F489880

General Info

Members Datasets Scaffolds Average Seq Length
1091 651 2182 353

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10035370|Ga0105240_100353704
Length 362
Sequence MQQKRYRILIMGASYGSLLGAKLLLAGHAVKLVCLPAEADLINREGFRVRLPIKASNELVEIDTRRTPGKVSASGATGVDPSDYDLVALAMQEPQYASPGVRALLHAIATAKVPCMSIMNMPPLPYLARIPGLDVTLLRNCYADASVWDAFDPALMTLCSPDPQAFRPPDEKVNVLQVSLPTNFKAARFASDAHTAILRRLESDIDAIRFETSRGPVELPVKLKVHDSVFVPLAKWSMLLTGNYRCVQRDTMRSIRDAVHGDIDASRAVYAWVGEVCKALGASDGDLVPFEKYANAALGLTKPSSAARALAAGAANIERVDRLVQTAAAQKGMHLAAVDRIVALVDEWLARNRKPQAVATAT

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
95 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
96 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
97 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
162 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
192 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
193 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
263 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
270 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
358 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
367 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
378 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
382 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
383 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
384 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
385 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
386 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
387 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
388 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
389 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
390 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
391 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
392 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
393 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
394 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
395 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
396 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
397 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
398 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
401 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
402 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
403 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
404 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
408 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
409 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
412 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
413 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
414 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
415 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
416 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
419 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
420 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
421 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
422 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
423 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
424 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
425 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
426 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
427 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
428 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
429 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
430 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
431 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
432 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
433 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
434 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
435 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
436 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
437 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
438 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
439 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
440 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
441 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
442 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
443 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
444 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
445 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
446 2643221651 Afipia sp. Root123D2 Isolate Unclassified
447 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
448 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
449 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
450 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
451 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
452 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
453 2791355199
454 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
455 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
456 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
457 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
458 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
459 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
460 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
461 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
462 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
463 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
464 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
465 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
466 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
467 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
468 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
469 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
470 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
471 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
472 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
473 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
474 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
475 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
476 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
477 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
478 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
479 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
480 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
481 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
482 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
483 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
484 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
485 2842694124 Methylopila sp. R-72369 Isolate Unclassified
486 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
487 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
488 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
489 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
490 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
491 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
492 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
493 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
494 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
495 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
496 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
497 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
498 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
499 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
500 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
501 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
502 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
503 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
504 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
505 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
506 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
507 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
508 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
509 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
510 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
511 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
512 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
513 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
514 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
515 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
516 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
517 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
518 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
519 2902330777 Methylobacterium sp. 2A Isolate Unclassified
520 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
521 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
522 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
523 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
524 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
525 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
526 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
527 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
528 2906610324
529 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
530 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
531 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
532 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
533 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
534 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
535 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
536 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
537 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
538 2922368715
539 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
540 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
541 2922425934
542 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
543 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
544 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
545 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
546 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
547 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
548 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
549 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
550 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
551 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
552 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
553 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
554 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
555 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
556 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
557 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
558 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
559 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
560 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
561 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
562 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
563 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
564 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
565 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
566 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
567 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
568 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
569 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
570 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
571 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
572 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
573 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
574 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
575 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
576 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
577 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
578 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
579 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
580 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
581 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
582 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
583 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
584 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
585 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
586 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
587 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
588 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
589 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
590 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
591 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
592 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
593 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
594 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
595 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
596 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
597 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
598 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
599 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
600 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
601 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
602 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
603 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
604 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
605 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
606 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
607 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
608 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
609 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
610 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
611 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
612 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
613 641522639 Methylobacterium sp. 4-46 Isolate Nodule
614 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
615 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
616 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
617 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
618 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
619 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
620 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
621 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
622 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
623 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
624 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
625 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
626 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
627 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
628 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
629 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
630 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
631 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
632 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
633 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
634 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
635 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
636 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
637 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
638 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
639 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
640 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
641 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
642 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
643 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
644 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
645 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
646 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
647 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
648 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
649 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
650 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
651 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.62
Metatranscriptomes 0.09
Isolates 22.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.01
Nodule 17.05
Rhizoplane 6.6
Rhizosphere 51.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10035370 3300009093 Bacteria 6439
2 JGI25165J46597_1004863 3300003214 Bacteria 2729
3 JGI25153J46596_10001006 3300003215 Bacteria 17146
4 JGI25153J46596_10003080 3300003215 Bacteria 9407
5 JGI25153J46596_10003339 3300003215 Bacteria 9012
6 JGI25153J46596_10004419 3300003215 Bacteria 7589
7 JGI25153J46596_10015505 3300003215 Bacteria 3100
8 JGI25160J50197_1004437 3300003354 Bacteria 6071
9 JGI25160J50197_1007779 3300003354 Bacteria 4152
10 JGI25404J52841_10006029 3300003659 Bacteria 2521
11 JGI25404J52841_10006842 3300003659 Bacteria 2395
12 JGI25404J52841_10011784 3300003659 Bacteria 1889
13 Ga0055542_1003878 3300003762 Bacteria 3854
14 Ga0055531_10003229 3300003794 Bacteria 10457
15 Ga0065165_1001342 3300005262 Bacteria 27230
16 Ga0065165_1001514 3300005262 Bacteria 24527
17 Ga0065165_1006434 3300005262 Bacteria 6160
18 Ga0068869_100062459 3300005334 Bacteria 2734
19 Ga0068869_100090342 3300005334 Bacteria 2302
20 Ga0070680_100206506 3300005336 Bacteria 1657
21 Ga0068868_100045666 3300005338 Bacteria 3428
22 Ga0068868_100104604 3300005338 Bacteria 2294
23 Ga0070660_100292950 3300005339 Bacteria 1333
24 Ga0070661_100121661 3300005344 Bacteria 1956
25 Ga0070661_100123462 3300005344 Bacteria 1941
26 Ga0070668_100019411 3300005347 Bacteria 5116
27 Ga0070668_100059454 3300005347 Bacteria 2958
28 Ga0070659_100091325 3300005366 Bacteria 2441
29 Ga0070659_100148867 3300005366 Bacteria 1909
30 Ga0070709_10002304 3300005434 Bacteria 10365
31 Ga0070709_10004140 3300005434 Bacteria 7825
32 Ga0070709_10027704 3300005434 Bacteria 3371
33 Ga0070714_100005976 3300005435 Bacteria 9346
34 Ga0070714_100015630 3300005435 Bacteria 6109
35 Ga0070713_100019796 3300005436 Bacteria 5150
36 Ga0070713_100020424 3300005436 Bacteria 5078
37 Ga0070713_100031261 3300005436 Bacteria 4240
38 Ga0070713_100078964 3300005436 Bacteria 2802
39 Ga0070710_10000521 3300005437 Bacteria 18075
40 Ga0070710_10004965 3300005437 Bacteria 6294
41 Ga0070710_10014101 3300005437 Bacteria 4015
42 Ga0070710_10020794 3300005437 Bacteria 3411
43 Ga0070710_10026725 3300005437 Bacteria 3070
44 Ga0070711_100001950 3300005439 Bacteria 11571
45 Ga0070663_100045207 3300005455 Bacteria 3109
46 Ga0070663_100133800 3300005455 Bacteria 1886
47 Ga0070663_100162782 3300005455 Bacteria 1719
48 Ga0070678_100245255 3300005456 Bacteria 1500
49 Ga0070681_10019615 3300005458 Bacteria 6771
50 Ga0068867_100033728 3300005459 Bacteria 3709
51 Ga0068867_100054400 3300005459 Bacteria 2957
52 Ga0070706_100082363 3300005467 Bacteria 2980
53 Ga0070698_100035288 3300005471 Bacteria 5172
54 Ga0070699_100014453 3300005518 Bacteria 6788
55 Ga0070699_100242402 3300005518 Bacteria 1610
56 Ga0070679_100001793 3300005530 Bacteria 19369
57 Ga0070679_100161146 3300005530 Bacteria 2218
58 Ga0070684_100054739 3300005535 Bacteria 3476
59 Ga0068853_100055251 3300005539 Bacteria 3422
60 Ga0068853_100066605 3300005539 Bacteria 3128
61 Ga0068853_100071900 3300005539 Bacteria 3013
62 Ga0068853_100106651 3300005539 Bacteria 2483
63 Ga0070672_100031260 3300005543 Bacteria 4006
64 Ga0070686_100124277 3300005544 Bacteria 1776
65 Ga0070695_100064763 3300005545 Bacteria 2378
66 Ga0070696_100080530 3300005546 Bacteria 2306
67 Ga0070693_100043775 3300005547 Bacteria 2530
68 Ga0070693_100192943 3300005547 Bacteria 1318
69 Ga0070665_100021026 3300005548 Bacteria 6560
70 Ga0070665_100027508 3300005548 Bacteria 5728
71 Ga0070665_100034561 3300005548 Bacteria 5083
72 Ga0070665_100036481 3300005548 Bacteria 4945
73 Ga0070665_100386601 3300005548 Bacteria 1407
74 Ga0068855_100138582 3300005563 Bacteria 2775
75 Ga0068855_100244249 3300005563 Bacteria 2005
76 Ga0070664_100315801 3300005564 Bacteria 1415
77 Ga0070664_100377925 3300005564 Bacteria 1293
78 Ga0068856_100000985 3300005614 Bacteria 30399
79 Ga0068856_100004535 3300005614 Bacteria 13807
80 Ga0068856_100053954 3300005614 Bacteria 3964
81 Ga0068856_100088334 3300005614 Bacteria 3082
82 Ga0068852_100061095 3300005616 Bacteria 3274
83 Ga0068852_100146321 3300005616 Bacteria 2192
84 Ga0068864_100049315 3300005618 Bacteria 3622
85 Ga0068866_10014430 3300005718 Bacteria 3489
86 Ga0068861_100010400 3300005719 Bacteria 6456
87 Ga0068861_100047566 3300005719 Bacteria 3239
88 Ga0068861_100216702 3300005719 Bacteria 1615
89 Ga0068863_100147529 3300005841 Bacteria 2250
90 Ga0068858_100037227 3300005842 Bacteria 4511
91 Ga0068858_100098732 3300005842 Bacteria 2722
92 Ga0068858_100121019 3300005842 Bacteria 2448
93 Ga0068860_100019238 3300005843 Bacteria 6629
94 Ga0068862_100115984 3300005844 Bacteria 2356
95 Ga0068862_100163792 3300005844 Bacteria 1987
96 Ga0068862_100272494 3300005844 Bacteria 1548
97 Ga0068862_100322876 3300005844 Bacteria 1425
98 Ga0081455_10002753 3300005937 Bacteria 20743
99 Ga0081455_10007981 3300005937 Bacteria 11069
100 Ga0081455_10027907 3300005937 Bacteria 5166
101 Ga0081455_10064213 3300005937 Bacteria 3076
102 Ga0081455_10083200 3300005937 Bacteria 2616
103 Ga0081455_10246144 3300005937 Bacteria 1311
104 Ga0081538_10004783 3300005981 Bacteria 12370
105 Ga0081540_1002531 3300005983 Bacteria 14829
106 Ga0081540_1006569 3300005983 Bacteria 8439
107 Ga0081540_1012383 3300005983 Bacteria 5624
108 Ga0081540_1013164 3300005983 Bacteria 5397
109 Ga0081540_1030282 3300005983 Bacteria 3000
110 Ga0081540_1031626 3300005983 Bacteria 2906
111 Ga0081540_1059651 3300005983 Bacteria 1830
112 Ga0081540_1100803 3300005983 Bacteria 1244
113 Ga0081539_10000199 3300005985 Bacteria 139305
114 Ga0081539_10017005 3300005985 Bacteria 5146
115 Ga0081539_10026127 3300005985 Bacteria 3738
116 Ga0070717_10002847 3300006028 Bacteria 12266
117 Ga0070717_10005841 3300006028 Bacteria 9018
118 Ga0075365_10032734 3300006038 Bacteria 3345
119 Ga0075365_10040370 3300006038 Bacteria 3043
120 Ga0075365_10044902 3300006038 Bacteria 2897
121 Ga0075365_10053013 3300006038 Bacteria 2685
122 Ga0075365_10063671 3300006038 Bacteria 2469
123 Ga0075365_10190661 3300006038 Bacteria 1434
124 Ga0075365_10228898 3300006038 Bacteria 1305
125 Ga0075365_10236270 3300006038 Bacteria 1284
126 Ga0075368_10054710 3300006042 Bacteria 1591
127 Ga0075363_100005757 3300006048 Bacteria 5558
128 Ga0075364_10167453 3300006051 Bacteria 1485
129 Ga0070715_10017217 3300006163 Bacteria 2732
130 Ga0070716_100004538 3300006173 Bacteria 6652
131 Ga0070712_100003710 3300006175 Bacteria 9408
132 Ga0070712_100316228 3300006175 Bacteria 1268
133 Ga0075362_10078268 3300006177 Bacteria 1520
134 Ga0075362_10087363 3300006177 Bacteria 1444
135 Ga0075367_10034705 3300006178 Bacteria 2916
136 Ga0075367_10069852 3300006178 Bacteria 2109
137 Ga0075367_10084699 3300006178 Bacteria 1922
138 Ga0075366_10039147 3300006195 Bacteria 2802
139 Ga0075366_10088505 3300006195 Bacteria 1854
140 Ga0075366_10111610 3300006195 Bacteria 1645
141 Ga0075366_10116801 3300006195 Bacteria 1607
142 Ga0097621_100101362 3300006237 Bacteria 2423
143 Ga0075370_10165738 3300006353 Bacteria 1298
144 Ga0068871_100031595 3300006358 Bacteria 4176
145 Ga0068871_100114011 3300006358 Bacteria 2277
146 Ga0068871_100189601 3300006358 Bacteria 1770
147 Ga0075430_100034541 3300006846 Bacteria 4291
148 Ga0075434_100217956 3300006871 Bacteria 1928
149 Ga0068865_100091122 3300006881 Bacteria 2212
150 Ga0068865_100113303 3300006881 Bacteria 2004
151 Ga0075436_100001339 3300006914 Bacteria 16761
152 Ga0099824_1016218 3300006942 Bacteria 6814
153 Ga0099824_1021233 3300006942 Bacteria 4579
154 Ga0075435_100246992 3300007076 Bacteria 1519
155 Ga0075435_100320428 3300007076 Bacteria 1327
156 Ga0105250_10105858 3300009092 Bacteria 1150
157 Ga0105240_10026107 3300009093 Bacteria 7668
158 Ga0111539_10050015 3300009094 Bacteria 4981
159 Ga0111539_10294766 3300009094 Bacteria 1887
160 Ga0105245_10144864 3300009098 Bacteria 2241
161 Ga0114129_10097442 3300009147 Bacteria 4072
162 Ga0114129_10121024 3300009147 Bacteria 3603
163 Ga0105243_10022738 3300009148 Bacteria 4768
164 Ga0105241_10017557 3300009174 Bacteria 5261
165 Ga0105241_10103789 3300009174 Bacteria 2264
166 Ga0105237_10050202 3300009545 Bacteria 4192
167 Ga0105237_10086703 3300009545 Bacteria 3121
168 Ga0105237_10136414 3300009545 Bacteria 2448
169 Ga0105237_10219132 3300009545 Bacteria 1903
170 Ga0105238_10082014 3300009551 Bacteria 3215
171 Ga0105238_10350267 3300009551 Bacteria 1466
172 Ga0105239_10060246 3300010375 Bacteria 4166
173 Ga0105239_10119015 3300010375 Bacteria 2931
174 Ga0105239_10133679 3300010375 Bacteria 2761
175 Ga0105239_10353236 3300010375 Bacteria 1660
176 Ga0105246_10319765 3300011119 Bacteria 1260
177 Ga0157373_10094757 3300013100 Bacteria 2101
178 Ga0157370_10022974 3300013104 Bacteria 6198
179 Ga0157370_10206868 3300013104 Bacteria 1820
180 Ga0157370_10330504 3300013104 Bacteria 1406
181 Ga0157369_10014404 3300013105 Bacteria 8930
182 Ga0157369_10076848 3300013105 Bacteria 3579
183 Ga0157374_10028630 3300013296 Bacteria 5034
184 Ga0157378_10097702 3300013297 Bacteria 2677
185 Ga0157378_10139062 3300013297 Bacteria 2254
186 Ga0157378_10201868 3300013297 Bacteria 1881
187 Ga0163162_10181475 3300013306 Bacteria 2231
188 Ga0163162_10471957 3300013306 Bacteria 1386
189 Ga0157372_10390346 3300013307 Bacteria 1622
190 Ga0157372_10440548 3300013307 Bacteria 1518
191 Ga0157375_10266972 3300013308 Bacteria 1873
192 Ga0163163_10121409 3300014325 Bacteria 2647
193 Ga0163163_10528454 3300014325 Bacteria 1242
194 Ga0157380_10037342 3300014326 Bacteria 3764
195 Ga0157379_10351389 3300014968 Bacteria 1350
196 Ga0157376_10106692 3300014969 Bacteria 2458
197 Ga0214544_1000001 3300021320 Bacteria 783667
198 Ga0214542_1000005 3300021321 Bacteria 389646
199 Ga0214545_1000494 3300021324 Bacteria 62730
200 Ga0214543_1000002 3300021327 Bacteria 712733
201 Ga0213872_10027699 3300021361 Bacteria 2600
202 Ga0213875_10138889 3300021388 Bacteria 1137
203 Ga0213871_10000561 3300021441 Bacteria 5202
204 Ga0224712_10008390 3300022467 Bacteria 3060
205 Ga0209563_107458 3300025230 Bacteria 1795
206 Ga0207425_1013248 3300025245 Bacteria 1911
207 Ga0209677_102208 3300025253 Bacteria 7561
208 Ga0209148_1000303 3300025254 Bacteria 70843
209 Ga0209233_1001642 3300025261 Bacteria 8711
210 Ga0209233_1012946 3300025261 Bacteria 2399
211 Ga0209455_1003876 3300025272 Bacteria 5105
212 Ga0209455_1006070 3300025272 Bacteria 3631
213 Ga0209455_1012448 3300025272 Bacteria 2036
214 Ga0209564_1011410 3300025295 Bacteria 3984
215 Ga0209758_1000026 3300025297 Bacteria 582706
216 Ga0209758_1000258 3300025297 Bacteria 106281
217 Ga0209758_1004294 3300025297 Bacteria 12016
218 Ga0209758_1004912 3300025297 Bacteria 10748
219 Ga0209758_1006924 3300025297 Bacteria 7910
220 Ga0209758_1010259 3300025297 Bacteria 5640
221 Ga0209758_1017302 3300025297 Bacteria 3601
222 Ga0209758_1018986 3300025297 Bacteria 3340
223 Ga0209758_1041439 3300025297 Bacteria 1721
224 Ga0209256_1006566 3300025299 Bacteria 6102
225 Ga0207426_1000237 3300025302 Bacteria 124707
226 Ga0207426_1001633 3300025302 Bacteria 17577
227 Ga0209051_1036517 3300025303 Bacteria 1813
228 Ga0209257_1002311 3300025304 Bacteria 19277
229 Ga0207697_10056637 3300025315 Bacteria 1626
230 Ga0207692_10001254 3300025898 Bacteria 9420
231 Ga0207692_10001827 3300025898 Bacteria 8089
232 Ga0207692_10004461 3300025898 Bacteria 5544
233 Ga0207692_10016382 3300025898 Bacteria 3281
234 Ga0207680_10114077 3300025903 Bacteria 1758
235 Ga0207685_10008841 3300025905 Bacteria 2894
236 Ga0207685_10015853 3300025905 Bacteria 2398
237 Ga0207699_10004416 3300025906 Bacteria 6728
238 Ga0207699_10009885 3300025906 Bacteria 4766
239 Ga0207645_10108162 3300025907 Bacteria 1799
240 Ga0207705_10200680 3300025909 Bacteria 1511
241 Ga0207705_10317286 3300025909 Bacteria 1197
242 Ga0207684_10159843 3300025910 Bacteria 1940
243 Ga0207654_10070949 3300025911 Bacteria 2069
244 Ga0207654_10085619 3300025911 Bacteria 1908
245 Ga0207707_10009661 3300025912 Bacteria 8369
246 Ga0207707_10208440 3300025912 Bacteria 1703
247 Ga0207695_10000006 3300025913 Bacteria 1135309
248 Ga0207695_10015132 3300025913 Bacteria 9101
249 Ga0207695_10051095 3300025913 Bacteria 4343
250 Ga0207671_10010822 3300025914 Bacteria 7485
251 Ga0207671_10062239 3300025914 Bacteria 2771
252 Ga0207671_10276157 3300025914 Bacteria 1325
253 Ga0207693_10010348 3300025915 Bacteria 7571
254 Ga0207663_10034850 3300025916 Bacteria 3014
255 Ga0207662_10138424 3300025918 Bacteria 1540
256 Ga0207657_10000700 3300025919 Bacteria 35601
257 Ga0207657_10170915 3300025919 Bacteria 1761
258 Ga0207649_10194829 3300025920 Bacteria 1427
259 Ga0207652_10128497 3300025921 Bacteria 2259
260 Ga0207652_10343475 3300025921 Bacteria 1347
261 Ga0207652_10361500 3300025921 Bacteria 1310
262 Ga0207681_10040025 3300025923 Bacteria 3116
263 Ga0207681_10129152 3300025923 Bacteria 1866
264 Ga0207694_10348170 3300025924 Bacteria 1226
265 Ga0207650_10258597 3300025925 Bacteria 1412
266 Ga0207687_10067595 3300025927 Bacteria 2543
267 Ga0207687_10106164 3300025927 Bacteria 2076
268 Ga0207687_10178787 3300025927 Bacteria 1642
269 Ga0207700_10013572 3300025928 Bacteria 5307
270 Ga0207700_10021991 3300025928 Bacteria 4368
271 Ga0207700_10025617 3300025928 Bacteria 4100
272 Ga0207700_10045495 3300025928 Bacteria 3239
273 Ga0207700_10109077 3300025928 Bacteria 2224
274 Ga0207664_10010661 3300025929 Bacteria 6498
275 Ga0207664_10057892 3300025929 Bacteria 3082
276 Ga0207664_10065948 3300025929 Bacteria 2900
277 Ga0207664_10401086 3300025929 Bacteria 1220
278 Ga0207690_10192420 3300025932 Bacteria 1543
279 Ga0207706_10073866 3300025933 Bacteria 2998
280 Ga0207706_10262329 3300025933 Bacteria 1508
281 Ga0207709_10036637 3300025935 Bacteria 2908
282 Ga0207709_10123333 3300025935 Bacteria 1753
283 Ga0207669_10016142 3300025937 Bacteria 3786
284 Ga0207704_10058819 3300025938 Bacteria 2369
285 Ga0207704_10101679 3300025938 Bacteria 1918
286 Ga0207665_10001457 3300025939 Bacteria 15930
287 Ga0207665_10011789 3300025939 Bacteria 5745
288 Ga0207691_10129177 3300025940 Bacteria 2233
289 Ga0207711_10044126 3300025941 Bacteria 3805
290 Ga0207689_10017115 3300025942 Bacteria 6136
291 Ga0207689_10051838 3300025942 Bacteria 3383
292 Ga0207679_10234659 3300025945 Bacteria 1551
293 Ga0207667_10065370 3300025949 Bacteria 3794
294 Ga0207667_10088183 3300025949 Bacteria 3209
295 Ga0207667_10099877 3300025949 Bacteria 2994
296 Ga0207667_10158994 3300025949 Bacteria 2325
297 Ga0207667_10292644 3300025949 Bacteria 1664
298 Ga0207668_10027047 3300025972 Bacteria 3733
299 Ga0207668_10036940 3300025972 Bacteria 3265
300 Ga0207668_10056808 3300025972 Bacteria 2727
301 Ga0207668_10329792 3300025972 Bacteria 1269
302 Ga0207677_10096849 3300026023 Bacteria 2160
303 Ga0207677_10150419 3300026023 Bacteria 1795
304 Ga0207703_10038840 3300026035 Bacteria 3802
305 Ga0207703_10060602 3300026035 Bacteria 3095
306 Ga0207703_10072536 3300026035 Bacteria 2846
307 Ga0207678_10017055 3300026067 Bacteria 6377
308 Ga0207678_10030923 3300026067 Bacteria 4674
309 Ga0207678_10044669 3300026067 Bacteria 3832
310 Ga0207678_10089637 3300026067 Bacteria 2629
311 Ga0207678_10179013 3300026067 Bacteria 1810
312 Ga0207702_10000101 3300026078 Bacteria 99845
313 Ga0207702_10024729 3300026078 Bacteria 4983
314 Ga0207702_10214943 3300026078 Bacteria 1789
315 Ga0207648_10187717 3300026089 Bacteria 1831
316 Ga0207674_10115225 3300026116 Bacteria 2659
317 Ga0207674_10141053 3300026116 Bacteria 2369
318 Ga0207674_10490471 3300026116 Bacteria 1187
319 Ga0207675_100026996 3300026118 Bacteria 5346
320 Ga0207683_10011530 3300026121 Bacteria 7545
321 Ga0207698_10037193 3300026142 Bacteria 3582
322 Ga0209389_1000497 3300027296 Bacteria 23633
323 Ga0209389_1026172 3300027296 Bacteria 5063
324 Ga0209589_1000005 3300027357 Bacteria 530958
325 Ga0209589_1003816 3300027357 Bacteria 26258
326 Ga0209489_100005 3300027361 Bacteria 530958
327 Ga0209489_100105 3300027361 Bacteria 118979
328 Ga0209700_100006 3300027363 Bacteria 530958
329 Ga0209700_100138 3300027363 Bacteria 111133
330 Ga0209588_1012186 3300027671 Bacteria 2608
331 Ga0209971_1004175 3300027682 Bacteria 3427
332 Ga0209974_10013666 3300027876 Bacteria 2703
333 Ga0268266_10001098 3300028379 Bacteria 33929
334 Ga0268266_10003540 3300028379 Bacteria 15501
335 Ga0268266_10023009 3300028379 Bacteria 5303
336 Ga0268266_10140472 3300028379 Bacteria 2167
337 Ga0268266_10302757 3300028379 Bacteria 1492
338 Ga0268265_10021129 3300028380 Bacteria 4553
339 Ga0268264_10000194 3300028381 Bacteria 125395
340 Ga0268264_10053031 3300028381 Bacteria 3383
341 Ga0268264_10143466 3300028381 Bacteria 2132
342 Ga0265337_1015597 3300028556 Bacteria 2481
343 Ga0265319_1033366 3300028563 Bacteria 1778
344 Ga0265334_10008755 3300028573 Bacteria 4298
345 Ga0265336_10002190 3300028666 Bacteria 8237
346 Ga0307517_10000483 3300028786 Bacteria 68332
347 Ga0307517_10000579 3300028786 Bacteria 62428
348 Ga0307515_10019505 3300028794 Bacteria 12194
349 Ga0307515_10020668 3300028794 Bacteria 11727
350 Ga0265338_10000086 3300028800 Bacteria 175026
351 Ga0265330_10029145 3300031235 Bacteria 2484
352 Ga0265340_10017733 3300031247 Bacteria 3682
353 Ga0265331_10032341 3300031250 Bacteria 2593
354 Ga0265316_10249487 3300031344 Bacteria 1304
355 Ga0307513_10084794 3300031456 Bacteria 3253
356 Ga0307509_10016147 3300031507 Bacteria 8656
357 Ga0265314_10003340 3300031711 Bacteria 15623
358 Ga0265314_10048195 3300031711 Bacteria 2992
359 Ga0316576_10008583 3300031727 Bacteria 6532
360 Ga0316576_10117508 3300031727 Bacteria 1996
361 Ga0307516_10003800 3300031730 Bacteria 19176
362 Ga0307516_10019415 3300031730 Bacteria 7041
363 Ga0307516_10080655 3300031730 Bacteria 3098
364 Ga0307413_10046200 3300031824 Bacteria 2587
365 Ga0307413_10075321 3300031824 Bacteria 2142
366 Ga0307406_10080608 3300031901 Bacteria 2162
367 Ga0307406_10173180 3300031901 Bacteria 1564
368 Ga0307407_10085309 3300031903 Bacteria 1921
369 Ga0307409_100069217 3300031995 Bacteria 2795
370 Ga0307416_100062470 3300032002 Bacteria 3046
371 Ga0307415_100009955 3300032126 Bacteria 5361
372 Ga0307507_10010695 3300033179 Bacteria 11775
373 Ga0307510_10007650 3300033180 Bacteria 12884
374 Ga0307510_10015422 3300033180 Bacteria 9035
375 Ga0307510_10026275 3300033180 Bacteria 6696
376 Ga0307510_10075684 3300033180 Bacteria 3317
377 Ga0315911_1000005 3300033442 Bacteria 426255
378 Ga0373944_0017475 3300035089 Bacteria 2037
379 Ga0373923_0007604 3300035111 Bacteria 3820
380 Ga0373923_0031667 3300035111 Bacteria 2133
381 Ga0373936_0016796 3300035113 Bacteria 2817
382 Ga0373945_0053809 3300035116 Bacteria 1487
383 Ga0373953_0000300 3300035117 Bacteria 13444
384 Ga0373954_0000863 3300035118 Bacteria 11778
385 Ga0373943_0010120 3300035170 Bacteria 4231
386 Ga0373943_0017687 3300035170 Bacteria 3264
387 Ga0373943_0094554 3300035170 Bacteria 1553
388 Ga0373946_0003431 3300035171 Bacteria 5623
389 Ga0373946_0027620 3300035171 Bacteria 2246
390 Ga0373955_0043423 3300035172 Bacteria 2418
391 Ga0373924_0009837 3300035410 Bacteria 3514
392 Ga0373931_0030911 3300035691 Bacteria 2759
393 Ga0373935_0000128 3300035692 Bacteria 34347
394 Ga0373935_0015796 3300035692 Bacteria 4567
395 Ga0373927_0013611 3300035695 Bacteria 5402
396 Ga0373927_0170498 3300035695 Bacteria 1426
397 Ga0373933_0000163 3300035724 Bacteria 43339
398 Ga0373933_0000983 3300035724 Bacteria 17420
399 Ga0373947_0006253 3300035725 Bacteria 6924
400 Ga0373947_0092387 3300035725 Bacteria 1890
401 Ga0373937_0002366 3300036401 Bacteria 15700
402 Ga0373937_0025430 3300036401 Bacteria 5344
403 Ga0373937_0175309 3300036401 Bacteria 2013
404 Ga0316584_0375052 3300036712 Bacteria 1018
405 Ga0373925_0002522 3300037068 Bacteria 14617
406 Ga0373925_0022604 3300037068 Bacteria 4589
407 Ga0373925_0072330 3300037068 Bacteria 2609
408 Ga0373925_0317794 3300037068 Bacteria 1259
409 Ga0395899_0115360 3300037312 Bacteria 1928
410 Ga0395900_0007637 3300037418 Bacteria 11163
411 Ga0395900_0015995 3300037418 Bacteria 7645
412 Ga0395898_0185038 3300037466 Bacteria 1990
413 Ga0395898_0339065 3300037466 Bacteria 1433
414 Ga0395905_0237013 3300037471 Bacteria 1705
415 Ga0395901_0108229 3300038443 Bacteria 2918
416 Ga0395901_0299915 3300038443 Bacteria 1666
417 Ga0395901_0384954 3300038443 Bacteria 1443
418 Ga0400483_075416 3300039062 Bacteria 10578
419 Ga0400483_184286 3300039062 Bacteria 8445
420 Ga0400483_249057 3300039062 Bacteria 14821
421 Ga0400483_264862 3300039062 Bacteria 1782
422 Ga0400483_286324 3300039062 Bacteria 4617
423 Ga0436365_0110589 3300039437 Bacteria 3180
424 Ga0436365_0702288 3300039437 Bacteria 2739
425 Ga0436365_0708731 3300039437 Bacteria 1368
426 Ga0436360_0844045 3300039438 Bacteria 1071
427 Ga0436361_0949641 3300039447 Bacteria 2670
428 Ga0436363_0370067 3300039450 Bacteria 1277
429 Ga0436363_1003374 3300039450 Bacteria 1235
430 Ga0436362_0634832 3300039453 Bacteria 7794
431 Ga0451853_1351790 3300041512 Bacteria 1838
432 Ga0439435_0002099 3300042436 Bacteria 3872
433 Ga0466969_0009743 3300044656 Bacteria 5092
434 Ga0466972_0000054 3300044658 Bacteria 111745
435 Ga0466972_0045471 3300044658 Bacteria 2128
436 Ga0466965_0030581 3300044683 Bacteria 2624
437 Ga0466965_0135346 3300044683 Bacteria 1280
438 Ga0466966_0001560 3300044684 Bacteria 14713
439 Ga0466966_0024491 3300044684 Bacteria 3947
440 Ga0466961_0000009 3300044693 Bacteria 139001
441 Ga0466968_0004987 3300044735 Bacteria 4977
442 Ga0466968_0014215 3300044735 Bacteria 3143
443 Ga0466968_0017745 3300044735 Bacteria 2849
444 Ga0466970_0053248 3300044765 Bacteria 2161
445 Ga0466960_0046940 3300044901 Bacteria 2069
446 Ga0466960_0071688 3300044901 Bacteria 1726
447 Ga0466959_0001060 3300045049 Bacteria 16449
448 Ga0466959_0030545 3300045049 Bacteria 3990
449 Ga0466959_0115072 3300045049 Bacteria 1916
450 Ga0466958_0157698 3300045836 Bacteria 1433
451 Ga0466967_0062361 3300045976 Bacteria 3309
452 Ga0466967_0084396 3300045976 Bacteria 2874
453 Ga0466967_0085095 3300045976 Bacteria 2863
454 Ga0466967_0284987 3300045976 Bacteria 1586
455 Ga0466967_0543675 3300045976 Bacteria 1143
456 Ga0495617_039508 3300046452 Bacteria 1578
457 Ga0495592_0001156 3300046454 Bacteria 18322
458 Ga0495592_0010943 3300046454 Bacteria 6847
459 Ga0495592_0181721 3300046454 Bacteria 1432
460 Ga0495603_0001212 3300046455 Bacteria 15064
461 Ga0495603_0022066 3300046455 Bacteria 3855
462 Ga0495603_0156421 3300046455 Bacteria 1323
463 Ga0495629_0000970 3300046459 Bacteria 23123
464 Ga0495629_0001713 3300046459 Bacteria 17220
465 Ga0495629_0010950 3300046459 Bacteria 6595
466 Ga0495638_0001053 3300046460 Bacteria 27149
467 Ga0495641_0000402 3300046461 Bacteria 36037
468 Ga0495651_0008308 3300046462 Bacteria 7954
469 Ga0495651_0016788 3300046462 Bacteria 5670
470 Ga0495651_0103915 3300046462 Bacteria 2110
471 Ga0495653_0001031 3300046463 Bacteria 21478
472 Ga0495653_0052500 3300046463 Bacteria 3124
473 Ga0495580_0001155 3300046472 Bacteria 23222
474 Ga0495582_0000063 3300046473 Bacteria 54381
475 Ga0495639_0001528 3300046475 Bacteria 10322
476 Ga0495639_0017681 3300046475 Bacteria 3098
477 Ga0495662_0004861 3300046476 Bacteria 6732
478 Ga0495664_0004784 3300046477 Bacteria 7407
479 Ga0495664_0039552 3300046477 Bacteria 2787
480 Ga0495585_0028047 3300046492 Bacteria 3213
481 Ga0495585_0054180 3300046492 Bacteria 2218
482 Ga0495585_0076859 3300046492 Bacteria 1813
483 Ga0495594_0000237 3300046499 Bacteria 26610
484 Ga0495594_0114212 3300046499 Bacteria 1524
485 Ga0495607_0094443 3300046501 Bacteria 1613
486 Ga0495583_0101016 3300046506 Bacteria 1231
487 Ga0495606_0002402 3300046507 Bacteria 21882
488 Ga0495606_0005498 3300046507 Bacteria 12120
489 Ga0495606_0067370 3300046507 Bacteria 2267
490 Ga0495606_0076507 3300046507 Bacteria 2092
491 Ga0495608_0001890 3300046511 Bacteria 14994
492 Ga0495608_0124282 3300046511 Bacteria 1653
493 Ga0495608_0140117 3300046511 Bacteria 1544
494 Ga0495610_0063984 3300046512 Bacteria 1740
495 Ga0495618_0017234 3300046514 Bacteria 4427
496 Ga0495618_0220567 3300046514 Bacteria 1196
497 Ga0495620_0044590 3300046515 Bacteria 1926
498 Ga0495628_0022077 3300046516 Bacteria 5232
499 Ga0495630_0010676 3300046517 Bacteria 6631
500 Ga0495631_0038870 3300046518 Bacteria 2114
501 Ga0495631_0048559 3300046518 Bacteria 1861
502 Ga0495632_0069080 3300046519 Bacteria 1701
503 Ga0495632_0078064 3300046519 Bacteria 1582
504 Ga0495637_0034558 3300046520 Bacteria 2213
505 Ga0495644_0033373 3300046523 Bacteria 1945
506 Ga0495648_0001808 3300046524 Bacteria 20598
507 Ga0495648_0081503 3300046524 Bacteria 1840
508 Ga0495648_0115605 3300046524 Bacteria 1451
509 Ga0495652_0009725 3300046529 Bacteria 8721
510 Ga0495652_0018844 3300046529 Bacteria 6151
511 Ga0495652_0177448 3300046529 Bacteria 1638
512 Ga0495665_0001528 3300046531 Bacteria 12332
513 Ga0495665_0098141 3300046531 Bacteria 1538
514 Ga0495640_0016170 3300046533 Bacteria 5586
515 Ga0495640_0030468 3300046533 Bacteria 3863
516 Ga0495640_0036751 3300046533 Bacteria 3458
517 Ga0495587_0007169 3300046536 Bacteria 7235
518 Ga0495587_0093442 3300046536 Bacteria 1737
519 Ga0495587_0111331 3300046536 Bacteria 1572
520 Ga0495598_0002625 3300046537 Bacteria 3721
521 Ga0495598_0003921 3300046537 Bacteria 3191
522 Ga0495597_0113636 3300046542 Bacteria 1134
523 Ga0495645_0016981 3300046543 Bacteria 5209
524 Ga0495645_0039206 3300046543 Bacteria 3456
525 Ga0495645_0156206 3300046543 Bacteria 1580
526 Ga0495622_0001950 3300046557 Bacteria 10129
527 Ga0495622_0025346 3300046557 Bacteria 2770
528 Ga0495667_0000309 3300046559 Bacteria 31068
529 Ga0495667_0057384 3300046559 Bacteria 2559
530 Ga0495667_0085404 3300046559 Bacteria 2048
531 Ga0495656_0009228 3300046615 Bacteria 3543
532 Ga0495656_0015149 3300046615 Bacteria 2905
533 Ga0495656_0052013 3300046615 Bacteria 1755
534 Ga0495668_0018007 3300046616 Bacteria 4089
535 Ga0495668_0072305 3300046616 Bacteria 1895
536 Ga0495634_0000645 3300046642 Bacteria 33906
537 Ga0495634_0019882 3300046642 Bacteria 4767
538 Ga0495611_0111529 3300046648 Bacteria 1273
539 Ga0495625_0121147 3300046660 Bacteria 1780
540 Ga0495625_0196623 3300046660 Bacteria 1333
541 Ga0495635_0000133 3300046663 Bacteria 44583
542 Ga0495635_0000640 3300046663 Bacteria 22461
543 Ga0495635_0033464 3300046663 Bacteria 3565
544 Ga0495659_0010383 3300046664 Bacteria 2986
545 Ga0495661_0103429 3300046665 Bacteria 1598
546 Ga0495588_0015704 3300046674 Bacteria 3650
547 Ga0495588_0056046 3300046674 Bacteria 2034
548 Ga0495588_0076036 3300046674 Bacteria 1750
549 Ga0495657_0004124 3300046675 Bacteria 11637
550 Ga0495657_0004557 3300046675 Bacteria 11073
551 Ga0495599_0000486 3300046678 Bacteria 22676
552 Ga0495599_0088545 3300046678 Bacteria 1933
553 Ga0495599_0163151 3300046678 Bacteria 1377
554 Ga0495623_0028160 3300046679 Bacteria 3616
555 Ga0495646_0000464 3300046680 Bacteria 21530
556 Ga0495646_0023990 3300046680 Bacteria 3840
557 Ga0495647_0000793 3300046681 Bacteria 9422
558 Ga0495658_0001369 3300046683 Bacteria 12785
559 Ga0495613_0093775 3300046689 Bacteria 2173
560 Ga0495613_0133438 3300046689 Bacteria 1777
561 Ga0495613_0196593 3300046689 Bacteria 1423
562 Ga0495624_0000224 3300046690 Bacteria 44228
563 Ga0495670_0001602 3300046691 Bacteria 11074
564 Ga0495670_0025398 3300046691 Bacteria 2931
565 Ga0495671_0026885 3300046692 Bacteria 2978
566 Ga0495649_0010422 3300046694 Bacteria 5480
567 Ga0495600_0000868 3300046809 Bacteria 16144
568 Ga0495600_0010438 3300046809 Bacteria 5765
569 Ga0495600_0023965 3300046809 Bacteria 3928
570 Ga0495660_0137344 3300046810 Bacteria 1220
571 Ga0495581_0000237 3300047315 Bacteria 26157
572 Ga0495581_0103750 3300047315 Bacteria 1652
573 Ga0495604_0010505 3300047317 Bacteria 7340
574 Ga0495604_0010749 3300047317 Bacteria 7268
575 Ga0495604_0014375 3300047317 Bacteria 6313
576 Ga0495604_0049200 3300047317 Bacteria 3277
577 Ga0495636_0044932 3300047318 Bacteria 1840
578 Ga0495674_0001107 3300047319 Bacteria 25900
579 Ga0495674_0020841 3300047319 Bacteria 6069
580 Ga0495674_0264077 3300047319 Bacteria 1414
581 Ga0495672_0083464 3300047320 Bacteria 1774
582 Ga0495676_0006639 3300047321 Bacteria 10666
583 Ga0495676_0014347 3300047321 Bacteria 7091
584 Ga0495676_0237251 3300047321 Bacteria 1250
585 Ga0495680_0002191 3300047322 Bacteria 20217
586 Ga0495680_0086415 3300047322 Bacteria 2360
587 Ga0495680_0184000 3300047322 Bacteria 1506
588 Ga0495680_0189621 3300047322 Bacteria 1480
589 Ga0495687_007547 3300047443 Bacteria 6384
590 Ga0495675_0004069 3300047444 Bacteria 8861
591 Ga0495675_0125362 3300047444 Bacteria 1598
592 Ga0495673_0039499 3300047469 Bacteria 2140
593 Ga0495673_0048376 3300047469 Bacteria 1875
594 Ga0495681_0038441 3300047470 Bacteria 2346
595 Ga0495684_0002289 3300047471 Bacteria 15322
596 Ga0495684_0016387 3300047471 Bacteria 5707
597 Ga0495684_0044712 3300047471 Bacteria 3390
598 Ga0495686_0090721 3300047472 Bacteria 1855
599 Ga0495686_0158521 3300047472 Bacteria 1324
600 Ga0495593_0000150 3300047673 Bacteria 34569
601 Ga0495593_0001676 3300047673 Bacteria 13126
602 Ga0495593_0051506 3300047673 Bacteria 2178
603 Ga0495593_0133836 3300047673 Bacteria 1258
604 Ga0495602_0031978 3300048088 Bacteria 4962
605 Ga0495602_0095492 3300048088 Bacteria 2454
606 Ga0495602_0283540 3300048088 Bacteria 1219
607 Ga0495626_0037657 3300048091 Bacteria 2297
608 Ga0496100_0217903 3300048903 Bacteria 1399
609 Ga0496101_0003652 3300048904 Bacteria 9603
610 Ga0496101_0052731 3300048904 Bacteria 2934
611 Ga0496101_0099256 3300048904 Bacteria 2177
612 Ga0496101_0156281 3300048904 Bacteria 1747
613 Ga0496101_0219049 3300048904 Bacteria 1476
614 Ga0496102_0021960 3300048905 Bacteria 5651
615 Ga0496102_0029057 3300048905 Bacteria 4943
616 Ga0496102_0038484 3300048905 Bacteria 4316
617 Ga0496102_0118104 3300048905 Bacteria 2475
618 Ga0496102_0218646 3300048905 Bacteria 1795
619 Ga0496102_0403339 3300048905 Bacteria 1285
620 Ga0496103_0134420 3300048906 Bacteria 1580
621 Ga0496104_0007319 3300048907 Bacteria 9743
622 Ga0496104_0019348 3300048907 Bacteria 6227
623 Ga0496104_0037617 3300048907 Bacteria 4525
624 Ga0496104_0061166 3300048907 Bacteria 3569
625 Ga0496104_0111158 3300048907 Bacteria 2627
626 Ga0496105_0000614 3300048908 Bacteria 23855
627 Ga0496105_0000976 3300048908 Bacteria 19683
628 Ga0496105_0039988 3300048908 Bacteria 3866
629 Ga0496105_0264097 3300048908 Bacteria 1391
630 Ga0496106_0001619 3300048909 Bacteria 16929
631 Ga0496106_0002911 3300048909 Bacteria 12737
632 Ga0496106_0050739 3300048909 Bacteria 3127
633 Ga0496106_0135631 3300048909 Bacteria 1933
634 Ga0496106_0160578 3300048909 Bacteria 1777
635 Ga0496106_0356568 3300048909 Bacteria 1175
636 Ga0496107_0040906 3300048910 Bacteria 3328
637 Ga0496107_0119509 3300048910 Bacteria 1941
638 Ga0496107_0198682 3300048910 Bacteria 1490
639 Ga0496108_0000514 3300048911 Bacteria 30292
640 Ga0496108_0000525 3300048911 Bacteria 30030
641 Ga0496108_0005971 3300048911 Bacteria 9866
642 Ga0496108_0019444 3300048911 Bacteria 5578
643 Ga0496108_0088876 3300048911 Bacteria 2625
644 Ga0496109_0000868 3300048912 Bacteria 25173
645 Ga0496109_0005168 3300048912 Bacteria 10894
646 Ga0496109_0044344 3300048912 Bacteria 4034
647 Ga0496109_0078952 3300048912 Bacteria 3031
648 Ga0496110_0001789 3300048913 Bacteria 15843
649 Ga0496110_0007468 3300048913 Bacteria 8736
650 Ga0496110_0007918 3300048913 Bacteria 8513
651 Ga0496110_0021722 3300048913 Bacteria 5439
652 Ga0496110_0021955 3300048913 Bacteria 5414
653 Ga0496110_0130871 3300048913 Bacteria 2266
654 Ga0496110_0206642 3300048913 Bacteria 1785
655 Ga0496110_0225484 3300048913 Bacteria 1704
656 Ga0496110_0353911 3300048913 Bacteria 1338
657 Ga0496111_0006050 3300048914 Bacteria 7817
658 Ga0496111_0008928 3300048914 Bacteria 6666
659 Ga0496111_0033770 3300048914 Bacteria 3650
660 Ga0496111_0078800 3300048914 Bacteria 2402
661 Ga0496111_0137869 3300048914 Bacteria 1808
662 Ga0496112_0000035 3300048915 Bacteria 106983
663 Ga0496112_0009271 3300048915 Bacteria 8849
664 Ga0496112_0041598 3300048915 Bacteria 4497
665 Ga0496112_0244500 3300048915 Bacteria 1746
666 Ga0496113_0008447 3300048916 Bacteria 6709
667 Ga0496113_0071121 3300048916 Bacteria 2646
668 Ga0496113_0094491 3300048916 Bacteria 2310
669 Ga0496113_0182023 3300048916 Bacteria 1666
670 Ga0496113_0284614 3300048916 Bacteria 1322
671 Ga0496113_0286122 3300048916 Bacteria 1318
672 Ga0496114_0208459 3300048917 Bacteria 1714
673 Ga0496115_0051445 3300048918 Bacteria 3303
674 Ga0496115_0069082 3300048918 Bacteria 2861
675 Ga0496115_0115103 3300048918 Bacteria 2211
676 Ga0496115_0161902 3300048918 Bacteria 1849
677 Ga0496115_0270834 3300048918 Bacteria 1395
678 Ga0496116_0001906 3300048919 Bacteria 22482
679 Ga0496116_0023676 3300048919 Bacteria 4566
680 Ga0496117_0022461 3300048920 Bacteria 5059
681 Ga0496118_0001860 3300048921 Bacteria 30195
682 Ga0496118_0016811 3300048921 Bacteria 6687
683 Ga0496118_0168418 3300048921 Bacteria 1342
684 Ga0496119_0052582 3300048922 Bacteria 2494
685 Ga0496120_0079496 3300048923 Bacteria 1780
686 Ga0496121_0000352 3300048924 Bacteria 95800
687 Ga0496121_0005414 3300048924 Bacteria 16387
688 Ga0496121_0005976 3300048924 Bacteria 15378
689 Ga0496121_0019896 3300048924 Bacteria 6681
690 Ga0496121_0030315 3300048924 Bacteria 4969
691 Ga0496121_0040405 3300048924 Bacteria 4093
692 Ga0496121_0045157 3300048924 Bacteria 3789
693 Ga0496121_0109704 3300048924 Bacteria 2107
694 Ga0496121_0122864 3300048924 Bacteria 1957
695 Ga0496121_0145667 3300048924 Bacteria 1750
696 Ga0496121_0178076 3300048924 Bacteria 1537
697 Ga0496122_0037001 3300048925 Bacteria 3937
698 Ga0496122_0096726 3300048925 Bacteria 1990
699 Ga0496122_0104676 3300048925 Bacteria 1879
700 Ga0496123_0030659 3300048926 Bacteria 3932
701 Ga0496123_0073032 3300048926 Bacteria 2131
702 Ga0496123_0073951 3300048926 Bacteria 2112
703 Ga0496124_0001634 3300048927 Bacteria 32154
704 Ga0496124_0037363 3300048927 Bacteria 4224
705 Ga0496124_0044719 3300048927 Bacteria 3798
706 Ga0496124_0112513 3300048927 Bacteria 2189
707 Ga0496124_0200086 3300048927 Bacteria 1520
708 Ga0496125_0000243 3300048928 Bacteria 111891
709 Ga0496125_0001982 3300048928 Bacteria 27855
710 Ga0496125_0005127 3300048928 Bacteria 14739
711 Ga0496125_0131973 3300048928 Bacteria 1756
712 Ga0496126_0009754 3300048929 Bacteria 10169
713 Ga0496126_0011360 3300048929 Bacteria 9231
714 Ga0496126_0014014 3300048929 Bacteria 8125
715 Ga0496126_0016390 3300048929 Bacteria 7412
716 Ga0496126_0020815 3300048929 Bacteria 6419
717 Ga0496126_0025925 3300048929 Bacteria 5629
718 Ga0496126_0068006 3300048929 Bacteria 3182
719 Ga0496126_0081690 3300048929 Bacteria 2856
720 Ga0496126_0147044 3300048929 Bacteria 2023
721 Ga0496126_0244783 3300048929 Bacteria 1496
722 Ga0496126_0338769 3300048929 Bacteria 1232
723 Ga0495682_0035773 3300049460 Bacteria 1828
724 Ga0501031_0001969 3300049568 Bacteria 12970
725 Ga0501032_0000088 3300049569 Bacteria 79913
726 Ga0501033_0002046 3300049570 Bacteria 17530
727 Ga0501033_0109873 3300049570 Bacteria 2007
728 Ga0501034_0000332 3300049571 Bacteria 82900
729 Ga0501034_0471850 3300049571 Bacteria 1171
730 Ga0501036_0000596 3300049572 Bacteria 26159
731 Ga0501036_0168110 3300049572 Bacteria 1848
732 Ga0501037_0000408 3300049573 Bacteria 35870
733 Ga0501037_0101509 3300049573 Bacteria 2076
734 Ga0501038_0000049 3300049574 Bacteria 100279
735 Ga0501039_0005549 3300049575 Bacteria 9544
736 Ga0501041_0213405 3300049577 Bacteria 1211
737 Ga0501043_0003412 3300049579 Bacteria 13062
738 Ga0501046_0001621 3300049580 Bacteria 21522
739 Ga0501047_0000875 3300049581 Bacteria 30740
740 Ga0501047_0004735 3300049581 Bacteria 12794
741 Ga0501048_0011314 3300049582 Bacteria 6653
742 Ga0501067_0000622 3300049583 Bacteria 19101
743 Ga0501068_0002318 3300049584 Bacteria 10148
744 Ga0501070_0004157 3300049586 Bacteria 12451
745 Ga0501070_0081927 3300049586 Bacteria 2670
746 Ga0501072_0002235 3300049588 Bacteria 14455
747 Ga0501073_0000795 3300049589 Bacteria 22422
748 Ga0501073_0035881 3300049589 Bacteria 3523
749 Ga0501074_0003389 3300049590 Bacteria 11280
750 Ga0501076_0260852 3300049592 Bacteria 1419
751 Ga0501079_0008497 3300049741 Bacteria 7787
752 Ga0501080_0000343 3300049742 Bacteria 35792
753 Ga0501080_0031812 3300049742 Bacteria 4916
754 Ga0501083_0000903 3300049744 Bacteria 19665
755 Ga0501035_0000442 3300049822 Bacteria 46373
756 Ga0501044_0000182 3300049823 Bacteria 78052
757 Ga0501044_0169016 3300049823 Bacteria 2159
758 Ga0501045_0004289 3300049824 Bacteria 9834
759 nmdc:mga03n38_1190_c1 3300050490 Bacteria 7269
760 nmdc:mga00v17_108878_c1 3300050491 Bacteria 1756
761 nmdc:mga00v17_17902_c1 3300050491 Bacteria 4018
762 nmdc:mga0yw44_10147_c1 3300050492 Bacteria 4798
763 nmdc:mga0yw44_24419_c1 3300050492 Bacteria 3420
764 nmdc:mga0yw44_26118_c1 3300050492 Bacteria 3332
765 nmdc:mga0yw44_53966_c1 3300050492 Bacteria 2442
766 nmdc:mga0k408_76281_c1 3300050493 Bacteria 1959
767 nmdc:mga06z11_52594_c1 3300050494 Bacteria 2090
768 nmdc:mga05p37_121114_c1 3300050507 Bacteria 3214
769 nmdc:mga05p37_38357_c1 3300050507 Bacteria 5876
770 nmdc:mga09592_84001_c1 3300050508 Bacteria 2715
771 nmdc:mga06r32_131863_c1 3300050510 Bacteria 2472
772 nmdc:mga08y16_305847_c1 3300050511 Bacteria 1638
773 nmdc:mga08y16_50834_c1 3300050511 Bacteria 4337
774 nmdc:mga0n895_551674_c1 3300050512 Bacteria 1158
775 nmdc:mga08x19_9052_c1 3300050514 Bacteria 5944
776 Ga0495612_0018896 3300053078 Bacteria 2759
777 Ga0500635_0002442 3300053080 Bacteria 4611
778 Ga0500635_0033538 3300053080 Bacteria 1675
779 Ga0495655_0004085 3300053083 Bacteria 2470
780 Ga0495595_0008917 3300053084 Bacteria 4133
781 Ga0495595_0054540 3300053084 Bacteria 1859
782 Ga0500643_000097 3300053087 Bacteria 92120
783 Ga0500646_0015611 3300053090 Bacteria 1979
784 Ga0500647_0099673 3300053091 Bacteria 1387
785 Ga0500583_0033147 3300053092 Bacteria 2284
786 Ga0500651_0012130 3300053093 Bacteria 5215
787 Ga0500651_0108136 3300053093 Bacteria 1699
788 Ga0500566_0000839 3300053094 Bacteria 17527
789 Ga0500566_0001042 3300053094 Bacteria 16057
790 Ga0500566_0005126 3300053094 Bacteria 7809
791 Ga0500566_0007941 3300053094 Bacteria 6279
792 Ga0500566_0083626 3300053094 Bacteria 1772
793 Ga0500566_0118144 3300053094 Bacteria 1433
794 Ga0500641_0005672 3300053096 Bacteria 4423
795 Ga0500641_0011863 3300053096 Bacteria 3170
796 Ga0500554_006785 3300053102 Bacteria 2592
797 Ga0500554_027986 3300053102 Bacteria 1635
798 Ga0500556_0000005 3300053104 Bacteria 581135
799 Ga0500556_0005623 3300053104 Bacteria 3539
800 Ga0500557_000018 3300053105 Bacteria 95477
801 Ga0500572_007622 3300053111 Bacteria 2510
802 Ga0500592_001497 3300053116 Bacteria 3784
803 Ga0500594_0007920 3300053118 Bacteria 2412
804 Ga0500595_000203 3300053119 Bacteria 40552
805 Ga0500595_013787 3300053119 Bacteria 3089
806 Ga0500595_014319 3300053119 Bacteria 3012
807 Ga0500595_028453 3300053119 Bacteria 1905
808 Ga0500595_035356 3300053119 Bacteria 1645
809 Ga0500607_017180 3300053121 Bacteria 4132
810 Ga0500618_006971 3300053125 Bacteria 3265
811 Ga0500642_0000009 3300053130 Bacteria 286829
812 Ga0500642_0000069 3300053130 Bacteria 55916
813 Ga0500642_0008129 3300053130 Bacteria 3570
814 Ga0500652_000124 3300053131 Bacteria 29312
815 Ga0500652_001194 3300053131 Bacteria 8283
816 Ga0500559_0000154 3300053136 Bacteria 54106
817 Ga0500559_0000957 3300053136 Bacteria 18135
818 Ga0500559_0064857 3300053136 Bacteria 1635
819 Ga0500559_0067261 3300053136 Bacteria 1608
820 Ga0500561_0010202 3300053137 Bacteria 1934
821 Ga0500568_0006037 3300053139 Bacteria 6150
822 Ga0500586_002918 3300053145 Bacteria 3959
823 Ga0500603_000276 3300053150 Bacteria 13561
824 Ga0500604_0021226 3300053151 Bacteria 1834
825 Ga0500616_0000048 3300053153 Bacteria 313108
826 Ga0500616_0000118 3300053153 Bacteria 143496
827 Ga0500616_0006096 3300053153 Bacteria 7978
828 Ga0500616_0016304 3300053153 Bacteria 4232
829 Ga0500622_0002631 3300053156 Bacteria 12762
830 Ga0500634_0068538 3300053161 Bacteria 1863
831 Ga0500638_044034 3300053162 Bacteria 2167
832 Ga0500638_089559 3300053162 Bacteria 1450
833 Ga0500639_008732 3300053163 Bacteria 5287
834 Ga0500636_0000523 3300053177 Bacteria 20892
835 Ga0500636_0010057 3300053177 Bacteria 5509
836 Ga0500636_0025563 3300053177 Bacteria 3490
837 Ga0500637_0000189 3300053178 Bacteria 22957
838 Ga0500637_0007975 3300053178 Bacteria 5318
839 Ga0500625_000679 3300053729 Bacteria 9950
840 Ga0500596_006547 3300053735 Bacteria 1963
841 Ga0500599_000419 3300053736 Bacteria 4352
842 Ga0500601_000441 3300053737 Bacteria 6764
843 Ga0500661_000533 3300055283 Bacteria 7073
844 Ga0501082_0006159 3300060353 Bacteria 10413
845 2507511295 2507262055 Bacteria 8048963
846 2508545094 2508501009 Bacteria 7784016
847 2508693842 2508501042 Bacteria 8719808
848 2509150930 2508501128 Bacteria 8613869
849 2511399919 2511231028 Bacteria 8046582
850 2513628457 2513237092 Bacteria 8341956
851 2513640919 2513237094 Bacteria 8789602
852 2513650451 2513237095 Bacteria 8976980
853 2513655468 2513237096 Bacteria 8722461
854 2513677489 2513237098 Bacteria 9902361
855 2513692486 2513237101 Bacteria 7952346
856 2513695703 2513237101 Bacteria 7952346
857 2513719737 2513237104 Bacteria 10034502
858 2513859982 2513237137 Bacteria 9558895
859 2513880155 2513237139 Bacteria 8737671
860 2513888707 2513237141 Bacteria 8496279
861 2513916454 2513237145 Bacteria 8979722
862 2514010373 2513237161 Bacteria 8871253
863 2517100913 2517093001 Bacteria 9002274
864 2517889935 2517572143 Bacteria 9484767
865 2524437886 2524023205 Bacteria 8918781
866 2524466200 2524023210 Bacteria 9029266
867 2524535021 2524023228 Bacteria 10118060
868 2528858362 2528768022 Bacteria 10457665
869 2545675102 2545555834 Bacteria 8130841
870 2596372994 2595698237 Bacteria 6712432
871 2603858028 2602042107 Bacteria 6226103
872 2617350469 2617270735 Bacteria 9163226
873 2617373430 2617270741 Bacteria 8201522
874 2644289555 2643221651 Bacteria 4798932
875 2671121037 2667528175 Bacteria 7532676
876 2723845127 2721755755 Bacteria 8322773
877 2723846955 2721755755 Bacteria 8322773
878 2728749159 2728368998 Bacteria 8720350
879 2745082262 2744054633 Bacteria 8678936
880 2793061735 2791355196 Bacteria 7323613
881 2793068109 2791355197 Bacteria 8420563
882 2793079955
883 2793080947
884 2805916908 2802429603 Bacteria 8777136
885 2818238447 2816332527 Bacteria 8933356
886 2824609177 2824600985 Bacteria 8488197
887 2824611431 2824609381 Bacteria 8672835
888 2824625455 2824617872 Bacteria 8814715
889 2824634267 2824626560 Bacteria 8813858
890 2824638017 2824635225 Bacteria 8785348
891 2824648742 2824644064 Bacteria 8743947
892 2824657289 2824653114 Bacteria 8493680
893 2824668638 2824661429 Bacteria 9877870
894 2824676687 2824671348 Bacteria 8369588
895 2824687409 2824679649 Bacteria 8248951
896 2824690062 2824687955 Bacteria 8360029
897 2824703585 2824696289 Bacteria 8335049
898 2824712468 2824704595 Bacteria 9667483
899 2824721009 2824714736 Bacteria 8717648
900 2824729020 2824723954 Bacteria 8758240
901 2824740216 2824732956 Bacteria 7810675
902 2824746119 2824746037 Bacteria 7911610
903 2824762202 2824753945 Bacteria 9787441
904 2824764391 2824763712 Bacteria 9792355
905 2824773580 2824773399 Bacteria 8360218
906 2838129028 2838122688 Bacteria 8803140
907 2841943453 2841941048 Bacteria 8688029
908 2841953816 2841949485 Bacteria 8680857
909 2841961914 2841957949 Bacteria 8652217
910 2841971468 2841966195 Bacteria 8673214
911 2841981164 2841974524 Bacteria 8931498
912 2841990429 2841983080 Bacteria 8395090
913 2842042408 2842038055 Bacteria 8002051
914 2842050451 2842045827 Bacteria 8006841
915 2842694848 2842694124 Bacteria 4063419
916 2844316634 2844315083 Bacteria 8138177
917 2847938836 2847930680 Bacteria 9342022
918 2847943975 2847939898 Bacteria 8606328
919 2849081813 2849076700 Bacteria 7039503
920 2857512467 2857509624 Bacteria 7472071
921 2857527410 2857524615 Bacteria 6615449
922 2874591652 2874590934 Bacteria 8299676
923 2874605152 2874604998 Bacteria 7834745
924 2874611082 2874604998 Bacteria 7834745
925 2874619834 2874612657 Bacteria 8252029
926 2874625369 2874620515 Bacteria 8290088
927 2874633845 2874628541 Bacteria 8630250
928 2874646019 2874645413 Bacteria 8214782
929 2876770588 2876761206 Bacteria 10111113
930 2876771753 2876771140 Bacteria 8287509
931 2876811543 2876808645 Bacteria 8824342
932 2876817259 2876808645 Bacteria 8824342
933 2876819097 2876818435 Bacteria 8274608
934 2879075572 2879074833 Bacteria 8279565
935 2879084562 2879083081 Bacteria 8587928
936 2879101810 2879099564 Bacteria 10442239
937 2879113660 2879110137 Bacteria 8907982
938 2879114499 2879110137 Bacteria 8907982
939 2879128022 2879127579 Bacteria 8294491
940 2879143321 2879142872 Bacteria 8267021
941 2881367423 2881364244 Bacteria 7710352
942 2881672834 2881665667 Bacteria 8175609
943 2885366647 2885366525 Bacteria 8326213
944 2885376528 2885374607 Bacteria 8927485
945 2885413665 2885409591 Bacteria 9235467
946 2888381221 2888378607 Bacteria 9652610
947 2888389452 2888388044 Bacteria 7304136
948 2888421659 2888419890 Bacteria 7857137
949 2889038237 2889033259 Bacteria 9099371
950 2889039877 2889033259 Bacteria 9099371
951 2889308964 2889306138 Bacteria 6358934
952 2893071947 2893066018 Bacteria 6158120
953 2902330802 2902330777 Bacteria 6395352
954 2902406500 2902405164 Bacteria 6784948
955 2903731300 2903727486 Bacteria 8281579
956 2903755360 2903748898 Bacteria 9972761
957 2903771342 2903768456 Bacteria 9749579
958 2904670673 2904666416 Bacteria 8226587
959 2904692629 2904690495 Bacteria 9412302
960 2904712674 2904711408 Bacteria 9771557
961 2906603901 2906602504 Bacteria 8295279
962 2906612317
963 2906630828 2906626472 Bacteria 8826946
964 2906638346 2906635258 Bacteria 8601019
965 2906652389 2906643746 Bacteria 8722424
966 2906663369 2906660503 Bacteria 8595048
967 2908739809 2908739725 Bacteria 8628932
968 2908757840 2908756301 Bacteria 8864324
969 2908781872 2908775508 Bacteria 8092255
970 2919073229 2919073203 Bacteria 6531949
971 2922362651 2922361189 Bacteria 7436256
972 2922365320 2922361189 Bacteria 7436256
973 2922370847
974 2922387547 2922386360 Bacteria 7017218
975 2922390936 2922386360 Bacteria 7017218
976 2922401274 2922393267 Bacteria 8285685
977 2922426982
978 2928125643 2928125067 Bacteria 5937560
979 2929619229 2929615660 Bacteria 9193770
980 2929628276 2929624759 Bacteria 9339455
981 2932785539 2932784394 Bacteria 9704911
982 2932797028 2932794094 Bacteria 7915132
983 2932807324 2932801729 Bacteria 7987968
984 2932816545 2932809354 Bacteria 9135765
985 2932822168 2932818245 Bacteria 9955613
986 2932830617 2932828146 Bacteria 9745859
987 2933581150 2933577622 Bacteria 9116884
988 2935612474 2935608549 Bacteria 8203142
989 2935620642 2935616580 Bacteria 9032984
990 2935633131 2935630451 Bacteria 8169952
991 2935639736 2935638405 Bacteria 10015038
992 2935650376 2935648319 Bacteria 8801166
993 2935658523 2935656913 Bacteria 8965014
994 2935667426 2935665750 Bacteria 9571747
995 2935677515 2935675223 Bacteria 9928132
996 2935690542 2935684952 Bacteria 9590419
997 2935697127 2935694250 Bacteria 9291695
998 2935705166 2935703347 Bacteria 10242284
999 2935717762 2935713505 Bacteria 9608509
1000 2935727088 2935722832 Bacteria 9608746
1001 2935735858 2935732158 Bacteria 9706831
1002 2935744871 2935741537 Bacteria 9707219
1003 2935755551 2935750917 Bacteria 9590372
1004 2935761933 2935760218 Bacteria 9817913
1005 2935774587 2935769743 Bacteria 7878163
1006 2935781874 2935777560 Bacteria 8077691
1007 2935789398 2935785616 Bacteria 7962367
1008 2935797559 2935793552 Bacteria 8012592
1009 2935803433 2935801545 Bacteria 9301974
1010 2935819551 2935810662 Bacteria 9401221
1011 2935823963 2935819856 Bacteria 8261050
1012 2935829219 2935827899 Bacteria 10038562
1013 2935846732 2935837841 Bacteria 9454360
1014 2935852890 2935847175 Bacteria 8228321
1015 2935858450 2935855204 Bacteria 9035059
1016 2935867129 2935864058 Bacteria 9784707
1017 2935877259 2935873716 Bacteria 9632195
1018 2935884549 2935883170 Bacteria 7964738
1019 2935913349 2935908558 Bacteria 8568796
1020 2935922166 2935916978 Bacteria 9113783
1021 2935931334 2935926038 Bacteria 8601059
1022 2935935616 2935934488 Bacteria 8602579
1023 2935947182 2935942939 Bacteria 8599779
1024 2935953723 2935951376 Bacteria 8602333
1025 2935961713 2935959822 Bacteria 7869783
1026 2935968749 2935967501 Bacteria 8603075
1027 2935986085 2935984226 Bacteria 8302647
1028 2935995121 2935992306 Bacteria 9802711
1029 2936003992 2936002035 Bacteria 9362176
1030 2936013065 2936011229 Bacteria 8801034
1031 2936021848 2936019824 Bacteria 8804134
1032 2936030358 2936028420 Bacteria 8965941
1033 2936037942 2936037263 Bacteria 9446081
1034 2936048042 2936046547 Bacteria 8903709
1035 2936058042 2936055302 Bacteria 8785755
1036 2940561168 2940556831 Bacteria 9590747
1037 2941509567 2941507105 Bacteria 8166816
1038 2941517396 2941515067 Bacteria 8166720
1039 2941526651 2941523033 Bacteria 8169134
1040 2941533418 2941531003 Bacteria 7653939
1041 2941546985 2941538514 Bacteria 9402094
1042 3005476164 3005474847 Bacteria 9259049
1043 3005488238 3005483717 Bacteria 7877331
1044 3005511245 3005506211 Bacteria 6943378
1045 3005592803 3005587118 Bacteria 7794411
1046 3005596244 3005594810 Bacteria 8716512
1047 3005712291 3005710791 Bacteria 7622528
1048 3005719413 3005718088 Bacteria 8283608
1049 641645851 641522639 Bacteria 7737025
1050 8006929873 8006926726 Bacteria 6749210
1051 8006937468 8006933436 Bacteria 10410654
1052 8006965700 8006964411 Bacteria 8966052
1053 8006968477 8006964411 Bacteria 8966052
1054 8006977497 8006973647 Bacteria 10679141
1055 8006987092 8006984368 Bacteria 9651211
1056 8006987412 8006984368 Bacteria 9651211
1057 8006994917 8006994254 Bacteria 8309700
1058 8006998767 8006994254 Bacteria 8309700
1059 8016516798 8016511872 Bacteria 9921665
1060 8016524138 8016522445 Bacteria 8156687
1061 8016551320 8016548790 Bacteria 8155074
1062 8016559710 8016557553 Bacteria 8154380
1063 8016567340 8016566248 Bacteria 8158151
1064 8016580049 8016575299 Bacteria 8154085
1065 8016588795 8016583857 Bacteria 10421953
1066 8016597651 8016595262 Bacteria 8149947
1067 8016604668 8016603502 Bacteria 8731218
1068 8016620345 8016613128 Bacteria 8794220
1069 8016629631 8016622563 Bacteria 7999408
1070 8016637793 8016630954 Bacteria 9217207
1071 8017059767 8017057580 Bacteria 10023680
1072 8019537358 8019530166 Bacteria 8155624
1073 8019539075 8019538911 Bacteria 7872763
1074 8019548568 8019547302 Bacteria 7996444
1075 8019561152 8019555841 Bacteria 9642137
1076 8019571239 8019565922 Bacteria 9639779
1077 8019579245 8019576017 Bacteria 10049540
1078 8019597300 8019586578 Bacteria 10212056
1079 8019604392 8019597564 Bacteria 10041141
1080 8019614146 8019608314 Bacteria 10042931
1081 8019637314 8019629233 Bacteria 8687553
1082 8019642274 8019638758 Bacteria 9062356
1083 8019650334 8019648815 Bacteria 10014479
1084 8019681390 8019678201 Bacteria 8863603
1085 8019694426 8019687851 Bacteria 8712826
1086 8055749514 8055742211 Bacteria 9226248
1087 8056673902 8056673599 Bacteria 7871253
1088 8056679478 8056673599 Bacteria 7871253
1089 8056687049 8056681323 Bacteria 8472857
1090 8056691957 8056689827 Bacteria 6712655
1091 8056973733 8056967851 Bacteria 9038162
1092 Ga0105240_10035370
1093 JGI25165J46597_1004863
1094 JGI25153J46596_10001006
1095 JGI25153J46596_10003080
1096 JGI25153J46596_10003339
1097 JGI25153J46596_10004419
1098 JGI25153J46596_10015505
1099 JGI25160J50197_1004437
1100 JGI25160J50197_1007779
1101 JGI25404J52841_10006029
1102 JGI25404J52841_10006842
1103 JGI25404J52841_10011784
1104 Ga0055542_1003878
1105 Ga0055531_10003229
1106 Ga0065165_1001342
1107 Ga0065165_1001514
1108 Ga0065165_1006434
1109 Ga0068869_100062459
1110 Ga0068869_100090342
1111 Ga0070680_100206506
1112 Ga0068868_100045666
1113 Ga0068868_100104604
1114 Ga0070660_100292950
1115 Ga0070661_100121661
1116 Ga0070661_100123462
1117 Ga0070668_100019411
1118 Ga0070668_100059454
1119 Ga0070659_100091325
1120 Ga0070659_100148867
1121 Ga0070709_10002304
1122 Ga0070709_10004140
1123 Ga0070709_10027704
1124 Ga0070714_100005976
1125 Ga0070714_100015630
1126 Ga0070713_100019796
1127 Ga0070713_100020424
1128 Ga0070713_100031261
1129 Ga0070713_100078964
1130 Ga0070710_10000521
1131 Ga0070710_10004965
1132 Ga0070710_10014101
1133 Ga0070710_10020794
1134 Ga0070710_10026725
1135 Ga0070711_100001950
1136 Ga0070663_100045207
1137 Ga0070663_100133800
1138 Ga0070663_100162782
1139 Ga0070678_100245255
1140 Ga0070681_10019615
1141 Ga0068867_100033728
1142 Ga0068867_100054400
1143 Ga0070706_100082363
1144 Ga0070698_100035288
1145 Ga0070699_100014453
1146 Ga0070699_100242402
1147 Ga0070679_100001793
1148 Ga0070679_100161146
1149 Ga0070684_100054739
1150 Ga0068853_100055251
1151 Ga0068853_100066605
1152 Ga0068853_100071900
1153 Ga0068853_100106651
1154 Ga0070672_100031260
1155 Ga0070686_100124277
1156 Ga0070695_100064763
1157 Ga0070696_100080530
1158 Ga0070693_100043775
1159 Ga0070693_100192943
1160 Ga0070665_100021026
1161 Ga0070665_100027508
1162 Ga0070665_100034561
1163 Ga0070665_100036481
1164 Ga0070665_100386601
1165 Ga0068855_100138582
1166 Ga0068855_100244249
1167 Ga0070664_100315801
1168 Ga0070664_100377925
1169 Ga0068856_100000985
1170 Ga0068856_100004535
1171 Ga0068856_100053954
1172 Ga0068856_100088334
1173 Ga0068852_100061095
1174 Ga0068852_100146321
1175 Ga0068864_100049315
1176 Ga0068866_10014430
1177 Ga0068861_100010400
1178 Ga0068861_100047566
1179 Ga0068861_100216702
1180 Ga0068863_100147529
1181 Ga0068858_100037227
1182 Ga0068858_100098732
1183 Ga0068858_100121019
1184 Ga0068860_100019238
1185 Ga0068862_100115984
1186 Ga0068862_100163792
1187 Ga0068862_100272494
1188 Ga0068862_100322876
1189 Ga0081455_10002753
1190 Ga0081455_10007981
1191 Ga0081455_10027907
1192 Ga0081455_10064213
1193 Ga0081455_10083200
1194 Ga0081455_10246144
1195 Ga0081538_10004783
1196 Ga0081540_1002531
1197 Ga0081540_1006569
1198 Ga0081540_1012383
1199 Ga0081540_1013164
1200 Ga0081540_1030282
1201 Ga0081540_1031626
1202 Ga0081540_1059651
1203 Ga0081540_1100803
1204 Ga0081539_10000199
1205 Ga0081539_10017005
1206 Ga0081539_10026127
1207 Ga0070717_10002847
1208 Ga0070717_10005841
1209 Ga0075365_10032734
1210 Ga0075365_10040370
1211 Ga0075365_10044902
1212 Ga0075365_10053013
1213 Ga0075365_10063671
1214 Ga0075365_10190661
1215 Ga0075365_10228898
1216 Ga0075365_10236270
1217 Ga0075368_10054710
1218 Ga0075363_100005757
1219 Ga0075364_10167453
1220 Ga0070715_10017217
1221 Ga0070716_100004538
1222 Ga0070712_100003710
1223 Ga0070712_100316228
1224 Ga0075362_10078268
1225 Ga0075362_10087363
1226 Ga0075367_10034705
1227 Ga0075367_10069852
1228 Ga0075367_10084699
1229 Ga0075366_10039147
1230 Ga0075366_10088505
1231 Ga0075366_10111610
1232 Ga0075366_10116801
1233 Ga0097621_100101362
1234 Ga0075370_10165738
1235 Ga0068871_100031595
1236 Ga0068871_100114011
1237 Ga0068871_100189601
1238 Ga0075430_100034541
1239 Ga0075434_100217956
1240 Ga0068865_100091122
1241 Ga0068865_100113303
1242 Ga0075436_100001339
1243 Ga0099824_1016218
1244 Ga0099824_1021233
1245 Ga0075435_100246992
1246 Ga0075435_100320428
1247 Ga0105250_10105858
1248 Ga0105240_10026107
1249 Ga0111539_10050015
1250 Ga0111539_10294766
1251 Ga0105245_10144864
1252 Ga0114129_10097442
1253 Ga0114129_10121024
1254 Ga0105243_10022738
1255 Ga0105241_10017557
1256 Ga0105241_10103789
1257 Ga0105237_10050202
1258 Ga0105237_10086703
1259 Ga0105237_10136414
1260 Ga0105237_10219132
1261 Ga0105238_10082014
1262 Ga0105238_10350267
1263 Ga0105239_10060246
1264 Ga0105239_10119015
1265 Ga0105239_10133679
1266 Ga0105239_10353236
1267 Ga0105246_10319765
1268 Ga0157373_10094757
1269 Ga0157370_10022974
1270 Ga0157370_10206868
1271 Ga0157370_10330504
1272 Ga0157369_10014404
1273 Ga0157369_10076848
1274 Ga0157374_10028630
1275 Ga0157378_10097702
1276 Ga0157378_10139062
1277 Ga0157378_10201868
1278 Ga0163162_10181475
1279 Ga0163162_10471957
1280 Ga0157372_10390346
1281 Ga0157372_10440548
1282 Ga0157375_10266972
1283 Ga0163163_10121409
1284 Ga0163163_10528454
1285 Ga0157380_10037342
1286 Ga0157379_10351389
1287 Ga0157376_10106692
1288 Ga0214544_1000001
1289 Ga0214542_1000005
1290 Ga0214545_1000494
1291 Ga0214543_1000002
1292 Ga0213872_10027699
1293 Ga0213875_10138889
1294 Ga0213871_10000561
1295 Ga0224712_10008390
1296 Ga0209563_107458
1297 Ga0207425_1013248
1298 Ga0209677_102208
1299 Ga0209148_1000303
1300 Ga0209233_1001642
1301 Ga0209233_1012946
1302 Ga0209455_1003876
1303 Ga0209455_1006070
1304 Ga0209455_1012448
1305 Ga0209564_1011410
1306 Ga0209758_1000026
1307 Ga0209758_1000258
1308 Ga0209758_1004294
1309 Ga0209758_1004912
1310 Ga0209758_1006924
1311 Ga0209758_1010259
1312 Ga0209758_1017302
1313 Ga0209758_1018986
1314 Ga0209758_1041439
1315 Ga0209256_1006566
1316 Ga0207426_1000237
1317 Ga0207426_1001633
1318 Ga0209051_1036517
1319 Ga0209257_1002311
1320 Ga0207697_10056637
1321 Ga0207692_10001254
1322 Ga0207692_10001827
1323 Ga0207692_10004461
1324 Ga0207692_10016382
1325 Ga0207680_10114077
1326 Ga0207685_10008841
1327 Ga0207685_10015853
1328 Ga0207699_10004416
1329 Ga0207699_10009885
1330 Ga0207645_10108162
1331 Ga0207705_10200680
1332 Ga0207705_10317286
1333 Ga0207684_10159843
1334 Ga0207654_10070949
1335 Ga0207654_10085619
1336 Ga0207707_10009661
1337 Ga0207707_10208440
1338 Ga0207695_10000006
1339 Ga0207695_10015132
1340 Ga0207695_10051095
1341 Ga0207671_10010822
1342 Ga0207671_10062239
1343 Ga0207671_10276157
1344 Ga0207693_10010348
1345 Ga0207663_10034850
1346 Ga0207662_10138424
1347 Ga0207657_10000700
1348 Ga0207657_10170915
1349 Ga0207649_10194829
1350 Ga0207652_10128497
1351 Ga0207652_10343475
1352 Ga0207652_10361500
1353 Ga0207681_10040025
1354 Ga0207681_10129152
1355 Ga0207694_10348170
1356 Ga0207650_10258597
1357 Ga0207687_10067595
1358 Ga0207687_10106164
1359 Ga0207687_10178787
1360 Ga0207700_10013572
1361 Ga0207700_10021991
1362 Ga0207700_10025617
1363 Ga0207700_10045495
1364 Ga0207700_10109077
1365 Ga0207664_10010661
1366 Ga0207664_10057892
1367 Ga0207664_10065948
1368 Ga0207664_10401086
1369 Ga0207690_10192420
1370 Ga0207706_10073866
1371 Ga0207706_10262329
1372 Ga0207709_10036637
1373 Ga0207709_10123333
1374 Ga0207669_10016142
1375 Ga0207704_10058819
1376 Ga0207704_10101679
1377 Ga0207665_10001457
1378 Ga0207665_10011789
1379 Ga0207691_10129177
1380 Ga0207711_10044126
1381 Ga0207689_10017115
1382 Ga0207689_10051838
1383 Ga0207679_10234659
1384 Ga0207667_10065370
1385 Ga0207667_10088183
1386 Ga0207667_10099877
1387 Ga0207667_10158994
1388 Ga0207667_10292644
1389 Ga0207668_10027047
1390 Ga0207668_10036940
1391 Ga0207668_10056808
1392 Ga0207668_10329792
1393 Ga0207677_10096849
1394 Ga0207677_10150419
1395 Ga0207703_10038840
1396 Ga0207703_10060602
1397 Ga0207703_10072536
1398 Ga0207678_10017055
1399 Ga0207678_10030923
1400 Ga0207678_10044669
1401 Ga0207678_10089637
1402 Ga0207678_10179013
1403 Ga0207702_10000101
1404 Ga0207702_10024729
1405 Ga0207702_10214943
1406 Ga0207648_10187717
1407 Ga0207674_10115225
1408 Ga0207674_10141053
1409 Ga0207674_10490471
1410 Ga0207675_100026996
1411 Ga0207683_10011530
1412 Ga0207698_10037193
1413 Ga0209389_1000497
1414 Ga0209389_1026172
1415 Ga0209589_1000005
1416 Ga0209589_1003816
1417 Ga0209489_100005
1418 Ga0209489_100105
1419 Ga0209700_100006
1420 Ga0209700_100138
1421 Ga0209588_1012186
1422 Ga0209971_1004175
1423 Ga0209974_10013666
1424 Ga0268266_10001098
1425 Ga0268266_10003540
1426 Ga0268266_10023009
1427 Ga0268266_10140472
1428 Ga0268266_10302757
1429 Ga0268265_10021129
1430 Ga0268264_10000194
1431 Ga0268264_10053031
1432 Ga0268264_10143466
1433 Ga0265337_1015597
1434 Ga0265319_1033366
1435 Ga0265334_10008755
1436 Ga0265336_10002190
1437 Ga0307517_10000483
1438 Ga0307517_10000579
1439 Ga0307515_10019505
1440 Ga0307515_10020668
1441 Ga0265338_10000086
1442 Ga0265330_10029145
1443 Ga0265340_10017733
1444 Ga0265331_10032341
1445 Ga0265316_10249487
1446 Ga0307513_10084794
1447 Ga0307509_10016147
1448 Ga0265314_10003340
1449 Ga0265314_10048195
1450 Ga0316576_10008583
1451 Ga0316576_10117508
1452 Ga0307516_10003800
1453 Ga0307516_10019415
1454 Ga0307516_10080655
1455 Ga0307413_10046200
1456 Ga0307413_10075321
1457 Ga0307406_10080608
1458 Ga0307406_10173180
1459 Ga0307407_10085309
1460 Ga0307409_100069217
1461 Ga0307416_100062470
1462 Ga0307415_100009955
1463 Ga0307507_10010695
1464 Ga0307510_10007650
1465 Ga0307510_10015422
1466 Ga0307510_10026275
1467 Ga0307510_10075684
1468 Ga0315911_1000005
1469 Ga0373944_0017475
1470 Ga0373923_0007604
1471 Ga0373923_0031667
1472 Ga0373936_0016796
1473 Ga0373945_0053809
1474 Ga0373953_0000300
1475 Ga0373954_0000863
1476 Ga0373943_0010120
1477 Ga0373943_0017687
1478 Ga0373943_0094554
1479 Ga0373946_0003431
1480 Ga0373946_0027620
1481 Ga0373955_0043423
1482 Ga0373924_0009837
1483 Ga0373931_0030911
1484 Ga0373935_0000128
1485 Ga0373935_0015796
1486 Ga0373927_0013611
1487 Ga0373927_0170498
1488 Ga0373933_0000163
1489 Ga0373933_0000983
1490 Ga0373947_0006253
1491 Ga0373947_0092387
1492 Ga0373937_0002366
1493 Ga0373937_0025430
1494 Ga0373937_0175309
1495 Ga0316584_0375052
1496 Ga0373925_0002522
1497 Ga0373925_0022604
1498 Ga0373925_0072330
1499 Ga0373925_0317794
1500 Ga0395899_0115360
1501 Ga0395900_0007637
1502 Ga0395900_0015995
1503 Ga0395898_0185038
1504 Ga0395898_0339065
1505 Ga0395905_0237013
1506 Ga0395901_0108229
1507 Ga0395901_0299915
1508 Ga0395901_0384954
1509 Ga0400483_075416
1510 Ga0400483_184286
1511 Ga0400483_249057
1512 Ga0400483_264862
1513 Ga0400483_286324
1514 Ga0436365_0110589
1515 Ga0436365_0702288
1516 Ga0436365_0708731
1517 Ga0436360_0844045
1518 Ga0436361_0949641
1519 Ga0436363_0370067
1520 Ga0436363_1003374
1521 Ga0436362_0634832
1522 Ga0451853_1351790
1523 Ga0439435_0002099
1524 Ga0466969_0009743
1525 Ga0466972_0000054
1526 Ga0466972_0045471
1527 Ga0466965_0030581
1528 Ga0466965_0135346
1529 Ga0466966_0001560
1530 Ga0466966_0024491
1531 Ga0466961_0000009
1532 Ga0466968_0004987
1533 Ga0466968_0014215
1534 Ga0466968_0017745
1535 Ga0466970_0053248
1536 Ga0466960_0046940
1537 Ga0466960_0071688
1538 Ga0466959_0001060
1539 Ga0466959_0030545
1540 Ga0466959_0115072
1541 Ga0466958_0157698
1542 Ga0466967_0062361
1543 Ga0466967_0084396
1544 Ga0466967_0085095
1545 Ga0466967_0284987
1546 Ga0466967_0543675
1547 Ga0495617_039508
1548 Ga0495592_0001156
1549 Ga0495592_0010943
1550 Ga0495592_0181721
1551 Ga0495603_0001212
1552 Ga0495603_0022066
1553 Ga0495603_0156421
1554 Ga0495629_0000970
1555 Ga0495629_0001713
1556 Ga0495629_0010950
1557 Ga0495638_0001053
1558 Ga0495641_0000402
1559 Ga0495651_0008308
1560 Ga0495651_0016788
1561 Ga0495651_0103915
1562 Ga0495653_0001031
1563 Ga0495653_0052500
1564 Ga0495580_0001155
1565 Ga0495582_0000063
1566 Ga0495639_0001528
1567 Ga0495639_0017681
1568 Ga0495662_0004861
1569 Ga0495664_0004784
1570 Ga0495664_0039552
1571 Ga0495585_0028047
1572 Ga0495585_0054180
1573 Ga0495585_0076859
1574 Ga0495594_0000237
1575 Ga0495594_0114212
1576 Ga0495607_0094443
1577 Ga0495583_0101016
1578 Ga0495606_0002402
1579 Ga0495606_0005498
1580 Ga0495606_0067370
1581 Ga0495606_0076507
1582 Ga0495608_0001890
1583 Ga0495608_0124282
1584 Ga0495608_0140117
1585 Ga0495610_0063984
1586 Ga0495618_0017234
1587 Ga0495618_0220567
1588 Ga0495620_0044590
1589 Ga0495628_0022077
1590 Ga0495630_0010676
1591 Ga0495631_0038870
1592 Ga0495631_0048559
1593 Ga0495632_0069080
1594 Ga0495632_0078064
1595 Ga0495637_0034558
1596 Ga0495644_0033373
1597 Ga0495648_0001808
1598 Ga0495648_0081503
1599 Ga0495648_0115605
1600 Ga0495652_0009725
1601 Ga0495652_0018844
1602 Ga0495652_0177448
1603 Ga0495665_0001528
1604 Ga0495665_0098141
1605 Ga0495640_0016170
1606 Ga0495640_0030468
1607 Ga0495640_0036751
1608 Ga0495587_0007169
1609 Ga0495587_0093442
1610 Ga0495587_0111331
1611 Ga0495598_0002625
1612 Ga0495598_0003921
1613 Ga0495597_0113636
1614 Ga0495645_0016981
1615 Ga0495645_0039206
1616 Ga0495645_0156206
1617 Ga0495622_0001950
1618 Ga0495622_0025346
1619 Ga0495667_0000309
1620 Ga0495667_0057384
1621 Ga0495667_0085404
1622 Ga0495656_0009228
1623 Ga0495656_0015149
1624 Ga0495656_0052013
1625 Ga0495668_0018007
1626 Ga0495668_0072305
1627 Ga0495634_0000645
1628 Ga0495634_0019882
1629 Ga0495611_0111529
1630 Ga0495625_0121147
1631 Ga0495625_0196623
1632 Ga0495635_0000133
1633 Ga0495635_0000640
1634 Ga0495635_0033464
1635 Ga0495659_0010383
1636 Ga0495661_0103429
1637 Ga0495588_0015704
1638 Ga0495588_0056046
1639 Ga0495588_0076036
1640 Ga0495657_0004124
1641 Ga0495657_0004557
1642 Ga0495599_0000486
1643 Ga0495599_0088545
1644 Ga0495599_0163151
1645 Ga0495623_0028160
1646 Ga0495646_0000464
1647 Ga0495646_0023990
1648 Ga0495647_0000793
1649 Ga0495658_0001369
1650 Ga0495613_0093775
1651 Ga0495613_0133438
1652 Ga0495613_0196593
1653 Ga0495624_0000224
1654 Ga0495670_0001602
1655 Ga0495670_0025398
1656 Ga0495671_0026885
1657 Ga0495649_0010422
1658 Ga0495600_0000868
1659 Ga0495600_0010438
1660 Ga0495600_0023965
1661 Ga0495660_0137344
1662 Ga0495581_0000237
1663 Ga0495581_0103750
1664 Ga0495604_0010505
1665 Ga0495604_0010749
1666 Ga0495604_0014375
1667 Ga0495604_0049200
1668 Ga0495636_0044932
1669 Ga0495674_0001107
1670 Ga0495674_0020841
1671 Ga0495674_0264077
1672 Ga0495672_0083464
1673 Ga0495676_0006639
1674 Ga0495676_0014347
1675 Ga0495676_0237251
1676 Ga0495680_0002191
1677 Ga0495680_0086415
1678 Ga0495680_0184000
1679 Ga0495680_0189621
1680 Ga0495687_007547
1681 Ga0495675_0004069
1682 Ga0495675_0125362
1683 Ga0495673_0039499
1684 Ga0495673_0048376
1685 Ga0495681_0038441
1686 Ga0495684_0002289
1687 Ga0495684_0016387
1688 Ga0495684_0044712
1689 Ga0495686_0090721
1690 Ga0495686_0158521
1691 Ga0495593_0000150
1692 Ga0495593_0001676
1693 Ga0495593_0051506
1694 Ga0495593_0133836
1695 Ga0495602_0031978
1696 Ga0495602_0095492
1697 Ga0495602_0283540
1698 Ga0495626_0037657
1699 Ga0496100_0217903
1700 Ga0496101_0003652
1701 Ga0496101_0052731
1702 Ga0496101_0099256
1703 Ga0496101_0156281
1704 Ga0496101_0219049
1705 Ga0496102_0021960
1706 Ga0496102_0029057
1707 Ga0496102_0038484
1708 Ga0496102_0118104
1709 Ga0496102_0218646
1710 Ga0496102_0403339
1711 Ga0496103_0134420
1712 Ga0496104_0007319
1713 Ga0496104_0019348
1714 Ga0496104_0037617
1715 Ga0496104_0061166
1716 Ga0496104_0111158
1717 Ga0496105_0000614
1718 Ga0496105_0000976
1719 Ga0496105_0039988
1720 Ga0496105_0264097
1721 Ga0496106_0001619
1722 Ga0496106_0002911
1723 Ga0496106_0050739
1724 Ga0496106_0135631
1725 Ga0496106_0160578
1726 Ga0496106_0356568
1727 Ga0496107_0040906
1728 Ga0496107_0119509
1729 Ga0496107_0198682
1730 Ga0496108_0000514
1731 Ga0496108_0000525
1732 Ga0496108_0005971
1733 Ga0496108_0019444
1734 Ga0496108_0088876
1735 Ga0496109_0000868
1736 Ga0496109_0005168
1737 Ga0496109_0044344
1738 Ga0496109_0078952
1739 Ga0496110_0001789
1740 Ga0496110_0007468
1741 Ga0496110_0007918
1742 Ga0496110_0021722
1743 Ga0496110_0021955
1744 Ga0496110_0130871
1745 Ga0496110_0206642
1746 Ga0496110_0225484
1747 Ga0496110_0353911
1748 Ga0496111_0006050
1749 Ga0496111_0008928
1750 Ga0496111_0033770
1751 Ga0496111_0078800
1752 Ga0496111_0137869
1753 Ga0496112_0000035
1754 Ga0496112_0009271
1755 Ga0496112_0041598
1756 Ga0496112_0244500
1757 Ga0496113_0008447
1758 Ga0496113_0071121
1759 Ga0496113_0094491
1760 Ga0496113_0182023
1761 Ga0496113_0284614
1762 Ga0496113_0286122
1763 Ga0496114_0208459
1764 Ga0496115_0051445
1765 Ga0496115_0069082
1766 Ga0496115_0115103
1767 Ga0496115_0161902
1768 Ga0496115_0270834
1769 Ga0496116_0001906
1770 Ga0496116_0023676
1771 Ga0496117_0022461
1772 Ga0496118_0001860
1773 Ga0496118_0016811
1774 Ga0496118_0168418
1775 Ga0496119_0052582
1776 Ga0496120_0079496
1777 Ga0496121_0000352
1778 Ga0496121_0005414
1779 Ga0496121_0005976
1780 Ga0496121_0019896
1781 Ga0496121_0030315
1782 Ga0496121_0040405
1783 Ga0496121_0045157
1784 Ga0496121_0109704
1785 Ga0496121_0122864
1786 Ga0496121_0145667
1787 Ga0496121_0178076
1788 Ga0496122_0037001
1789 Ga0496122_0096726
1790 Ga0496122_0104676
1791 Ga0496123_0030659
1792 Ga0496123_0073032
1793 Ga0496123_0073951
1794 Ga0496124_0001634
1795 Ga0496124_0037363
1796 Ga0496124_0044719
1797 Ga0496124_0112513
1798 Ga0496124_0200086
1799 Ga0496125_0000243
1800 Ga0496125_0001982
1801 Ga0496125_0005127
1802 Ga0496125_0131973
1803 Ga0496126_0009754
1804 Ga0496126_0011360
1805 Ga0496126_0014014
1806 Ga0496126_0016390
1807 Ga0496126_0020815
1808 Ga0496126_0025925
1809 Ga0496126_0068006
1810 Ga0496126_0081690
1811 Ga0496126_0147044
1812 Ga0496126_0244783
1813 Ga0496126_0338769
1814 Ga0495682_0035773
1815 Ga0501031_0001969
1816 Ga0501032_0000088
1817 Ga0501033_0002046
1818 Ga0501033_0109873
1819 Ga0501034_0000332
1820 Ga0501034_0471850
1821 Ga0501036_0000596
1822 Ga0501036_0168110
1823 Ga0501037_0000408
1824 Ga0501037_0101509
1825 Ga0501038_0000049
1826 Ga0501039_0005549
1827 Ga0501041_0213405
1828 Ga0501043_0003412
1829 Ga0501046_0001621
1830 Ga0501047_0000875
1831 Ga0501047_0004735
1832 Ga0501048_0011314
1833 Ga0501067_0000622
1834 Ga0501068_0002318
1835 Ga0501070_0004157
1836 Ga0501070_0081927
1837 Ga0501072_0002235
1838 Ga0501073_0000795
1839 Ga0501073_0035881
1840 Ga0501074_0003389
1841 Ga0501076_0260852
1842 Ga0501079_0008497
1843 Ga0501080_0000343
1844 Ga0501080_0031812
1845 Ga0501083_0000903
1846 Ga0501035_0000442
1847 Ga0501044_0000182
1848 Ga0501044_0169016
1849 Ga0501045_0004289
1850 nmdc:mga03n38_1190_c1
1851 nmdc:mga00v17_108878_c1
1852 nmdc:mga00v17_17902_c1
1853 nmdc:mga0yw44_10147_c1
1854 nmdc:mga0yw44_24419_c1
1855 nmdc:mga0yw44_26118_c1
1856 nmdc:mga0yw44_53966_c1
1857 nmdc:mga0k408_76281_c1
1858 nmdc:mga06z11_52594_c1
1859 nmdc:mga05p37_121114_c1
1860 nmdc:mga05p37_38357_c1
1861 nmdc:mga09592_84001_c1
1862 nmdc:mga06r32_131863_c1
1863 nmdc:mga08y16_305847_c1
1864 nmdc:mga08y16_50834_c1
1865 nmdc:mga0n895_551674_c1
1866 nmdc:mga08x19_9052_c1
1867 Ga0495612_0018896
1868 Ga0500635_0002442
1869 Ga0500635_0033538
1870 Ga0495655_0004085
1871 Ga0495595_0008917
1872 Ga0495595_0054540
1873 Ga0500643_000097
1874 Ga0500646_0015611
1875 Ga0500647_0099673
1876 Ga0500583_0033147
1877 Ga0500651_0012130
1878 Ga0500651_0108136
1879 Ga0500566_0000839
1880 Ga0500566_0001042
1881 Ga0500566_0005126
1882 Ga0500566_0007941
1883 Ga0500566_0083626
1884 Ga0500566_0118144
1885 Ga0500641_0005672
1886 Ga0500641_0011863
1887 Ga0500554_006785
1888 Ga0500554_027986
1889 Ga0500556_0000005
1890 Ga0500556_0005623
1891 Ga0500557_000018
1892 Ga0500572_007622
1893 Ga0500592_001497
1894 Ga0500594_0007920
1895 Ga0500595_000203
1896 Ga0500595_013787
1897 Ga0500595_014319
1898 Ga0500595_028453
1899 Ga0500595_035356
1900 Ga0500607_017180
1901 Ga0500618_006971
1902 Ga0500642_0000009
1903 Ga0500642_0000069
1904 Ga0500642_0008129
1905 Ga0500652_000124
1906 Ga0500652_001194
1907 Ga0500559_0000154
1908 Ga0500559_0000957
1909 Ga0500559_0064857
1910 Ga0500559_0067261
1911 Ga0500561_0010202
1912 Ga0500568_0006037
1913 Ga0500586_002918
1914 Ga0500603_000276
1915 Ga0500604_0021226
1916 Ga0500616_0000048
1917 Ga0500616_0000118
1918 Ga0500616_0006096
1919 Ga0500616_0016304
1920 Ga0500622_0002631
1921 Ga0500634_0068538
1922 Ga0500638_044034
1923 Ga0500638_089559
1924 Ga0500639_008732
1925 Ga0500636_0000523
1926 Ga0500636_0010057
1927 Ga0500636_0025563
1928 Ga0500637_0000189
1929 Ga0500637_0007975
1930 Ga0500625_000679
1931 Ga0500596_006547
1932 Ga0500599_000419
1933 Ga0500601_000441
1934 Ga0500661_000533
1935 Ga0501082_0006159
1936 2507511295
1937 2508545094
1938 2508693842
1939 2509150930
1940 2511399919
1941 2513628457
1942 2513640919
1943 2513650451
1944 2513655468
1945 2513677489
1946 2513692486
1947 2513695703
1948 2513719737
1949 2513859982
1950 2513880155
1951 2513888707
1952 2513916454
1953 2514010373
1954 2517100913
1955 2517889935
1956 2524437886
1957 2524466200
1958 2524535021
1959 2528858362
1960 2545675102
1961 2596372994
1962 2603858028
1963 2617350469
1964 2617373430
1965 2644289555
1966 2671121037
1967 2723845127
1968 2723846955
1969 2728749159
1970 2745082262
1971 2793061735
1972 2793068109
1973 2793079955
1974 2793080947
1975 2805916908
1976 2818238447
1977 2824609177
1978 2824611431
1979 2824625455
1980 2824634267
1981 2824638017
1982 2824648742
1983 2824657289
1984 2824668638
1985 2824676687
1986 2824687409
1987 2824690062
1988 2824703585
1989 2824712468
1990 2824721009
1991 2824729020
1992 2824740216
1993 2824746119
1994 2824762202
1995 2824764391
1996 2824773580
1997 2838129028
1998 2841943453
1999 2841953816
2000 2841961914
2001 2841971468
2002 2841981164
2003 2841990429
2004 2842042408
2005 2842050451
2006 2842694848
2007 2844316634
2008 2847938836
2009 2847943975
2010 2849081813
2011 2857512467
2012 2857527410
2013 2874591652
2014 2874605152
2015 2874611082
2016 2874619834
2017 2874625369
2018 2874633845
2019 2874646019
2020 2876770588
2021 2876771753
2022 2876811543
2023 2876817259
2024 2876819097
2025 2879075572
2026 2879084562
2027 2879101810
2028 2879113660
2029 2879114499
2030 2879128022
2031 2879143321
2032 2881367423
2033 2881672834
2034 2885366647
2035 2885376528
2036 2885413665
2037 2888381221
2038 2888389452
2039 2888421659
2040 2889038237
2041 2889039877
2042 2889308964
2043 2893071947
2044 2902330802
2045 2902406500
2046 2903731300
2047 2903755360
2048 2903771342
2049 2904670673
2050 2904692629
2051 2904712674
2052 2906603901
2053 2906612317
2054 2906630828
2055 2906638346
2056 2906652389
2057 2906663369
2058 2908739809
2059 2908757840
2060 2908781872
2061 2919073229
2062 2922362651
2063 2922365320
2064 2922370847
2065 2922387547
2066 2922390936
2067 2922401274
2068 2922426982
2069 2928125643
2070 2929619229
2071 2929628276
2072 2932785539
2073 2932797028
2074 2932807324
2075 2932816545
2076 2932822168
2077 2932830617
2078 2933581150
2079 2935612474
2080 2935620642
2081 2935633131
2082 2935639736
2083 2935650376
2084 2935658523
2085 2935667426
2086 2935677515
2087 2935690542
2088 2935697127
2089 2935705166
2090 2935717762
2091 2935727088
2092 2935735858
2093 2935744871
2094 2935755551
2095 2935761933
2096 2935774587
2097 2935781874
2098 2935789398
2099 2935797559
2100 2935803433
2101 2935819551
2102 2935823963
2103 2935829219
2104 2935846732
2105 2935852890
2106 2935858450
2107 2935867129
2108 2935877259
2109 2935884549
2110 2935913349
2111 2935922166
2112 2935931334
2113 2935935616
2114 2935947182
2115 2935953723
2116 2935961713
2117 2935968749
2118 2935986085
2119 2935995121
2120 2936003992
2121 2936013065
2122 2936021848
2123 2936030358
2124 2936037942
2125 2936048042
2126 2936058042
2127 2940561168
2128 2941509567
2129 2941517396
2130 2941526651
2131 2941533418
2132 2941546985
2133 3005476164
2134 3005488238
2135 3005511245
2136 3005592803
2137 3005596244
2138 3005712291
2139 3005719413
2140 641645851
2141 8006929873
2142 8006937468
2143 8006965700
2144 8006968477
2145 8006977497
2146 8006987092
2147 8006987412
2148 8006994917
2149 8006998767
2150 8016516798
2151 8016524138
2152 8016551320
2153 8016559710
2154 8016567340
2155 8016580049
2156 8016588795
2157 8016597651
2158 8016604668
2159 8016620345
2160 8016629631
2161 8016637793
2162 8017059767
2163 8019537358
2164 8019539075
2165 8019548568
2166 8019561152
2167 8019571239
2168 8019579245
2169 8019597300
2170 8019604392
2171 8019614146
2172 8019637314
2173 8019642274
2174 8019650334
2175 8019681390
2176 8019694426
2177 8055749514
2178 8056673902
2179 8056679478
2180 8056687049
2181 8056691957
2182 8056973733

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.7741 3 345
5hws-assembly1.cif.gz_D crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ 0.7701 3 343
3i83-assembly1.cif.gz_A crystal structure of 2-dehydropantoate 2-reductase from methylococcus capsulatus 0.7696 4 353
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.7649 3 345
5hws-assembly1.cif.gz_D crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ 0.7635 3 343
ID Description Score Start End Superfamily
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9488 1 30 3.50.50.60
af_A4HVU0_28_425_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8744 3 32 3.50.50.60
4yshB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8602 2 30 3.50.50.60
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8487 5 30 3.50.50.60
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8292 2 40 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A560DNX9-F1-model_v4 Ketopantoate reductase 0.9964 1 354 GO:0016020
AF-A0A560DNX9-F1-model_v4 Ketopantoate reductase 0.9936 1 354 GO:0016020
AF-A0A381Q2U3-F1-model_v4 Uncharacterized protein 0.9826 22 348
AF-A0A1Z8RTI4-F1-model_v4 deleted 0.9773 2 348
AF-A0A2E5PPA2-F1-model_v4 Acetyl-CoA carboxylase 0.9723 1 348

Map