285803 | 3300025932 | Bacteria | 1286 |
| 438 | Ga0207690_10442364 | 3300025932 | Bacteria | 1043 |
| 439 | Ga0207690_10980249 | 3300025932 | Bacteria | 703 |
| 440 | Ga0207706_10037083 | 3300025933 | Bacteria | 4329 |
| 441 | Ga0207706_10399290 | 3300025933 | Bacteria | 1192 |
| 442 | Ga0207686_10007592 | 3300025934 | Bacteria | 5842 |
| 443 | Ga0207686_10229718 | 3300025934 | Bacteria | 1344 |
| 444 | Ga0207686_10471918 | 3300025934 | Bacteria | 969 |
| 445 | Ga0207686_10818529 | 3300025934 | Bacteria | 747 |
| 446 | Ga0207709_10002377 | 3300025935 | Bacteria | 11868 |
| 447 | Ga0207709_10106544 | 3300025935 | Bacteria | 1865 |
| 448 | Ga0207709_10313048 | 3300025935 | Bacteria | 1172 |
| 449 | Ga0207709_10488070 | 3300025935 | Bacteria | 959 |
| 450 | Ga0207670_10017826 | 3300025936 | Bacteria | 4300 |
| 451 | Ga0207670_10038535 | 3300025936 | Bacteria | 3123 |
| 452 | Ga0207670_10115103 | 3300025936 | Bacteria | 1945 |
| 453 | Ga0207670_11639789 | 3300025936 | Bacteria | 547 |
| 454 | Ga0207669_10082283 | 3300025937 | Bacteria | 2066 |
| 455 | Ga0207669_10224725 | 3300025937 | Bacteria | 1380 |
| 456 | Ga0207704_10022125 | 3300025938 | Bacteria | 3400 |
| 457 | Ga0207704_10163764 | 3300025938 | Bacteria | 1586 |
| 458 | Ga0207691_10012079 | 3300025940 | Bacteria | 8282 |
| 459 | Ga0207691_10350923 | 3300025940 | Bacteria | 1262 |
| 460 | Ga0207711_10118660 | 3300025941 | Bacteria | 2360 |
| 461 | Ga0207711_10206620 | 3300025941 | Bacteria | 1793 |
| 462 | Ga0207711_10544796 | 3300025941 | Bacteria | 1082 |
| 463 | Ga0207711_10959266 | 3300025941 | Bacteria | 794 |
| 464 | Ga0207689_10024119 | 3300025942 | Bacteria | 5104 |
| 465 | Ga0207689_10063355 | 3300025942 | Bacteria | 3042 |
| 466 | Ga0207689_10169291 | 3300025942 | Bacteria | 1800 |
| 467 | Ga0207689_10432260 | 3300025942 | Bacteria | 1099 |
| 468 | Ga0207661_10032234 | 3300025944 | Bacteria | 4058 |
| 469 | Ga0207661_10163071 | 3300025944 | Bacteria | 1935 |
| 470 | Ga0207661_10287839 | 3300025944 | Bacteria | 1470 |
| 471 | Ga0207661_10442349 | 3300025944 | Bacteria | 1183 |
| 472 | Ga0207661_10513505 | 3300025944 | Bacteria | 1095 |
| 473 | Ga0207661_11240526 | 3300025944 | Bacteria | 686 |
| 474 | Ga0207679_10048806 | 3300025945 | Bacteria | 3084 |
| 475 | Ga0207679_10103742 | 3300025945 | Bacteria | 2229 |
| 476 | Ga0207679_10154960 | 3300025945 | Bacteria | 1869 |
| 477 | Ga0207679_10185449 | 3300025945 | Bacteria | 1725 |
| 478 | Ga0207667_10559100 | 3300025949 | Bacteria | 1156 |
| 479 | Ga0207667_11821802 | 3300025949 | Bacteria | 572 |
| 480 | Ga0207651_10263577 | 3300025960 | Bacteria | 1416 |
| 481 | Ga0207651_10266872 | 3300025960 | Bacteria | 1408 |
| 482 | Ga0207651_10338122 | 3300025960 | Bacteria | 1264 |
| 483 | Ga0207712_10032732 | 3300025961 | Bacteria | 3511 |
| 484 | Ga0207712_10037324 | 3300025961 | Bacteria | 3314 |
| 485 | Ga0207712_10088490 | 3300025961 | Bacteria | 2274 |
| 486 | Ga0207712_10516187 | 3300025961 | Bacteria | 1023 |
| 487 | Ga0207712_11889811 | 3300025961 | Bacteria | 535 |
| 488 | Ga0207712_11961828 | 3300025961 | Bacteria | 524 |
| 489 | Ga0207668_10302377 | 3300025972 | Bacteria | 1321 |
| 490 | Ga0207668_10363536 | 3300025972 | Bacteria | 1213 |
| 491 | Ga0207668_10413093 | 3300025972 | Bacteria | 1144 |
| 492 | Ga0207658_10414449 | 3300025986 | Bacteria | 1187 |
| 493 | Ga0207677_10272599 | 3300026023 | Bacteria | 1385 |
| 494 | Ga0207703_10059681 | 3300026035 | Bacteria | 3116 |
| 495 | Ga0207703_10114999 | 3300026035 | Bacteria | 2301 |
| 496 | Ga0207639_10023770 | 3300026041 | Bacteria | 4427 |
| 497 | Ga0207639_10470421 | 3300026041 | Bacteria | 1144 |
| 498 | Ga0207678_10007086 | 3300026067 | Bacteria | 9947 |
| 499 | Ga0207678_10043858 | 3300026067 | Bacteria | 3869 |
| 500 | Ga0207678_10126560 | 3300026067 | Bacteria | 2179 |
| 501 | Ga0207678_10735579 | 3300026067 | Bacteria | 869 |
| 502 | Ga0207678_11555841 | 3300026067 | Bacteria | 583 |
| 503 | Ga0207708_10001783 | 3300026075 | Bacteria | 15882 |
| 504 | Ga0207708_10011411 | 3300026075 | Bacteria | 6616 |
| 505 | Ga0207708_10019504 | 3300026075 | Bacteria | 5113 |
| 506 | Ga0207708_11030232 | 3300026075 | Bacteria | 716 |
| 507 | Ga0207702_10062068 | 3300026078 | Bacteria | 3190 |
| 508 | Ga0207702_10209821 | 3300026078 | Bacteria | 1810 |
| 509 | Ga0207702_11848342 | 3300026078 | Bacteria | 596 |
| 510 | Ga0207641_10441195 | 3300026088 | Bacteria | 1256 |
| 511 | Ga0207641_10446731 | 3300026088 | Bacteria | 1249 |
| 512 | Ga0207641_12163260 | 3300026088 | Bacteria | 557 |
| 513 | Ga0207648_10002707 | 3300026089 | Bacteria | 18858 |
| 514 | Ga0207648_10012528 | 3300026089 | Bacteria | 7936 |
| 515 | Ga0207648_10024149 | 3300026089 | Bacteria | 5431 |
| 516 | Ga0207648_10529525 | 3300026089 | Bacteria | 1080 |
| 517 | Ga0207648_10835564 | 3300026089 | Unclassified | 859 |
| 518 | Ga0207648_11843272 | 3300026089 | Bacteria | 566 |
| 519 | Ga0207676_10001154 | 3300026095 | Bacteria | 19868 |
| 520 | Ga0207676_10267394 | 3300026095 | Bacteria | 1547 |
| 521 | Ga0207676_10367621 | 3300026095 | Bacteria | 1335 |
| 522 | Ga0207676_10556431 | 3300026095 | Bacteria | 1096 |
| 523 | Ga0207674_10000474 | 3300026116 | Bacteria | 52766 |
| 524 | Ga0207674_10002131 | 3300026116 | Bacteria | 25008 |
| 525 | Ga0207674_10012869 | 3300026116 | Bacteria | 9337 |
| 526 | Ga0207674_10037497 | 3300026116 | Bacteria | 5041 |
| 527 | Ga0207675_100036836 | 3300026118 | Bacteria | 4563 |
| 528 | Ga0207675_100094356 | 3300026118 | Bacteria | 2815 |
| 529 | Ga0207675_100621125 | 3300026118 | Bacteria | 1085 |
| 530 | Ga0207675_100711041 | 3300026118 | Bacteria | 1014 |
| 531 | Ga0207683_10000699 | 3300026121 | Bacteria | 30634 |
| 532 | Ga0207683_10021066 | 3300026121 | Bacteria | 5579 |
| 533 | Ga0207698_10112080 | 3300026142 | Bacteria | 2289 |
| 534 | Ga0207698_11209321 | 3300026142 | Bacteria | 770 |
| 535 | Ga0207428_10000597 | 3300027907 | Bacteria | 42692 |
| 536 | Ga0207428_10000612 | 3300027907 | Bacteria | 42181 |
| 537 | Ga0207428_10066471 | 3300027907 | Bacteria | 2841 |
| 538 | Ga0207428_10089011 | 3300027907 | Bacteria | 2400 |
| 539 | Ga0268266_11646311 | 3300028379 | Bacteria | 617 |
| 540 | Ga0268265_10152651 | 3300028380 | Bacteria | 1950 |
| 541 | Ga0268265_11237521 | 3300028380 | Bacteria | 745 |
| 542 | Ga0268265_12282750 | 3300028380 | Bacteria | 548 |
| 543 | Ga0268264_10068874 | 3300028381 | Bacteria | 2992 |
| 544 | Ga0307405_10089568 | 3300031731 | Bacteria | 2033 |
| 545 | Ga0307407_10241833 | 3300031903 | Bacteria | 1232 |
| 546 | Ga0307412_10185058 | 3300031911 | Bacteria | 1570 |
| 547 | Ga0307412_11177980 | 3300031911 | Bacteria | 685 |
| 548 | Ga0307416_100028459 | 3300032002 | Bacteria | 4156 |
| 549 | Ga0307416_100041206 | 3300032002 | Bacteria | 3594 |
| 550 | Ga0307415_100006911 | 3300032126 | Bacteria | 6162 |
| 551 | Ga0373948_0161398 | 3300034817 | Bacteria | 566 |
| 552 | Ga0373938_0111988 | 3300034957 | Bacteria | 696 |
| 553 | Ga0373928_0130745 | 3300035084 | Bacteria | 681 |
| 554 | Ga0373944_0368160 | 3300035089 | Unclassified | 549 |
| 555 | Ga0373951_0035340 | 3300035091 | Bacteria | 1190 |
| 556 | Ga0373951_0288988 | 3300035091 | Bacteria | 503 |
| 557 | Ga0373952_0087683 | 3300035092 | Bacteria | 804 |
| 558 | Ga0373932_0058294 | 3300035112 | Bacteria | 1167 |
| 559 | Ga0373939_0162653 | 3300035114 | Bacteria | 821 |
| 560 | Ga0373941_0067724 | 3300035115 | Bacteria | 1178 |
| 561 | Ga0373960_0037178 | 3300035121 | Bacteria | 1390 |
| 562 | Ga0373942_0269420 | 3300035207 | Bacteria | 584 |
| 563 | Ga0373961_0133670 | 3300035241 | Bacteria | 833 |
| 564 | Ga0373962_0038836 | 3300035242 | Bacteria | 1334 |
| 565 | Ga0373947_0402726 | 3300035725 | Bacteria | 923 |
| 566 | Ga0373947_0787417 | 3300035725 | Unclassified | 649 |
| 567 | Ga0395899_0003576 | 3300037312 | Bacteria | 12306 |
| 568 | Ga0395899_0005616 | 3300037312 | Bacteria | 9733 |
| 569 | Ga0395899_0020638 | 3300037312 | Bacteria | 4994 |
| 570 | Ga0395899_0024678 | 3300037312 | Bacteria | 4544 |
| 571 | Ga0395899_0225812 | 3300037312 | Bacteria | 1295 |
| 572 | Ga0395899_0334085 | 3300037312 | Bacteria | 1018 |
| 573 | Ga0395900_0002509 | 3300037418 | Bacteria | 20165 |
| 574 | Ga0395900_0003754 | 3300037418 | Bacteria | 16317 |
| 575 | Ga0395900_0003775 | 3300037418 | Bacteria | 16230 |
| 576 | Ga0395900_0006012 | 3300037418 | Bacteria | 12662 |
| 577 | Ga0395900_0011358 | 3300037418 | Bacteria | 9111 |
| 578 | Ga0395900_0020004 | 3300037418 | Bacteria | 6824 |
| 579 | Ga0395900_0025384 | 3300037418 | Bacteria | 6067 |
| 580 | Ga0395900_0031122 | 3300037418 | Bacteria | 5482 |
| 581 | Ga0395900_0044769 | 3300037418 | Bacteria | 4559 |
| 582 | Ga0395900_0209549 | 3300037418 | Bacteria | 1968 |
| 583 | Ga0395900_0235300 | 3300037418 | Bacteria | 1840 |
| 584 | Ga0395900_0489151 | 3300037418 | Bacteria | 1182 |
| 585 | Ga0395900_0585106 | 3300037418 | Bacteria | 1058 |
| 586 | Ga0395900_1262029 | 3300037418 | Bacteria | 653 |
| 587 | Ga0395900_1367117 | 3300037418 | Bacteria | 621 |
| 588 | Ga0395898_0008185 | 3300037466 | Bacteria | 11064 |
| 589 | Ga0395898_0010957 | 3300037466 | Bacteria | 9454 |
| 590 | Ga0395898_0027496 | 3300037466 | Bacteria | 5709 |
| 591 | Ga0395898_0031515 | 3300037466 | Bacteria | 5296 |
| 592 | Ga0395898_0091366 | 3300037466 | Bacteria | 2929 |
| 593 | Ga0395898_0104246 | 3300037466 | Unclassified | 2720 |
| 594 | Ga0395898_0192447 | 3300037466 | Bacteria | 1949 |
| 595 | Ga0395898_0364212 | 3300037466 | Bacteria | 1378 |
| 596 | Ga0395898_0383795 | 3300037466 | Bacteria | 1340 |
| 597 | Ga0395898_0575775 | 3300037466 | Bacteria | 1068 |
| 598 | Ga0395905_0014012 | 3300037471 | Bacteria | 7667 |
| 599 | Ga0395905_0017698 | 3300037471 | Bacteria | 6766 |
| 600 | Ga0395905_0020103 | 3300037471 | Bacteria | 6326 |
| 601 | Ga0395905_0021749 | 3300037471 | Bacteria | 6067 |
| 602 | Ga0395905_0024628 | 3300037471 | Bacteria | 5678 |
| 603 | Ga0395905_0073888 | 3300037471 | Bacteria | 3196 |
| 604 | Ga0395905_0520628 | 3300037471 | Bacteria | 1090 |
| 605 | Ga0395905_1167395 | 3300037471 | Bacteria | 673 |
| 606 | Ga0395905_1246160 | 3300037471 | Bacteria | 647 |
| 607 | Ga0395901_0004795 | 3300038443 | Bacteria | 13643 |
| 608 | Ga0395901_0014998 | 3300038443 | Bacteria | 7876 |
| 609 | Ga0395901_0017966 | 3300038443 | Bacteria | 7218 |
| 610 | Ga0395901_0019865 | 3300038443 | Bacteria | 6872 |
| 611 | Ga0395901_0027705 | 3300038443 | Bacteria | 5825 |
| 612 | Ga0395901_0031459 | 3300038443 | Bacteria | 5472 |
| 613 | Ga0395901_0031768 | 3300038443 | Bacteria | 5444 |
| 614 | Ga0395901_0036290 | 3300038443 | Bacteria | 5094 |
| 615 | Ga0395901_0054431 | 3300038443 | Bacteria | 4159 |
| 616 | Ga0395901_0087819 | 3300038443 | Bacteria | 3251 |
| 617 | Ga0395901_0127656 | 3300038443 | Bacteria | 2673 |
| 618 | Ga0395901_0246330 | 3300038443 | Bacteria | 1863 |
| 619 | Ga0395901_0262734 | 3300038443 | Bacteria | 1796 |
| 620 | Ga0395901_0386844 | 3300038443 | Bacteria | 1439 |
| 621 | Ga0395901_0582458 | 3300038443 | Bacteria | 1130 |
| 622 | Ga0395901_1440121 | 3300038443 | Bacteria | 646 |
| 623 | Ga0451849_1075940 | 3300041505 | Bacteria | 757 |
| 624 | Ga0451853_1930551 | 3300041512 | Bacteria | 532 |
| 625 | Ga0439443_016560 | 3300042003 | Bacteria | 1127 |
| 626 | Ga0439448_0021437 | 3300042005 | Bacteria | 2003 |
| 627 | Ga0439450_071670 | 3300042008 | Bacteria | 851 |
| 628 | Ga0450920_009120 | 3300042122 | Bacteria | 1824 |
| 629 | Ga0450920_058579 | 3300042122 | Bacteria | 777 |
| 630 | Ga0450906_015742 | 3300042145 | Bacteria | 1373 |
| 631 | Ga0450906_110120 | 3300042145 | Bacteria | 505 |
| 632 | Ga0450907_013730 | 3300042146 | Bacteria | 1350 |
| 633 | Ga0439460_0017901 | 3300042461 | Bacteria | 1903 |
| 634 | Ga0439440_0024431 | 3300042993 | Bacteria | 1385 |
| 635 | Ga0466969_0067182 | 3300044656 | Bacteria | 1730 |
| 636 | Ga0466965_0036296 | 3300044683 | Bacteria | 2418 |
| 637 | Ga0466965_0345930 | 3300044683 | Bacteria | 814 |
| 638 | Ga0466966_0011436 | 3300044684 | Bacteria | 5887 |
| 639 | Ga0466966_0044418 | 3300044684 | Bacteria | 2845 |
| 640 | Ga0466966_0184826 | 3300044684 | Bacteria | 1264 |
| 641 | Ga0466961_0004553 | 3300044693 | Bacteria | 8695 |
| 642 | Ga0466961_0037677 | 3300044693 | Bacteria | 3102 |
| 643 | Ga0466961_0044985 | 3300044693 | Bacteria | 2825 |
| 644 | Ga0466963_0094222 | 3300044694 | Bacteria | 2042 |
| 645 | Ga0466963_0175132 | 3300044694 | Bacteria | 1496 |
| 646 | Ga0466964_0057224 | 3300044706 | Bacteria | 1614 |
| 647 | Ga0466964_0121569 | 3300044706 | Bacteria | 1178 |
| 648 | Ga0466964_0133093 | 3300044706 | Bacteria | 1135 |
| 649 | Ga0466971_0000452 | 3300044719 | Bacteria | 16030 |
| 650 | Ga0466968_0016592 | 3300044735 | Bacteria | 2934 |
| 651 | Ga0466957_0000958 | 3300044842 | Bacteria | 14798 |
| 652 | Ga0466957_0246332 | 3300044842 | Bacteria | 1187 |
| 653 | Ga0466957_0934443 | 3300044842 | Bacteria | 621 |
| 654 | Ga0466960_0359287 | 3300044901 | Bacteria | 832 |
| 655 | Ga0466959_0000902 | 3300045049 | Bacteria | 17530 |
| 656 | Ga0466959_0080834 | 3300045049 | Bacteria | 2342 |
| 657 | Ga0466959_0135158 | 3300045049 | Bacteria | 1746 |
| 658 | Ga0451576_0584423 | 3300045051 | Bacteria | 1174 |
| 659 | Ga0451576_1375856 | 3300045051 | Bacteria | 735 |
| 660 | Ga0466958_0034865 | 3300045836 | Bacteria | 3004 |
| 661 | Ga0466958_0084621 | 3300045836 | Bacteria | 1956 |
| 662 | Ga0466958_0092580 | 3300045836 | Bacteria | 1871 |
| 663 | Ga0466958_0154390 | 3300045836 | Bacteria | 1448 |
| 664 | Ga0466967_0000142 | 3300045976 | Bacteria | 27844 |
| 665 | Ga0466967_0014924 | 3300045976 | Bacteria | 6074 |
| 666 | Ga0466967_0082101 | 3300045976 | Bacteria | 2912 |
| 667 | Ga0466967_0111152 | 3300045976 | Bacteria | 2518 |
| 668 | Ga0466967_0201087 | 3300045976 | Bacteria | 1887 |
| 669 | Ga0466967_0263629 | 3300045976 | Bacteria | 1649 |
| 670 | Ga0466967_0501610 | 3300045976 | Bacteria | 1191 |
| 671 | Ga0466967_0661874 | 3300045976 | Bacteria | 1033 |
| 672 | Ga0495617_173736 | 3300046452 | Bacteria | 680 |
| 673 | Ga0495592_0127989 | 3300046454 | Bacteria | 1779 |
| 674 | Ga0495592_0172142 | 3300046454 | Bacteria | 1482 |
| 675 | Ga0495592_0605910 | 3300046454 | Bacteria | 667 |
| 676 | Ga0495603_0014627 | 3300046455 | Bacteria | 4744 |
| 677 | Ga0495603_0039194 | 3300046455 | Bacteria | 2840 |
| 678 | Ga0495603_0574502 | 3300046455 | Unclassified | 645 |
| 679 | Ga0495629_0094156 | 3300046459 | Bacteria | 2090 |
| 680 | Ga0495629_0161708 | 3300046459 | Bacteria | 1555 |
| 681 | Ga0495641_0055750 | 3300046461 | Bacteria | 1793 |
| 682 | Ga0495641_0211658 | 3300046461 | Bacteria | 869 |
| 683 | Ga0495651_0005992 | 3300046462 | Bacteria | 9277 |
| 684 | Ga0495651_0311671 | 3300046462 | Bacteria | 1052 |
| 685 | Ga0495653_0130012 | 3300046463 | Bacteria | 1784 |
| 686 | Ga0495653_0391872 | 3300046463 | Bacteria | 885 |
| 687 | Ga0495580_0285974 | 3300046472 | Bacteria | 1124 |
| 688 | Ga0495580_0988039 | 3300046472 | Bacteria | 537 |
| 689 | Ga0495582_0107285 | 3300046473 | Bacteria | 1567 |
| 690 | Ga0495582_0274367 | 3300046473 | Bacteria | 968 |
| 691 | Ga0495605_0297518 | 3300046474 | Bacteria | 683 |
| 692 | Ga0495639_0138250 | 3300046475 | Bacteria | 1170 |
| 693 | Ga0495639_0649754 | 3300046475 | Unclassified | 544 |
| 694 | Ga0495662_0122826 | 3300046476 | Bacteria | 1275 |
| 695 | Ga0495662_0236512 | 3300046476 | Unclassified | 900 |
| 696 | Ga0495664_0006619 | 3300046477 | Bacteria | 6408 |
| 697 | Ga0495584_0013798 | 3300046491 | Bacteria | 4119 |
| 698 | Ga0495584_0048320 | 3300046491 | Bacteria | 2145 |
| 699 | Ga0495584_0330213 | 3300046491 | Bacteria | 774 |
| 700 | Ga0495584_0335132 | 3300046491 | Bacteria | 768 |
| 701 | Ga0495584_0434421 | 3300046491 | Bacteria | 668 |
| 702 | Ga0495585_0074859 | 3300046492 | Bacteria | 1842 |
| 703 | Ga0495585_0146263 | 3300046492 | Bacteria | 1235 |
| 704 | Ga0495585_0245988 | 3300046492 | Bacteria | 894 |
| 705 | Ga0495585_0420552 | 3300046492 | Bacteria | 642 |
| 706 | Ga0495594_0511504 | 3300046499 | Unclassified | 682 |
| 707 | Ga0495596_0083610 | 3300046500 | Bacteria | 1239 |
| 708 | Ga0495596_0217884 | 3300046500 | Bacteria | 741 |
| 709 | Ga0495607_0224132 | 3300046501 | Bacteria | 918 |
| 710 | Ga0495583_0195840 | 3300046506 | Bacteria | 823 |
| 711 | Ga0495608_0046272 | 3300046511 | Bacteria | 2896 |
| 712 | Ga0495608_0180345 | 3300046511 | Bacteria | 1336 |
| 713 | Ga0495618_0433444 | 3300046514 | Bacteria | 800 |
| 714 | Ga0495618_0672433 | 3300046514 | Bacteria | 611 |
| 715 | Ga0495620_0047100 | 3300046515 | Bacteria | 1858 |
| 716 | Ga0495628_0075440 | 3300046516 | Bacteria | 2626 |
| 717 | Ga0495628_0657180 | 3300046516 | Bacteria | 744 |
| 718 | Ga0495630_0010704 | 3300046517 | Bacteria | 6624 |
| 719 | Ga0495630_1085894 | 3300046517 | Unclassified | 607 |
| 720 | Ga0495631_0156102 | 3300046518 | Bacteria | 979 |
| 721 | Ga0495637_0072574 | 3300046520 | Bacteria | 1386 |
| 722 | Ga0495644_0102583 | 3300046523 | Bacteria | 1083 |
| 723 | Ga0495663_0011429 | 3300046525 | Bacteria | 2471 |
| 724 | Ga0495663_0041467 | 3300046525 | Bacteria | 1400 |
| 725 | Ga0495663_0070572 | 3300046525 | Bacteria | 1112 |
| 726 | Ga0495642_0023025 | 3300046528 | Bacteria | 2458 |
| 727 | Ga0495642_0056089 | 3300046528 | Bacteria | 1627 |
| 728 | Ga0495652_0035321 | 3300046529 | Bacteria | 4351 |
| 729 | Ga0495652_0110752 | 3300046529 | Bacteria | 2208 |
| 730 | Ga0495652_0129156 | 3300046529 | Bacteria | 2003 |
| 731 | Ga0495652_0186799 | 3300046529 | Bacteria | 1585 |
| 732 | Ga0495652_0403108 | 3300046529 | Bacteria | 968 |
| 733 | Ga0495652_0476426 | 3300046529 | Bacteria | 869 |
| 734 | Ga0495665_0150471 | 3300046531 | Bacteria | 1215 |
| 735 | Ga0495640_0045573 | 3300046533 | Bacteria | 3042 |
| 736 | Ga0495587_0045090 | 3300046536 | Bacteria | 2622 |
| 737 | Ga0495587_0100727 | 3300046536 | Bacteria | 1665 |
| 738 | Ga0495587_0101219 | 3300046536 | Bacteria | 1660 |
| 739 | Ga0495609_0043616 | 3300046538 | Bacteria | 2014 |
| 740 | Ga0495609_0054158 | 3300046538 | Unclassified | 1782 |
| 741 | Ga0495621_0060833 | 3300046539 | Bacteria | 1371 |
| 742 | Ga0495645_0340194 | 3300046543 | Bacteria | 969 |
| 743 | Ga0495633_0110125 | 3300046558 | Bacteria | 1277 |
| 744 | Ga0495633_0426512 | 3300046558 | Bacteria | 599 |
| 745 | Ga0495667_0005465 | 3300046559 | Bacteria | 8585 |
| 746 | Ga0495667_0406283 | 3300046559 | Bacteria | 858 |
| 747 | Ga0495656_0104993 | 3300046615 | Bacteria | 1313 |
| 748 | Ga0495656_0330394 | 3300046615 | Unclassified | 787 |
| 749 | Ga0495656_0377606 | 3300046615 | Bacteria | 738 |
| 750 | Ga0495656_0450022 | 3300046615 | Bacteria | 678 |
| 751 | Ga0495656_0815039 | 3300046615 | Unclassified | 505 |
| 752 | Ga0495668_0104482 | 3300046616 | Bacteria | 1550 |
| 753 | Ga0495634_0012463 | 3300046642 | Bacteria | 6152 |
| 754 | Ga0495634_0020500 | 3300046642 | Bacteria | 4688 |
| 755 | Ga0495611_0034649 | 3300046648 | Bacteria | 2233 |
| 756 | Ga0495611_0089792 | 3300046648 | Bacteria | 1420 |
| 757 | Ga0495635_0106627 | 3300046663 | Bacteria | 1914 |
| 758 | Ga0495659_0023816 | 3300046664 | Bacteria | 2083 |
| 759 | Ga0495659_0145953 | 3300046664 | Bacteria | 947 |
| 760 | Ga0495659_0271383 | 3300046664 | Unclassified | 711 |
| 761 | Ga0495659_0538171 | 3300046664 | Bacteria | 514 |
| 762 | Ga0495661_0371786 | 3300046665 | Bacteria | 700 |
| 763 | Ga0495588_0283207 | 3300046674 | Bacteria | 873 |
| 764 | Ga0495588_0290126 | 3300046674 | Bacteria | 862 |
| 765 | Ga0495657_0013412 | 3300046675 | Bacteria | 6050 |
| 766 | Ga0495599_0154472 | 3300046678 | Bacteria | 1420 |
| 767 | Ga0495599_0224241 | 3300046678 | Bacteria | 1149 |
| 768 | Ga0495646_0234523 | 3300046680 | Bacteria | 988 |
| 769 | Ga0495647_0021653 | 3300046681 | Bacteria | 2316 |
| 770 | Ga0495658_0948368 | 3300046683 | Bacteria | 550 |
| 771 | Ga0495613_0173792 | 3300046689 | Bacteria | 1528 |
| 772 | Ga0495613_0238465 | 3300046689 | Bacteria | 1272 |
| 773 | Ga0495624_0183391 | 3300046690 | Bacteria | 1275 |
| 774 | Ga0495624_0256094 | 3300046690 | Bacteria | 1058 |
| 775 | Ga0495670_0640964 | 3300046691 | Unclassified | 579 |
| 776 | Ga0495671_0108319 | 3300046692 | Bacteria | 1357 |
| 777 | Ga0495671_0282953 | 3300046692 | Bacteria | 799 |
| 778 | Ga0495589_0212575 | 3300046794 | Bacteria | 910 |
| 779 | Ga0495589_0217321 | 3300046794 | Unclassified | 899 |
| 780 | Ga0495589_0217617 | 3300046794 | Bacteria | 898 |
| 781 | Ga0495660_0308475 | 3300046810 | Bacteria | 715 |
| 782 | Ga0495581_0001437 | 3300047315 | Bacteria | 13221 |
| 783 | Ga0495604_0254207 | 3300047317 | Archaea | 1197 |
| 784 | Ga0495636_0247876 | 3300047318 | Bacteria | 823 |
| 785 | Ga0495636_0371607 | 3300047318 | Bacteria | 677 |
| 786 | Ga0495674_0001759 | 3300047319 | Bacteria | 21327 |
| 787 | Ga0495674_0014529 | 3300047319 | Bacteria | 7368 |
| 788 | Ga0495676_0016250 | 3300047321 | Bacteria | 6609 |
| 789 | Ga0495676_0099145 | 3300047321 | Bacteria | 2160 |
| 790 | Ga0495676_0331094 | 3300047321 | Bacteria | 1021 |
| 791 | Ga0495680_0004490 | 3300047322 | Bacteria | 13338 |
| 792 | Ga0495680_0134885 | 3300047322 | Bacteria | 1811 |
| 793 | Ga0495683_0081310 | 3300047323 | Bacteria | 1580 |
| 794 | Ga0495675_0617487 | 3300047444 | Bacteria | 613 |
| 795 | Ga0495685_075380 | 3300047447 | Bacteria | 1127 |
| 796 | Ga0495684_0012761 | 3300047471 | Bacteria | 6485 |
| 797 | Ga0495684_0031156 | 3300047471 | Bacteria | 4094 |
| 798 | Ga0495602_0056568 | 3300048088 | Bacteria | 3448 |
| 799 | Ga0495602_0118922 | 3300048088 | Bacteria | 2130 |
| 800 | Ga0495602_0606539 | 3300048088 | Bacteria | 752 |
| 801 | Ga0495626_0233957 | 3300048091 | Bacteria | 742 |
| 802 | Ga0496100_0020900 | 3300048903 | Bacteria | 3933 |
| 803 | Ga0496100_0025820 | 3300048903 | Bacteria | 3595 |
| 804 | Ga0496100_0124230 | 3300048903 | Bacteria | 1810 |
| 805 | Ga0496100_0153973 | 3300048903 | Bacteria | 1642 |
| 806 | Ga0496100_0215911 | 3300048903 | Bacteria | 1405 |
| 807 | Ga0496100_0245633 | 3300048903 | Bacteria | 1322 |
| 808 | Ga0496100_0742605 | 3300048903 | Unclassified | 767 |
| 809 | Ga0496101_0001238 | 3300048904 | Bacteria | 15269 |
| 810 | Ga0496101_0006620 | 3300048904 | Bacteria | 7465 |
| 811 | Ga0496101_0039764 | 3300048904 | Bacteria | 3346 |
| 812 | Ga0496101_0056633 | 3300048904 | Bacteria | 2834 |
| 813 | Ga0496101_0116970 | 3300048904 | Bacteria | 2012 |
| 814 | Ga0496101_0246479 | 3300048904 | Bacteria | 1391 |
| 815 | Ga0496101_0486173 | 3300048904 | Bacteria | 975 |
| 816 | Ga0496101_0605690 | 3300048904 | Bacteria | 866 |
| 817 | Ga0496101_1235124 | 3300048904 | Bacteria | 585 |
| 818 | Ga0496102_0011268 | 3300048905 | Bacteria | 7704 |
| 819 | Ga0496102_0021057 | 3300048905 | Bacteria | 5766 |
| 820 | Ga0496102_0189247 | 3300048905 | Bacteria | 1939 |
| 821 | Ga0496102_0471145 | 3300048905 | Bacteria | 1177 |
| 822 | Ga0496103_0010249 | 3300048906 | Bacteria | 5543 |
| 823 | Ga0496103_0065969 | 3300048906 | Bacteria | 2259 |
| 824 | Ga0496103_0086272 | 3300048906 | Bacteria | 1979 |
| 825 | Ga0496103_0304712 | 3300048906 | Bacteria | 1025 |
| 826 | Ga0496103_0854503 | 3300048906 | Bacteria | 572 |
| 827 | Ga0496104_0023003 | 3300048907 | Bacteria | 5728 |
| 828 | Ga0496104_0049875 | 3300048907 | Bacteria | 3948 |
| 829 | Ga0496104_0060932 | 3300048907 | Bacteria | 3575 |
| 830 | Ga0496104_0085119 | 3300048907 | Bacteria | 3018 |
| 831 | Ga0496104_0156791 | 3300048907 | Bacteria | 2184 |
| 832 | Ga0496104_0208489 | 3300048907 | Bacteria | 1866 |
| 833 | Ga0496104_0432369 | 3300048907 | Bacteria | 1228 |
| 834 | Ga0496104_1692141 | 3300048907 | Bacteria | 535 |
| 835 | Ga0496105_0019124 | 3300048908 | Bacteria | 5521 |
| 836 | Ga0496105_0055464 | 3300048908 | Bacteria | 3272 |
| 837 | Ga0496105_0066335 | 3300048908 | Bacteria | 2979 |
| 838 | Ga0496105_0074201 | 3300048908 | Bacteria | 2810 |
| 839 | Ga0496105_0140198 | 3300048908 | Bacteria | 1990 |
| 840 | Ga0496105_0477793 | 3300048908 | Bacteria | 981 |
| 841 | Ga0496106_0047257 | 3300048909 | Bacteria | 3239 |
| 842 | Ga0496106_0125317 | 3300048909 | Bacteria | 2010 |
| 843 | Ga0496106_0213534 | 3300048909 | Bacteria | 1537 |
| 844 | Ga0496106_0367567 | 3300048909 | Bacteria | 1156 |
| 845 | Ga0496106_0803852 | 3300048909 | Bacteria | 746 |
| 846 | Ga0496107_0003998 | 3300048910 | Bacteria | 9928 |
| 847 | Ga0496107_0017318 | 3300048910 | Bacteria | 5067 |
| 848 | Ga0496107_0025181 | 3300048910 | Bacteria | 4210 |
| 849 | Ga0496107_0038996 | 3300048910 | Bacteria | 3408 |
| 850 | Ga0496108_0012078 | 3300048911 | Bacteria | 7023 |
| 851 | Ga0496108_0037636 | 3300048911 | Bacteria | 4031 |
| 852 | Ga0496108_0057536 | 3300048911 | Bacteria | 3267 |
| 853 | Ga0496108_0061648 | 3300048911 | Bacteria | 3156 |
| 854 | Ga0496108_0072694 | 3300048911 | Bacteria | 2903 |
| 855 | Ga0496108_0113713 | 3300048911 | Bacteria | 2317 |
| 856 | Ga0496108_0155986 | 3300048911 | Bacteria | 1971 |
| 857 | Ga0496108_0197021 | 3300048911 | Bacteria | 1747 |
| 858 | Ga0496109_0002264 | 3300048912 | Bacteria | 15994 |
| 859 | Ga0496109_0021245 | 3300048912 | Bacteria | 5739 |
| 860 | Ga0496109_0032706 | 3300048912 | Bacteria | 4677 |
| 861 | Ga0496109_0038096 | 3300048912 | Bacteria | 4345 |
| 862 | Ga0496109_0043225 | 3300048912 | Bacteria | 4084 |
| 863 | Ga0496109_0177711 | 3300048912 | Bacteria | 1998 |
| 864 | Ga0496109_0277415 | 3300048912 | Bacteria | 1579 |
| 865 | Ga0496109_0289482 | 3300048912 | Bacteria | 1544 |
| 866 | Ga0496109_1884196 | 3300048912 | Bacteria | 530 |
| 867 | Ga0496109_1904458 | 3300048912 | Bacteria | 527 |
| 868 | Ga0496110_0015243 | 3300048913 | Bacteria | 6392 |
| 869 | Ga0496110_0018263 | 3300048913 | Bacteria | 5879 |
| 870 | Ga0496110_0036616 | 3300048913 | Bacteria | 4261 |
| 871 | Ga0496110_0038011 | 3300048913 | Bacteria | 4186 |
| 872 | Ga0496110_0153191 | 3300048913 | Bacteria | 2088 |
| 873 | Ga0496110_0182804 | 3300048913 | Bacteria | 1904 |
| 874 | Ga0496110_0225600 | 3300048913 | Bacteria | 1703 |
| 875 | Ga0496111_0001469 | 3300048914 | Bacteria | 13485 |
| 876 | Ga0496111_0022743 | 3300048914 | Bacteria | 4392 |
| 877 | Ga0496111_0203192 | 3300048914 | Bacteria | 1473 |
| 878 | Ga0496111_0289112 | 3300048914 | Bacteria | 1215 |
| 879 | Ga0496111_0440531 | 3300048914 | Bacteria | 962 |
| 880 | Ga0496111_0590905 | 3300048914 | Bacteria | 813 |
| 881 | Ga0496112_0037870 | 3300048915 | Bacteria | 4709 |
| 882 | Ga0496112_0048819 | 3300048915 | Bacteria | 4147 |
| 883 | Ga0496112_0903943 | 3300048915 | Bacteria | 805 |
| 884 | Ga0496112_0908541 | 3300048915 | Bacteria | 802 |
| 885 | Ga0496113_0016652 | 3300048916 | Bacteria | 5082 |
| 886 | Ga0496113_0102528 | 3300048916 | Bacteria | 2219 |
| 887 | Ga0496113_0152345 | 3300048916 | Bacteria | 1825 |
| 888 | Ga0496113_0309601 | 3300048916 | Bacteria | 1265 |
| 889 | Ga0496113_0409871 | 3300048916 | Bacteria | 1088 |
| 890 | Ga0496113_0775558 | 3300048916 | Bacteria | 762 |
| 891 | Ga0496114_0001682 | 3300048917 | Bacteria | 16779 |
| 892 | Ga0496114_0003284 | 3300048917 | Bacteria | 12414 |
| 893 | Ga0496114_0014618 | 3300048917 | Bacteria | 6306 |
| 894 | Ga0496114_0033628 | 3300048917 | Bacteria | 4225 |
| 895 | Ga0496114_0156454 | 3300048917 | Bacteria | 1979 |
| 896 | Ga0496114_0176375 | 3300048917 | Bacteria | 1865 |
| 897 | Ga0496114_0243907 | 3300048917 | Bacteria | 1580 |
| 898 | Ga0496114_0319927 | 3300048917 | Bacteria | 1371 |
| 899 | Ga0496114_0361246 | 3300048917 | Bacteria | 1284 |
| 900 | Ga0496114_0438352 | 3300048917 | Bacteria | 1157 |
| 901 | Ga0496114_1669636 | 3300048917 | Bacteria | 525 |
| 902 | Ga0496115_0007909 | 3300048918 | Bacteria | 7843 |
| 903 | Ga0496115_0025154 | 3300048918 | Bacteria | 4633 |
| 904 | Ga0496115_0077306 | 3300048918 | Bacteria | 2706 |
| 905 | Ga0496115_0384849 | 3300048918 | Bacteria | 1140 |
| 906 | Ga0496115_0425118 | 3300048918 | Bacteria | 1076 |
| 907 | Ga0496115_0679169 | 3300048918 | Unclassified | 811 |
| 908 | Ga0501031_0003942 | 3300049568 | Bacteria | 9557 |
| 909 | Ga0501031_0010352 | 3300049568 | Bacteria | 6075 |
| 910 | Ga0501031_0017160 | 3300049568 | Bacteria | 4704 |
| 911 | Ga0501031_0104696 | 3300049568 | Bacteria | 1846 |
| 912 | Ga0501032_0009499 | 3300049569 | Bacteria | 7048 |
| 913 | Ga0501032_0067535 | 3300049569 | Bacteria | 2388 |
| 914 | Ga0501032_0715991 | 3300049569 | Bacteria | 634 |
| 915 | Ga0501033_0002792 | 3300049570 | Bacteria | 14638 |
| 916 | Ga0501033_0019169 | 3300049570 | Bacteria | 5173 |
| 917 | Ga0501033_0022135 | 3300049570 | Bacteria | 4796 |
| 918 | Ga0501033_0271976 | 3300049570 | Bacteria | 1197 |
| 919 | Ga0501034_0308270 | 3300049571 | Bacteria | 1518 |
| 920 | Ga0501034_0331298 | 3300049571 | Bacteria | 1454 |
| 921 | Ga0501036_0002911 | 3300049572 | Bacteria | 13584 |
| 922 | Ga0501036_0004301 | 3300049572 | Bacteria | 11503 |
| 923 | Ga0501036_0023454 | 3300049572 | Bacteria | 5199 |
| 924 | Ga0501036_0025742 | 3300049572 | Bacteria | 4965 |
| 925 | Ga0501037_0015949 | 3300049573 | Bacteria | 5530 |
| 926 | Ga0501037_0017091 | 3300049573 | Bacteria | 5338 |
| 927 | Ga0501037_0068516 | 3300049573 | Bacteria | 2583 |
| 928 | Ga0501038_0016158 | 3300049574 | Bacteria | 6771 |
| 929 | Ga0501038_0030196 | 3300049574 | Bacteria | 4798 |
| 930 | Ga0501038_0031091 | 3300049574 | Bacteria | 4720 |
| 931 | Ga0501039_0005424 | 3300049575 | Bacteria | 9641 |
| 932 | Ga0501039_0031596 | 3300049575 | Bacteria | 4082 |
| 933 | Ga0501039_0037989 | 3300049575 | Bacteria | 3718 |
| 934 | Ga0501039_0621323 | 3300049575 | Bacteria | 846 |
| 935 | Ga0501040_0008288 | 3300049576 | Bacteria | 6760 |
| 936 | Ga0501040_0008921 | 3300049576 | Bacteria | 6522 |
| 937 | Ga0501040_0054609 | 3300049576 | Bacteria | 2738 |
| 938 | Ga0501040_0085324 | 3300049576 | Bacteria | 2191 |
| 939 | Ga0501040_0437399 | 3300049576 | Bacteria | 941 |
| 940 | Ga0501040_1041498 | 3300049576 | Bacteria | 593 |
| 941 | Ga0501041_0006011 | 3300049577 | Bacteria | 7101 |
| 942 | Ga0501041_0008515 | 3300049577 | Bacteria | 6037 |
| 943 | Ga0501041_0028061 | 3300049577 | Bacteria | 3394 |
| 944 | Ga0501041_0030363 | 3300049577 | Bacteria | 3261 |
| 945 | Ga0501041_0075454 | 3300049577 | Bacteria | 2073 |
| 946 | Ga0501041_0651929 | 3300049577 | Bacteria | 673 |
| 947 | Ga0501042_0003550 | 3300049578 | Bacteria | 9815 |
| 948 | Ga0501042_0012945 | 3300049578 | Bacteria | 5666 |
| 949 | Ga0501042_0037872 | 3300049578 | Bacteria | 3423 |
| 950 | Ga0501042_0886850 | 3300049578 | Bacteria | 649 |
| 951 | Ga0501043_0027956 | 3300049579 | Bacteria | 4427 |
| 952 | Ga0501043_0034990 | 3300049579 | Bacteria | 3950 |
| 953 | Ga0501043_0074284 | 3300049579 | Bacteria | 2670 |
| 954 | Ga0501043_0269576 | 3300049579 | Bacteria | 1307 |
| 955 | Ga0501046_0005418 | 3300049580 | Bacteria | 11404 |
| 956 | Ga0501046_0006355 | 3300049580 | Bacteria | 10477 |
| 957 | Ga0501046_0016160 | 3300049580 | Bacteria | 6258 |
| 958 | Ga0501047_0084848 | 3300049581 | Bacteria | 3044 |
| 959 | Ga0501047_0489418 | 3300049581 | Bacteria | 1057 |
| 960 | Ga0501048_0010744 | 3300049582 | Bacteria | 6827 |
| 961 | Ga0501048_0044270 | 3300049582 | Bacteria | 3183 |
| 962 | Ga0501048_0061804 | 3300049582 | Bacteria | 2651 |
| 963 | Ga0501067_0000723 | 3300049583 | Bacteria | 17781 |
| 964 | Ga0501067_0025932 | 3300049583 | Bacteria | 3248 |
| 965 | Ga0501067_0082087 | 3300049583 | Bacteria | 1787 |
| 966 | Ga0501068_0003171 | 3300049584 | Bacteria | 8803 |
| 967 | Ga0501068_0004263 | 3300049584 | Bacteria | 7764 |
| 968 | Ga0501068_0005313 | 3300049584 | Bacteria | 7037 |
| 969 | Ga0501068_0012067 | 3300049584 | Bacteria | 4890 |
| 970 | Ga0501068_0312893 | 3300049584 | Bacteria | 1006 |
| 971 | Ga0501069_0003377 | 3300049585 | Bacteria | 8191 |
| 972 | Ga0501069_0074044 | 3300049585 | Bacteria | 1910 |
| 973 | Ga0501069_0198357 | 3300049585 | Bacteria | 1162 |
| 974 | Ga0501069_0273745 | 3300049585 | Bacteria | 987 |
| 975 | Ga0501069_0344213 | 3300049585 | Bacteria | 878 |
| 976 | Ga0501070_0003251 | 3300049586 | Bacteria | 14104 |
| 977 | Ga0501070_0128405 | 3300049586 | Bacteria | 2095 |
| 978 | Ga0501070_0131948 | 3300049586 | Bacteria | 2063 |
| 979 | Ga0501071_0002637 | 3300049587 | Bacteria | 10978 |
| 980 | Ga0501071_0008478 | 3300049587 | Bacteria | 6797 |
| 981 | Ga0501071_0011103 | 3300049587 | Bacteria | 6054 |
| 982 | Ga0501071_0034242 | 3300049587 | Bacteria | 3613 |
| 983 | Ga0501071_0090807 | 3300049587 | Bacteria | 2243 |
| 984 | Ga0501072_0001947 | 3300049588 | Bacteria | 15381 |
| 985 | Ga0501072_0022731 | 3300049588 | Bacteria | 4865 |
| 986 | Ga0501072_0022807 | 3300049588 | Bacteria | 4857 |
| 987 | Ga0501072_0028314 | 3300049588 | Bacteria | 4374 |
| 988 | Ga0501072_0127626 | 3300049588 | Bacteria | 2026 |
| 989 | Ga0501073_0016904 | 3300049589 | Bacteria | 5283 |
| 990 | Ga0501073_0023276 | 3300049589 | Bacteria | 4450 |
| 991 | Ga0501074_0013222 | 3300049590 | Bacteria | 6001 |
| 992 | Ga0501074_0020299 | 3300049590 | Bacteria | 4828 |
| 993 | Ga0501074_0029295 | 3300049590 | Bacteria | 3988 |
| 994 | Ga0501074_1008096 | 3300049590 | Bacteria | 585 |
| 995 | Ga0501075_0030898 | 3300049591 | Bacteria | 3971 |
| 996 | Ga0501075_0047023 | 3300049591 | Bacteria | 3242 |
| 997 | Ga0501075_0143708 | 3300049591 | Bacteria | 1818 |
| 998 | Ga0501075_0157933 | 3300049591 | Bacteria | 1729 |
| 999 | Ga0501075_0907903 | 3300049591 | Unclassified | 670 |
| 1000 | Ga0501076_0002533 | 3300049592 | Bacteria | 12573 |
| 1001 | Ga0501076_0024282 | 3300049592 | Bacteria | 4683 |
| 1002 | Ga0501076_0089336 | 3300049592 | Bacteria | 2476 |
| 1003 | Ga0501076_0163553 | 3300049592 | Bacteria | 1813 |
| 1004 | Ga0501076_0589976 | 3300049592 | Bacteria | 916 |
| 1005 | Ga0501077_0002613 | 3300049593 | Bacteria | 10786 |
| 1006 | Ga0501077_0020436 | 3300049593 | Bacteria | 4191 |
| 1007 | Ga0501077_0030214 | 3300049593 | Bacteria | 3447 |
| 1008 | Ga0501077_0298122 | 3300049593 | Bacteria | 1027 |
| 1009 | Ga0501077_0539274 | 3300049593 | Bacteria | 748 |
| 1010 | Ga0501079_0003011 | 3300049741 | Bacteria | 12323 |
| 1011 | Ga0501079_0004898 | 3300049741 | Bacteria | 9923 |
| 1012 | Ga0501079_0037053 | 3300049741 | Bacteria | 3757 |
| 1013 | Ga0501079_0661213 | 3300049741 | Bacteria | 822 |
| 1014 | Ga0501080_0006559 | 3300049742 | Bacteria | 10460 |
| 1015 | Ga0501080_0055563 | 3300049742 | Bacteria | 3688 |
| 1016 | Ga0501080_0084119 | 3300049742 | Bacteria | 2956 |
| 1017 | Ga0501080_0149099 | 3300049742 | Bacteria | 2162 |
| 1018 | Ga0501081_0003248 | 3300049743 | Bacteria | 10349 |
| 1019 | Ga0501081_0008667 | 3300049743 | Bacteria | 6607 |
| 1020 | Ga0501081_0009207 | 3300049743 | Bacteria | 6431 |
| 1021 | Ga0501081_0028566 | 3300049743 | Bacteria | 3764 |
| 1022 | Ga0501081_0516528 | 3300049743 | Bacteria | 891 |
| 1023 | Ga0501083_0006107 | 3300049744 | Bacteria | 8538 |
| 1024 | Ga0501083_0017440 | 3300049744 | Bacteria | 5004 |
| 1025 | Ga0501083_0059737 | 3300049744 | Bacteria | 2549 |
| 1026 | Ga0501035_0033143 | 3300049822 | Bacteria | 4698 |
| 1027 | Ga0501035_0044775 | 3300049822 | Bacteria | 3983 |
| 1028 | Ga0501035_0098605 | 3300049822 | Bacteria | 2565 |
| 1029 | Ga0501035_0222690 | 3300049822 | Bacteria | 1610 |
| 1030 | Ga0501044_0042478 | 3300049823 | Bacteria | 4728 |
| 1031 | Ga0501044_0157716 | 3300049823 | Bacteria | 2248 |
| 1032 | Ga0501045_0004481 | 3300049824 | Bacteria | 9648 |
| 1033 | Ga0501045_0012686 | 3300049824 | Bacteria | 5933 |
| 1034 | Ga0501045_0013202 | 3300049824 | Bacteria | 5826 |
| 1035 | Ga0501045_0041391 | 3300049824 | Bacteria | 3352 |
| 1036 | Ga0501212_072943 | 3300049851 | Bacteria | 610 |
| 1037 | nmdc:mga0yw44_19648_c1 | 3300050492 | Bacteria | 3730 |
| 1038 | nmdc:mga0yw44_94113_c1 | 3300050492 | Bacteria | 1898 |
| 1039 | nmdc:mga05p37_134912_c1 | 3300050507 | Bacteria | 3028 |
| 1040 | nmdc:mga05p37_223309_c1 | 3300050507 | Bacteria | 2273 |
| 1041 | nmdc:mga05p37_260641_c1 | 3300050507 | Bacteria | 2075 |
| 1042 | nmdc:mga05p37_37438_c1 | 3300050507 | Bacteria | 5947 |
| 1043 | nmdc:mga05p37_4582_c1 | 3300050507 | Bacteria | 16162 |
| 1044 | nmdc:mga05p37_70019_c1 | 3300050507 | Bacteria | 4315 |
| 1045 | nmdc:mga05p37_97110_c1 | 3300050507 | Bacteria | 3630 |
| 1046 | nmdc:mga09592_111660_c1 | 3300050508 | Bacteria | 2345 |
| 1047 | nmdc:mga09592_144158_c1 | 3300050508 | Bacteria | 2054 |
| 1048 | nmdc:mga09592_48952_c1 | 3300050508 | Bacteria | 3563 |
| 1049 | nmdc:mga0qj67_375781_c1 | 3300050509 | Bacteria | 1148 |
| 1050 | nmdc:mga0qj67_4158_c1 | 3300050509 | Bacteria | 10490 |
| 1051 | nmdc:mga06r32_213841_c1 | 3300050510 | Bacteria | 1916 |
| 1052 | nmdc:mga06r32_30480_c1 | 3300050510 | Bacteria | 5061 |
| 1053 | nmdc:mga08y16_126060_c1 | 3300050511 | Bacteria | 2664 |
| 1054 | nmdc:mga08y16_17248_c1 | 3300050511 | Bacteria | 7601 |
| 1055 | nmdc:mga08y16_443118_c1 | 3300050511 | Bacteria | 1325 |
| 1056 | nmdc:mga08y16_60836_c1 | 3300050511 | Bacteria | 3944 |
| 1057 | nmdc:mga08y16_65593_c1 | 3300050511 | Bacteria | 3790 |
| 1058 | nmdc:mga0n895_14265_c1 | 3300050512 | Bacteria | 7210 |
| 1059 | nmdc:mga0n895_1688258_c1 | 3300050512 | Bacteria | 596 |
| 1060 | nmdc:mga0rr50_1847713_c1 | 3300050513 | Bacteria | 508 |
| 1061 | nmdc:mga0rr50_203522_c1 | 3300050513 | Bacteria | 1628 |
| 1062 | nmdc:mga08x19_151142_c1 | 3300050514 | Bacteria | 1572 |
| 1063 | nmdc:mga0a205_193435_c1 | 3300050515 | Bacteria | 1926 |
| 1064 | nmdc:mga0a205_24400_c1 | 3300050515 | Bacteria | 5750 |
| 1065 | nmdc:mga0a205_265860_c1 | 3300050515 | Bacteria | 1592 |
| 1066 | nmdc:mga0a205_51265_c1 | 3300050515 | Bacteria | 3984 |
| 1067 | nmdc:mga0a205_695225_c1 | 3300050515 | Bacteria | 867 |
| 1068 | Ga0495612_0039540 | 3300053078 | Bacteria | 1919 |
| 1069 | Ga0495655_0179386 | 3300053083 | Unclassified | 682 |
| 1070 | Ga0495619_0007565 | 3300053085 | Bacteria | 6878 |
| 1071 | Ga0495619_0017932 | 3300053085 | Bacteria | 4488 |
| 1072 | Ga0495619_0111441 | 3300053085 | Bacteria | 1870 |
| 1073 | Ga0501084_0009530 | 3300054114 | Bacteria | 8036 |
| 1074 | Ga0501084_0040993 | 3300054114 | Bacteria | 3873 |
| 1075 | Ga0501084_0064556 | 3300054114 | Bacteria | 3063 |
| 1076 | Ga0501084_0186756 | 3300054114 | Bacteria | 1749 |
| 1077 | Ga0501084_0556022 | 3300054114 | Bacteria | 969 |
| 1078 | Ga0501084_0880737 | 3300054114 | Bacteria | 753 |
| 1079 | Ga0501082_0006790 | 3300060353 | Bacteria | 9890 |
| 1080 | Ga0501082_0025916 | 3300060353 | Bacteria | 5053 |
| 1081 | Ga0501082_0046122 | 3300060353 | Bacteria | 3757 |
| 1082 | Ga0501082_0148669 | 3300060353 | Bacteria | 2034 |
| 1083 | Ga0501082_0182839 | 3300060353 | Bacteria | 1823 |
| 1084 | Ga0466962_0001047 | 3300061719 | Bacteria | 12699 |
| 1085 | Ga0466962_0026892 | 3300061719 | Bacteria | 2762 |
| 1086 | Ga0530510_0003120 | 3300061734 | Bacteria | 11372 |
| 1087 | Ga0530510_0009782 | 3300061734 | Bacteria | 6728 |
| 1088 | Ga0530510_0069435 | 3300061734 | Bacteria | 2557 |
| 1089 | Ga0530510_0288108 | 3300061734 | Bacteria | 1227 |
| 1090 | Ga0530510_0768076 | 3300061734 | Bacteria | 735 |
| 1091 | Ga0530510_1355551 | 3300061734 | Bacteria | 546 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005456 | Ga0070678_100900398 | Ga0070678_1009003981 | 117 |
| 2 | 3300046491 | Ga0495584_0013798 | Ga0495584_0013798_2514_2873 | 117 |
| 3 | 3300046538 | Ga0495609_0043616 | Ga0495609_0043616_35_394 | 117 |
| 4 | 3300046459 | Ga0495629_0161708 | Ga0495629_0161708_988_1344 | 118 |
| 5 | 3300005439 | Ga0070711_100053883 | Ga0070711_1000538832 | 119 |
| 6 | 3300005536 | Ga0070697_100140243 | Ga0070697_1001402433 | 119 |
| 7 | 3300006175 | Ga0070712_100003758 | Ga0070712_10000375811 | 119 |
| 8 | 3300025915 | Ga0207693_10002613 | Ga0207693_1000261315 | 119 |
| 9 | 3300025916 | Ga0207663_10464508 | Ga0207663_104645082 | 119 |
| 10 | 3300026089 | Ga0207648_11843272 | Ga0207648_118432722 | 119 |
| 11 | 3300048912 | Ga0496109_1904458 | Ga0496109_1904458_16_414 | 119 |
| 12 | 3300053083 | Ga0495655_0179386 | Ga0495655_0179386_21_380 | 119 |
| 13 | 3300009148 | Ga0105243_12675507 | Ga0105243_126755071 | 120 |
| 14 | 3300031911 | Ga0307412_11177980 | Ga0307412_111779802 | 120 |
| 15 | 3300032002 | Ga0307416_100041206 | Ga0307416_1000412063 | 120 |
| 16 | 3300032126 | Ga0307415_100006911 | Ga0307415_1000069118 | 120 |
| 17 | 3300048088 | Ga0495602_0056568 | Ga0495602_0056568_1736_2098 | 120 |
| 18 | 3300044684 | Ga0466966_0044418 | Ga0466966_0044418_1526_1897 | 121 |
| 19 | 3300044693 | Ga0466961_0044985 | Ga0466961_0044985_1609_1980 | 121 |
| 20 | 3300014497 | Ga0182008_10172334 | Ga0182008_101723342 | 122 |
| 21 | 3300014497 | Ga0182008_10605403 | Ga0182008_106054031 | 122 |
| 22 | 3300041505 | Ga0451849_1075940 | Ga0451849_1075940_306_680 | 122 |
| 23 | 3300047317 | Ga0495604_0254207 | Ga0495604_0254207_793_1167 | 122 |
| 24 | 3300048915 | Ga0496112_0908541 | Ga0496112_0908541_264_638 | 122 |
| 25 | 3300005339 | Ga0070660_100625583 | Ga0070660_1006255832 | 123 |
| 26 | 3300005355 | Ga0070671_100303644 | Ga0070671_1003036442 | 123 |
| 27 | 3300005367 | Ga0070667_101844135 | Ga0070667_1018441352 | 123 |
| 28 | 3300005437 | Ga0070710_10573179 | Ga0070710_105731791 | 123 |
| 29 | 3300005439 | Ga0070711_100018382 | Ga0070711_1000183822 | 123 |
| 30 | 3300005614 | Ga0068856_100051292 | Ga0068856_1000512924 | 123 |
| 31 | 3300005719 | Ga0068861_100608497 | Ga0068861_1006084972 | 123 |
| 32 | 3300006175 | Ga0070712_100057122 | Ga0070712_1000571222 | 123 |
| 33 | 3300006237 | Ga0097621_100563304 | Ga0097621_1005633041 | 123 |
| 34 | 3300009148 | Ga0105243_11545768 | Ga0105243_115457682 | 123 |
| 35 | 3300013296 | Ga0157374_10458172 | Ga0157374_104581722 | 123 |
| 36 | 3300013297 | Ga0157378_10376892 | Ga0157378_103768922 | 123 |
| 37 | 3300014968 | Ga0157379_11483912 | Ga0157379_114839121 | 123 |
| 38 | 3300014969 | Ga0157376_10195562 | Ga0157376_101955621 | 123 |
| 39 | 3300025898 | Ga0207692_10164973 | Ga0207692_101649732 | 123 |
| 40 | 3300025915 | Ga0207693_10034709 | Ga0207693_100347093 | 123 |
| 41 | 3300025916 | Ga0207663_10010873 | Ga0207663_100108732 | 123 |
| 42 | 3300025927 | Ga0207687_11152570 | Ga0207687_111525701 | 123 |
| 43 | 3300025931 | Ga0207644_10311452 | Ga0207644_103114522 | 123 |
| 44 | 3300025935 | Ga0207709_10488070 | Ga0207709_104880702 | 123 |
| 45 | 3300025944 | Ga0207661_10442349 | Ga0207661_104423491 | 123 |
| 46 | 3300026078 | Ga0207702_10209821 | Ga0207702_102098212 | 123 |
| 47 | 3300026118 | Ga0207675_100621125 | Ga0207675_1006211251 | 123 |
| 48 | 3300044683 | Ga0466965_0036296 | Ga0466965_0036296_703_1074 | 123 |
| 49 | 3300044684 | Ga0466966_0184826 | Ga0466966_0184826_686_1057 | 123 |
| 50 | 3300044693 | Ga0466961_0004553 | Ga0466961_0004553_6687_7058 | 123 |
| 51 | 3300044694 | Ga0466963_0175132 | Ga0466963_0175132_320_691 | 123 |
| 52 | 3300044706 | Ga0466964_0057224 | Ga0466964_0057224_686_1057 | 123 |
| 53 | 3300044719 | Ga0466971_0000452 | Ga0466971_0000452_12581_12952 | 123 |
| 54 | 3300044842 | Ga0466957_0000958 | Ga0466957_0000958_12585_12956 | 123 |
| 55 | 3300045049 | Ga0466959_0000902 | Ga0466959_0000902_9162_9533 | 123 |
| 56 | 3300045836 | Ga0466958_0154390 | Ga0466958_0154390_559_930 | 123 |
| 57 | 3300045976 | Ga0466967_0000142 | Ga0466967_0000142_25631_26002 | 123 |
| 58 | 3300045976 | Ga0466967_0082101 | Ga0466967_0082101_1661_2032 | 123 |
| 59 | 3300045976 | Ga0466967_0263629 | Ga0466967_0263629_716_1087 | 123 |
| 60 | 3300046461 | Ga0495641_0055750 | Ga0495641_0055750_1295_1666 | 123 |
| 61 | 3300046463 | Ga0495653_0391872 | Ga0495653_0391872_332_703 | 123 |
| 62 | 3300046529 | Ga0495652_0129156 | Ga0495652_0129156_1053_1424 | 123 |
| 63 | 3300046536 | Ga0495587_0101219 | Ga0495587_0101219_1258_1629 | 123 |
| 64 | 3300046678 | Ga0495599_0154472 | Ga0495599_0154472_722_1093 | 123 |
| 65 | 3300048903 | Ga0496100_0020900 | Ga0496100_0020900_2415_2786 | 123 |
| 66 | 3300048904 | Ga0496101_0001238 | Ga0496101_0001238_9035_9406 | 123 |
| 67 | 3300048905 | Ga0496102_0021057 | Ga0496102_0021057_1831_2202 | 123 |
| 68 | 3300048907 | Ga0496104_0060932 | Ga0496104_0060932_345_716 | 123 |
| 69 | 3300048908 | Ga0496105_0019124 | Ga0496105_0019124_2909_3280 | 123 |
| 70 | 3300048910 | Ga0496107_0003998 | Ga0496107_0003998_8269_8640 | 123 |
| 71 | 3300048911 | Ga0496108_0037636 | Ga0496108_0037636_3102_3473 | 123 |
| 72 | 3300048911 | Ga0496108_0197021 | Ga0496108_0197021_1102_1473 | 123 |
| 73 | 3300048912 | Ga0496109_0038096 | Ga0496109_0038096_1787_2158 | 123 |
| 74 | 3300048912 | Ga0496109_1884196 | Ga0496109_1884196_22_393 | 123 |
| 75 | 3300048913 | Ga0496110_0038011 | Ga0496110_0038011_1819_2190 | 123 |
| 76 | 3300048914 | Ga0496111_0440531 | Ga0496111_0440531_397_768 | 123 |
| 77 | 3300048915 | Ga0496112_0903943 | Ga0496112_0903943_18_389 | 123 |
| 78 | 3300048916 | Ga0496113_0152345 | Ga0496113_0152345_364_735 | 123 |
| 79 | 3300048917 | Ga0496114_0014618 | Ga0496114_0014618_3716_4087 | 123 |
| 80 | 3300048918 | Ga0496115_0077306 | Ga0496115_0077306_101_472 | 123 |
| 81 | 3300049583 | Ga0501067_0000723 | Ga0501067_0000723_8890_9261 | 123 |
| 82 | 3300049584 | Ga0501068_0003171 | Ga0501068_0003171_2102_2473 | 123 |
| 83 | 3300049586 | Ga0501070_0128405 | Ga0501070_0128405_1070_1441 | 123 |
| 84 | 3300049587 | Ga0501071_0090807 | Ga0501071_0090807_592_963 | 123 |
| 85 | 3300061719 | Ga0466962_0001047 | Ga0466962_0001047_3595_3966 | 123 |
| 86 | 3300061734 | Ga0530510_0069435 | Ga0530510_0069435_102_473 | 123 |
| 87 | 3300003373 | JGI25407J50210_10000425 | JGI25407J50210_100004258 | 124 |
| 88 | 3300005435 | Ga0070714_100549090 | Ga0070714_1005490901 | 124 |
| 89 | 3300005436 | Ga0070713_100226203 | Ga0070713_1002262032 | 124 |
| 90 | 3300005439 | Ga0070711_100081384 | Ga0070711_1000813844 | 124 |
| 91 | 3300005844 | Ga0068862_102402452 | Ga0068862_1024024521 | 124 |
| 92 | 3300005981 | Ga0081538_10003208 | Ga0081538_100032088 | 124 |
| 93 | 3300006028 | Ga0070717_10020221 | Ga0070717_100202214 | 124 |
| 94 | 3300006175 | Ga0070712_101461121 | Ga0070712_1014611212 | 124 |
| 95 | 3300006358 | Ga0068871_100452313 | Ga0068871_1004523132 | 124 |
| 96 | 3300009553 | Ga0105249_10606560 | Ga0105249_106065602 | 124 |
| 97 | 3300011119 | Ga0105246_10298873 | Ga0105246_102988732 | 124 |
| 98 | 3300014745 | Ga0157377_10319413 | Ga0157377_103194132 | 124 |
| 99 | 3300025915 | Ga0207693_10185557 | Ga0207693_101855572 | 124 |
| 100 | 3300025915 | Ga0207693_10294814 | Ga0207693_102948142 | 124 |
| 101 | 3300025922 | Ga0207646_10185660 | Ga0207646_101856602 | 124 |
| 102 | 3300025928 | Ga0207700_10216674 | Ga0207700_102166742 | 124 |
| 103 | 3300025928 | Ga0207700_10600136 | Ga0207700_106001362 | 124 |
| 104 | 3300025936 | Ga0207670_11639789 | Ga0207670_116397892 | 124 |
| 105 | 3300026088 | Ga0207641_12163260 | Ga0207641_121632602 | 124 |
| 106 | 3300028380 | Ga0268265_12282750 | Ga0268265_122827501 | 124 |
| 107 | 3300044656 | Ga0466969_0067182 | Ga0466969_0067182_722_1096 | 124 |
| 108 | 3300044735 | Ga0466968_0016592 | Ga0466968_0016592_1857_2231 | 124 |
| 109 | 3300044842 | Ga0466957_0246332 | Ga0466957_0246332_471_845 | 124 |
| 110 | 3300045049 | Ga0466959_0080834 | Ga0466959_0080834_209_583 | 124 |
| 111 | 3300045836 | Ga0466958_0084621 | Ga0466958_0084621_797_1171 | 124 |
| 112 | 3300045976 | Ga0466967_0111152 | Ga0466967_0111152_1833_2207 | 124 |
| 113 | 3300045976 | Ga0466967_0501610 | Ga0466967_0501610_114_488 | 124 |
| 114 | 3300046454 | Ga0495592_0172142 | Ga0495592_0172142_528_902 | 124 |
| 115 | 3300046454 | Ga0495592_0605910 | Ga0495592_0605910_122_496 | 124 |
| 116 | 3300046459 | Ga0495629_0094156 | Ga0495629_0094156_381_755 | 124 |
| 117 | 3300046462 | Ga0495651_0005992 | Ga0495651_0005992_5788_6162 | 124 |
| 118 | 3300046462 | Ga0495651_0311671 | Ga0495651_0311671_526_900 | 124 |
| 119 | 3300046463 | Ga0495653_0130012 | Ga0495653_0130012_592_966 | 124 |
| 120 | 3300046473 | Ga0495582_0274367 | Ga0495582_0274367_472_846 | 124 |
| 121 | 3300046475 | Ga0495639_0138250 | Ga0495639_0138250_20_394 | 124 |
| 122 | 3300046476 | Ga0495662_0122826 | Ga0495662_0122826_402_776 | 124 |
| 123 | 3300046477 | Ga0495664_0006619 | Ga0495664_0006619_5536_5910 | 124 |
| 124 | 3300046511 | Ga0495608_0046272 | Ga0495608_0046272_1773_2147 | 124 |
| 125 | 3300046511 | Ga0495608_0180345 | Ga0495608_0180345_192_566 | 124 |
| 126 | 3300046514 | Ga0495618_0433444 | Ga0495618_0433444_23_397 | 124 |
| 127 | 3300046514 | Ga0495618_0672433 | Ga0495618_0672433_29_403 | 124 |
| 128 | 3300046516 | Ga0495628_0075440 | Ga0495628_0075440_1488_1862 | 124 |
| 129 | 3300046517 | Ga0495630_0010704 | Ga0495630_0010704_558_932 | 124 |
| 130 | 3300046525 | Ga0495663_0011429 | Ga0495663_0011429_1964_2344 | 124 |
| 131 | 3300046528 | Ga0495642_0056089 | Ga0495642_0056089_1234_1614 | 124 |
| 132 | 3300046529 | Ga0495652_0110752 | Ga0495652_0110752_764_1138 | 124 |
| 133 | 3300046529 | Ga0495652_0186799 | Ga0495652_0186799_994_1368 | 124 |
| 134 | 3300046529 | Ga0495652_0403108 | Ga0495652_0403108_192_566 | 124 |
| 135 | 3300046531 | Ga0495665_0150471 | Ga0495665_0150471_830_1204 | 124 |
| 136 | 3300046536 | Ga0495587_0045090 | Ga0495587_0045090_1308_1682 | 124 |
| 137 | 3300046543 | Ga0495645_0340194 | Ga0495645_0340194_458_832 | 124 |
| 138 | 3300046559 | Ga0495667_0005465 | Ga0495667_0005465_6086_6460 | 124 |
| 139 | 3300046559 | Ga0495667_0406283 | Ga0495667_0406283_437_811 | 124 |
| 140 | 3300046615 | Ga0495656_0104993 | Ga0495656_0104993_193_573 | 124 |
| 141 | 3300046642 | Ga0495634_0012463 | Ga0495634_0012463_133_507 | 124 |
| 142 | 3300046642 | Ga0495634_0020500 | Ga0495634_0020500_233_607 | 124 |
| 143 | 3300046663 | Ga0495635_0106627 | Ga0495635_0106627_26_400 | 124 |
| 144 | 3300046664 | Ga0495659_0023816 | Ga0495659_0023816_43_423 | 124 |
| 145 | 3300046675 | Ga0495657_0013412 | Ga0495657_0013412_5028_5402 | 124 |
| 146 | 3300046678 | Ga0495599_0224241 | Ga0495599_0224241_609_983 | 124 |
| 147 | 3300046683 | Ga0495658_0948368 | Ga0495658_0948368_67_441 | 124 |
| 148 | 3300046689 | Ga0495613_0238465 | Ga0495613_0238465_757_1131 | 124 |
| 149 | 3300046690 | Ga0495624_0256094 | Ga0495624_0256094_447_821 | 124 |
| 150 | 3300046692 | Ga0495671_0108319 | Ga0495671_0108319_280_660 | 124 |
| 151 | 3300046794 | Ga0495589_0217321 | Ga0495589_0217321_274_654 | 124 |
| 152 | 3300047318 | Ga0495636_0371607 | Ga0495636_0371607_52_432 | 124 |
| 153 | 3300047319 | Ga0495674_0001759 | Ga0495674_0001759_6466_6840 | 124 |
| 154 | 3300047321 | Ga0495676_0331094 | Ga0495676_0331094_208_582 | 124 |
| 155 | 3300047322 | Ga0495680_0004490 | Ga0495680_0004490_4415_4789 | 124 |
| 156 | 3300047322 | Ga0495680_0134885 | Ga0495680_0134885_632_1006 | 124 |
| 157 | 3300047447 | Ga0495685_075380 | Ga0495685_075380_588_968 | 124 |
| 158 | 3300047471 | Ga0495684_0012761 | Ga0495684_0012761_5245_5619 | 124 |
| 159 | 3300047471 | Ga0495684_0031156 | Ga0495684_0031156_2871_3245 | 124 |
| 160 | 3300048088 | Ga0495602_0118922 | Ga0495602_0118922_460_834 | 124 |
| 161 | 3300048088 | Ga0495602_0606539 | Ga0495602_0606539_295_669 | 124 |
| 162 | 3300048903 | Ga0496100_0742605 | Ga0496100_0742605_52_426 | 124 |
| 163 | 3300048904 | Ga0496101_1235124 | Ga0496101_1235124_160_534 | 124 |
| 164 | 3300048907 | Ga0496104_0208489 | Ga0496104_0208489_187_561 | 124 |
| 165 | 3300048907 | Ga0496104_1692141 | Ga0496104_1692141_16_390 | 124 |
| 166 | 3300048908 | Ga0496105_0074201 | Ga0496105_0074201_2197_2571 | 124 |
| 167 | 3300048912 | Ga0496109_0289482 | Ga0496109_0289482_949_1323 | 124 |
| 168 | 3300048913 | Ga0496110_0153191 | Ga0496110_0153191_1149_1523 | 124 |
| 169 | 3300048913 | Ga0496110_0182804 | Ga0496110_0182804_743_1117 | 124 |
| 170 | 3300048916 | Ga0496113_0309601 | Ga0496113_0309601_717_1091 | 124 |
| 171 | 3300048917 | Ga0496114_0001682 | Ga0496114_0001682_14857_15231 | 124 |
| 172 | 3300048917 | Ga0496114_0438352 | Ga0496114_0438352_626_1000 | 124 |
| 173 | 3300048917 | Ga0496114_1669636 | Ga0496114_1669636_72_446 | 124 |
| 174 | 3300048918 | Ga0496115_0425118 | Ga0496115_0425118_296_676 | 124 |
| 175 | 3300048918 | Ga0496115_0679169 | Ga0496115_0679169_64_438 | 124 |
| 176 | 3300053078 | Ga0495612_0039540 | Ga0495612_0039540_879_1253 | 124 |
| 177 | 3300053085 | Ga0495619_0007565 | Ga0495619_0007565_5804_6178 | 124 |
| 178 | 3300053085 | Ga0495619_0017932 | Ga0495619_0017932_3834_4208 | 124 |
| 179 | 3300053085 | Ga0495619_0111441 | Ga0495619_0111441_690_1064 | 124 |
| 180 | 3300005329 | Ga0070683_100042976 | Ga0070683_1000429764 | 125 |
| 181 | 3300005334 | Ga0068869_100669261 | Ga0068869_1006692611 | 125 |
| 182 | 3300005440 | Ga0070705_100638081 | Ga0070705_1006380812 | 125 |
| 183 | 3300005445 | Ga0070708_100006168 | Ga0070708_1000061683 | 125 |
| 184 | 3300005467 | Ga0070706_100000265 | Ga0070706_10000026518 | 125 |
| 185 | 3300005467 | Ga0070706_100016294 | Ga0070706_1000162944 | 125 |
| 186 | 3300005468 | Ga0070707_100003506 | Ga0070707_1000035063 | 125 |
| 187 | 3300005471 | Ga0070698_100054382 | Ga0070698_1000543824 | 125 |
| 188 | 3300005471 | Ga0070698_100424142 | Ga0070698_1004241422 | 125 |
| 189 | 3300005471 | Ga0070698_100656962 | Ga0070698_1006569622 | 125 |
| 190 | 3300005518 | Ga0070699_100670809 | Ga0070699_1006708092 | 125 |
| 191 | 3300005535 | Ga0070684_100042878 | Ga0070684_1000428782 | 125 |
| 192 | 3300005536 | Ga0070697_100076109 | Ga0070697_1000761091 | 125 |
| 193 | 3300005937 | Ga0081455_10014560 | Ga0081455_100145609 | 125 |
| 194 | 3300005983 | Ga0081540_1000879 | Ga0081540_100087927 | 125 |
| 195 | 3300005985 | Ga0081539_10002754 | Ga0081539_1000275411 | 125 |
| 196 | 3300006038 | Ga0075365_10109483 | Ga0075365_101094832 | 125 |
| 197 | 3300006058 | Ga0075432_10142691 | Ga0075432_101426912 | 125 |
| 198 | 3300009094 | Ga0111539_10082138 | Ga0111539_100821383 | 125 |
| 199 | 3300009098 | Ga0105245_10623096 | Ga0105245_106230962 | 125 |
| 200 | 3300011119 | Ga0105246_10556720 | Ga0105246_105567202 | 125 |
| 201 | 3300025899 | Ga0207642_10488668 | Ga0207642_104886682 | 125 |
| 202 | 3300025910 | Ga0207684_10000221 | Ga0207684_1000022160 | 125 |
| 203 | 3300025910 | Ga0207684_10034243 | Ga0207684_100342433 | 125 |
| 204 | 3300025920 | Ga0207649_10473698 | Ga0207649_104736982 | 125 |
| 205 | 3300025922 | Ga0207646_10004631 | Ga0207646_1000463115 | 125 |
| 206 | 3300025942 | Ga0207689_10432260 | Ga0207689_104322602 | 125 |
| 207 | 3300025944 | Ga0207661_10032234 | Ga0207661_100322345 | 125 |
| 208 | 3300035089 | Ga0373944_0368160 | Ga0373944_0368160_158_535 | 125 |
| 209 | 3300035725 | Ga0373947_0402726 | Ga0373947_0402726_406_783 | 125 |
| 210 | 3300037418 | Ga0395900_0025384 | Ga0395900_0025384_3266_3643 | 125 |
| 211 | 3300037471 | Ga0395905_1246160 | Ga0395905_1246160_68_445 | 125 |
| 212 | 3300038443 | Ga0395901_0054431 | Ga0395901_0054431_772_1149 | 125 |
| 213 | 3300042122 | Ga0450920_058579 | Ga0450920_058579_138_518 | 125 |
| 214 | 3300042145 | Ga0450906_110120 | Ga0450906_110120_39_419 | 125 |
| 215 | 3300044683 | Ga0466965_0345930 | Ga0466965_0345930_162_539 | 125 |
| 216 | 3300044684 | Ga0466966_0011436 | Ga0466966_0011436_2322_2699 | 125 |
| 217 | 3300044693 | Ga0466961_0037677 | Ga0466961_0037677_2390_2767 | 125 |
| 218 | 3300044694 | Ga0466963_0094222 | Ga0466963_0094222_712_1107 | 125 |
| 219 | 3300044706 | Ga0466964_0121569 | Ga0466964_0121569_676_1053 | 125 |
| 220 | 3300045049 | Ga0466959_0135158 | Ga0466959_0135158_80_457 | 125 |
| 221 | 3300045051 | Ga0451576_0584423 | Ga0451576_0584423_698_1075 | 125 |
| 222 | 3300045836 | Ga0466958_0092580 | Ga0466958_0092580_1459_1839 | 125 |
| 223 | 3300049568 | Ga0501031_0017160 | Ga0501031_0017160_200_577 | 125 |
| 224 | 3300049569 | Ga0501032_0715991 | Ga0501032_0715991_200_577 | 125 |
| 225 | 3300049570 | Ga0501033_0271976 | Ga0501033_0271976_355_732 | 125 |
| 226 | 3300049572 | Ga0501036_0023454 | Ga0501036_0023454_2541_2918 | 125 |
| 227 | 3300049574 | Ga0501038_0030196 | Ga0501038_0030196_3964_4341 | 125 |
| 228 | 3300049575 | Ga0501039_0031596 | Ga0501039_0031596_1842_2219 | 125 |
| 229 | 3300049576 | Ga0501040_0085324 | Ga0501040_0085324_1445_1822 | 125 |
| 230 | 3300049577 | Ga0501041_0008515 | Ga0501041_0008515_2671_3048 | 125 |
| 231 | 3300049578 | Ga0501042_0012945 | Ga0501042_0012945_4582_4959 | 125 |
| 232 | 3300049579 | Ga0501043_0269576 | Ga0501043_0269576_189_566 | 125 |
| 233 | 3300049582 | Ga0501048_0061804 | Ga0501048_0061804_725_1102 | 125 |
| 234 | 3300049585 | Ga0501069_0074044 | Ga0501069_0074044_851_1228 | 125 |
| 235 | 3300049587 | Ga0501071_0011103 | Ga0501071_0011103_4074_4451 | 125 |
| 236 | 3300049588 | Ga0501072_0022731 | Ga0501072_0022731_2698_3075 | 125 |
| 237 | 3300049590 | Ga0501074_0029295 | Ga0501074_0029295_1863_2240 | 125 |
| 238 | 3300049591 | Ga0501075_0047023 | Ga0501075_0047023_1281_1658 | 125 |
| 239 | 3300049592 | Ga0501076_0024282 | Ga0501076_0024282_4107_4484 | 125 |
| 240 | 3300049593 | Ga0501077_0020436 | Ga0501077_0020436_1649_2026 | 125 |
| 241 | 3300049741 | Ga0501079_0037053 | Ga0501079_0037053_2522_2899 | 125 |
| 242 | 3300049742 | Ga0501080_0055563 | Ga0501080_0055563_2651_3028 | 125 |
| 243 | 3300049743 | Ga0501081_0028566 | Ga0501081_0028566_317_694 | 125 |
| 244 | 3300049822 | Ga0501035_0222690 | Ga0501035_0222690_510_887 | 125 |
| 245 | 3300049824 | Ga0501045_0013202 | Ga0501045_0013202_3179_3556 | 125 |
| 246 | 3300050492 | nmdc:mga0yw44_94113_c1 | nmdc:mga0yw44_94113_c1_1248_1625 | 125 |
| 247 | 3300050511 | nmdc:mga08y16_65593_c1 | nmdc:mga08y16_65593_c1_409_786 | 125 |
| 248 | 3300054114 | Ga0501084_0064556 | Ga0501084_0064556_1376_1753 | 125 |
| 249 | 3300054114 | Ga0501084_0880737 | Ga0501084_0880737_17_397 | 125 |
| 250 | 3300060353 | Ga0501082_0182839 | Ga0501082_0182839_462_839 | 125 |
| 251 | 3300061719 | Ga0466962_0026892 | Ga0466962_0026892_250_627 | 125 |
| 252 | 3300001978 | JGI24747J21853_1006440 | JGI24747J21853_10064402 | 126 |
| 253 | 3300002077 | JGI24744J21845_10002681 | JGI24744J21845_100026812 | 126 |
| 254 | 3300002155 | JGI24033J26618_1001669 | JGI24033J26618_10016693 | 126 |
| 255 | 3300002244 | JGI24742J22300_10021071 | JGI24742J22300_100210712 | 126 |
| 256 | 3300002459 | JGI24751J29686_10000223 | JGI24751J29686_100002232 | 126 |
| 257 | 3300002459 | JGI24751J29686_10007378 | JGI24751J29686_100073783 | 126 |
| 258 | 3300005328 | Ga0070676_10516119 | Ga0070676_105161192 | 126 |
| 259 | 3300005329 | Ga0070683_100013383 | Ga0070683_1000133834 | 126 |
| 260 | 3300005330 | Ga0070690_100586048 | Ga0070690_1005860482 | 126 |
| 261 | 3300005330 | Ga0070690_100810082 | Ga0070690_1008100821 | 126 |
| 262 | 3300005331 | Ga0070670_100011290 | Ga0070670_1000112904 | 126 |
| 263 | 3300005331 | Ga0070670_100349551 | Ga0070670_1003495512 | 126 |
| 264 | 3300005335 | Ga0070666_10039778 | Ga0070666_100397785 | 126 |
| 265 | 3300005336 | Ga0070680_100010728 | Ga0070680_1000107287 | 126 |
| 266 | 3300005336 | Ga0070680_100213008 | Ga0070680_1002130082 | 126 |
| 267 | 3300005337 | Ga0070682_100005203 | Ga0070682_1000052032 | 126 |
| 268 | 3300005337 | Ga0070682_100809160 | Ga0070682_1008091602 | 126 |
| 269 | 3300005338 | Ga0068868_100029932 | Ga0068868_1000299322 | 126 |
| 270 | 3300005339 | Ga0070660_100126703 | Ga0070660_1001267032 | 126 |
| 271 | 3300005339 | Ga0070660_100370265 | Ga0070660_1003702652 | 126 |
| 272 | 3300005340 | Ga0070689_100013742 | Ga0070689_1000137422 | 126 |
| 273 | 3300005340 | Ga0070689_100180355 | Ga0070689_1001803552 | 126 |
| 274 | 3300005343 | Ga0070687_100537140 | Ga0070687_1005371402 | 126 |
| 275 | 3300005343 | Ga0070687_101156369 | Ga0070687_1011563691 | 126 |
| 276 | 3300005344 | Ga0070661_100159774 | Ga0070661_1001597742 | 126 |
| 277 | 3300005344 | Ga0070661_100677212 | Ga0070661_1006772121 | 126 |
| 278 | 3300005344 | Ga0070661_101577090 | Ga0070661_1015770901 | 126 |
| 279 | 3300005345 | Ga0070692_10073774 | Ga0070692_100737742 | 126 |
| 280 | 3300005345 | Ga0070692_10119108 | Ga0070692_101191081 | 126 |
| 281 | 3300005345 | Ga0070692_10302373 | Ga0070692_103023732 | 126 |
| 282 | 3300005347 | Ga0070668_100177352 | Ga0070668_1001773521 | 126 |
| 283 | 3300005354 | Ga0070675_100187551 | Ga0070675_1001875512 | 126 |
| 284 | 3300005354 | Ga0070675_100430778 | Ga0070675_1004307782 | 126 |
| 285 | 3300005354 | Ga0070675_101374675 | Ga0070675_1013746751 | 126 |
| 286 | 3300005355 | Ga0070671_100308743 | Ga0070671_1003087431 | 126 |
| 287 | 3300005356 | Ga0070674_100006099 | Ga0070674_1000060994 | 126 |
| 288 | 3300005356 | Ga0070674_100014513 | Ga0070674_1000145136 | 126 |
| 289 | 3300005356 | Ga0070674_101115884 | Ga0070674_1011158842 | 126 |
| 290 | 3300005364 | Ga0070673_100036857 | Ga0070673_1000368572 | 126 |
| 291 | 3300005364 | Ga0070673_100421497 | Ga0070673_1004214972 | 126 |
| 292 | 3300005365 | Ga0070688_100008183 | Ga0070688_1000081837 | 126 |
| 293 | 3300005365 | Ga0070688_100009091 | Ga0070688_1000090914 | 126 |
| 294 | 3300005365 | Ga0070688_100581586 | Ga0070688_1005815862 | 126 |
| 295 | 3300005365 | Ga0070688_101057459 | Ga0070688_1010574591 | 126 |
| 296 | 3300005366 | Ga0070659_100040224 | Ga0070659_1000402242 | 126 |
| 297 | 3300005366 | Ga0070659_100954389 | Ga0070659_1009543892 | 126 |
| 298 | 3300005366 | Ga0070659_101573745 | Ga0070659_1015737451 | 126 |
| 299 | 3300005406 | Ga0070703_10003075 | Ga0070703_100030752 | 126 |
| 300 | 3300005434 | Ga0070709_10860137 | Ga0070709_108601371 | 126 |
| 301 | 3300005435 | Ga0070714_100002672 | Ga0070714_10000267211 | 126 |
| 302 | 3300005435 | Ga0070714_100365206 | Ga0070714_1003652061 | 126 |
| 303 | 3300005435 | Ga0070714_100872673 | Ga0070714_1008726731 | 126 |
| 304 | 3300005436 | Ga0070713_100034470 | Ga0070713_1000344702 | 126 |
| 305 | 3300005437 | Ga0070710_10007082 | Ga0070710_100070827 | 126 |
| 306 | 3300005438 | Ga0070701_10175250 | Ga0070701_101752502 | 126 |
| 307 | 3300005438 | Ga0070701_10575077 | Ga0070701_105750772 | 126 |
| 308 | 3300005438 | Ga0070701_10667068 | Ga0070701_106670682 | 126 |
| 309 | 3300005439 | Ga0070711_100020235 | Ga0070711_1000202356 | 126 |
| 310 | 3300005440 | Ga0070705_100009626 | Ga0070705_1000096261 | 126 |
| 311 | 3300005440 | Ga0070705_100050491 | Ga0070705_1000504912 | 126 |
| 312 | 3300005440 | Ga0070705_100200159 | Ga0070705_1002001592 | 126 |
| 313 | 3300005440 | Ga0070705_100221055 | Ga0070705_1002210552 | 126 |
| 314 | 3300005440 | Ga0070705_100702064 | Ga0070705_1007020642 | 126 |
| 315 | 3300005441 | Ga0070700_100001522 | Ga0070700_10000152212 | 126 |
| 316 | 3300005441 | Ga0070700_100019689 | Ga0070700_1000196892 | 126 |
| 317 | 3300005441 | Ga0070700_100683667 | Ga0070700_1006836672 | 126 |
| 318 | 3300005444 | Ga0070694_100019660 | Ga0070694_1000196602 | 126 |
| 319 | 3300005444 | Ga0070694_100306859 | Ga0070694_1003068591 | 126 |
| 320 | 3300005445 | Ga0070708_100010959 | Ga0070708_1000109591 | 126 |
| 321 | 3300005445 | Ga0070708_100173553 | Ga0070708_1001735532 | 126 |
| 322 | 3300005445 | Ga0070708_101247196 | Ga0070708_1012471962 | 126 |
| 323 | 3300005455 | Ga0070663_100007368 | Ga0070663_1000073681 | 126 |
| 324 | 3300005455 | Ga0070663_100508960 | Ga0070663_1005089602 | 126 |
| 325 | 3300005455 | Ga0070663_100529554 | Ga0070663_1005295541 | 126 |
| 326 | 3300005455 | Ga0070663_100952762 | Ga0070663_1009527622 | 126 |
| 327 | 3300005456 | Ga0070678_100001885 | Ga0070678_1000018854 | 126 |
| 328 | 3300005456 | Ga0070678_100080894 | Ga0070678_1000808944 | 126 |
| 329 | 3300005457 | Ga0070662_100024483 | Ga0070662_1000244834 | 126 |
| 330 | 3300005457 | Ga0070662_100054330 | Ga0070662_1000543302 | 126 |
| 331 | 3300005459 | Ga0068867_100002812 | Ga0068867_10000281212 | 126 |
| 332 | 3300005459 | Ga0068867_100025980 | Ga0068867_1000259804 | 126 |
| 333 | 3300005459 | Ga0068867_100037053 | Ga0068867_1000370533 | 126 |
| 334 | 3300005466 | Ga0070685_10014113 | Ga0070685_100141134 | 126 |
| 335 | 3300005466 | Ga0070685_10099905 | Ga0070685_100999052 | 126 |
| 336 | 3300005466 | Ga0070685_10482302 | Ga0070685_104823022 | 126 |
| 337 | 3300005466 | Ga0070685_10529601 | Ga0070685_105296012 | 126 |
| 338 | 3300005467 | Ga0070706_100258090 | Ga0070706_1002580902 | 126 |
| 339 | 3300005467 | Ga0070706_100272381 | Ga0070706_1002723813 | 126 |
| 340 | 3300005467 | Ga0070706_100335891 | Ga0070706_1003358912 | 126 |
| 341 | 3300005467 | Ga0070706_101339102 | Ga0070706_1013391021 | 126 |
| 342 | 3300005468 | Ga0070707_100328567 | Ga0070707_1003285672 | 126 |
| 343 | 3300005468 | Ga0070707_101989904 | Ga0070707_1019899041 | 126 |
| 344 | 3300005471 | Ga0070698_100206090 | Ga0070698_1002060902 | 126 |
| 345 | 3300005471 | Ga0070698_100905513 | Ga0070698_1009055131 | 126 |
| 346 | 3300005471 | Ga0070698_101499891 | Ga0070698_1014998912 | 126 |
| 347 | 3300005518 | Ga0070699_100040001 | Ga0070699_1000400014 | 126 |
| 348 | 3300005518 | Ga0070699_100205509 | Ga0070699_1002055092 | 126 |
| 349 | 3300005530 | Ga0070679_100191341 | Ga0070679_1001913412 | 126 |
| 350 | 3300005530 | Ga0070679_101635771 | Ga0070679_1016357712 | 126 |
| 351 | 3300005535 | Ga0070684_100000718 | Ga0070684_1000007182 | 126 |
| 352 | 3300005535 | Ga0070684_100008288 | Ga0070684_1000082887 | 126 |
| 353 | 3300005536 | Ga0070697_100021631 | Ga0070697_1000216313 | 126 |
| 354 | 3300005536 | Ga0070697_101403352 | Ga0070697_1014033522 | 126 |
| 355 | 3300005539 | Ga0068853_100299142 | Ga0068853_1002991422 | 126 |
| 356 | 3300005543 | Ga0070672_100011868 | Ga0070672_1000118682 | 126 |
| 357 | 3300005544 | Ga0070686_100004420 | Ga0070686_1000044203 | 126 |
| 358 | 3300005544 | Ga0070686_100021094 | Ga0070686_1000210942 | 126 |
| 359 | 3300005544 | Ga0070686_100581643 | Ga0070686_1005816432 | 126 |
| 360 | 3300005545 | Ga0070695_100746980 | Ga0070695_1007469802 | 126 |
| 361 | 3300005546 | Ga0070696_100018988 | Ga0070696_1000189883 | 126 |
| 362 | 3300005546 | Ga0070696_100019404 | Ga0070696_1000194045 | 126 |
| 363 | 3300005546 | Ga0070696_100293958 | Ga0070696_1002939582 | 126 |
| 364 | 3300005546 | Ga0070696_100328636 | Ga0070696_1003286362 | 126 |
| 365 | 3300005546 | Ga0070696_100729915 | Ga0070696_1007299152 | 126 |
| 366 | 3300005546 | Ga0070696_101462719 | Ga0070696_1014627192 | 126 |
| 367 | 3300005547 | Ga0070693_100183653 | Ga0070693_1001836532 | 126 |
| 368 | 3300005548 | Ga0070665_100108249 | Ga0070665_1001082492 | 126 |
| 369 | 3300005549 | Ga0070704_100001582 | Ga0070704_10000158211 | 126 |
| 370 | 3300005549 | Ga0070704_100239069 | Ga0070704_1002390691 | 126 |
| 371 | 3300005549 | Ga0070704_100691769 | Ga0070704_1006917692 | 126 |
| 372 | 3300005563 | Ga0068855_102283690 | Ga0068855_1022836901 | 126 |
| 373 | 3300005564 | Ga0070664_100019961 | Ga0070664_1000199613 | 126 |
| 374 | 3300005564 | Ga0070664_100098038 | Ga0070664_1000980382 | 126 |
| 375 | 3300005564 | Ga0070664_100233888 | Ga0070664_1002338882 | 126 |
| 376 | 3300005564 | Ga0070664_100605125 | Ga0070664_1006051252 | 126 |
| 377 | 3300005564 | Ga0070664_101297518 | Ga0070664_1012975182 | 126 |
| 378 | 3300005577 | Ga0068857_100022262 | Ga0068857_1000222622 | 126 |
| 379 | 3300005577 | Ga0068857_100027256 | Ga0068857_1000272562 | 126 |
| 380 | 3300005577 | Ga0068857_100158141 | Ga0068857_1001581412 | 126 |
| 381 | 3300005577 | Ga0068857_100705252 | Ga0068857_1007052522 | 126 |
| 382 | 3300005578 | Ga0068854_100489844 | Ga0068854_1004898442 | 126 |
| 383 | 3300005578 | Ga0068854_100758406 | Ga0068854_1007584062 | 126 |
| 384 | 3300005614 | Ga0068856_100087246 | Ga0068856_1000872462 | 126 |
| 385 | 3300005614 | Ga0068856_100577133 | Ga0068856_1005771332 | 126 |
| 386 | 3300005615 | Ga0070702_100145703 | Ga0070702_1001457031 | 126 |
| 387 | 3300005615 | Ga0070702_100186433 | Ga0070702_1001864332 | 126 |
| 388 | 3300005615 | Ga0070702_100236549 | Ga0070702_1002365492 | 126 |
| 389 | 3300005615 | Ga0070702_100680672 | Ga0070702_1006806722 | 126 |
| 390 | 3300005615 | Ga0070702_100835249 | Ga0070702_1008352492 | 126 |
| 391 | 3300005616 | Ga0068852_101768244 | Ga0068852_1017682441 | 126 |
| 392 | 3300005617 | Ga0068859_100042738 | Ga0068859_1000427384 | 126 |
| 393 | 3300005617 | Ga0068859_100653203 | Ga0068859_1006532032 | 126 |
| 394 | 3300005617 | Ga0068859_100797774 | Ga0068859_1007977742 | 126 |
| 395 | 3300005617 | Ga0068859_101013963 | Ga0068859_1010139632 | 126 |
| 396 | 3300005618 | Ga0068864_100103778 | Ga0068864_1001037782 | 126 |
| 397 | 3300005618 | Ga0068864_101295310 | Ga0068864_1012953102 | 126 |
| 398 | 3300005718 | Ga0068866_10004917 | Ga0068866_100049177 | 126 |
| 399 | 3300005719 | Ga0068861_100004620 | Ga0068861_1000046204 | 126 |
| 400 | 3300005719 | Ga0068861_100066704 | Ga0068861_1000667043 | 126 |
| 401 | 3300005719 | Ga0068861_100842984 | Ga0068861_1008429842 | 126 |
| 402 | 3300005834 | Ga0068851_10429055 | Ga0068851_104290552 | 126 |
| 403 | 3300005840 | Ga0068870_10004753 | Ga0068870_100047532 | 126 |
| 404 | 3300005840 | Ga0068870_10007440 | Ga0068870_100074404 | 126 |
| 405 | 3300005840 | Ga0068870_10095903 | Ga0068870_100959032 | 126 |
| 406 | 3300005840 | Ga0068870_10327392 | Ga0068870_103273922 | 126 |
| 407 | 3300005841 | Ga0068863_100028952 | Ga0068863_1000289523 | 126 |
| 408 | 3300005841 | Ga0068863_100468397 | Ga0068863_1004683972 | 126 |
| 409 | 3300005841 | Ga0068863_100858325 | Ga0068863_1008583251 | 126 |
| 410 | 3300005841 | Ga0068863_101947726 | Ga0068863_1019477261 | 126 |
| 411 | 3300005842 | Ga0068858_100040973 | Ga0068858_1000409735 | 126 |
| 412 | 3300005843 | Ga0068860_100136828 | Ga0068860_1001368283 | 126 |
| 413 | 3300005843 | Ga0068860_100331602 | Ga0068860_1003316022 | 126 |
| 414 | 3300005843 | Ga0068860_100391942 | Ga0068860_1003919422 | 126 |
| 415 | 3300005844 | Ga0068862_100076290 | Ga0068862_1000762904 | 126 |
| 416 | 3300005937 | Ga0081455_10003184 | Ga0081455_1000318412 | 126 |
| 417 | 3300005937 | Ga0081455_10023102 | Ga0081455_100231023 | 126 |
| 418 | 3300005937 | Ga0081455_10033620 | Ga0081455_100336204 | 126 |
| 419 | 3300005937 | Ga0081455_10051279 | Ga0081455_100512792 | 126 |
| 420 | 3300005937 | Ga0081455_10052811 | Ga0081455_100528112 | 126 |
| 421 | 3300005937 | Ga0081455_10146895 | Ga0081455_101468952 | 126 |
| 422 | 3300005937 | Ga0081455_10240217 | Ga0081455_102402172 | 126 |
| 423 | 3300005937 | Ga0081455_10258194 | Ga0081455_102581942 | 126 |
| 424 | 3300005937 | Ga0081455_10303955 | Ga0081455_103039552 | 126 |
| 425 | 3300005937 | Ga0081455_10596483 | Ga0081455_105964832 | 126 |
| 426 | 3300005981 | Ga0081538_10098095 | Ga0081538_100980951 | 126 |
| 427 | 3300005981 | Ga0081538_10191186 | Ga0081538_101911862 | 126 |
| 428 | 3300005985 | Ga0081539_10167839 | Ga0081539_101678392 | 126 |
| 429 | 3300006028 | Ga0070717_10120096 | Ga0070717_101200962 | 126 |
| 430 | 3300006028 | Ga0070717_10335052 | Ga0070717_103350523 | 126 |
| 431 | 3300006038 | Ga0075365_10015406 | Ga0075365_100154063 | 126 |
| 432 | 3300006051 | Ga0075364_10116426 | Ga0075364_101164262 | 126 |
| 433 | 3300006058 | Ga0075432_10001799 | Ga0075432_100017995 | 126 |
| 434 | 3300006173 | Ga0070716_100377196 | Ga0070716_1003771962 | 126 |
| 435 | 3300006173 | Ga0070716_100708124 | Ga0070716_1007081242 | 126 |
| 436 | 3300006175 | Ga0070712_100172051 | Ga0070712_1001720512 | 126 |
| 437 | 3300006178 | Ga0075367_10324660 | Ga0075367_103246602 | 126 |
| 438 | 3300006237 | Ga0097621_100120527 | Ga0097621_1001205273 | 126 |
| 439 | 3300006237 | Ga0097621_100124068 | Ga0097621_1001240682 | 126 |
| 440 | 3300006358 | Ga0068871_100039897 | Ga0068871_1000398974 | 126 |
| 441 | 3300006358 | Ga0068871_100066036 | Ga0068871_1000660361 | 126 |
| 442 | 3300006844 | Ga0075428_100033997 | Ga0075428_1000339973 | 126 |
| 443 | 3300006844 | Ga0075428_100039421 | Ga0075428_1000394213 | 126 |
| 444 | 3300006844 | Ga0075428_102433309 | Ga0075428_1024333091 | 126 |
| 445 | 3300006846 | Ga0075430_100010189 | Ga0075430_1000101895 | 126 |
| 446 | 3300006846 | Ga0075430_100052967 | Ga0075430_1000529675 | 126 |
| 447 | 3300006847 | Ga0075431_100010011 | Ga0075431_1000100115 | 126 |
| 448 | 3300006847 | Ga0075431_100140156 | Ga0075431_1001401562 | 126 |
| 449 | 3300006852 | Ga0075433_10000149 | Ga0075433_1000014935 | 126 |
| 450 | 3300006852 | Ga0075433_10011686 | Ga0075433_100116865 | 126 |
| 451 | 3300006852 | Ga0075433_10021142 | Ga0075433_100211423 | 126 |
| 452 | 3300006852 | Ga0075433_10088345 | Ga0075433_100883452 | 126 |
| 453 | 3300006852 | Ga0075433_10714073 | Ga0075433_107140732 | 126 |
| 454 | 3300006871 | Ga0075434_100005828 | Ga0075434_1000058283 | 126 |
| 455 | 3300006871 | Ga0075434_100007538 | Ga0075434_1000075382 | 126 |
| 456 | 3300006880 | Ga0075429_100149373 | Ga0075429_1001493732 | 126 |
| 457 | 3300006880 | Ga0075429_100250488 | Ga0075429_1002504882 | 126 |
| 458 | 3300006881 | Ga0068865_100011942 | Ga0068865_1000119425 | 126 |
| 459 | 3300006881 | Ga0068865_100109842 | Ga0068865_1001098421 | 126 |
| 460 | 3300006881 | Ga0068865_100205728 | Ga0068865_1002057282 | 126 |
| 461 | 3300006914 | Ga0075436_100064663 | Ga0075436_1000646632 | 126 |
| 462 | 3300006931 | Ga0097620_100042737 | Ga0097620_1000427374 | 126 |
| 463 | 3300006931 | Ga0097620_100653186 | Ga0097620_1006531862 | 126 |
| 464 | 3300006931 | Ga0097620_100797881 | Ga0097620_1007978812 | 126 |
| 465 | 3300006931 | Ga0097620_101013765 | Ga0097620_1010137652 | 126 |
| 466 | 3300007076 | Ga0075435_100032344 | Ga0075435_1000323444 | 126 |
| 467 | 3300009011 | Ga0105251_10050465 | Ga0105251_100504652 | 126 |
| 468 | 3300009094 | Ga0111539_10080744 | Ga0111539_100807445 | 126 |
| 469 | 3300009094 | Ga0111539_10177989 | Ga0111539_101779892 | 126 |
| 470 | 3300009094 | Ga0111539_10284180 | Ga0111539_102841802 | 126 |
| 471 | 3300009094 | Ga0111539_10295246 | Ga0111539_102952462 | 126 |
| 472 | 3300009098 | Ga0105245_10044957 | Ga0105245_100449572 | 126 |
| 473 | 3300009098 | Ga0105245_10046136 | Ga0105245_100461363 | 126 |
| 474 | 3300009098 | Ga0105245_10063865 | Ga0105245_100638652 | 126 |
| 475 | 3300009098 | Ga0105245_10554196 | Ga0105245_105541962 | 126 |
| 476 | 3300009098 | Ga0105245_10617585 | Ga0105245_106175852 | 126 |
| 477 | 3300009098 | Ga0105245_11075661 | Ga0105245_110756612 | 126 |
| 478 | 3300009098 | Ga0105245_11786312 | Ga0105245_117863121 | 126 |
| 479 | 3300009101 | Ga0105247_11249689 | Ga0105247_112496891 | 126 |
| 480 | 3300009147 | Ga0114129_10000667 | Ga0114129_1000066737 | 126 |
| 481 | 3300009147 | Ga0114129_10020441 | Ga0114129_100204412 | 126 |
| 482 | 3300009147 | Ga0114129_10123275 | Ga0114129_101232752 | 126 |
| 483 | 3300009147 | Ga0114129_10197914 | Ga0114129_101979142 | 126 |
| 484 | 3300009147 | Ga0114129_10641285 | Ga0114129_106412852 | 126 |
| 485 | 3300009147 | Ga0114129_10720348 | Ga0114129_107203482 | 126 |
| 486 | 3300009147 | Ga0114129_10913986 | Ga0114129_109139862 | 126 |
| 487 | 3300009148 | Ga0105243_10003824 | Ga0105243_1000382412 | 126 |
| 488 | 3300009148 | Ga0105243_10006839 | Ga0105243_100068397 | 126 |
| 489 | 3300009148 | Ga0105243_10079721 | Ga0105243_100797212 | 126 |
| 490 | 3300009148 | Ga0105243_10270750 | Ga0105243_102707502 | 126 |
| 491 | 3300009148 | Ga0105243_10277012 | Ga0105243_102770122 | 126 |
| 492 | 3300009148 | Ga0105243_10813467 | Ga0105243_108134672 | 126 |
| 493 | 3300009148 | Ga0105243_11332978 | Ga0105243_113329782 | 126 |
| 494 | 3300009174 | Ga0105241_10517329 | Ga0105241_105173292 | 126 |
| 495 | 3300009174 | Ga0105241_10563126 | Ga0105241_105631263 | 126 |
| 496 | 3300009174 | Ga0105241_10828537 | Ga0105241_108285371 | 126 |
| 497 | 3300009176 | Ga0105242_10003423 | Ga0105242_100034234 | 126 |
| 498 | 3300009176 | Ga0105242_10009376 | Ga0105242_100093762 | 126 |
| 499 | 3300009176 | Ga0105242_10029108 | Ga0105242_100291087 | 126 |
| 500 | 3300009176 | Ga0105242_10410948 | Ga0105242_104109482 | 126 |
| 501 | 3300009176 | Ga0105242_10678008 | Ga0105242_106780082 | 126 |
| 502 | 3300009176 | Ga0105242_10679999 | Ga0105242_106799992 | 126 |
| 503 | 3300009176 | Ga0105242_12569020 | Ga0105242_125690201 | 126 |
| 504 | 3300009177 | Ga0105248_10031295 | Ga0105248_100312954 | 126 |
| 505 | 3300009177 | Ga0105248_10413998 | Ga0105248_104139982 | 126 |
| 506 | 3300009177 | Ga0105248_10753334 | Ga0105248_107533342 | 126 |
| 507 | 3300009177 | Ga0105248_11982503 | Ga0105248_119825031 | 126 |
| 508 | 3300009545 | Ga0105237_11507369 | Ga0105237_115073692 | 126 |
| 509 | 3300009551 | Ga0105238_10015628 | Ga0105238_100156282 | 126 |
| 510 | 3300009551 | Ga0105238_12327621 | Ga0105238_123276211 | 126 |
| 511 | 3300009553 | Ga0105249_10001792 | Ga0105249_100017923 | 126 |
| 512 | 3300009553 | Ga0105249_10059717 | Ga0105249_100597175 | 126 |
| 513 | 3300009553 | Ga0105249_10123526 | Ga0105249_101235262 | 126 |
| 514 | 3300009553 | Ga0105249_10703427 | Ga0105249_107034272 | 126 |
| 515 | 3300010375 | Ga0105239_10170095 | Ga0105239_101700954 | 126 |
| 516 | 3300010375 | Ga0105239_10224033 | Ga0105239_102240332 | 126 |
| 517 | 3300010375 | Ga0105239_10258081 | Ga0105239_102580812 | 126 |
| 518 | 3300010375 | Ga0105239_10501726 | Ga0105239_105017262 | 126 |
| 519 | 3300011119 | Ga0105246_10022863 | Ga0105246_100228633 | 126 |
| 520 | 3300011119 | Ga0105246_10903332 | Ga0105246_109033321 | 126 |
| 521 | 3300011119 | Ga0105246_10983809 | Ga0105246_109838092 | 126 |
| 522 | 3300013100 | Ga0157373_10106315 | Ga0157373_101063152 | 126 |
| 523 | 3300013102 | Ga0157371_10624445 | Ga0157371_106244452 | 126 |
| 524 | 3300013105 | Ga0157369_12455320 | Ga0157369_124553201 | 126 |
| 525 | 3300013296 | Ga0157374_10175068 | Ga0157374_101750682 | 126 |
| 526 | 3300013296 | Ga0157374_10491150 | Ga0157374_104911502 | 126 |
| 527 | 3300013296 | Ga0157374_10983492 | Ga0157374_109834922 | 126 |
| 528 | 3300013297 | Ga0157378_10004712 | Ga0157378_100047122 | 126 |
| 529 | 3300013297 | Ga0157378_10179344 | Ga0157378_101793443 | 126 |
| 530 | 3300013297 | Ga0157378_11334808 | Ga0157378_113348082 | 126 |
| 531 | 3300013306 | Ga0163162_10005507 | Ga0163162_1000550713 | 126 |
| 532 | 3300013306 | Ga0163162_10201780 | Ga0163162_102017803 | 126 |
| 533 | 3300013306 | Ga0163162_11793284 | Ga0163162_117932842 | 126 |
| 534 | 3300013306 | Ga0163162_11821100 | Ga0163162_118211002 | 126 |
| 535 | 3300013306 | Ga0163162_12488470 | Ga0163162_124884702 | 126 |
| 536 | 3300013307 | Ga0157372_10722465 | Ga0157372_107224652 | 126 |
| 537 | 3300013308 | Ga0157375_10234330 | Ga0157375_102343303 | 126 |
| 538 | 3300013308 | Ga0157375_10540395 | Ga0157375_105403952 | 126 |
| 539 | 3300013308 | Ga0157375_10655271 | Ga0157375_106552711 | 126 |
| 540 | 3300013308 | Ga0157375_11554919 | Ga0157375_115549191 | 126 |
| 541 | 3300014325 | Ga0163163_10263831 | Ga0163163_102638311 | 126 |
| 542 | 3300014325 | Ga0163163_10738138 | Ga0163163_107381382 | 126 |
| 543 | 3300014326 | Ga0157380_10025600 | Ga0157380_100256005 | 126 |
| 544 | 3300014326 | Ga0157380_10141442 | Ga0157380_101414422 | 126 |
| 545 | 3300014326 | Ga0157380_11062905 | Ga0157380_110629052 | 126 |
| 546 | 3300014326 | Ga0157380_11130707 | Ga0157380_111307072 | 126 |
| 547 | 3300014326 | Ga0157380_11343311 | Ga0157380_113433112 | 126 |
| 548 | 3300014326 | Ga0157380_11825536 | Ga0157380_118255362 | 126 |
| 549 | 3300014745 | Ga0157377_10004589 | Ga0157377_100045892 | 126 |
| 550 | 3300014745 | Ga0157377_10037023 | Ga0157377_100370233 | 126 |
| 551 | 3300014745 | Ga0157377_10397180 | Ga0157377_103971802 | 126 |
| 552 | 3300014745 | Ga0157377_10782750 | Ga0157377_107827502 | 126 |
| 553 | 3300014745 | Ga0157377_11062873 | Ga0157377_110628732 | 126 |
| 554 | 3300014968 | Ga0157379_10101297 | Ga0157379_101012973 | 126 |
| 555 | 3300014968 | Ga0157379_10567811 | Ga0157379_105678112 | 126 |
| 556 | 3300014968 | Ga0157379_10914341 | Ga0157379_109143412 | 126 |
| 557 | 3300014969 | Ga0157376_10323551 | Ga0157376_103235512 | 126 |
| 558 | 3300014969 | Ga0157376_11042648 | Ga0157376_110426482 | 126 |
| 559 | 3300014969 | Ga0157376_12870617 | Ga0157376_128706172 | 126 |
| 560 | 3300017792 | Ga0163161_10177907 | Ga0163161_101779072 | 126 |
| 561 | 3300025321 | Ga0207656_10011064 | Ga0207656_100110644 | 126 |
| 562 | 3300025321 | Ga0207656_10464349 | Ga0207656_104643492 | 126 |
| 563 | 3300025885 | Ga0207653_10001669 | Ga0207653_100016695 | 126 |
| 564 | 3300025898 | Ga0207692_10003480 | Ga0207692_100034806 | 126 |
| 565 | 3300025899 | Ga0207642_10011346 | Ga0207642_100113461 | 126 |
| 566 | 3300025900 | Ga0207710_10005058 | Ga0207710_100050585 | 126 |
| 567 | 3300025900 | Ga0207710_10282202 | Ga0207710_102822021 | 126 |
| 568 | 3300025901 | Ga0207688_10010940 | Ga0207688_100109404 | 126 |
| 569 | 3300025901 | Ga0207688_10026972 | Ga0207688_100269723 | 126 |
| 570 | 3300025901 | Ga0207688_10177738 | Ga0207688_101777381 | 126 |
| 571 | 3300025904 | Ga0207647_10031056 | Ga0207647_100310564 | 126 |
| 572 | 3300025904 | Ga0207647_10075408 | Ga0207647_100754081 | 126 |
| 573 | 3300025904 | Ga0207647_10193082 | Ga0207647_101930822 | 126 |
| 574 | 3300025904 | Ga0207647_10408605 | Ga0207647_104086052 | 126 |
| 575 | 3300025907 | Ga0207645_10443085 | Ga0207645_104430852 | 126 |
| 576 | 3300025908 | Ga0207643_10002088 | Ga0207643_100020882 | 126 |
| 577 | 3300025908 | Ga0207643_10005135 | Ga0207643_100051355 | 126 |
| 578 | 3300025908 | Ga0207643_10046922 | Ga0207643_100469222 | 126 |
| 579 | 3300025910 | Ga0207684_10259573 | Ga0207684_102595732 | 126 |
| 580 | 3300025911 | Ga0207654_10475632 | Ga0207654_104756322 | 126 |
| 581 | 3300025915 | Ga0207693_10011416 | Ga0207693_100114167 | 126 |
| 582 | 3300025915 | Ga0207693_10607360 | Ga0207693_106073603 | 126 |
| 583 | 3300025916 | Ga0207663_11069062 | Ga0207663_110690621 | 126 |
| 584 | 3300025917 | Ga0207660_10015411 | Ga0207660_100154114 | 126 |
| 585 | 3300025917 | Ga0207660_10657613 | Ga0207660_106576132 | 126 |
| 586 | 3300025918 | Ga0207662_10018938 | Ga0207662_100189386 | 126 |
| 587 | 3300025918 | Ga0207662_10576610 | Ga0207662_105766101 | 126 |
| 588 | 3300025919 | Ga0207657_10025802 | Ga0207657_100258025 | 126 |
| 589 | 3300025919 | Ga0207657_10067512 | Ga0207657_100675122 | 126 |
| 590 | 3300025920 | Ga0207649_10202552 | Ga0207649_102025522 | 126 |
| 591 | 3300025920 | Ga0207649_10280891 | Ga0207649_102808912 | 126 |
| 592 | 3300025921 | Ga0207652_10212966 | Ga0207652_102129661 | 126 |
| 593 | 3300025922 | Ga0207646_10398543 | Ga0207646_103985432 | 126 |
| 594 | 3300025922 | Ga0207646_10738101 | Ga0207646_107381012 | 126 |
| 595 | 3300025925 | Ga0207650_10023167 | Ga0207650_100231672 | 126 |
| 596 | 3300025925 | Ga0207650_10045211 | Ga0207650_100452113 | 126 |
| 597 | 3300025925 | Ga0207650_10750071 | Ga0207650_107500712 | 126 |
| 598 | 3300025926 | Ga0207659_10067135 | Ga0207659_100671353 | 126 |
| 599 | 3300025926 | Ga0207659_10448620 | Ga0207659_104486202 | 126 |
| 600 | 3300025926 | Ga0207659_11040329 | Ga0207659_110403292 | 126 |
| 601 | 3300025927 | Ga0207687_10032206 | Ga0207687_100322062 | 126 |
| 602 | 3300025927 | Ga0207687_10072029 | Ga0207687_100720292 | 126 |
| 603 | 3300025927 | Ga0207687_10120279 | Ga0207687_101202792 | 126 |
| 604 | 3300025927 | Ga0207687_10202043 | Ga0207687_102020432 | 126 |
| 605 | 3300025927 | Ga0207687_10232817 | Ga0207687_102328172 | 126 |
| 606 | 3300025927 | Ga0207687_10379874 | Ga0207687_103798742 | 126 |
| 607 | 3300025927 | Ga0207687_10604053 | Ga0207687_106040532 | 126 |
| 608 | 3300025927 | Ga0207687_11488249 | Ga0207687_114882491 | 126 |
| 609 | 3300025928 | Ga0207700_10270200 | Ga0207700_102702003 | 126 |
| 610 | 3300025929 | Ga0207664_10011571 | Ga0207664_100115715 | 126 |
| 611 | 3300025929 | Ga0207664_10564380 | Ga0207664_105643801 | 126 |
| 612 | 3300025929 | Ga0207664_10578017 | Ga0207664_105780172 | 126 |
| 613 | 3300025931 | Ga0207644_10700074 | Ga0207644_107000742 | 126 |
| 614 | 3300025931 | Ga0207644_10818342 | Ga0207644_108183422 | 126 |
| 615 | 3300025932 | Ga0207690_10104757 | Ga0207690_101047572 | 126 |
| 616 | 3300025932 | Ga0207690_10198315 | Ga0207690_101983152 | 126 |
| 617 | 3300025932 | Ga0207690_10285803 | Ga0207690_102858032 | 126 |
| 618 | 3300025932 | Ga0207690_10442364 | Ga0207690_104423642 | 126 |
| 619 | 3300025932 | Ga0207690_10980249 | Ga0207690_109802492 | 126 |
| 620 | 3300025933 | Ga0207706_10037083 | Ga0207706_100370833 | 126 |
| 621 | 3300025933 | Ga0207706_10399290 | Ga0207706_103992902 | 126 |
| 622 | 3300025934 | Ga0207686_10007592 | Ga0207686_100075926 | 126 |
| 623 | 3300025934 | Ga0207686_10229718 | Ga0207686_102297182 | 126 |
| 624 | 3300025934 | Ga0207686_10471918 | Ga0207686_104719182 | 126 |
| 625 | 3300025934 | Ga0207686_10818529 | Ga0207686_108185292 | 126 |
| 626 | 3300025935 | Ga0207709_10002377 | Ga0207709_100023774 | 126 |
| 627 | 3300025935 | Ga0207709_10106544 | Ga0207709_101065442 | 126 |
| 628 | 3300025935 | Ga0207709_10313048 | Ga0207709_103130482 | 126 |
| 629 | 3300025936 | Ga0207670_10017826 | Ga0207670_100178264 | 126 |
| 630 | 3300025936 | Ga0207670_10038535 | Ga0207670_100385354 | 126 |
| 631 | 3300025936 | Ga0207670_10115103 | Ga0207670_101151032 | 126 |
| 632 | 3300025937 | Ga0207669_10082283 | Ga0207669_100822832 | 126 |
| 633 | 3300025937 | Ga0207669_10224725 | Ga0207669_102247252 | 126 |
| 634 | 3300025938 | Ga0207704_10022125 | Ga0207704_100221252 | 126 |
| 635 | 3300025938 | Ga0207704_10163764 | Ga0207704_101637642 | 126 |
| 636 | 3300025940 | Ga0207691_10012079 | Ga0207691_100120794 | 126 |
| 637 | 3300025940 | Ga0207691_10350923 | Ga0207691_103509232 | 126 |
| 638 | 3300025941 | Ga0207711_10118660 | Ga0207711_101186603 | 126 |
| 639 | 3300025941 | Ga0207711_10206620 | Ga0207711_102066202 | 126 |
| 640 | 3300025941 | Ga0207711_10544796 | Ga0207711_105447961 | 126 |
| 641 | 3300025941 | Ga0207711_10959266 | Ga0207711_109592662 | 126 |
| 642 | 3300025942 | Ga0207689_10024119 | Ga0207689_100241193 | 126 |
| 643 | 3300025942 | Ga0207689_10063355 | Ga0207689_100633552 | 126 |
| 644 | 3300025942 | Ga0207689_10169291 | Ga0207689_101692912 | 126 |
| 645 | 3300025944 | Ga0207661_10163071 | Ga0207661_101630712 | 126 |
| 646 | 3300025944 | Ga0207661_10287839 | Ga0207661_102878392 | 126 |
| 647 | 3300025944 | Ga0207661_10513505 | Ga0207661_105135052 | 126 |
| 648 | 3300025944 | Ga0207661_11240526 | Ga0207661_112405262 | 126 |
| 649 | 3300025945 | Ga0207679_10048806 | Ga0207679_100488062 | 126 |
| 650 | 3300025945 | Ga0207679_10103742 | Ga0207679_101037422 | 126 |
| 651 | 3300025945 | Ga0207679_10154960 | Ga0207679_101549602 | 126 |
| 652 | 3300025945 | Ga0207679_10185449 | Ga0207679_101854492 | 126 |
| 653 | 3300025949 | Ga0207667_10559100 | Ga0207667_105591001 | 126 |
| 654 | 3300025949 | Ga0207667_11821802 | Ga0207667_118218022 | 126 |
| 655 | 3300025960 | Ga0207651_10263577 | Ga0207651_102635773 | 126 |
| 656 | 3300025960 | Ga0207651_10266872 | Ga0207651_102668721 | 126 |
| 657 | 3300025960 | Ga0207651_10338122 | Ga0207651_103381222 | 126 |
| 658 | 3300025961 | Ga0207712_10032732 | Ga0207712_100327324 | 126 |
| 659 | 3300025961 | Ga0207712_10037324 | Ga0207712_100373243 | 126 |
| 660 | 3300025961 | Ga0207712_10088490 | Ga0207712_100884902 | 126 |
| 661 | 3300025961 | Ga0207712_10516187 | Ga0207712_105161872 | 126 |
| 662 | 3300025961 | Ga0207712_11889811 | Ga0207712_118898111 | 126 |
| 663 | 3300025961 | Ga0207712_11961828 | Ga0207712_119618282 | 126 |
| 664 | 3300025972 | Ga0207668_10302377 | Ga0207668_103023773 | 126 |
| 665 | 3300025972 | Ga0207668_10363536 | Ga0207668_103635361 | 126 |
| 666 | 3300025972 | Ga0207668_10413093 | Ga0207668_104130932 | 126 |
| 667 | 3300025986 | Ga0207658_10414449 | Ga0207658_104144492 | 126 |
| 668 | 3300026023 | Ga0207677_10272599 | Ga0207677_102725992 | 126 |
| 669 | 3300026035 | Ga0207703_10059681 | Ga0207703_100596813 | 126 |
| 670 | 3300026035 | Ga0207703_10114999 | Ga0207703_101149992 | 126 |
| 671 | 3300026041 | Ga0207639_10023770 | Ga0207639_100237705 | 126 |
| 672 | 3300026041 | Ga0207639_10470421 | Ga0207639_104704212 | 126 |
| 673 | 3300026067 | Ga0207678_10007086 | Ga0207678_100070863 | 126 |
| 674 | 3300026067 | Ga0207678_10043858 | Ga0207678_100438582 | 126 |
| 675 | 3300026067 | Ga0207678_10126560 | Ga0207678_101265602 | 126 |
| 676 | 3300026067 | Ga0207678_10735579 | Ga0207678_107355792 | 126 |
| 677 | 3300026067 | Ga0207678_11555841 | Ga0207678_115558412 | 126 |
| 678 | 3300026075 | Ga0207708_10001783 | Ga0207708_100017833 | 126 |
| 679 | 3300026075 | Ga0207708_10011411 | Ga0207708_100114116 | 126 |
| 680 | 3300026075 | Ga0207708_10019504 | Ga0207708_100195044 | 126 |
| 681 | 3300026075 | Ga0207708_11030232 | Ga0207708_110302322 | 126 |
| 682 | 3300026078 | Ga0207702_10062068 | Ga0207702_100620684 | 126 |
| 683 | 3300026078 | Ga0207702_11848342 | Ga0207702_118483422 | 126 |
| 684 | 3300026088 | Ga0207641_10441195 | Ga0207641_104411952 | 126 |
| 685 | 3300026088 | Ga0207641_10446731 | Ga0207641_104467312 | 126 |
| 686 | 3300026089 | Ga0207648_10002707 | Ga0207648_100027074 | 126 |
| 687 | 3300026089 | Ga0207648_10012528 | Ga0207648_100125289 | 126 |
| 688 | 3300026089 | Ga0207648_10024149 | Ga0207648_100241492 | 126 |
| 689 | 3300026089 | Ga0207648_10529525 | Ga0207648_105295252 | 126 |
| 690 | 3300026089 | Ga0207648_10835564 | Ga0207648_108355642 | 126 |
| 691 | 3300026095 | Ga0207676_10001154 | Ga0207676_100011542 | 126 |
| 692 | 3300026095 | Ga0207676_10267394 | Ga0207676_102673942 | 126 |
| 693 | 3300026095 | Ga0207676_10367621 | Ga0207676_103676212 | 126 |
| 694 | 3300026095 | Ga0207676_10556431 | Ga0207676_105564312 | 126 |
| 695 | 3300026116 | Ga0207674_10000474 | Ga0207674_100004742 | 126 |
| 696 | 3300026116 | Ga0207674_10002131 | Ga0207674_1000213122 | 126 |
| 697 | 3300026116 | Ga0207674_10012869 | Ga0207674_1001286911 | 126 |
| 698 | 3300026116 | Ga0207674_10037497 | Ga0207674_100374972 | 126 |
| 699 | 3300026118 | Ga0207675_100036836 | Ga0207675_1000368362 | 126 |
| 700 | 3300026118 | Ga0207675_100094356 | Ga0207675_1000943562 | 126 |
| 701 | 3300026118 | Ga0207675_100711041 | Ga0207675_1007110412 | 126 |
| 702 | 3300026121 | Ga0207683_10000699 | Ga0207683_1000069933 | 126 |
| 703 | 3300026121 | Ga0207683_10021066 | Ga0207683_100210662 | 126 |
| 704 | 3300026142 | Ga0207698_10112080 | Ga0207698_101120802 | 126 |
| 705 | 3300026142 | Ga0207698_11209321 | Ga0207698_112093211 | 126 |
| 706 | 3300027907 | Ga0207428_10000597 | Ga0207428_1000059729 | 126 |
| 707 | 3300027907 | Ga0207428_10000612 | Ga0207428_1000061220 | 126 |
| 708 | 3300027907 | Ga0207428_10066471 | Ga0207428_100664713 | 126 |
| 709 | 3300027907 | Ga0207428_10089011 | Ga0207428_100890113 | 126 |
| 710 | 3300028379 | Ga0268266_11646311 | Ga0268266_116463112 | 126 |
| 711 | 3300028380 | Ga0268265_10152651 | Ga0268265_101526512 | 126 |
| 712 | 3300028380 | Ga0268265_11237521 | Ga0268265_112375212 | 126 |
| 713 | 3300028381 | Ga0268264_10068874 | Ga0268264_100688742 | 126 |
| 714 | 3300031731 | Ga0307405_10089568 | Ga0307405_100895682 | 126 |
| 715 | 3300031903 | Ga0307407_10241833 | Ga0307407_102418332 | 126 |
| 716 | 3300031911 | Ga0307412_10185058 | Ga0307412_101850582 | 126 |
| 717 | 3300032002 | Ga0307416_100028459 | Ga0307416_1000284594 | 126 |
| 718 | 3300034817 | Ga0373948_0161398 | Ga0373948_0161398_172_552 | 126 |
| 719 | 3300034957 | Ga0373938_0111988 | Ga0373938_0111988_100_480 | 126 |
| 720 | 3300035084 | Ga0373928_0130745 | Ga0373928_0130745_232_612 | 126 |
| 721 | 3300035091 | Ga0373951_0035340 | Ga0373951_0035340_239_619 | 126 |
| 722 | 3300035091 | Ga0373951_0288988 | Ga0373951_0288988_111_491 | 126 |
| 723 | 3300035092 | Ga0373952_0087683 | Ga0373952_0087683_136_516 | 126 |
| 724 | 3300035112 | Ga0373932_0058294 | Ga0373932_0058294_10_390 | 126 |
| 725 | 3300035114 | Ga0373939_0162653 | Ga0373939_0162653_368_748 | 126 |
| 726 | 3300035115 | Ga0373941_0067724 | Ga0373941_0067724_476_856 | 126 |
| 727 | 3300035121 | Ga0373960_0037178 | Ga0373960_0037178_541_921 | 126 |
| 728 | 3300035207 | Ga0373942_0269420 | Ga0373942_0269420_87_467 | 126 |
| 729 | 3300035241 | Ga0373961_0133670 | Ga0373961_0133670_376_756 | 126 |
| 730 | 3300035242 | Ga0373962_0038836 | Ga0373962_0038836_340_720 | 126 |
| 731 | 3300035725 | Ga0373947_0787417 | Ga0373947_0787417_166_546 | 126 |
| 732 | 3300037312 | Ga0395899_0003576 | Ga0395899_0003576_3276_3659 | 126 |
| 733 | 3300037312 | Ga0395899_0005616 | Ga0395899_0005616_1230_1613 | 126 |
| 734 | 3300037312 | Ga0395899_0020638 | Ga0395899_0020638_2381_2761 | 126 |
| 735 | 3300037312 | Ga0395899_0024678 | Ga0395899_0024678_3815_4195 | 126 |
| 736 | 3300037312 | Ga0395899_0225812 | Ga0395899_0225812_138_518 | 126 |
| 737 | 3300037312 | Ga0395899_0334085 | Ga0395899_0334085_273_653 | 126 |
| 738 | 3300037418 | Ga0395900_0002509 | Ga0395900_0002509_8959_9342 | 126 |
| 739 | 3300037418 | Ga0395900_0003754 | Ga0395900_0003754_14564_14944 | 126 |
| 740 | 3300037418 | Ga0395900_0003775 | Ga0395900_0003775_2676_3056 | 126 |
| 741 | 3300037418 | Ga0395900_0006012 | Ga0395900_0006012_6528_6908 | 126 |
| 742 | 3300037418 | Ga0395900_0011358 | Ga0395900_0011358_3466_3846 | 126 |
| 743 | 3300037418 | Ga0395900_0020004 | Ga0395900_0020004_3115_3498 | 126 |
| 744 | 3300037418 | Ga0395900_0031122 | Ga0395900_0031122_1062_1442 | 126 |
| 745 | 3300037418 | Ga0395900_0044769 | Ga0395900_0044769_3473_3853 | 126 |
| 746 | 3300037418 | Ga0395900_0209549 | Ga0395900_0209549_766_1146 | 126 |
| 747 | 3300037418 | Ga0395900_0235300 | Ga0395900_0235300_492_872 | 126 |
| 748 | 3300037418 | Ga0395900_0489151 | Ga0395900_0489151_10_390 | 126 |
| 749 | 3300037418 | Ga0395900_0585106 | Ga0395900_0585106_565_945 | 126 |
| 750 | 3300037418 | Ga0395900_1262029 | Ga0395900_1262029_109_489 | 126 |
| 751 | 3300037418 | Ga0395900_1367117 | Ga0395900_1367117_81_461 | 126 |
| 752 | 3300037466 | Ga0395898_0008185 | Ga0395898_0008185_5737_6117 | 126 |
| 753 | 3300037466 | Ga0395898_0010957 | Ga0395898_0010957_6012_6395 | 126 |
| 754 | 3300037466 | Ga0395898_0027496 | Ga0395898_0027496_3640_4020 | 126 |
| 755 | 3300037466 | Ga0395898_0031515 | Ga0395898_0031515_4865_5248 | 126 |
| 756 | 3300037466 | Ga0395898_0091366 | Ga0395898_0091366_1808_2188 | 126 |
| 757 | 3300037466 | Ga0395898_0104246 | Ga0395898_0104246_2177_2557 | 126 |
| 758 | 3300037466 | Ga0395898_0192447 | Ga0395898_0192447_164_544 | 126 |
| 759 | 3300037466 | Ga0395898_0364212 | Ga0395898_0364212_407_787 | 126 |
| 760 | 3300037466 | Ga0395898_0383795 | Ga0395898_0383795_909_1289 | 126 |
| 761 | 3300037466 | Ga0395898_0575775 | Ga0395898_0575775_580_960 | 126 |
| 762 | 3300037471 | Ga0395905_0014012 | Ga0395905_0014012_3521_3904 | 126 |
| 763 | 3300037471 | Ga0395905_0017698 | Ga0395905_0017698_4648_5028 | 126 |
| 764 | 3300037471 | Ga0395905_0020103 | Ga0395905_0020103_4725_5108 | 126 |
| 765 | 3300037471 | Ga0395905_0021749 | Ga0395905_0021749_2964_3344 | 126 |
| 766 | 3300037471 | Ga0395905_0024628 | Ga0395905_0024628_5053_5433 | 126 |
| 767 | 3300037471 | Ga0395905_0073888 | Ga0395905_0073888_1436_1816 | 126 |
| 768 | 3300037471 | Ga0395905_0520628 | Ga0395905_0520628_312_692 | 126 |
| 769 | 3300037471 | Ga0395905_1167395 | Ga0395905_1167395_160_540 | 126 |
| 770 | 3300038443 | Ga0395901_0004795 | Ga0395901_0004795_4873_5253 | 126 |
| 771 | 3300038443 | Ga0395901_0014998 | Ga0395901_0014998_3973_4356 | 126 |
| 772 | 3300038443 | Ga0395901_0017966 | Ga0395901_0017966_113_493 | 126 |
| 773 | 3300038443 | Ga0395901_0019865 | Ga0395901_0019865_3247_3627 | 126 |
| 774 | 3300038443 | Ga0395901_0027705 | Ga0395901_0027705_2207_2587 | 126 |
| 775 | 3300038443 | Ga0395901_0031459 | Ga0395901_0031459_2878_3258 | 126 |
| 776 | 3300038443 | Ga0395901_0031768 | Ga0395901_0031768_4678_5058 | 126 |
| 777 | 3300038443 | Ga0395901_0036290 | Ga0395901_0036290_952_1332 | 126 |
| 778 | 3300038443 | Ga0395901_0087819 | Ga0395901_0087819_2130_2510 | 126 |
| 779 | 3300038443 | Ga0395901_0127656 | Ga0395901_0127656_2213_2593 | 126 |
| 780 | 3300038443 | Ga0395901_0246330 | Ga0395901_0246330_140_520 | 126 |
| 781 | 3300038443 | Ga0395901_0262734 | Ga0395901_0262734_1326_1706 | 126 |
| 782 | 3300038443 | Ga0395901_0386844 | Ga0395901_0386844_315_695 | 126 |
| 783 | 3300038443 | Ga0395901_0582458 | Ga0395901_0582458_609_989 | 126 |
| 784 | 3300038443 | Ga0395901_1440121 | Ga0395901_1440121_40_420 | 126 |
| 785 | 3300041512 | Ga0451853_1930551 | Ga0451853_1930551_47_427 | 126 |
| 786 | 3300042003 | Ga0439443_016560 | Ga0439443_016560_280_660 | 126 |
| 787 | 3300042005 | Ga0439448_0021437 | Ga0439448_0021437_592_975 | 126 |
| 788 | 3300042008 | Ga0439450_071670 | Ga0439450_071670_101_481 | 126 |
| 789 | 3300042122 | Ga0450920_009120 | Ga0450920_009120_854_1234 | 126 |
| 790 | 3300042145 | Ga0450906_015742 | Ga0450906_015742_849_1229 | 126 |
| 791 | 3300042146 | Ga0450907_013730 | Ga0450907_013730_145_525 | 126 |
| 792 | 3300042461 | Ga0439460_0017901 | Ga0439460_0017901_1465_1845 | 126 |
| 793 | 3300042993 | Ga0439440_0024431 | Ga0439440_0024431_472_852 | 126 |
| 794 | 3300044706 | Ga0466964_0133093 | Ga0466964_0133093_682_1062 | 126 |
| 795 | 3300044842 | Ga0466957_0934443 | Ga0466957_0934443_45_485 | 126 |
| 796 | 3300044901 | Ga0466960_0359287 | Ga0466960_0359287_104_544 | 126 |
| 797 | 3300045051 | Ga0451576_1375856 | Ga0451576_1375856_80_460 | 126 |
| 798 | 3300045836 | Ga0466958_0034865 | Ga0466958_0034865_2365_2805 | 126 |
| 799 | 3300045976 | Ga0466967_0014924 | Ga0466967_0014924_5001_5441 | 126 |
| 800 | 3300045976 | Ga0466967_0201087 | Ga0466967_0201087_123_503 | 126 |
| 801 | 3300045976 | Ga0466967_0661874 | Ga0466967_0661874_41_421 | 126 |
| 802 | 3300046452 | Ga0495617_173736 | Ga0495617_173736_45_428 | 126 |
| 803 | 3300046454 | Ga0495592_0127989 | Ga0495592_0127989_466_846 | 126 |
| 804 | 3300046455 | Ga0495603_0014627 | Ga0495603_0014627_2908_3288 | 126 |
| 805 | 3300046455 | Ga0495603_0039194 | Ga0495603_0039194_996_1376 | 126 |
| 806 | 3300046455 | Ga0495603_0574502 | Ga0495603_0574502_73_453 | 126 |
| 807 | 3300046461 | Ga0495641_0211658 | Ga0495641_0211658_33_413 | 126 |
| 808 | 3300046472 | Ga0495580_0285974 | Ga0495580_0285974_128_508 | 126 |
| 809 | 3300046472 | Ga0495580_0988039 | Ga0495580_0988039_49_429 | 126 |
| 810 | 3300046473 | Ga0495582_0107285 | Ga0495582_0107285_708_1088 | 126 |
| 811 | 3300046474 | Ga0495605_0297518 | Ga0495605_0297518_270_653 | 126 |
| 812 | 3300046475 | Ga0495639_0649754 | Ga0495639_0649754_93_473 | 126 |
| 813 | 3300046476 | Ga0495662_0236512 | Ga0495662_0236512_370_750 | 126 |
| 814 | 3300046491 | Ga0495584_0048320 | Ga0495584_0048320_855_1235 | 126 |
| 815 | 3300046491 | Ga0495584_0330213 | Ga0495584_0330213_114_494 | 126 |
| 816 | 3300046491 | Ga0495584_0335132 | Ga0495584_0335132_63_446 | 126 |
| 817 | 3300046491 | Ga0495584_0434421 | Ga0495584_0434421_37_417 | 126 |
| 818 | 3300046492 | Ga0495585_0074859 | Ga0495585_0074859_1419_1802 | 126 |
| 819 | 3300046492 | Ga0495585_0146263 | Ga0495585_0146263_775_1155 | 126 |
| 820 | 3300046492 | Ga0495585_0245988 | Ga0495585_0245988_166_546 | 126 |
| 821 | 3300046492 | Ga0495585_0420552 | Ga0495585_0420552_18_398 | 126 |
| 822 | 3300046499 | Ga0495594_0511504 | Ga0495594_0511504_74_454 | 126 |
| 823 | 3300046500 | Ga0495596_0083610 | Ga0495596_0083610_783_1163 | 126 |
| 824 | 3300046500 | Ga0495596_0217884 | Ga0495596_0217884_307_690 | 126 |
| 825 | 3300046501 | Ga0495607_0224132 | Ga0495607_0224132_429_818 | 126 |
| 826 | 3300046506 | Ga0495583_0195840 | Ga0495583_0195840_328_711 | 126 |
| 827 | 3300046515 | Ga0495620_0047100 | Ga0495620_0047100_1288_1671 | 126 |
| 828 | 3300046516 | Ga0495628_0657180 | Ga0495628_0657180_34_420 | 126 |
| 829 | 3300046517 | Ga0495630_1085894 | Ga0495630_1085894_180_560 | 126 |
| 830 | 3300046518 | Ga0495631_0156102 | Ga0495631_0156102_187_570 | 126 |
| 831 | 3300046520 | Ga0495637_0072574 | Ga0495637_0072574_554_934 | 126 |
| 832 | 3300046523 | Ga0495644_0102583 | Ga0495644_0102583_673_1056 | 126 |
| 833 | 3300046525 | Ga0495663_0041467 | Ga0495663_0041467_863_1246 | 126 |
| 834 | 3300046525 | Ga0495663_0070572 | Ga0495663_0070572_633_1013 | 126 |
| 835 | 3300046528 | Ga0495642_0023025 | Ga0495642_0023025_1746_2126 | 126 |
| 836 | 3300046529 | Ga0495652_0035321 | Ga0495652_0035321_2396_2782 | 126 |
| 837 | 3300046529 | Ga0495652_0476426 | Ga0495652_0476426_224_604 | 126 |
| 838 | 3300046533 | Ga0495640_0045573 | Ga0495640_0045573_2406_2792 | 126 |
| 839 | 3300046536 | Ga0495587_0100727 | Ga0495587_0100727_619_1005 | 126 |
| 840 | 3300046538 | Ga0495609_0054158 | Ga0495609_0054158_1349_1732 | 126 |
| 841 | 3300046539 | Ga0495621_0060833 | Ga0495621_0060833_491_871 | 126 |
| 842 | 3300046558 | Ga0495633_0110125 | Ga0495633_0110125_140_520 | 126 |
| 843 | 3300046558 | Ga0495633_0426512 | Ga0495633_0426512_73_456 | 126 |
| 844 | 3300046615 | Ga0495656_0330394 | Ga0495656_0330394_273_680 | 126 |
| 845 | 3300046615 | Ga0495656_0377606 | Ga0495656_0377606_205_585 | 126 |
| 846 | 3300046615 | Ga0495656_0450022 | Ga0495656_0450022_257_649 | 126 |
| 847 | 3300046615 | Ga0495656_0815039 | Ga0495656_0815039_98_478 | 126 |
| 848 | 3300046616 | Ga0495668_0104482 | Ga0495668_0104482_822_1205 | 126 |
| 849 | 3300046648 | Ga0495611_0034649 | Ga0495611_0034649_1099_1482 | 126 |
| 850 | 3300046648 | Ga0495611_0089792 | Ga0495611_0089792_549_929 | 126 |
| 851 | 3300046664 | Ga0495659_0145953 | Ga0495659_0145953_468_848 | 126 |
| 852 | 3300046664 | Ga0495659_0271383 | Ga0495659_0271383_86_466 | 126 |
| 853 | 3300046664 | Ga0495659_0538171 | Ga0495659_0538171_87_467 | 126 |
| 854 | 3300046665 | Ga0495661_0371786 | Ga0495661_0371786_301_681 | 126 |
| 855 | 3300046674 | Ga0495588_0283207 | Ga0495588_0283207_139_519 | 126 |
| 856 | 3300046674 | Ga0495588_0290126 | Ga0495588_0290126_37_417 | 126 |
| 857 | 3300046680 | Ga0495646_0234523 | Ga0495646_0234523_93_479 | 126 |
| 858 | 3300046681 | Ga0495647_0021653 | Ga0495647_0021653_1724_2104 | 126 |
| 859 | 3300046689 | Ga0495613_0173792 | Ga0495613_0173792_1070_1450 | 126 |
| 860 | 3300046690 | Ga0495624_0183391 | Ga0495624_0183391_11_391 | 126 |
| 861 | 3300046691 | Ga0495670_0640964 | Ga0495670_0640964_158_538 | 126 |
| 862 | 3300046692 | Ga0495671_0282953 | Ga0495671_0282953_219_599 | 126 |
| 863 | 3300046794 | Ga0495589_0212575 | Ga0495589_0212575_177_560 | 126 |
| 864 | 3300046794 | Ga0495589_0217617 | Ga0495589_0217617_47_427 | 126 |
| 865 | 3300046810 | Ga0495660_0308475 | Ga0495660_0308475_228_611 | 126 |
| 866 | 3300047315 | Ga0495581_0001437 | Ga0495581_0001437_719_1099 | 126 |
| 867 | 3300047318 | Ga0495636_0247876 | Ga0495636_0247876_232_615 | 126 |
| 868 | 3300047319 | Ga0495674_0014529 | Ga0495674_0014529_321_707 | 126 |
| 869 | 3300047321 | Ga0495676_0016250 | Ga0495676_0016250_6156_6536 | 126 |
| 870 | 3300047321 | Ga0495676_0099145 | Ga0495676_0099145_1035_1415 | 126 |
| 871 | 3300047323 | Ga0495683_0081310 | Ga0495683_0081310_1043_1426 | 126 |
| 872 | 3300047444 | Ga0495675_0617487 | Ga0495675_0617487_54_434 | 126 |
| 873 | 3300048091 | Ga0495626_0233957 | Ga0495626_0233957_62_442 | 126 |
| 874 | 3300048903 | Ga0496100_0025820 | Ga0496100_0025820_378_758 | 126 |
| 875 | 3300048903 | Ga0496100_0124230 | Ga0496100_0124230_994_1374 | 126 |
| 876 | 3300048903 | Ga0496100_0153973 | Ga0496100_0153973_848_1228 | 126 |
| 877 | 3300048903 | Ga0496100_0215911 | Ga0496100_0215911_556_936 | 126 |
| 878 | 3300048903 | Ga0496100_0245633 | Ga0496100_0245633_190_570 | 126 |
| 879 | 3300048904 | Ga0496101_0006620 | Ga0496101_0006620_2628_3008 | 126 |
| 880 | 3300048904 | Ga0496101_0039764 | Ga0496101_0039764_524_904 | 126 |
| 881 | 3300048904 | Ga0496101_0056633 | Ga0496101_0056633_2410_2790 | 126 |
| 882 | 3300048904 | Ga0496101_0116970 | Ga0496101_0116970_523_903 | 126 |
| 883 | 3300048904 | Ga0496101_0246479 | Ga0496101_0246479_99_485 | 126 |
| 884 | 3300048904 | Ga0496101_0486173 | Ga0496101_0486173_356_736 | 126 |
| 885 | 3300048904 | Ga0496101_0605690 | Ga0496101_0605690_34_417 | 126 |
| 886 | 3300048905 | Ga0496102_0011268 | Ga0496102_0011268_5066_5446 | 126 |
| 887 | 3300048905 | Ga0496102_0189247 | Ga0496102_0189247_1159_1539 | 126 |
| 888 | 3300048905 | Ga0496102_0471145 | Ga0496102_0471145_197_577 | 126 |
| 889 | 3300048906 | Ga0496103_0010249 | Ga0496103_0010249_2745_3125 | 126 |
| 890 | 3300048906 | Ga0496103_0065969 | Ga0496103_0065969_959_1339 | 126 |
| 891 | 3300048906 | Ga0496103_0086272 | Ga0496103_0086272_1026_1406 | 126 |
| 892 | 3300048906 | Ga0496103_0304712 | Ga0496103_0304712_436_822 | 126 |
| 893 | 3300048906 | Ga0496103_0854503 | Ga0496103_0854503_157_537 | 126 |
| 894 | 3300048907 | Ga0496104_0023003 | Ga0496104_0023003_2918_3298 | 126 |
| 895 | 3300048907 | Ga0496104_0049875 | Ga0496104_0049875_144_524 | 126 |
| 896 | 3300048907 | Ga0496104_0085119 | Ga0496104_0085119_1260_1640 | 126 |
| 897 | 3300048907 | Ga0496104_0156791 | Ga0496104_0156791_163_543 | 126 |
| 898 | 3300048907 | Ga0496104_0432369 | Ga0496104_0432369_276_656 | 126 |
| 899 | 3300048908 | Ga0496105_0055464 | Ga0496105_0055464_579_959 | 126 |
| 900 | 3300048908 | Ga0496105_0066335 | Ga0496105_0066335_1606_1986 | 126 |
| 901 | 3300048908 | Ga0496105_0140198 | Ga0496105_0140198_594_974 | 126 |
| 902 | 3300048908 | Ga0496105_0477793 | Ga0496105_0477793_319_699 | 126 |
| 903 | 3300048909 | Ga0496106_0047257 | Ga0496106_0047257_343_723 | 126 |
| 904 | 3300048909 | Ga0496106_0125317 | Ga0496106_0125317_139_519 | 126 |
| 905 | 3300048909 | Ga0496106_0213534 | Ga0496106_0213534_225_605 | 126 |
| 906 | 3300048909 | Ga0496106_0367567 | Ga0496106_0367567_247_627 | 126 |
| 907 | 3300048909 | Ga0496106_0803852 | Ga0496106_0803852_308_688 | 126 |
| 908 | 3300048910 | Ga0496107_0017318 | Ga0496107_0017318_3891_4271 | 126 |
| 909 | 3300048910 | Ga0496107_0025181 | Ga0496107_0025181_2567_2947 | 126 |
| 910 | 3300048910 | Ga0496107_0038996 | Ga0496107_0038996_89_469 | 126 |
| 911 | 3300048911 | Ga0496108_0012078 | Ga0496108_0012078_513_893 | 126 |
| 912 | 3300048911 | Ga0496108_0057536 | Ga0496108_0057536_1329_1748 | 126 |
| 913 | 3300048911 | Ga0496108_0061648 | Ga0496108_0061648_281_661 | 126 |
| 914 | 3300048911 | Ga0496108_0072694 | Ga0496108_0072694_2399_2782 | 126 |
| 915 | 3300048911 | Ga0496108_0113713 | Ga0496108_0113713_1912_2292 | 126 |
| 916 | 3300048911 | Ga0496108_0155986 | Ga0496108_0155986_987_1367 | 126 |
| 917 | 3300048912 | Ga0496109_0002264 | Ga0496109_0002264_655_1035 | 126 |
| 918 | 3300048912 | Ga0496109_0021245 | Ga0496109_0021245_422_802 | 126 |
| 919 | 3300048912 | Ga0496109_0032706 | Ga0496109_0032706_795_1178 | 126 |
| 920 | 3300048912 | Ga0496109_0043225 | Ga0496109_0043225_1173_1556 | 126 |
| 921 | 3300048912 | Ga0496109_0177711 | Ga0496109_0177711_869_1249 | 126 |
| 922 | 3300048912 | Ga0496109_0277415 | Ga0496109_0277415_601_981 | 126 |
| 923 | 3300048913 | Ga0496110_0015243 | Ga0496110_0015243_2459_2842 | 126 |
| 924 | 3300048913 | Ga0496110_0018263 | Ga0496110_0018263_2737_3117 | 126 |
| 925 | 3300048913 | Ga0496110_0036616 | Ga0496110_0036616_1190_1570 | 126 |
| 926 | 3300048913 | Ga0496110_0225600 | Ga0496110_0225600_319_699 | 126 |
| 927 | 3300048914 | Ga0496111_0001469 | Ga0496111_0001469_9117_9497 | 126 |
| 928 | 3300048914 | Ga0496111_0022743 | Ga0496111_0022743_485_868 | 126 |
| 929 | 3300048914 | Ga0496111_0203192 | Ga0496111_0203192_104_484 | 126 |
| 930 | 3300048914 | Ga0496111_0289112 | Ga0496111_0289112_104_484 | 126 |
| 931 | 3300048914 | Ga0496111_0590905 | Ga0496111_0590905_235_615 | 126 |
| 932 | 3300048915 | Ga0496112_0037870 | Ga0496112_0037870_580_960 | 126 |
| 933 | 3300048915 | Ga0496112_0048819 | Ga0496112_0048819_3116_3496 | 126 |
| 934 | 3300048916 | Ga0496113_0016652 | Ga0496113_0016652_503_883 | 126 |
| 935 | 3300048916 | Ga0496113_0102528 | Ga0496113_0102528_927_1307 | 126 |
| 936 | 3300048916 | Ga0496113_0409871 | Ga0496113_0409871_567_947 | 126 |
| 937 | 3300048916 | Ga0496113_0775558 | Ga0496113_0775558_139_519 | 126 |
| 938 | 3300048917 | Ga0496114_0003284 | Ga0496114_0003284_9397_9777 | 126 |
| 939 | 3300048917 | Ga0496114_0033628 | Ga0496114_0033628_2917_3297 | 126 |
| 940 | 3300048917 | Ga0496114_0156454 | Ga0496114_0156454_1006_1386 | 126 |
| 941 | 3300048917 | Ga0496114_0176375 | Ga0496114_0176375_492_872 | 126 |
| 942 | 3300048917 | Ga0496114_0243907 | Ga0496114_0243907_667_1053 | 126 |
| 943 | 3300048917 | Ga0496114_0319927 | Ga0496114_0319927_251_634 | 126 |
| 944 | 3300048917 | Ga0496114_0361246 | Ga0496114_0361246_23_403 | 126 |
| 945 | 3300048918 | Ga0496115_0007909 | Ga0496115_0007909_1944_2324 | 126 |
| 946 | 3300048918 | Ga0496115_0025154 | Ga0496115_0025154_1746_2126 | 126 |
| 947 | 3300048918 | Ga0496115_0384849 | Ga0496115_0384849_703_1083 | 126 |
| 948 | 3300049568 | Ga0501031_0003942 | Ga0501031_0003942_8868_9248 | 126 |
| 949 | 3300049568 | Ga0501031_0010352 | Ga0501031_0010352_5396_5776 | 126 |
| 950 | 3300049568 | Ga0501031_0104696 | Ga0501031_0104696_1409_1789 | 126 |
| 951 | 3300049569 | Ga0501032_0009499 | Ga0501032_0009499_1669_2049 | 126 |
| 952 | 3300049569 | Ga0501032_0067535 | Ga0501032_0067535_1993_2373 | 126 |
| 953 | 3300049570 | Ga0501033_0002792 | Ga0501033_0002792_3211_3591 | 126 |
| 954 | 3300049570 | Ga0501033_0019169 | Ga0501033_0019169_737_1117 | 126 |
| 955 | 3300049570 | Ga0501033_0022135 | Ga0501033_0022135_1024_1404 | 126 |
| 956 | 3300049571 | Ga0501034_0308270 | Ga0501034_0308270_553_933 | 126 |
| 957 | 3300049571 | Ga0501034_0331298 | Ga0501034_0331298_1028_1408 | 126 |
| 958 | 3300049572 | Ga0501036_0002911 | Ga0501036_0002911_9521_9901 | 126 |
| 959 | 3300049572 | Ga0501036_0004301 | Ga0501036_0004301_3143_3523 | 126 |
| 960 | 3300049572 | Ga0501036_0025742 | Ga0501036_0025742_1733_2113 | 126 |
| 961 | 3300049573 | Ga0501037_0015949 | Ga0501037_0015949_298_678 | 126 |
| 962 | 3300049573 | Ga0501037_0017091 | Ga0501037_0017091_4797_5177 | 126 |
| 963 | 3300049573 | Ga0501037_0068516 | Ga0501037_0068516_877_1257 | 126 |
| 964 | 3300049574 | Ga0501038_0016158 | Ga0501038_0016158_208_588 | 126 |
| 965 | 3300049574 | Ga0501038_0031091 | Ga0501038_0031091_4206_4586 | 126 |
| 966 | 3300049575 | Ga0501039_0005424 | Ga0501039_0005424_2035_2415 | 126 |
| 967 | 3300049575 | Ga0501039_0037989 | Ga0501039_0037989_2064_2444 | 126 |
| 968 | 3300049575 | Ga0501039_0621323 | Ga0501039_0621323_334_714 | 126 |
| 969 | 3300049576 | Ga0501040_0008288 | Ga0501040_0008288_583_963 | 126 |
| 970 | 3300049576 | Ga0501040_0008921 | Ga0501040_0008921_5476_5856 | 126 |
| 971 | 3300049576 | Ga0501040_0054609 | Ga0501040_0054609_625_1005 | 126 |
| 972 | 3300049576 | Ga0501040_0437399 | Ga0501040_0437399_374_754 | 126 |
| 973 | 3300049576 | Ga0501040_1041498 | Ga0501040_1041498_187_576 | 126 |
| 974 | 3300049577 | Ga0501041_0006011 | Ga0501041_0006011_5975_6355 | 126 |
| 975 | 3300049577 | Ga0501041_0028061 | Ga0501041_0028061_1856_2236 | 126 |
| 976 | 3300049577 | Ga0501041_0030363 | Ga0501041_0030363_1705_2085 | 126 |
| 977 | 3300049577 | Ga0501041_0075454 | Ga0501041_0075454_1019_1399 | 126 |
| 978 | 3300049577 | Ga0501041_0651929 | Ga0501041_0651929_89_478 | 126 |
| 979 | 3300049578 | Ga0501042_0003550 | Ga0501042_0003550_3870_4250 | 126 |
| 980 | 3300049578 | Ga0501042_0037872 | Ga0501042_0037872_2220_2600 | 126 |
| 981 | 3300049578 | Ga0501042_0886850 | Ga0501042_0886850_107_487 | 126 |
| 982 | 3300049579 | Ga0501043_0027956 | Ga0501043_0027956_4013_4393 | 126 |
| 983 | 3300049579 | Ga0501043_0034990 | Ga0501043_0034990_1733_2113 | 126 |
| 984 | 3300049579 | Ga0501043_0074284 | Ga0501043_0074284_876_1256 | 126 |
| 985 | 3300049580 | Ga0501046_0005418 | Ga0501046_0005418_9625_10005 | 126 |
| 986 | 3300049580 | Ga0501046_0006355 | Ga0501046_0006355_8598_8978 | 126 |
| 987 | 3300049580 | Ga0501046_0016160 | Ga0501046_0016160_2333_2713 | 126 |
| 988 | 3300049581 | Ga0501047_0084848 | Ga0501047_0084848_292_672 | 126 |
| 989 | 3300049581 | Ga0501047_0489418 | Ga0501047_0489418_339_719 | 126 |
| 990 | 3300049582 | Ga0501048_0010744 | Ga0501048_0010744_5798_6178 | 126 |
| 991 | 3300049582 | Ga0501048_0044270 | Ga0501048_0044270_625_1005 | 126 |
| 992 | 3300049583 | Ga0501067_0025932 | Ga0501067_0025932_952_1332 | 126 |
| 993 | 3300049583 | Ga0501067_0082087 | Ga0501067_0082087_524_904 | 126 |
| 994 | 3300049584 | Ga0501068_0004263 | Ga0501068_0004263_4858_5238 | 126 |
| 995 | 3300049584 | Ga0501068_0005313 | Ga0501068_0005313_5874_6254 | 126 |
| 996 | 3300049584 | Ga0501068_0012067 | Ga0501068_0012067_1249_1629 | 126 |
| 997 | 3300049584 | Ga0501068_0312893 | Ga0501068_0312893_36_416 | 126 |
| 998 | 3300049585 | Ga0501069_0003377 | Ga0501069_0003377_5633_6013 | 126 |
| 999 | 3300049585 | Ga0501069_0198357 | Ga0501069_0198357_460_840 | 126 |
| 1000 | 3300049585 | Ga0501069_0273745 | Ga0501069_0273745_204_584 | 126 |
| 1001 | 3300049585 | Ga0501069_0344213 | Ga0501069_0344213_484_864 | 126 |
| 1002 | 3300049586 | Ga0501070_0003251 | Ga0501070_0003251_3366_3746 | 126 |
| 1003 | 3300049586 | Ga0501070_0131948 | Ga0501070_0131948_1419_1799 | 126 |
| 1004 | 3300049587 | Ga0501071_0002637 | Ga0501071_0002637_9375_9755 | 126 |
| 1005 | 3300049587 | Ga0501071_0008478 | Ga0501071_0008478_5671_6051 | 126 |
| 1006 | 3300049587 | Ga0501071_0034242 | Ga0501071_0034242_1215_1595 | 126 |
| 1007 | 3300049588 | Ga0501072_0001947 | Ga0501072_0001947_263_643 | 126 |
| 1008 | 3300049588 | Ga0501072_0022807 | Ga0501072_0022807_339_719 | 126 |
| 1009 | 3300049588 | Ga0501072_0028314 | Ga0501072_0028314_747_1127 | 126 |
| 1010 | 3300049588 | Ga0501072_0127626 | Ga0501072_0127626_695_1075 | 126 |
| 1011 | 3300049589 | Ga0501073_0016904 | Ga0501073_0016904_1906_2286 | 126 |
| 1012 | 3300049589 | Ga0501073_0023276 | Ga0501073_0023276_3394_3774 | 126 |
| 1013 | 3300049590 | Ga0501074_0013222 | Ga0501074_0013222_3770_4150 | 126 |
| 1014 | 3300049590 | Ga0501074_0020299 | Ga0501074_0020299_2715_3095 | 126 |
| 1015 | 3300049590 | Ga0501074_1008096 | Ga0501074_1008096_159_539 | 126 |
| 1016 | 3300049591 | Ga0501075_0030898 | Ga0501075_0030898_3556_3936 | 126 |
| 1017 | 3300049591 | Ga0501075_0143708 | Ga0501075_0143708_171_551 | 126 |
| 1018 | 3300049591 | Ga0501075_0157933 | Ga0501075_0157933_560_940 | 126 |
| 1019 | 3300049591 | Ga0501075_0907903 | Ga0501075_0907903_202_591 | 126 |
| 1020 | 3300049592 | Ga0501076_0002533 | Ga0501076_0002533_8540_8920 | 126 |
| 1021 | 3300049592 | Ga0501076_0089336 | Ga0501076_0089336_335_715 | 126 |
| 1022 | 3300049592 | Ga0501076_0163553 | Ga0501076_0163553_831_1211 | 126 |
| 1023 | 3300049592 | Ga0501076_0589976 | Ga0501076_0589976_22_402 | 126 |
| 1024 | 3300049593 | Ga0501077_0002613 | Ga0501077_0002613_4401_4781 | 126 |
| 1025 | 3300049593 | Ga0501077_0030214 | Ga0501077_0030214_2861_3241 | 126 |
| 1026 | 3300049593 | Ga0501077_0298122 | Ga0501077_0298122_504_884 | 126 |
| 1027 | 3300049593 | Ga0501077_0539274 | Ga0501077_0539274_34_414 | 126 |
| 1028 | 3300049741 | Ga0501079_0003011 | Ga0501079_0003011_8058_8438 | 126 |
| 1029 | 3300049741 | Ga0501079_0004898 | Ga0501079_0004898_1758_2138 | 126 |
| 1030 | 3300049741 | Ga0501079_0661213 | Ga0501079_0661213_153_533 | 126 |
| 1031 | 3300049742 | Ga0501080_0006559 | Ga0501080_0006559_7931_8311 | 126 |
| 1032 | 3300049742 | Ga0501080_0084119 | Ga0501080_0084119_795_1175 | 126 |
| 1033 | 3300049742 | Ga0501080_0149099 | Ga0501080_0149099_824_1204 | 126 |
| 1034 | 3300049743 | Ga0501081_0003248 | Ga0501081_0003248_7937_8317 | 126 |
| 1035 | 3300049743 | Ga0501081_0008667 | Ga0501081_0008667_5061_5441 | 126 |
| 1036 | 3300049743 | Ga0501081_0009207 | Ga0501081_0009207_5799_6179 | 126 |
| 1037 | 3300049743 | Ga0501081_0516528 | Ga0501081_0516528_115_495 | 126 |
| 1038 | 3300049744 | Ga0501083_0006107 | Ga0501083_0006107_5610_5990 | 126 |
| 1039 | 3300049744 | Ga0501083_0017440 | Ga0501083_0017440_2880_3260 | 126 |
| 1040 | 3300049744 | Ga0501083_0059737 | Ga0501083_0059737_23_403 | 126 |
| 1041 | 3300049822 | Ga0501035_0033143 | Ga0501035_0033143_339_719 | 126 |
| 1042 | 3300049822 | Ga0501035_0044775 | Ga0501035_0044775_378_758 | 126 |
| 1043 | 3300049822 | Ga0501035_0098605 | Ga0501035_0098605_428_808 | 126 |
| 1044 | 3300049823 | Ga0501044_0042478 | Ga0501044_0042478_2147_2527 | 126 |
| 1045 | 3300049823 | Ga0501044_0157716 | Ga0501044_0157716_1308_1688 | 126 |
| 1046 | 3300049824 | Ga0501045_0004481 | Ga0501045_0004481_1751_2131 | 126 |
| 1047 | 3300049824 | Ga0501045_0012686 | Ga0501045_0012686_335_715 | 126 |
| 1048 | 3300049824 | Ga0501045_0041391 | Ga0501045_0041391_2348_2728 | 126 |
| 1049 | 3300049851 | Ga0501212_072943 | Ga0501212_072943_46_429 | 126 |
| 1050 | 3300050492 | nmdc:mga0yw44_19648_c1 | nmdc:mga0yw44_19648_c1_661_1041 | 126 |
| 1051 | 3300050507 | nmdc:mga05p37_134912_c1 | nmdc:mga05p37_134912_c1_1440_1820 | 126 |
| 1052 | 3300050507 | nmdc:mga05p37_223309_c1 | nmdc:mga05p37_223309_c1_617_997 | 126 |
| 1053 | 3300050507 | nmdc:mga05p37_260641_c1 | nmdc:mga05p37_260641_c1_249_629 | 126 |
| 1054 | 3300050507 | nmdc:mga05p37_37438_c1 | nmdc:mga05p37_37438_c1_225_605 | 126 |
| 1055 | 3300050507 | nmdc:mga05p37_4582_c1 | nmdc:mga05p37_4582_c1_490_870 | 126 |
| 1056 | 3300050507 | nmdc:mga05p37_70019_c1 | nmdc:mga05p37_70019_c1_3200_3580 | 126 |
| 1057 | 3300050507 | nmdc:mga05p37_97110_c1 | nmdc:mga05p37_97110_c1_2108_2488 | 126 |
| 1058 | 3300050508 | nmdc:mga09592_111660_c1 | nmdc:mga09592_111660_c1_1650_2030 | 126 |
| 1059 | 3300050508 | nmdc:mga09592_144158_c1 | nmdc:mga09592_144158_c1_993_1373 | 126 |
| 1060 | 3300050508 | nmdc:mga09592_48952_c1 | nmdc:mga09592_48952_c1_1400_1780 | 126 |
| 1061 | 3300050509 | nmdc:mga0qj67_375781_c1 | nmdc:mga0qj67_375781_c1_178_558 | 126 |
| 1062 | 3300050509 | nmdc:mga0qj67_4158_c1 | nmdc:mga0qj67_4158_c1_8338_8718 | 126 |
| 1063 | 3300050510 | nmdc:mga06r32_213841_c1 | nmdc:mga06r32_213841_c1_353_733 | 126 |
| 1064 | 3300050510 | nmdc:mga06r32_30480_c1 | nmdc:mga06r32_30480_c1_1430_1810 | 126 |
| 1065 | 3300050511 | nmdc:mga08y16_126060_c1 | nmdc:mga08y16_126060_c1_1121_1501 | 126 |
| 1066 | 3300050511 | nmdc:mga08y16_17248_c1 | nmdc:mga08y16_17248_c1_4802_5182 | 126 |
| 1067 | 3300050511 | nmdc:mga08y16_443118_c1 | nmdc:mga08y16_443118_c1_118_498 | 126 |
| 1068 | 3300050511 | nmdc:mga08y16_60836_c1 | nmdc:mga08y16_60836_c1_825_1205 | 126 |
| 1069 | 3300050512 | nmdc:mga0n895_14265_c1 | nmdc:mga0n895_14265_c1_5433_5813 | 126 |
| 1070 | 3300050512 | nmdc:mga0n895_1688258_c1 | nmdc:mga0n895_1688258_c1_31_411 | 126 |
| 1071 | 3300050513 | nmdc:mga0rr50_1847713_c1 | nmdc:mga0rr50_1847713_c1_114_497 | 126 |
| 1072 | 3300050513 | nmdc:mga0rr50_203522_c1 | nmdc:mga0rr50_203522_c1_840_1220 | 126 |
| 1073 | 3300050514 | nmdc:mga08x19_151142_c1 | nmdc:mga08x19_151142_c1_1018_1398 | 126 |
| 1074 | 3300050515 | nmdc:mga0a205_193435_c1 | nmdc:mga0a205_193435_c1_993_1373 | 126 |
| 1075 | 3300050515 | nmdc:mga0a205_24400_c1 | nmdc:mga0a205_24400_c1_2690_3070 | 126 |
| 1076 | 3300050515 | nmdc:mga0a205_265860_c1 | nmdc:mga0a205_265860_c1_1041_1421 | 126 |
| 1077 | 3300050515 | nmdc:mga0a205_51265_c1 | nmdc:mga0a205_51265_c1_1586_1966 | 126 |
| 1078 | 3300050515 | nmdc:mga0a205_695225_c1 | nmdc:mga0a205_695225_c1_340_720 | 126 |
| 1079 | 3300054114 | Ga0501084_0009530 | Ga0501084_0009530_424_804 | 126 |
| 1080 | 3300054114 | Ga0501084_0040993 | Ga0501084_0040993_1762_2142 | 126 |
| 1081 | 3300054114 | Ga0501084_0186756 | Ga0501084_0186756_616_996 | 126 |
| 1082 | 3300054114 | Ga0501084_0556022 | Ga0501084_0556022_212_592 | 126 |
| 1083 | 3300060353 | Ga0501082_0006790 | Ga0501082_0006790_2121_2501 | 126 |
| 1084 | 3300060353 | Ga0501082_0025916 | Ga0501082_0025916_4227_4607 | 126 |
| 1085 | 3300060353 | Ga0501082_0046122 | Ga0501082_0046122_130_510 | 126 |
| 1086 | 3300060353 | Ga0501082_0148669 | Ga0501082_0148669_824_1204 | 126 |
| 1087 | 3300061734 | Ga0530510_0003120 | Ga0530510_0003120_7390_7770 | 126 |
| 1088 | 3300061734 | Ga0530510_0009782 | Ga0530510_0009782_4593_4973 | 126 |
| 1089 | 3300061734 | Ga0530510_0288108 | Ga0530510_0288108_695_1075 | 126 |
| 1090 | 3300061734 | Ga0530510_0768076 | Ga0530510_0768076_304_693 | 126 |
| 1091 | 3300061734 | Ga0530510_1355551 | Ga0530510_1355551_145_525 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mb3-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ | 0.9816 | 4 | 121 |
| 1mav-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ | 0.9756 | 4 | 121 |
| 1m5t-assembly1.cif.gz_A | crystal structure of the response regulator divk | 0.9744 | 4 | 122 |
| 1mb0-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ | 0.974 | 4 | 121 |
| 1m5u-assembly1.cif.gz_A | crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form | 0.9676 | 4 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9787 | 4 | 84 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9707 | 3 | 84 | 3.40.50.2300 |
| 1m5uA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9676 | 4 | 121 | 3.40.50.2300 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.967 | 5 | 84 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9643 | 4 | 87 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0E3NMV5-F1-model_v4 | Two-component response regulator | 0.9868 | 4 | 121 |
GO:0000160
|
| AF-A0A0F8Z828-F1-model_v4 | Response regulatory domain-containing protein | 0.9868 | 3 | 121 |
GO:0000160
|
| AF-A0A2V6Q3I5-F1-model_v4 | Response regulatory domain-containing protein | 0.9863 | 2 | 122 |
GO:0000160
|
| AF-A0A4R5DVV8-F1-model_v4 | Response regulator | 0.9859 | 4 | 122 |
GO:0000160
|
| AF-A0A1G1FBP9-F1-model_v4 | Two-component system response regulator | 0.9848 | 2 | 119 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar