F489885

General Info

Members Datasets Scaffolds Average Seq Length
1091 605 878 464

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10059800|Ga0207684_100598002
Length 453
Sequence MKTRMEKDTFGPIEVPADRLWGAQTQRSLEHFRISGERMPRGLLRALALVKKAAALVNMDLKVLDEKKGRAIVAAADEVLAGRHDDEFPLVVWQTGSGTQTNMNMNEVLANRASEVLGGERGESRLVHPNDDVNRSQSSNDVFPAAMSVAAAEALRREVIPAVALLRDALAKKGAAFKDIVKIGRTHLQDATPLTLGQEFSGYVSQLDHALHLSELALGGTAVGTGLNAPPGYAEKVAAKIAELTGSPFVTAPNKFEALAANDAIVHAHGALKGLAAALNKIANDIRWLASGPRCGIGEISIPENEPGSSIMPGKVNPTQAEAMTMLCAQVMGNDVAIGVGGASGNFELNVFKPLLIHNFMMSARLIADGCRSFREHCVEGIEPNRERIRQHLENSLMLVTALNPHIGYDNAAKIAKTAHKTGKTLKETAVELGLVTPEQFDTWVKPERMVGE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
6 2506520008 Serratia plymuthica AS12 Isolate Unclassified
7 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
8 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
9 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
10 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
11 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
12 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
13 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
14 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
15 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
16 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
17 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
18 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
19 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
20 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
21 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
22 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
23 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
24 2547132181 Kosakonia sacchari SP1 Isolate Stem
25 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
26 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
27 2561511199 Enterobacter sp. R4-368 Isolate Nodule
28 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
29 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
30 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
31 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
32 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
33 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
34 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
35 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
36 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
37 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
38 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
39 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
40 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
41 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
42 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
43 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
44 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
45 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
46 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
47 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
48 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
49 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
50 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
51 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
52 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
53 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
54 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
55 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
56 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
57 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
58 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
59 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
60 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
61 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
62 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
63 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
64 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
65 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
66 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
67 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
68 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
69 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
70 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
71 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
72 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
73 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
74 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
75 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
76 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
77 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
78 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
79 2636415599 Klebsiella variicola DX120E Isolate Unclassified
80 2643221570 Acidovorax sp. Root568 Isolate Unclassified
81 2643221585 Pelomonas sp. Root662 Isolate Unclassified
82 2643221596 Acidovorax sp. Root70 Isolate Unclassified
83 2643221652 Acidovorax sp. Root402 Isolate Unclassified
84 2643221656 Pelomonas sp. Root405 Isolate Unclassified
85 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
86 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
87 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
88 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
89 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
90 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
91 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
92 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
93 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
94 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
95 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
96 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
97 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
98 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
99 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
100 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
101 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
102 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
103 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
104 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
105 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
106 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
107 2751185917 Enterobacter sp. HK169 Isolate Unclassified
108 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
109 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
110 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
111 2775507074 Klebsiella sp. D5A Isolate Unclassified
112 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
113 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
114 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
115 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
116 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
117 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
118 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
119 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
120 2821118458 Enterobacter asburiae 609 Isolate Unclassified
121 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
122 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
123 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
124 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
125 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
126 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
127 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
128 2847085930 Erwinia persicina B64 Isolate Bulb
129 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
130 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
131 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
132 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
133 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
134 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
135 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
136 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
137 2858950400 Achromobacter sp. K91 Isolate Unclassified
138 2865014394 Pantoea sp. R-71966 Isolate Unclassified
139 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
140 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
141 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
142 2876601092 Pantoea endophytica 596 Isolate Unclassified
143 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
144 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
145 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
146 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
147 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
148 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
149 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
150 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
151 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
152 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
153 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
154 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
155 2904504865 Serratia marcescens 1822 Isolate Unclassified
156 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
157 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
158 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
159 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
160 2919150387 Rahnella aceris 1817 Isolate Unclassified
161 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
162 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
163 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
164 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
165 2927143783 Rahnella sp. 2050 Isolate Unclassified
166 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
167 2928058823 Ralstonia sp. 1138 Isolate Unclassified
168 2932406140 Serratia sp. 2723 Isolate Rhizosphere
169 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
170 2937539931 Pantoea sp. LS15 Isolate Unclassified
171 2937967321 Serratia sp. YC16 Isolate Unclassified
172 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
173 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
174 2939577877 Serratia sp. 509 Isolate Rhizosphere
175 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
176 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
177 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
178 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
179 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
180 2941479691
181 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
182 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
183 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
184 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
185 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
186 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
187 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
188 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
189 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
190 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
191 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
192 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
193 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
194 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
195 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
196 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
197 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
198 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
199 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
200 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
201 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
202 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
203 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
204 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
205 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
206 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
207 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
208 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
209 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
210 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
211 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
212 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
213 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
214 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
215 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
216 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
217 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
218 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
219 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
220 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
221 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
222 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
223 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
224 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
225 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
226 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
227 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
228 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
229 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
230 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
231 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
232 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
233 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
234 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
235 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
236 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
237 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
238 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
239 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
240 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
241 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
242 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
243 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
244 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
245 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
246 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
247 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
248 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
249 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
250 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
251 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
252 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
253 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
254 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
255 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
256 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
257 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
258 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
259 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
260 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
261 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
262 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
263 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
264 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
265 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
266 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
267 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
268 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
269 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
270 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
271 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
272 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
273 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
274 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
275 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
276 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
277 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
278 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
279 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
280 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
281 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
282 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
283 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
284 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
285 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
286 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
287 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
288 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
289 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
290 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
291 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
292 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
293 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
294 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
295 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
296 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
297 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
298 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
299 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
300 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
301 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
302 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
303 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
304 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
305 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
306 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
307 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
308 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
309 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
310 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
311 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
312 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
313 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
314 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
315 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
316 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
317 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
318 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
319 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
320 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
327 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
328 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
330 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
333 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
334 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
335 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
339 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
383 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
384 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
385 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
386 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
388 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
391 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
392 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
393 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
394 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
398 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
399 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
400 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
401 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
402 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
403 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
404 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
405 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
406 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
407 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
408 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
409 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
410 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
411 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
412 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
413 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
414 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
415 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
416 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
417 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
419 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
420 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
421 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
422 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
423 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
424 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
425 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
426 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
427 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
428 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
429 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
430 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
431 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
432 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
433 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
434 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
435 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
436 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
437 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
438 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
439 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
440 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
441 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
442 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
443 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
444 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
445 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
446 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
447 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
448 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
449 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
450 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
451 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
452 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
453 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
454 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
455 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
456 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
457 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
458 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
459 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
460 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
461 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
462 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
463 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
464 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
465 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
466 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
467 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
468 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
469 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
470 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
471 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
472 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
473 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
474 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
475 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
476 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
477 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
478 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
479 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
480 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
481 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
482 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
483 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
484 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
485 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
486 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
487 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
488 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
489 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
490 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
491 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
492 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
493 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
494 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
495 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
496 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
497 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
498 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
499 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
500 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
501 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
502 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
503 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
504 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
505 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
506 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
507 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
508 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
509 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
510 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
511 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
512 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
513 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
514 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
515 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
516 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
517 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
518 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
519 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
520 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
521 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
522 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
523 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
524 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
525 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
526 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
527 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
528 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
529 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
530 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
531 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
532 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
533 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
534 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
535 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
536 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
537 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
538 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
539 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
541 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
542 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
543 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
544 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
545 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
546 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
547 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
548 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
549 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
550 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
551 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
552 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
553 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
554 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
555 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
556 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
557 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
558 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
559 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
560 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
561 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
562 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
563 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
564 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
565 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
566 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
567 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
568 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
569 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
570 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
571 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
572 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
573 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
574 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
575 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
576 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
577 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
578 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
579 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
580 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
581 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
582 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
583 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
584 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
585 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
586 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
587 640753048 Serratia proteamaculans 568 Isolate Endosphere
588 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
589 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
590 8004592986 Serratia sp. S119 Isolate Unclassified
591 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
592 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
593 8018221730 Enterobacter sp. CM29 Isolate Unclassified
594 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
595 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
596 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
597 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
598 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
599 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
600 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
601 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
602 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
603 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
604 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
605 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.02
Metatranscriptomes 0.46
Isolates 19.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0.09
Endosphere 5.22
Nodule 3.12
Rhizoplane 6.6
Rhizosphere 66.18
Stem 0.09
Stem Tuber 0.55
Unclassified 17.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2274192 2162886007 Bacteria 5709
2 SwRhRL2b_contig_2373311 2162886007 Bacteria 5215
3 SwRhRL2b_contig_3536331 2162886007 Bacteria 2787
4 JGI24740J21852_10005053 3300001979 Bacteria 5603
5 JGI24739J22299_10003298 3300001989 Bacteria 6150
6 JGI24739J22299_10003525 3300001989 Bacteria 5978
7 JGI24735J21928_10000661 3300002067 Bacteria 12202
8 JGI24735J21928_10001340 3300002067 Bacteria 8709
9 JGI24735J21928_10002079 3300002067 Bacteria 7060
10 JGI24735J21928_10003369 3300002067 Bacteria 5456
11 JGI25156J39149_1000472 3300002705 Bacteria 24254
12 JGI25156J39149_1003297 3300002705 Bacteria 5345
13 JGI25162J39368_1000009 3300002737 Bacteria 389795
14 JGI25162J39368_1003438 3300002737 Bacteria 4579
15 JGI25163J39215_1000112 3300002771 Bacteria 33836
16 JGI25164J39214_1000002 3300002772 Bacteria 406570
17 JGI25152J39213_1000258 3300002773 Bacteria 35248
18 JGI25165J46597_1000549 3300003214 Bacteria 34283
19 rootH2_10089152 3300003320 Bacteria 11949
20 Ga0055538_1000015 3300003751 Bacteria 311166
21 Ga0055539_1000009 3300003752 Bacteria 406566
22 Ga0055533_1000012 3300003756 Bacteria 406566
23 Ga0055533_1000304 3300003756 Bacteria 24463
24 Ga0055533_1003160 3300003756 Bacteria 3432
25 Ga0055532_1000039 3300003758 Bacteria 198049
26 Ga0055525_1000014 3300003759 Bacteria 406566
27 Ga0055527_1000024 3300003760 Bacteria 198049
28 Ga0055535_1000028 3300003761 Bacteria 198049
29 Ga0055542_1000047 3300003762 Bacteria 198049
30 Ga0055529_1000054 3300003763 Bacteria 198049
31 Ga0055531_10000078 3300003794 Bacteria 105599
32 Ga0055531_10000330 3300003794 Bacteria 46755
33 Ga0055541_1000006 3300003841 Bacteria 406566
34 Ga0058692_1000038 3300003856 Bacteria 140136
35 Ga0058692_1000101 3300003856 Bacteria 56780
36 Ga0058692_1000950 3300003856 Bacteria 11406
37 Ga0058692_1001279 3300003856 Bacteria 9556
38 Ga0058692_1001811 3300003856 Bacteria 7538
39 Ga0058692_1002584 3300003856 Bacteria 5991
40 Ga0058692_1003599 3300003856 Bacteria 4757
41 Ga0058692_1004459 3300003856 Bacteria 4142
42 Ga0058692_1004924 3300003856 Bacteria 3879
43 Ga0065704_10000297 3300005289 Bacteria 43486
44 Ga0065704_10000692 3300005289 Bacteria 25888
45 Ga0065704_10002081 3300005289 Bacteria 10006
46 Ga0065704_10002617 3300005289 Bacteria 9191
47 Ga0065704_10077307 3300005289 Bacteria 4784
48 Ga0070658_10005812 3300005327 Bacteria 9995
49 Ga0070658_10010343 3300005327 Bacteria 7483
50 Ga0070658_10081137 3300005327 Bacteria 2664
51 Ga0070683_100121973 3300005329 Bacteria 2463
52 Ga0070670_100048335 3300005331 Bacteria 3661
53 Ga0070677_10015625 3300005333 Bacteria 2690
54 Ga0070682_100000793 3300005337 Bacteria 18553
55 Ga0070682_100006254 3300005337 Bacteria 6678
56 Ga0068868_100168319 3300005338 Bacteria 1813
57 Ga0070660_100004620 3300005339 Bacteria 9531
58 Ga0070668_100009558 3300005347 Bacteria 7196
59 Ga0070668_100066843 3300005347 Bacteria 2791
60 Ga0070669_100000476 3300005353 Bacteria 30464
61 Ga0070669_100084764 3300005353 Bacteria 2365
62 Ga0070675_100008919 3300005354 Bacteria 7791
63 Ga0070675_100034221 3300005354 Bacteria 4122
64 Ga0070675_100098914 3300005354 Bacteria 2454
65 Ga0070674_100118659 3300005356 Bacteria 1955
66 Ga0070673_100004347 3300005364 Bacteria 8952
67 Ga0070688_100033877 3300005365 Bacteria 3089
68 Ga0070714_100026726 3300005435 Bacteria 4772
69 Ga0070705_100034077 3300005440 Bacteria 2844
70 Ga0070705_100071640 3300005440 Bacteria 2097
71 Ga0070700_100000738 3300005441 Bacteria 16152
72 Ga0070694_100013372 3300005444 Bacteria 5126
73 Ga0070708_100007105 3300005445 Bacteria 8934
74 Ga0070708_100090559 3300005445 Bacteria 2784
75 Ga0070681_10001390 3300005458 Bacteria 21220
76 Ga0070681_10042789 3300005458 Bacteria 4538
77 Ga0068867_100001861 3300005459 Bacteria 14665
78 Ga0070706_100000774 3300005467 Bacteria 35777
79 Ga0070706_100004075 3300005467 Bacteria 14209
80 Ga0070706_100098328 3300005467 Bacteria 2719
81 Ga0070707_100002619 3300005468 Bacteria 17103
82 Ga0070699_100015392 3300005518 Bacteria 6573
83 Ga0070699_100105771 3300005518 Bacteria 2468
84 Ga0070699_100132447 3300005518 Bacteria 2198
85 Ga0070679_100006620 3300005530 Bacteria 10800
86 Ga0070679_100226959 3300005530 Bacteria 1827
87 Ga0070679_100243167 3300005530 Bacteria 1757
88 Ga0070697_100004779 3300005536 Bacteria 10385
89 Ga0070672_100000456 3300005543 Bacteria 23773
90 Ga0070672_100000976 3300005543 Bacteria 17301
91 Ga0070695_100001230 3300005545 Bacteria 14075
92 Ga0070695_100008753 3300005545 Bacteria 6010
93 Ga0070695_100122562 3300005545 Bacteria 1781
94 Ga0070665_100003098 3300005548 Bacteria 17905
95 Ga0070665_100022454 3300005548 Bacteria 6351
96 Ga0070665_100118642 3300005548 Bacteria 2648
97 Ga0070665_100119565 3300005548 Bacteria 2637
98 Ga0070704_100136354 3300005549 Bacteria 1910
99 Ga0068855_100007173 3300005563 Bacteria 13525
100 Ga0068855_100020520 3300005563 Bacteria 7923
101 Ga0068855_100031239 3300005563 Bacteria 6361
102 Ga0068855_100074776 3300005563 Bacteria 3934
103 Ga0068855_100212064 3300005563 Bacteria 2175
104 Ga0070664_100197713 3300005564 Bacteria 1793
105 Ga0068857_100027883 3300005577 Bacteria 4980
106 Ga0068856_100005735 3300005614 Bacteria 12232
107 Ga0068856_100057170 3300005614 Bacteria 3850
108 Ga0070702_100106106 3300005615 Bacteria 1732
109 Ga0068859_100066499 3300005617 Bacteria 3640
110 Ga0068864_100018323 3300005618 Bacteria 5847
111 Ga0068864_100097498 3300005618 Bacteria 2603
112 Ga0068864_100110145 3300005618 Bacteria 2452
113 Ga0068866_10052783 3300005718 Bacteria 2076
114 Ga0068861_100006376 3300005719 Bacteria 8035
115 Ga0068861_100255464 3300005719 Bacteria 1498
116 Ga0068863_100067862 3300005841 Bacteria 3373
117 Ga0068858_100009422 3300005842 Bacteria 9316
118 Ga0068862_100003019 3300005844 Bacteria 14674
119 Ga0068862_100005097 3300005844 Bacteria 11051
120 Ga0081539_10000276 3300005985 Bacteria 117151
121 Ga0081539_10027422 3300005985 Bacteria 3609
122 Ga0075365_10000168 3300006038 Bacteria 20922
123 Ga0075364_10000919 3300006051 Bacteria 15563
124 Ga0070716_100023874 3300006173 Bacteria 3250
125 Ga0070712_100009232 3300006175 Bacteria 6211
126 Ga0075370_10000477 3300006353 Bacteria 15073
127 Ga0068871_100036920 3300006358 Bacteria 3893
128 Ga0068871_100098076 3300006358 Bacteria 2451
129 Ga0075428_100034587 3300006844 Bacteria 5572
130 Ga0075428_100152596 3300006844 Bacteria 2509
131 Ga0075431_100000212 3300006847 Bacteria 42845
132 Ga0075431_100036120 3300006847 Bacteria 5090
133 Ga0075433_10018521 3300006852 Bacteria 5791
134 Ga0075434_100000006 3300006871 Bacteria 96966
135 Ga0075434_100002612 3300006871 Bacteria 15887
136 Ga0075434_100286665 3300006871 Bacteria 1666
137 Ga0075429_100094063 3300006880 Bacteria 2614
138 Ga0068865_100186799 3300006881 Bacteria 1600
139 Ga0075436_100000111 3300006914 Bacteria 47863
140 Ga0097620_100066501 3300006931 Bacteria 3640
141 Ga0079104_1000083 3300006946 Bacteria 137254
142 Ga0079104_1000218 3300006946 Bacteria 80243
143 Ga0079104_1000263 3300006946 Bacteria 69767
144 Ga0079104_1000292 3300006946 Bacteria 63382
145 Ga0079104_1000716 3300006946 Bacteria 29970
146 Ga0079104_1000733 3300006946 Bacteria 29076
147 Ga0079104_1002054 3300006946 Bacteria 11666
148 Ga0075435_100007410 3300007076 Bacteria 7815
149 Ga0075435_100103023 3300007076 Bacteria 2367
150 Ga0075435_100199768 3300007076 Bacteria 1694
151 Ga0099794_10006613 3300007265 Bacteria 4707
152 Ga0105251_10000002 3300009011 Bacteria 350843
153 Ga0105251_10000285 3300009011 Bacteria 50961
154 Ga0105251_10000304 3300009011 Bacteria 49243
155 Ga0105251_10000470 3300009011 Bacteria 38359
156 Ga0105251_10000477 3300009011 Bacteria 37930
157 Ga0105251_10001242 3300009011 Bacteria 22091
158 Ga0105251_10001277 3300009011 Bacteria 21761
159 Ga0105251_10004030 3300009011 Bacteria 10351
160 Ga0105251_10004066 3300009011 Bacteria 10270
161 Ga0105251_10010168 3300009011 Bacteria 5485
162 Ga0105251_10013077 3300009011 Bacteria 4659
163 Ga0105251_10036211 3300009011 Bacteria 2430
164 Ga0105244_10000014 3300009036 Bacteria 257018
165 Ga0105244_10000015 3300009036 Bacteria 256814
166 Ga0105244_10000368 3300009036 Bacteria 41693
167 Ga0105244_10000411 3300009036 Bacteria 39919
168 Ga0105244_10002374 3300009036 Bacteria 14273
169 Ga0105244_10002576 3300009036 Bacteria 13611
170 Ga0105244_10003796 3300009036 Bacteria 10660
171 Ga0105244_10015097 3300009036 Bacteria 4439
172 Ga0105244_10027859 3300009036 Bacteria 3039
173 Ga0105244_10034576 3300009036 Bacteria 2659
174 Ga0105244_10037225 3300009036 Bacteria 2545
175 Ga0105244_10037690 3300009036 Bacteria 2526
176 Ga0105250_10000002 3300009092 Bacteria 566949
177 Ga0105250_10000072 3300009092 Bacteria 94689
178 Ga0105250_10000113 3300009092 Bacteria 72385
179 Ga0105250_10000806 3300009092 Bacteria 18828
180 Ga0105250_10000947 3300009092 Bacteria 17087
181 Ga0105250_10001578 3300009092 Bacteria 12245
182 Ga0105250_10003409 3300009092 Bacteria 7536
183 Ga0105240_10002811 3300009093 Bacteria 27492
184 Ga0111539_10002448 3300009094 Bacteria 24679
185 Ga0111539_10008156 3300009094 Bacteria 13342
186 Ga0111539_10011564 3300009094 Bacteria 11079
187 Ga0111539_10018887 3300009094 Bacteria 8529
188 Ga0111539_10068766 3300009094 Bacteria 4182
189 Ga0105245_10009110 3300009098 Bacteria 8653
190 Ga0105247_10000320 3300009101 Bacteria 43113
191 Ga0114129_10040553 3300009147 Bacteria 6563
192 Ga0114129_10220296 3300009147 Bacteria 2560
193 Ga0114129_10294103 3300009147 Bacteria 2166
194 Ga0114129_10447029 3300009147 Bacteria 1695
195 Ga0105243_10029166 3300009148 Bacteria 4242
196 Ga0105241_10000002 3300009174 Bacteria 869480
197 Ga0105241_10006567 3300009174 Bacteria 8573
198 Ga0105241_10104120 3300009174 Bacteria 2261
199 Ga0105242_10087887 3300009176 Bacteria 2610
200 Ga0105248_10048396 3300009177 Bacteria 4769
201 Ga0105237_10240995 3300009545 Bacteria 1809
202 Ga0105238_10091185 3300009551 Bacteria 3035
203 Ga0105249_10004941 3300009553 Bacteria 11506
204 Ga0105249_10067069 3300009553 Bacteria 3305
205 Ga0099796_10012954 3300010159 Bacteria 2370
206 Ga0105239_10001532 3300010375 Bacteria 30537
207 Ga0157373_10008163 3300013100 Bacteria 7783
208 Ga0157373_10008174 3300013100 Bacteria 7781
209 Ga0157373_10017295 3300013100 Bacteria 5249
210 Ga0157371_10000008 3300013102 Bacteria 393028
211 Ga0157371_10000782 3300013102 Bacteria 36580
212 Ga0157371_10001927 3300013102 Bacteria 20711
213 Ga0157371_10005800 3300013102 Bacteria 10334
214 Ga0157371_10028798 3300013102 Bacteria 4020
215 Ga0157371_10066978 3300013102 Bacteria 2542
216 Ga0157370_10002375 3300013104 Bacteria 22690
217 Ga0157370_10003134 3300013104 Bacteria 19581
218 Ga0157370_10007041 3300013104 Bacteria 12275
219 Ga0157370_10033077 3300013104 Bacteria 5042
220 Ga0157369_10001258 3300013105 Bacteria 31492
221 Ga0157369_10002784 3300013105 Bacteria 20879
222 Ga0157369_10021234 3300013105 Bacteria 7260
223 Ga0157369_10037413 3300013105 Bacteria 5313
224 Ga0157369_10090872 3300013105 Bacteria 3260
225 Ga0157369_10098110 3300013105 Bacteria 3125
226 Ga0157374_10000345 3300013296 Bacteria 42866
227 Ga0157374_10006893 3300013296 Bacteria 9667
228 Ga0157378_10067205 3300013297 Bacteria 3212
229 Ga0157378_10138472 3300013297 Bacteria 2258
230 Ga0163162_10010202 3300013306 Bacteria 9125
231 Ga0157372_10020335 3300013307 Bacteria 7160
232 Ga0157372_10022047 3300013307 Bacteria 6887
233 Ga0157372_10051752 3300013307 Bacteria 4571
234 Ga0157372_10062055 3300013307 Bacteria 4186
235 Ga0163163_10108683 3300014325 Bacteria 2801
236 Ga0157380_10008208 3300014326 Bacteria 7440
237 Ga0157380_10094703 3300014326 Bacteria 2472
238 Ga0182008_10002656 3300014497 Bacteria 11100
239 Ga0182008_10013829 3300014497 Bacteria 4239
240 Ga0157379_10087407 3300014968 Bacteria 2795
241 Ga0157376_10001401 3300014969 Bacteria 15849
242 Ga0182006_1000047 3300015261 Bacteria 187006
243 Ga0182006_1025506 3300015261 Bacteria 2427
244 Ga0182007_10006698 3300015262 Bacteria 4920
245 Ga0183366_1001 3300015679 Bacteria 2743932
246 Ga0183370_1001 3300015680 Bacteria 2743932
247 Ga0183369_1001 3300015685 Bacteria 2743932
248 Ga0183368_1001 3300015687 Bacteria 2743932
249 Ga0163161_10000001 3300017792 Bacteria 2041488
250 Ga0163161_10137989 3300017792 Bacteria 1845
251 Ga0206356_10035754 3300020070 Bacteria 5577
252 Ga0206353_10639345 3300020082 Bacteria 4121
253 Ga0213876_10000055 3300021384 Bacteria 136037
254 Ga0224712_10000018 3300022467 Bacteria 24692
255 Ga0209760_100120 3300025207 Bacteria 53842
256 Ga0209784_100001 3300025224 Bacteria 3600592
257 Ga0209566_100001 3300025225 Bacteria 3600765
258 Ga0209674_100002 3300025226 Bacteria 3600592
259 Ga0209674_100013 3300025226 Bacteria 813140
260 Ga0209674_100335 3300025226 Bacteria 28475
261 Ga0209672_100010 3300025228 Bacteria 873151
262 Ga0209672_101313 3300025228 Bacteria 9548
263 Ga0209147_100006 3300025229 Bacteria 873276
264 Ga0209563_100002 3300025230 Bacteria 2045675
265 Ga0209563_100543 3300025230 Bacteria 12683
266 Ga0209563_104507 3300025230 Bacteria 2651
267 Ga0207427_100020 3300025231 Bacteria 507515
268 Ga0209437_100001 3300025233 Bacteria 2045675
269 Ga0209437_100073 3300025233 Bacteria 302948
270 Ga0209258_100010 3300025242 Bacteria 873276
271 Ga0207425_1008939 3300025245 Bacteria 2524
272 Ga0209677_100002 3300025253 Bacteria 2045675
273 Ga0209148_1000018 3300025254 Bacteria 756247
274 Ga0209759_1000617 3300025256 Bacteria 34037
275 Ga0209759_1000927 3300025256 Bacteria 21233
276 Ga0209129_1000004 3300025258 Bacteria 884499
277 Ga0209233_1000135 3300025261 Bacteria 201057
278 Ga0209455_1000015 3300025272 Bacteria 756128
279 Ga0209676_1000089 3300025292 Bacteria 260196
280 Ga0209676_1003882 3300025292 Bacteria 8719
281 Ga0209050_1001636 3300025298 Bacteria 22933
282 Ga0209050_1019548 3300025298 Bacteria 2566
283 Ga0207426_1001597 3300025302 Bacteria 18065
284 Ga0209051_1030799 3300025303 Bacteria 2077
285 Ga0207697_10004020 3300025315 Bacteria 7128
286 Ga0207696_1000001 3300025711 Bacteria 2579611
287 Ga0207696_1000005 3300025711 Bacteria 642078
288 Ga0207696_1000042 3300025711 Bacteria 307256
289 Ga0207696_1000218 3300025711 Bacteria 83242
290 Ga0207696_1000292 3300025711 Bacteria 58466
291 Ga0207696_1001090 3300025711 Bacteria 15978
292 Ga0207696_1002437 3300025711 Bacteria 9130
293 Ga0207696_1018937 3300025711 Bacteria 2252
294 Ga0207655_1000001 3300025728 Bacteria 1866413
295 Ga0207655_1000009 3300025728 Bacteria 664676
296 Ga0207655_1000037 3300025728 Bacteria 354473
297 Ga0207655_1000061 3300025728 Bacteria 258893
298 Ga0207655_1000063 3300025728 Bacteria 257028
299 Ga0207655_1000069 3300025728 Bacteria 239968
300 Ga0207655_1000373 3300025728 Bacteria 63082
301 Ga0207655_1001029 3300025728 Bacteria 28136
302 Ga0207655_1001262 3300025728 Bacteria 24128
303 Ga0207655_1006842 3300025728 Bacteria 7490
304 Ga0207655_1009881 3300025728 Bacteria 5871
305 Ga0207655_1012198 3300025728 Bacteria 5046
306 Ga0207655_1020643 3300025728 Bacteria 3376
307 Ga0207655_1025369 3300025728 Bacteria 2880
308 Ga0207655_1030386 3300025728 Bacteria 2512
309 Ga0207713_1000001 3300025735 Bacteria 2295391
310 Ga0207713_1000002 3300025735 Bacteria 1061749
311 Ga0207713_1000003 3300025735 Bacteria 860698
312 Ga0207713_1000008 3300025735 Bacteria 553952
313 Ga0207713_1000016 3300025735 Bacteria 421689
314 Ga0207713_1000029 3300025735 Bacteria 285054
315 Ga0207713_1004098 3300025735 Bacteria 9602
316 Ga0207713_1010967 3300025735 Bacteria 4971
317 Ga0207713_1010995 3300025735 Bacteria 4963
318 Ga0207713_1014893 3300025735 Bacteria 4013
319 Ga0207682_10000918 3300025893 Bacteria 13664
320 Ga0207710_10000113 3300025900 Bacteria 102300
321 Ga0207647_10000967 3300025904 Bacteria 22285
322 Ga0207647_10023902 3300025904 Bacteria 4036
323 Ga0207645_10008977 3300025907 Bacteria 6942
324 Ga0207643_10003743 3300025908 Bacteria 8168
325 Ga0207643_10126312 3300025908 Bacteria 1519
326 Ga0207705_10022602 3300025909 Bacteria 4485
327 Ga0207705_10038189 3300025909 Bacteria 3437
328 Ga0207684_10012185 3300025910 Bacteria 7482
329 Ga0207684_10031880 3300025910 Bacteria 4484
330 Ga0207684_10032253 3300025910 Bacteria 4455
331 Ga0207684_10059800 3300025910 Bacteria 3236
332 Ga0207654_10000005 3300025911 Bacteria 869492
333 Ga0207707_10215815 3300025912 Bacteria 1670
334 Ga0207695_10006780 3300025913 Bacteria 14759
335 Ga0207662_10005515 3300025918 Bacteria 6756
336 Ga0207657_10002901 3300025919 Bacteria 18409
337 Ga0207652_10067965 3300025921 Bacteria 3091
338 Ga0207646_10048356 3300025922 Bacteria 3812
339 Ga0207646_10102705 3300025922 Bacteria 2563
340 Ga0207646_10220456 3300025922 Bacteria 1713
341 Ga0207694_10074742 3300025924 Bacteria 2652
342 Ga0207650_10009494 3300025925 Bacteria 6647
343 Ga0207650_10185341 3300025925 Bacteria 1660
344 Ga0207659_10034378 3300025926 Bacteria 3495
345 Ga0207659_10075285 3300025926 Bacteria 2476
346 Ga0207659_10228995 3300025926 Bacteria 1498
347 Ga0207687_10000100 3300025927 Bacteria 62488
348 Ga0207687_10005595 3300025927 Bacteria 8306
349 Ga0207664_10100333 3300025929 Bacteria 2390
350 Ga0207644_10045328 3300025931 Bacteria 3128
351 Ga0207706_10085899 3300025933 Bacteria 2766
352 Ga0207670_10043621 3300025936 Bacteria 2963
353 Ga0207704_10001490 3300025938 Bacteria 10490
354 Ga0207665_10017245 3300025939 Bacteria 4744
355 Ga0207691_10001622 3300025940 Bacteria 22341
356 Ga0207691_10041003 3300025940 Bacteria 4277
357 Ga0207691_10098706 3300025940 Bacteria 2608
358 Ga0207689_10014493 3300025942 Bacteria 6707
359 Ga0207679_10167298 3300025945 Bacteria 1806
360 Ga0207667_10001310 3300025949 Bacteria 31213
361 Ga0207667_10007729 3300025949 Bacteria 12853
362 Ga0207667_10012369 3300025949 Bacteria 9838
363 Ga0207667_10016418 3300025949 Bacteria 8369
364 Ga0207667_10232443 3300025949 Bacteria 1887
365 Ga0207651_10010746 3300025960 Bacteria 5088
366 Ga0207668_10026754 3300025972 Bacteria 3750
367 Ga0207703_10148540 3300026035 Bacteria 2041
368 Ga0207708_10001819 3300026075 Bacteria 15745
369 Ga0207702_10188218 3300026078 Bacteria 1905
370 Ga0207641_10024915 3300026088 Bacteria 4932
371 Ga0207641_10254521 3300026088 Bacteria 1641
372 Ga0207648_10000867 3300026089 Bacteria 34059
373 Ga0207648_10011667 3300026089 Bacteria 8270
374 Ga0207676_10001229 3300026095 Bacteria 19099
375 Ga0207674_10008117 3300026116 Bacteria 12168
376 Ga0207674_10046530 3300026116 Bacteria 4454
377 Ga0207675_100005679 3300026118 Bacteria 11939
378 Ga0207675_100035460 3300026118 Bacteria 4653
379 Ga0209281_1000001 3300027111 Bacteria 1933496
380 Ga0209281_1000003 3300027111 Bacteria 1260089
381 Ga0209281_1000006 3300027111 Bacteria 1170244
382 Ga0209281_1000130 3300027111 Bacteria 191756
383 Ga0209281_1000181 3300027111 Bacteria 146200
384 Ga0209281_1000287 3300027111 Bacteria 93918
385 Ga0209281_1000414 3300027111 Bacteria 64365
386 Ga0209281_1000494 3300027111 Bacteria 53600
387 Ga0209281_1000638 3300027111 Bacteria 38391
388 Ga0209281_1001424 3300027111 Bacteria 14249
389 Ga0209371_1000001 3300027312 Bacteria 2771503
390 Ga0209371_1000002 3300027312 Bacteria 1551985
391 Ga0209371_1000005 3300027312 Bacteria 1061740
392 Ga0209371_1000041 3300027312 Bacteria 340377
393 Ga0209371_1000093 3300027312 Bacteria 171050
394 Ga0209371_1000109 3300027312 Bacteria 141217
395 Ga0209371_1000124 3300027312 Bacteria 131108
396 Ga0209371_1000212 3300027312 Bacteria 80989
397 Ga0209371_1000627 3300027312 Bacteria 31397
398 Ga0209371_1001196 3300027312 Bacteria 18791
399 Ga0209371_1001431 3300027312 Bacteria 16269
400 Ga0209371_1007284 3300027312 Bacteria 3885
401 Ga0209371_1009235 3300027312 Bacteria 3153
402 Ga0209371_1013581 3300027312 Bacteria 2276
403 Ga0209969_1000332 3300027360 Bacteria 6312
404 Ga0209981_1002408 3300027378 Bacteria 2381
405 Ga0209996_1002544 3300027395 Bacteria 2259
406 Ga0210000_1000407 3300027462 Bacteria 5979
407 Ga0209995_1000410 3300027471 Bacteria 6670
408 Ga0209999_1005758 3300027543 Bacteria 2230
409 Ga0209983_1003166 3300027665 Bacteria 3532
410 Ga0209983_1008081 3300027665 Bacteria 2151
411 Ga0209971_1001442 3300027682 Bacteria 5915
412 Ga0209974_10002008 3300027876 Bacteria 7423
413 Ga0207428_10000879 3300027907 Bacteria 33736
414 Ga0207428_10019607 3300027907 Bacteria 5763
415 Ga0268266_10001737 3300028379 Bacteria 24933
416 Ga0268265_10001744 3300028380 Bacteria 17491
417 Ga0268265_10012058 3300028380 Bacteria 5852
418 Ga0268265_10188103 3300028380 Bacteria 1780
419 Ga0268264_10046259 3300028381 Bacteria 3614
420 Ga0307515_10032973 3300028794 Bacteria 8550
421 Ga0265338_10000183 3300028800 Bacteria 117272
422 Ga0268256_1000001 3300030500 Bacteria 2771065
423 Ga0268256_1000002 3300030500 Bacteria 1535763
424 Ga0268256_1000003 3300030500 Bacteria 1289401
425 Ga0268256_1000006 3300030500 Bacteria 1063991
426 Ga0268256_1000081 3300030500 Bacteria 171742
427 Ga0268256_1000239 3300030500 Bacteria 57839
428 Ga0268256_1000489 3300030500 Bacteria 33839
429 Ga0268256_1000680 3300030500 Bacteria 25587
430 Ga0268256_1001756 3300030500 Bacteria 12240
431 Ga0268256_1005443 3300030500 Bacteria 4991
432 Ga0268256_1007040 3300030500 Bacteria 4079
433 Ga0268256_1009746 3300030500 Bacteria 3153
434 Ga0268256_1018394 3300030500 Bacteria 1939
435 Ga0265330_10000306 3300031235 Bacteria 35320
436 Ga0265332_10000001 3300031238 Bacteria 863783
437 Ga0265332_10015042 3300031238 Bacteria 3419
438 Ga0265332_10027357 3300031238 Bacteria 2498
439 Ga0265328_10004600 3300031239 Bacteria 5977
440 Ga0265328_10045477 3300031239 Bacteria 1614
441 Ga0265320_10027272 3300031240 Bacteria 2981
442 Ga0265325_10004772 3300031241 Bacteria 8492
443 Ga0265329_10010183 3300031242 Bacteria 3467
444 Ga0265339_10003488 3300031249 Bacteria 10994
445 Ga0265331_10020455 3300031250 Bacteria 3397
446 Ga0265316_10019116 3300031344 Bacteria 5867
447 Ga0265316_10135303 3300031344 Bacteria 1854
448 Ga0307513_10000012 3300031456 Bacteria 328865
449 Ga0307408_100007103 3300031548 Bacteria 7412
450 Ga0307508_10080827 3300031616 Bacteria 2832
451 Ga0265314_10000001 3300031711 Bacteria 3792860
452 Ga0265314_10000022 3300031711 Bacteria 297299
453 Ga0265314_10000488 3300031711 Bacteria 51640
454 Ga0307516_10165819 3300031730 Bacteria 1954
455 Ga0307412_10000008 3300031911 Bacteria 461034
456 Ga0307412_10008095 3300031911 Bacteria 5990
457 Ga0307409_100048707 3300031995 Bacteria 3227
458 Ga0307416_100007037 3300032002 Bacteria 7101
459 Ga0316593_10002011 3300032168 Bacteria 4689
460 Ga0316593_10002668 3300032168 Bacteria 4286
461 Ga0373923_0004154 3300035111 Bacteria 4773
462 Ga0373936_0003572 3300035113 Bacteria 5854
463 Ga0373956_0042103 3300035119 Bacteria 2029
464 Ga0373955_0069961 3300035172 Bacteria 1959
465 Ga0373935_0069008 3300035692 Bacteria 2275
466 Ga0373937_0131486 3300036401 Bacteria 2337
467 Ga0395899_0000041 3300037312 Bacteria 255615
468 Ga0395899_0054347 3300037312 Bacteria 2963
469 Ga0395900_0000562 3300037418 Bacteria 51703
470 Ga0395900_0001108 3300037418 Bacteria 34263
471 Ga0395900_0014352 3300037418 Bacteria 8085
472 Ga0395900_0046261 3300037418 Bacteria 4481
473 Ga0395900_0105360 3300037418 Bacteria 2897
474 Ga0395900_0237352 3300037418 Bacteria 1830
475 Ga0395898_0000220 3300037466 Bacteria 146473
476 Ga0395898_0005659 3300037466 Bacteria 13476
477 Ga0395898_0010158 3300037466 Bacteria 9851
478 Ga0395898_0090044 3300037466 Bacteria 2952
479 Ga0395898_0238508 3300037466 Bacteria 1734
480 Ga0395905_0001029 3300037471 Bacteria 35545
481 Ga0395905_0004723 3300037471 Bacteria 14074
482 Ga0395905_0062446 3300037471 Bacteria 3485
483 Ga0395905_0063984 3300037471 Bacteria 3441
484 Ga0395905_0075130 3300037471 Bacteria 3167
485 Ga0395905_0194461 3300037471 Bacteria 1902
486 Ga0395905_0310534 3300037471 Bacteria 1465
487 Ga0395901_0000106 3300038443 Bacteria 114313
488 Ga0395901_0000264 3300038443 Bacteria 65306
489 Ga0395901_0050053 3300038443 Bacteria 4341
490 Ga0436365_0971002 3300039437 Bacteria 167792
491 Ga0439438_000001 3300041405 Bacteria 1263568
492 Ga0439438_002351 3300041405 Bacteria 8067
493 Ga0439466_0000009 3300041411 Bacteria 232657
494 Ga0439441_007472 3300042001 Bacteria 1761
495 Ga0439448_0000048 3300042005 Bacteria 19349
496 Ga0439452_000001 3300042010 Bacteria 1725439
497 Ga0439452_000002 3300042010 Bacteria 1377577
498 Ga0439452_000028 3300042010 Bacteria 204513
499 Ga0439452_000246 3300042010 Bacteria 37436
500 Ga0439452_000878 3300042010 Bacteria 13890
501 Ga0439463_020261 3300042016 Bacteria 1658
502 Ga0450907_000597 3300042146 Bacteria 9622
503 Ga0439444_0000735 3300042437 Bacteria 3883
504 Ga0439464_0010610 3300042439 Bacteria 2432
505 Ga0439460_0001606 3300042461 Bacteria 5350
506 Ga0451577_0001905 3300042876 Bacteria 26449
507 Ga0466969_0000178 3300044656 Bacteria 34152
508 Ga0466969_0007160 3300044656 Bacteria 5935
509 Ga0466977_0000005 3300044666 Bacteria 38551
510 Ga0466981_0000002 3300044669 Bacteria 313036
511 Ga0453683_0028670 3300044673 Bacteria 3524
512 Ga0466965_0000674 3300044683 Bacteria 12571
513 Ga0466965_0080997 3300044683 Bacteria 1641
514 Ga0466966_0000066 3300044684 Bacteria 69299
515 Ga0466966_0009862 3300044684 Bacteria 6331
516 Ga0466966_0011302 3300044684 Bacteria 5923
517 Ga0466966_0025775 3300044684 Bacteria 3840
518 Ga0466966_0028172 3300044684 Bacteria 3660
519 Ga0466966_0061841 3300044684 Bacteria 2361
520 Ga0466961_0000037 3300044693 Bacteria 80759
521 Ga0466961_0010650 3300044693 Bacteria 5869
522 Ga0466961_0012412 3300044693 Bacteria 5449
523 Ga0466961_0014465 3300044693 Bacteria 5067
524 Ga0466961_0059455 3300044693 Bacteria 2431
525 Ga0466963_0000836 3300044694 Bacteria 15434
526 Ga0466963_0014124 3300044694 Bacteria 4919
527 Ga0453684_0020522 3300044712 Bacteria 9957
528 Ga0466970_0013248 3300044765 Bacteria 4227
529 Ga0466957_0003499 3300044842 Bacteria 8627
530 Ga0466957_0008623 3300044842 Bacteria 5802
531 Ga0466957_0113767 3300044842 Bacteria 1719
532 Ga0466959_0006246 3300045049 Bacteria 8233
533 Ga0451576_0003527 3300045051 Bacteria 21348
534 Ga0451576_0266395 3300045051 Bacteria 1791
535 Ga0466958_0015896 3300045836 Bacteria 4325
536 Ga0466967_0008715 3300045976 Bacteria 7468
537 Ga0466967_0029575 3300045976 Bacteria 4587
538 Ga0466967_0220543 3300045976 Bacteria 1802
539 Ga0495617_006706 3300046452 Bacteria 4026
540 Ga0495627_000422 3300046453 Bacteria 36962
541 Ga0495592_0008691 3300046454 Bacteria 7624
542 Ga0495591_000013 3300046458 Bacteria 268106
543 Ga0495591_000100 3300046458 Bacteria 99473
544 Ga0495591_000763 3300046458 Bacteria 23259
545 Ga0495629_0005276 3300046459 Bacteria 9660
546 Ga0495638_0003120 3300046460 Bacteria 13125
547 Ga0495651_0004818 3300046462 Bacteria 10324
548 Ga0495653_0070331 3300046463 Bacteria 2619
549 Ga0495650_0000005 3300046471 Bacteria 766553
550 Ga0495650_0000043 3300046471 Bacteria 357197
551 Ga0495650_0000204 3300046471 Bacteria 129303
552 Ga0495650_0012027 3300046471 Bacteria 4684
553 Ga0495650_0044171 3300046471 Bacteria 1885
554 Ga0495580_0000894 3300046472 Bacteria 25943
555 Ga0495580_0002137 3300046472 Bacteria 17335
556 Ga0495580_0033151 3300046472 Bacteria 3722
557 Ga0495664_0000037 3300046477 Bacteria 70108
558 Ga0495664_0001086 3300046477 Bacteria 14056
559 Ga0495664_0063463 3300046477 Bacteria 2201
560 Ga0495584_0007246 3300046491 Bacteria 5788
561 Ga0495596_0006384 3300046500 Bacteria 5432
562 Ga0495596_0011981 3300046500 Bacteria 3722
563 Ga0495607_0000828 3300046501 Bacteria 29233
564 Ga0495607_0022682 3300046501 Bacteria 3939
565 Ga0495606_0002305 3300046507 Bacteria 22488
566 Ga0495606_0043213 3300046507 Bacteria 3007
567 Ga0495608_0001840 3300046511 Bacteria 15135
568 Ga0495610_0006548 3300046512 Bacteria 7973
569 Ga0495618_0003975 3300046514 Bacteria 9113
570 Ga0495620_0040052 3300046515 Bacteria 2065
571 Ga0495628_0002511 3300046516 Bacteria 16517
572 Ga0495628_0047853 3300046516 Bacteria 3390
573 Ga0495628_0070378 3300046516 Bacteria 2727
574 Ga0495630_0006847 3300046517 Bacteria 8124
575 Ga0495630_0015720 3300046517 Bacteria 5529
576 Ga0495632_0038190 3300046519 Bacteria 2432
577 Ga0495644_0002657 3300046523 Bacteria 7102
578 Ga0495648_0010354 3300046524 Bacteria 7106
579 Ga0495648_0025579 3300046524 Bacteria 3992
580 Ga0495666_0000702 3300046526 Bacteria 15197
581 Ga0495666_0007096 3300046526 Bacteria 5630
582 Ga0495666_0019406 3300046526 Bacteria 3373
583 Ga0495652_0004024 3300046529 Bacteria 14219
584 Ga0495654_0000041 3300046530 Bacteria 174733
585 Ga0495654_0000167 3300046530 Bacteria 64853
586 Ga0495654_0001461 3300046530 Bacteria 16174
587 Ga0495654_0028349 3300046530 Bacteria 2863
588 Ga0495665_0009029 3300046531 Bacteria 5408
589 Ga0495665_0045042 3300046531 Bacteria 2343
590 Ga0495640_0002107 3300046533 Bacteria 15872
591 Ga0495640_0004903 3300046533 Bacteria 10637
592 Ga0495640_0023260 3300046533 Bacteria 4519
593 Ga0495587_0002437 3300046536 Bacteria 12414
594 Ga0495587_0003186 3300046536 Bacteria 10969
595 Ga0495587_0016208 3300046536 Bacteria 4638
596 Ga0495597_0000768 3300046542 Bacteria 25372
597 Ga0495645_0059444 3300046543 Bacteria 2771
598 Ga0495622_0000190 3300046557 Bacteria 49410
599 Ga0495634_0002442 3300046642 Bacteria 15436
600 Ga0495634_0039150 3300046642 Bacteria 3230
601 Ga0495625_0002242 3300046660 Bacteria 21343
602 Ga0495625_0045423 3300046660 Bacteria 3175
603 Ga0495635_0004581 3300046663 Bacteria 9590
604 Ga0495657_0021700 3300046675 Bacteria 4605
605 Ga0495623_0053355 3300046679 Bacteria 2552
606 Ga0495646_0001486 3300046680 Bacteria 13941
607 Ga0495646_0036989 3300046680 Bacteria 3021
608 Ga0495613_0013934 3300046689 Bacteria 5966
609 Ga0495624_0003541 3300046690 Bacteria 11570
610 Ga0495624_0011860 3300046690 Bacteria 5977
611 Ga0495624_0034597 3300046690 Bacteria 3266
612 Ga0495649_0001040 3300046694 Bacteria 21746
613 Ga0495649_0057210 3300046694 Bacteria 2103
614 Ga0495589_0000001 3300046794 Bacteria 888100
615 Ga0495600_0001384 3300046809 Bacteria 13389
616 Ga0495600_0003796 3300046809 Bacteria 8947
617 Ga0495660_0000012 3300046810 Bacteria 350701
618 Ga0495660_0000048 3300046810 Bacteria 145350
619 Ga0495581_0005312 3300047315 Bacteria 7452
620 Ga0495604_0012258 3300047317 Bacteria 6814
621 Ga0495674_0019546 3300047319 Bacteria 6285
622 Ga0495674_0094282 3300047319 Bacteria 2553
623 Ga0495672_0000002 3300047320 Bacteria 740116
624 Ga0495672_0000020 3300047320 Bacteria 432845
625 Ga0495672_0000043 3300047320 Bacteria 266893
626 Ga0495672_0006394 3300047320 Bacteria 9147
627 Ga0495680_0070063 3300047322 Bacteria 2674
628 Ga0495683_0004345 3300047323 Bacteria 8073
629 Ga0495687_010663 3300047443 Bacteria 5019
630 Ga0495687_015601 3300047443 Bacteria 3856
631 Ga0495675_0001201 3300047444 Bacteria 15709
632 Ga0495675_0002377 3300047444 Bacteria 11241
633 Ga0495679_000018 3300047446 Bacteria 239433
634 Ga0495679_000416 3300047446 Bacteria 31556
635 Ga0495679_001650 3300047446 Bacteria 12436
636 Ga0495679_003580 3300047446 Bacteria 7416
637 Ga0495673_0000070 3300047469 Bacteria 217453
638 Ga0495673_0000167 3300047469 Bacteria 111793
639 Ga0495673_0005905 3300047469 Bacteria 7309
640 Ga0495681_0084723 3300047470 Bacteria 1409
641 Ga0495686_0000032 3300047472 Bacteria 345132
642 Ga0495602_0092898 3300048088 Bacteria 2498
643 Ga0495602_0138773 3300048088 Bacteria 1927
644 Ga0495614_0001603 3300048089 Bacteria 9829
645 Ga0496100_0027541 3300048903 Bacteria 3496
646 Ga0496101_0000055 3300048904 Bacteria 136176
647 Ga0496102_0003782 3300048905 Bacteria 12800
648 Ga0496102_0111644 3300048905 Bacteria 2548
649 Ga0496102_0368137 3300048905 Bacteria 1353
650 Ga0496104_0000091 3300048907 Bacteria 87834
651 Ga0496104_0014015 3300048907 Bacteria 7234
652 Ga0496105_0021709 3300048908 Bacteria 5196
653 Ga0496105_0042029 3300048908 Bacteria 3768
654 Ga0496105_0189091 3300048908 Bacteria 1684
655 Ga0496106_0007405 3300048909 Bacteria 8110
656 Ga0496108_0203778 3300048911 Bacteria 1717
657 Ga0496110_0007195 3300048913 Bacteria 8861
658 Ga0496112_0009530 3300048915 Bacteria 8759
659 Ga0496115_0000832 3300048918 Bacteria 22546
660 Ga0496116_0000001 3300048919 Bacteria 1501681
661 Ga0496116_0000066 3300048919 Bacteria 264035
662 Ga0496116_0000206 3300048919 Bacteria 112462
663 Ga0496116_0000305 3300048919 Bacteria 82397
664 Ga0496116_0000822 3300048919 Bacteria 39198
665 Ga0496116_0004122 3300048919 Bacteria 14002
666 Ga0496116_0009094 3300048919 Bacteria 8515
667 Ga0496116_0024574 3300048919 Bacteria 4450
668 Ga0496117_0000020 3300048920 Bacteria 458405
669 Ga0496117_0000022 3300048920 Bacteria 439512
670 Ga0496117_0000453 3300048920 Bacteria 68285
671 Ga0496117_0000643 3300048920 Bacteria 56275
672 Ga0496117_0001256 3300048920 Bacteria 37763
673 Ga0496117_0001475 3300048920 Bacteria 33818
674 Ga0496117_0002666 3300048920 Bacteria 22108
675 Ga0496117_0007030 3300048920 Bacteria 11140
676 Ga0496117_0008999 3300048920 Bacteria 9395
677 Ga0496117_0026654 3300048920 Bacteria 4518
678 Ga0496117_0026914 3300048920 Bacteria 4491
679 Ga0496117_0027043 3300048920 Bacteria 4476
680 Ga0496117_0042245 3300048920 Bacteria 3329
681 Ga0496117_0047339 3300048920 Bacteria 3084
682 Ga0496117_0053604 3300048920 Bacteria 2832
683 Ga0496118_0000007 3300048921 Bacteria 650986
684 Ga0496118_0000015 3300048921 Bacteria 551359
685 Ga0496118_0000085 3300048921 Bacteria 179731
686 Ga0496118_0000485 3300048921 Bacteria 65793
687 Ga0496118_0000688 3300048921 Bacteria 54924
688 Ga0496118_0002468 3300048921 Bacteria 24842
689 Ga0496118_0002758 3300048921 Bacteria 23065
690 Ga0496118_0012028 3300048921 Bacteria 8358
691 Ga0496118_0032975 3300048921 Bacteria 4257
692 Ga0496118_0041438 3300048921 Bacteria 3645
693 Ga0496119_0000001 3300048922 Bacteria 789520
694 Ga0496119_0000015 3300048922 Bacteria 312979
695 Ga0496119_0000039 3300048922 Bacteria 208631
696 Ga0496119_0002165 3300048922 Bacteria 22076
697 Ga0496119_0002195 3300048922 Bacteria 21817
698 Ga0496119_0004502 3300048922 Bacteria 13845
699 Ga0496119_0006694 3300048922 Bacteria 10593
700 Ga0496119_0011262 3300048922 Bacteria 7435
701 Ga0496119_0011306 3300048922 Bacteria 7412
702 Ga0496119_0018858 3300048922 Bacteria 5111
703 Ga0496119_0033360 3300048922 Bacteria 3413
704 Ga0496119_0035126 3300048922 Bacteria 3288
705 Ga0496119_0037672 3300048922 Bacteria 3137
706 Ga0496119_0042595 3300048922 Bacteria 2877
707 Ga0496119_0046177 3300048922 Bacteria 2723
708 Ga0496119_0067101 3300048922 Bacteria 2116
709 Ga0496120_0000002 3300048923 Bacteria 547999
710 Ga0496120_0000016 3300048923 Bacteria 307608
711 Ga0496120_0000029 3300048923 Bacteria 229859
712 Ga0496120_0000051 3300048923 Bacteria 186239
713 Ga0496120_0000092 3300048923 Bacteria 148990
714 Ga0496120_0000464 3300048923 Bacteria 63910
715 Ga0496120_0001569 3300048923 Bacteria 26742
716 Ga0496120_0003871 3300048923 Bacteria 13134
717 Ga0496120_0004907 3300048923 Bacteria 10889
718 Ga0496120_0005623 3300048923 Bacteria 9931
719 Ga0496120_0020437 3300048923 Bacteria 4208
720 Ga0496120_0032656 3300048923 Bacteria 3135
721 Ga0496120_0057626 3300048923 Bacteria 2185
722 Ga0496121_0002394 3300048924 Bacteria 28739
723 Ga0496121_0004747 3300048924 Bacteria 17937
724 Ga0496121_0005026 3300048924 Bacteria 17293
725 Ga0496121_0005621 3300048924 Bacteria 15973
726 Ga0496121_0014078 3300048924 Bacteria 8532
727 Ga0496121_0017594 3300048924 Bacteria 7285
728 Ga0496121_0039393 3300048924 Bacteria 4165
729 Ga0496122_0000005 3300048925 Bacteria 630659
730 Ga0496122_0000110 3300048925 Bacteria 190142
731 Ga0496122_0000545 3300048925 Bacteria 77927
732 Ga0496122_0001733 3300048925 Bacteria 33832
733 Ga0496122_0003163 3300048925 Bacteria 21971
734 Ga0496122_0015610 3300048925 Bacteria 7246
735 Ga0496122_0019153 3300048925 Bacteria 6272
736 Ga0496122_0031193 3300048925 Bacteria 4442
737 Ga0496122_0079740 3300048925 Bacteria 2286
738 Ga0496122_0087226 3300048925 Bacteria 2144
739 Ga0496123_0000008 3300048926 Bacteria 630628
740 Ga0496123_0000081 3300048926 Bacteria 190142
741 Ga0496123_0000189 3300048926 Bacteria 124719
742 Ga0496123_0001180 3300048926 Bacteria 38508
743 Ga0496123_0002644 3300048926 Bacteria 21675
744 Ga0496123_0002658 3300048926 Bacteria 21604
745 Ga0496123_0004613 3300048926 Bacteria 14336
746 Ga0496123_0004727 3300048926 Bacteria 14097
747 Ga0496123_0015411 3300048926 Bacteria 6272
748 Ga0496123_0022545 3300048926 Bacteria 4849
749 Ga0496123_0079637 3300048926 Bacteria 2001
750 Ga0496124_0000066 3300048927 Bacteria 222815
751 Ga0496124_0000195 3300048927 Bacteria 119909
752 Ga0496124_0000199 3300048927 Bacteria 118647
753 Ga0496124_0000425 3300048927 Bacteria 75572
754 Ga0496124_0001064 3300048927 Bacteria 43365
755 Ga0496124_0002919 3300048927 Bacteria 21557
756 Ga0496124_0007879 3300048927 Bacteria 11220
757 Ga0496124_0011263 3300048927 Bacteria 8956
758 Ga0496124_0017696 3300048927 Bacteria 6707
759 Ga0496124_0041785 3300048927 Bacteria 3953
760 Ga0496124_0059103 3300048927 Bacteria 3221
761 Ga0496124_0063517 3300048927 Bacteria 3084
762 Ga0496125_0000009 3300048928 Bacteria 677678
763 Ga0496125_0000017 3300048928 Bacteria 508217
764 Ga0496125_0000033 3300048928 Bacteria 351850
765 Ga0496125_0011441 3300048928 Bacteria 8873
766 Ga0496125_0115379 3300048928 Bacteria 1931
767 Ga0496126_0000420 3300048929 Bacteria 85425
768 Ga0496126_0000669 3300048929 Bacteria 63371
769 Ga0496126_0001084 3300048929 Bacteria 45796
770 Ga0496126_0001223 3300048929 Bacteria 41744
771 Ga0496126_0002308 3300048929 Bacteria 26193
772 Ga0496126_0014745 3300048929 Bacteria 7885
773 Ga0496126_0023471 3300048929 Bacteria 5977
774 Ga0495678_000354 3300049459 Bacteria 47217
775 Ga0495682_0000001 3300049460 Bacteria 1559116
776 Ga0501031_0012306 3300049568 Bacteria 5578
777 Ga0501031_0110400 3300049568 Bacteria 1796
778 Ga0501032_0023797 3300049569 Bacteria 4229
779 Ga0501033_0003107 3300049570 Bacteria 13782
780 Ga0501034_0000209 3300049571 Bacteria 111455
781 Ga0501034_0016258 3300049571 Bacteria 7637
782 Ga0501034_0081379 3300049571 Bacteria 3241
783 Ga0501036_0019447 3300049572 Bacteria 5702
784 Ga0501037_0010133 3300049573 Bacteria 6917
785 Ga0501038_0000827 3300049574 Bacteria 27559
786 Ga0501038_0000972 3300049574 Bacteria 25704
787 Ga0501038_0001518 3300049574 Bacteria 21375
788 Ga0501038_0065637 3300049574 Bacteria 3092
789 Ga0501038_0127638 3300049574 Bacteria 2092
790 Ga0501039_0000686 3300049575 Bacteria 24376
791 Ga0501039_0058628 3300049575 Bacteria 2982
792 Ga0501039_0095875 3300049575 Bacteria 2313
793 Ga0501040_0000627 3300049576 Bacteria 21539
794 Ga0501040_0028228 3300049576 Bacteria 3782
795 Ga0501040_0083074 3300049576 Bacteria 2221
796 Ga0501041_0000061 3300049577 Bacteria 40487
797 Ga0501041_0026485 3300049577 Bacteria 3489
798 Ga0501042_0002672 3300049578 Bacteria 10976
799 Ga0501046_0002154 3300049580 Bacteria 18584
800 Ga0501046_0086686 3300049580 Bacteria 2413
801 Ga0501046_0109640 3300049580 Bacteria 2110
802 Ga0501047_0016231 3300049581 Bacteria 7104
803 Ga0501048_0000204 3300049582 Bacteria 38757
804 Ga0501068_0094028 3300049584 Bacteria 1852
805 Ga0501070_0001974 3300049586 Bacteria 18103
806 Ga0501070_0008795 3300049586 Bacteria 8538
807 Ga0501071_0000332 3300049587 Bacteria 22804
808 Ga0501072_0002557 3300049588 Bacteria 13634
809 Ga0501072_0014020 3300049588 Bacteria 6142
810 Ga0501072_0029323 3300049588 Bacteria 4298
811 Ga0501073_0025893 3300049589 Bacteria 4203
812 Ga0501074_0005475 3300049590 Bacteria 9135
813 Ga0501074_0010286 3300049590 Bacteria 6791
814 Ga0501075_0000195 3300049591 Bacteria 31966
815 Ga0501075_0001008 3300049591 Bacteria 18004
816 Ga0501075_0065579 3300049591 Bacteria 2740
817 Ga0501076_0000012 3300049592 Bacteria 113396
818 Ga0501076_0000301 3300049592 Bacteria 30794
819 Ga0501076_0002352 3300049592 Bacteria 12934
820 Ga0501077_0000664 3300049593 Bacteria 20826
821 Ga0501079_0001433 3300049741 Bacteria 16836
822 Ga0501079_0006856 3300049741 Bacteria 8580
823 Ga0501079_0038923 3300049741 Bacteria 3667
824 Ga0501080_0020977 3300049742 Bacteria 6046
825 Ga0501080_0038372 3300049742 Bacteria 4472
826 Ga0501080_0143947 3300049742 Bacteria 2203
827 Ga0501080_0271531 3300049742 Bacteria 1543
828 Ga0501081_0000061 3300049743 Bacteria 42076
829 Ga0501081_0010331 3300049743 Bacteria 6092
830 Ga0501081_0037249 3300049743 Bacteria 3318
831 Ga0501081_0071466 3300049743 Bacteria 2419
832 Ga0501081_0160876 3300049743 Bacteria 1618
833 Ga0501083_0044026 3300049744 Bacteria 3022
834 Ga0501267_001405 3300049764 Bacteria 2059
835 Ga0501035_0006914 3300049822 Bacteria 10596
836 Ga0501044_0045943 3300049823 Bacteria 4523
837 Ga0501045_0007570 3300049824 Bacteria 7548
838 Ga0501045_0164895 3300049824 Bacteria 1650
839 nmdc:mga00v17_12685_c1 3300050491 Bacteria 4654
840 nmdc:mga0k408_7552_c1 3300050493 Bacteria 5807
841 nmdc:mga0k408_92354_c1 3300050493 Bacteria 1779
842 nmdc:mga07m45_22888_c1 3300050496 Bacteria 3413
843 nmdc:mga05p37_151206_c1 3300050507 Bacteria 2839
844 nmdc:mga09592_47852_c1 3300050508 Bacteria 3604
845 nmdc:mga0qj67_67514_c1 3300050509 Bacteria 2849
846 nmdc:mga06r32_216205_c1 3300050510 Bacteria 1904
847 nmdc:mga06r32_270_c1 3300050510 Bacteria 43060
848 nmdc:mga08y16_144039_c1 3300050511 Bacteria 2477
849 nmdc:mga08y16_15446_c2 3300050511 Bacteria 3554
850 nmdc:mga08y16_1648_c1 3300050511 Bacteria 22611
851 nmdc:mga08y16_208195_c1 3300050511 Bacteria 2026
852 nmdc:mga08y16_6769_c1 3300050511 Bacteria 12024
853 nmdc:mga08y16_70814_c1 3300050511 Bacteria 3634
854 nmdc:mga0n895_44775_c1 3300050512 Bacteria 4316
855 nmdc:mga0n895_490_c1 3300050512 Bacteria 26780
856 nmdc:mga0n895_66446_c1 3300050512 Bacteria 3571
857 nmdc:mga0rr50_44288_c1 3300050513 Bacteria 3263
858 nmdc:mga0rr50_887_c1 3300050513 Bacteria 16191
859 nmdc:mga0rr50_96420_c1 3300050513 Bacteria 2314
860 nmdc:mga08x19_18760_c1 3300050514 Bacteria 4240
861 nmdc:mga08x19_29490_c1 3300050514 Bacteria 3441
862 nmdc:mga08x19_401_c1 3300050514 Bacteria 30460
863 nmdc:mga0a205_17252_c1 3300050515 Bacteria 6764
864 nmdc:mga0a205_3886_c1 3300050515 Bacteria 13376
865 nmdc:mga0a205_647_c2 3300050515 Bacteria 6303
866 Ga0495595_0036958 3300053084 Bacteria 2218
867 Ga0500621_000003 3300053126 Bacteria 596975
868 Ga0501084_0000706 3300054114 Bacteria 25545
869 Ga0501084_0060319 3300054114 Bacteria 3176
870 Ga0501084_0061690 3300054114 Bacteria 3139
871 Ga0501082_0000471 3300060353 Bacteria 35550
872 Ga0501082_0001139 3300060353 Bacteria 23451
873 Ga0501082_0020106 3300060353 Bacteria 5754
874 Ga0466962_0000578 3300061719 Bacteria 16112
875 Ga0466962_0015614 3300061719 Bacteria 3661
876 Ga0530510_0000015 3300061734 Bacteria 104554
877 Ga0530510_0000947 3300061734 Bacteria 19139
878 Ga0530510_0001871 3300061734 Bacteria 14378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0368137 Ga0496102_0368137_10_1224 404
2 3300047470 Ga0495681_0084723 Ga0495681_0084723_26_1246 405
3 3300035119 Ga0373956_0042103 Ga0373956_0042103_783_2006 407
4 3300036401 Ga0373937_0131486 Ga0373937_0131486_18_1241 407
5 iso_pu_bacteria 2547132416 2548651212 408
6 iso_pu_bacteria 2847085930 2847087735 421
7 3300005445 Ga0070708_100090559 Ga0070708_1000905593 423
8 3300005467 Ga0070706_100098328 Ga0070706_1000983282 423
9 3300025922 Ga0207646_10048356 Ga0207646_100483562 423
10 3300037471 Ga0395905_0310534 Ga0395905_0310534_167_1441 424
11 3300031995 Ga0307409_100048707 Ga0307409_1000487072 429
12 3300005841 Ga0068863_100067862 Ga0068863_1000678624 432
13 3300006175 Ga0070712_100009232 Ga0070712_1000092322 432
14 3300005467 Ga0070706_100000774 Ga0070706_10000077412 439
15 3300025910 Ga0207684_10012185 Ga0207684_100121854 439
16 3300028381 Ga0268264_10046259 Ga0268264_100462591 439
17 3300044666 Ga0466977_0000005 Ga0466977_0000005_5483_6859 439
18 3300031730 Ga0307516_10165819 Ga0307516_101658191 441
19 3300047443 Ga0495687_015601 Ga0495687_015601_1788_3203 442
20 3300025922 Ga0207646_10220456 Ga0207646_102204562 443
21 3300044683 Ga0466965_0080997 Ga0466965_0080997_125_1504 443
22 3300049592 Ga0501076_0002352 Ga0501076_0002352_11586_12920 444
23 3300031616 Ga0307508_10080827 Ga0307508_100808272 445
24 3300046660 Ga0495625_0045423 Ga0495625_0045423_671_2086 445
25 3300046519 Ga0495632_0038190 Ga0495632_0038190_888_2303 446
26 3300050493 nmdc:mga0k408_92354_c1 nmdc:mga0k408_92354_c1_36_1454 446
27 3300044693 Ga0466961_0010650 Ga0466961_0010650_1486_2886 450
28 3300061719 Ga0466962_0015614 Ga0466962_0015614_1246_2646 450
29 3300005615 Ga0070702_100106106 Ga0070702_1001061061 451
30 3300025910 Ga0207684_10059800 Ga0207684_100598002 451
31 3300025927 Ga0207687_10000100 Ga0207687_1000010033 452
32 3300005468 Ga0070707_100002619 Ga0070707_1000026195 454
33 3300009011 Ga0105251_10000477 Ga0105251_1000047738 454
34 3300009036 Ga0105244_10003796 Ga0105244_100037966 454
35 3300009092 Ga0105250_10000072 Ga0105250_1000007222 454
36 3300046810 Ga0495660_0000012 Ga0495660_0000012_264652_266019 454
37 3300048908 Ga0496105_0189091 Ga0496105_0189091_26_1393 454
38 3300048918 Ga0496115_0000832 Ga0496115_0000832_14601_15965 454
39 3300048919 Ga0496116_0000066 Ga0496116_0000066_80544_81911 454
40 3300048928 Ga0496125_0000033 Ga0496125_0000033_185784_187151 454
41 3300003320 rootH2_10089152 rootH2_1008915212 455
42 3300041405 Ga0439438_002351 Ga0439438_002351_6345_7739 456
43 3300005545 Ga0070695_100122562 Ga0070695_1001225621 457
44 3300044693 Ga0466961_0014465 Ga0466961_0014465_2921_4294 457
45 iso_pu_bacteria 2643221585 2643935319 457
46 iso_pu_bacteria 2643221656 2644317101 457
47 iso_pu_bacteria 2900577576 2900582905 457
48 iso_pu_bacteria 2919704043 2919704785 457
49 iso_pu_bacteria 2928058823 2928059272 457
50 3300003856 Ga0058692_1003599 Ga0058692_10035992 458
51 3300015261 Ga0182006_1000047 Ga0182006_100004733 458
52 3300042010 Ga0439452_000002 Ga0439452_000002_1222835_1224238 458
53 3300044656 Ga0466969_0000178 Ga0466969_0000178_11399_12775 458
54 3300044683 Ga0466965_0000674 Ga0466965_0000674_10869_12245 458
55 3300044684 Ga0466966_0011302 Ga0466966_0011302_3828_5204 458
56 3300044694 Ga0466963_0000836 Ga0466963_0000836_12761_14137 458
57 3300044765 Ga0466970_0013248 Ga0466970_0013248_2686_4062 458
58 3300044842 Ga0466957_0008623 Ga0466957_0008623_4332_5708 458
59 3300045976 Ga0466967_0029575 Ga0466967_0029575_2864_4240 458
60 3300046452 Ga0495617_006706 Ga0495617_006706_2091_3488 458
61 3300046458 Ga0495591_000013 Ga0495591_000013_92812_94209 458
62 3300046477 Ga0495664_0000037 Ga0495664_0000037_30255_31631 458
63 3300046530 Ga0495654_0000041 Ga0495654_0000041_96935_98332 458
64 3300046531 Ga0495665_0045042 Ga0495665_0045042_424_1800 458
65 3300047319 Ga0495674_0019546 Ga0495674_0019546_3571_4947 458
66 3300048926 Ga0496123_0022545 Ga0496123_0022545_3360_4736 458
67 3300061719 Ga0466962_0000578 Ga0466962_0000578_9106_10482 458
68 iso_pu_bacteria 2596583598 2597030511 458
69 iso_pu_bacteria 2721755763 2723879883 458
70 3300006038 Ga0075365_10000168 Ga0075365_1000016813 459
71 3300006173 Ga0070716_100023874 Ga0070716_1000238742 459
72 3300009094 Ga0111539_10068766 Ga0111539_100687663 459
73 3300009147 Ga0114129_10220296 Ga0114129_102202963 459
74 3300009174 Ga0105241_10104120 Ga0105241_101041202 459
75 3300010159 Ga0099796_10012954 Ga0099796_100129542 459
76 3300013105 Ga0157369_10090872 Ga0157369_100908722 459
77 3300014969 Ga0157376_10001401 Ga0157376_1000140110 459
78 3300025933 Ga0207706_10085899 Ga0207706_100858993 459
79 3300025939 Ga0207665_10017245 Ga0207665_100172454 459
80 3300037418 Ga0395900_0014352 Ga0395900_0014352_2930_4309 459
81 3300037466 Ga0395898_0005659 Ga0395898_0005659_950_2329 459
82 3300037471 Ga0395905_0004723 Ga0395905_0004723_426_1805 459
83 3300037471 Ga0395905_0063984 Ga0395905_0063984_168_1547 459
84 3300037471 Ga0395905_0075130 Ga0395905_0075130_1583_2962 459
85 3300044656 Ga0466969_0007160 Ga0466969_0007160_1113_2495 459
86 3300044684 Ga0466966_0025775 Ga0466966_0025775_268_1653 459
87 3300044684 Ga0466966_0028172 Ga0466966_0028172_1648_3027 459
88 3300044693 Ga0466961_0000037 Ga0466961_0000037_42527_43906 459
89 3300044693 Ga0466961_0059455 Ga0466961_0059455_926_2308 459
90 3300045049 Ga0466959_0006246 Ga0466959_0006246_1113_2495 459
91 3300045976 Ga0466967_0220543 Ga0466967_0220543_86_1465 459
92 3300046454 Ga0495592_0008691 Ga0495592_0008691_2146_3528 459
93 3300046459 Ga0495629_0005276 Ga0495629_0005276_5399_6781 459
94 3300046462 Ga0495651_0004818 Ga0495651_0004818_2838_4220 459
95 3300046463 Ga0495653_0070331 Ga0495653_0070331_560_1942 459
96 3300046471 Ga0495650_0012027 Ga0495650_0012027_2827_4209 459
97 3300046472 Ga0495580_0000894 Ga0495580_0000894_5912_7294 459
98 3300046477 Ga0495664_0001086 Ga0495664_0001086_8652_10034 459
99 3300046500 Ga0495596_0006384 Ga0495596_0006384_1024_2406 459
100 3300046507 Ga0495606_0043213 Ga0495606_0043213_1281_2663 459
101 3300046511 Ga0495608_0001840 Ga0495608_0001840_1089_2471 459
102 3300046512 Ga0495610_0006548 Ga0495610_0006548_1938_3320 459
103 3300046514 Ga0495618_0003975 Ga0495618_0003975_3157_4539 459
104 3300046516 Ga0495628_0047853 Ga0495628_0047853_1690_3072 459
105 3300046517 Ga0495630_0015720 Ga0495630_0015720_3631_5013 459
106 3300046526 Ga0495666_0007096 Ga0495666_0007096_2004_3386 459
107 3300046529 Ga0495652_0004024 Ga0495652_0004024_6511_7893 459
108 3300046531 Ga0495665_0009029 Ga0495665_0009029_115_1497 459
109 3300046533 Ga0495640_0002107 Ga0495640_0002107_1830_3212 459
110 3300046533 Ga0495640_0004903 Ga0495640_0004903_8961_10343 459
111 3300046536 Ga0495587_0002437 Ga0495587_0002437_1035_2417 459
112 3300046557 Ga0495622_0000190 Ga0495622_0000190_14797_16179 459
113 3300046642 Ga0495634_0002442 Ga0495634_0002442_7909_9291 459
114 3300046642 Ga0495634_0039150 Ga0495634_0039150_284_1666 459
115 3300046663 Ga0495635_0004581 Ga0495635_0004581_4937_6319 459
116 3300046679 Ga0495623_0053355 Ga0495623_0053355_432_1814 459
117 3300046680 Ga0495646_0001486 Ga0495646_0001486_7980_9362 459
118 3300046680 Ga0495646_0036989 Ga0495646_0036989_1480_2862 459
119 3300046690 Ga0495624_0003541 Ga0495624_0003541_7481_8863 459
120 3300046690 Ga0495624_0034597 Ga0495624_0034597_214_1596 459
121 3300046694 Ga0495649_0057210 Ga0495649_0057210_472_1854 459
122 3300046809 Ga0495600_0001384 Ga0495600_0001384_5293_6675 459
123 3300047315 Ga0495581_0005312 Ga0495581_0005312_145_1527 459
124 3300047317 Ga0495604_0012258 Ga0495604_0012258_2344_3726 459
125 3300047322 Ga0495680_0070063 Ga0495680_0070063_615_1997 459
126 3300047443 Ga0495687_010663 Ga0495687_010663_2352_3734 459
127 3300047444 Ga0495675_0001201 Ga0495675_0001201_12638_14020 459
128 3300047444 Ga0495675_0002377 Ga0495675_0002377_6459_7841 459
129 3300047446 Ga0495679_001650 Ga0495679_001650_3204_4586 459
130 3300047469 Ga0495673_0005905 Ga0495673_0005905_3892_5274 459
131 3300048088 Ga0495602_0138773 Ga0495602_0138773_447_1829 459
132 3300048089 Ga0495614_0001603 Ga0495614_0001603_2121_3503 459
133 3300048920 Ga0496117_0007030 Ga0496117_0007030_5922_7304 459
134 3300048920 Ga0496117_0042245 Ga0496117_0042245_418_1800 459
135 3300048921 Ga0496118_0032975 Ga0496118_0032975_2640_4022 459
136 3300048929 Ga0496126_0001223 Ga0496126_0001223_12935_14317 459
137 3300048929 Ga0496126_0002308 Ga0496126_0002308_18604_19986 459
138 3300049575 Ga0501039_0095875 Ga0501039_0095875_803_2212 459
139 3300050508 nmdc:mga09592_47852_c1 nmdc:mga09592_47852_c1_593_1978 459
140 3300050509 nmdc:mga0qj67_67514_c1 nmdc:mga0qj67_67514_c1_607_1992 459
141 3300050511 nmdc:mga08y16_70814_c1 nmdc:mga08y16_70814_c1_1042_2427 459
142 iso_pu_bacteria 2599185292 2599906449 459
143 iso_pu_bacteria 2643221665 2644361345 459
144 iso_pu_bacteria 2791354903 2791921257 459
145 iso_pu_bacteria 2858950400 2858955908 459
146 iso_pu_bacteria 2923525760 2923529717 459
147 iso_pu_bacteria 2939607340 2939607560 459
148 iso_pu_bacteria 2939631187 2939635562 459
149 iso_pu_bacteria 2941479691 2941485208 459
150 3300005364 Ga0070673_100004347 Ga0070673_1000043475 460
151 3300005440 Ga0070705_100034077 Ga0070705_1000340772 460
152 3300005444 Ga0070694_100013372 Ga0070694_1000133725 460
153 3300005458 Ga0070681_10042789 Ga0070681_100427892 460
154 3300005467 Ga0070706_100004075 Ga0070706_1000040753 460
155 3300005545 Ga0070695_100008753 Ga0070695_1000087534 460
156 3300005617 Ga0068859_100066499 Ga0068859_1000664992 460
157 3300005618 Ga0068864_100097498 Ga0068864_1000974983 460
158 3300006871 Ga0075434_100286665 Ga0075434_1002866652 460
159 3300006931 Ga0097620_100066501 Ga0097620_1000665012 460
160 3300007076 Ga0075435_100199768 Ga0075435_1001997682 460
161 3300009147 Ga0114129_10040553 Ga0114129_100405534 460
162 3300025910 Ga0207684_10031880 Ga0207684_100318802 460
163 3300025912 Ga0207707_10215815 Ga0207707_102158152 460
164 3300025936 Ga0207670_10043621 Ga0207670_100436212 460
165 3300025960 Ga0207651_10010746 Ga0207651_100107466 460
166 3300026116 Ga0207674_10046530 Ga0207674_100465307 460
167 3300042001 Ga0439441_007472 Ga0439441_007472_147_1529 460
168 3300048929 Ga0496126_0023471 Ga0496126_0023471_2599_3987 460
169 3300050513 nmdc:mga0rr50_96420_c1 nmdc:mga0rr50_96420_c1_910_2298 460
170 3300050515 nmdc:mga0a205_17252_c1 nmdc:mga0a205_17252_c1_5203_6591 460
171 iso_pu_bacteria 2506520007 2506578296 460
172 iso_pu_bacteria 2506520008 2506583434 460
173 iso_pu_bacteria 2508501071 2508852305 460
174 iso_pu_bacteria 2508501125 2509131418 460
175 iso_pu_bacteria 2510065045 2510251820 460
176 iso_pu_bacteria 2511231025 2511382785 460
177 iso_pu_bacteria 2511231035 2511437676 460
178 iso_pu_bacteria 2513237151 2513961433 460
179 iso_pu_bacteria 2513237166 2514053344 460
180 iso_pu_bacteria 2515154122 2515684302 460
181 iso_pu_bacteria 2526164713 2527080676 460
182 iso_pu_bacteria 2537561728 2538424791 460
183 iso_pu_bacteria 2547132181 2547695232 460
184 iso_pu_bacteria 2554235234 2555257580 460
185 iso_pu_bacteria 2561511199 2562462905 460
186 iso_pu_bacteria 2585427591 2585830196 460
187 iso_pu_bacteria 2585427592 2585832884 460
188 iso_pu_bacteria 2599185169 2599409609 460
189 iso_pu_bacteria 2599185299 2599925591 460
190 iso_pu_bacteria 2600255067 2600810841 460
191 iso_pu_bacteria 2600255254 2601521897 460
192 iso_pu_bacteria 2600255255 2601526922 460
193 iso_pu_bacteria 2600255256 2601532439 460
194 iso_pu_bacteria 2600255257 2601537809 460
195 iso_pu_bacteria 2600255280 2601613752 460
196 iso_pu_bacteria 2600255281 2601618475 460
197 iso_pu_bacteria 2600255287 2601642896 460
198 iso_pu_bacteria 2600255288 2601647768 460
199 iso_pu_bacteria 2600255289 2601651900 460
200 iso_pu_bacteria 2600255290 2601657227 460
201 iso_pu_bacteria 2600255291 2601662717 460
202 iso_pu_bacteria 2600255298 2601695674 460
203 iso_pu_bacteria 2600255299 2601700350 460
204 iso_pu_bacteria 2600255300 2601705024 460
205 iso_pu_bacteria 2600255301 2601710053 460
206 iso_pu_bacteria 2600255302 2601715065 460
207 iso_pu_bacteria 2600255303 2601720701 460
208 iso_pu_bacteria 2600255304 2601725471 460
209 iso_pu_bacteria 2600255305 2601730013 460
210 iso_pu_bacteria 2600255306 2601735030 460
211 iso_pu_bacteria 2600255307 2601739715 460
212 iso_pu_bacteria 2600255309 2601750204 460
213 iso_pu_bacteria 2600255310 2601756535 460
214 iso_pu_bacteria 2600255311 2601762984 460
215 iso_pu_bacteria 2600255392 2602017457 460
216 iso_pu_bacteria 2602042046 2603638118 460
217 iso_pu_bacteria 2602042047 2603642615 460
218 iso_pu_bacteria 2602042052 2603660091 460
219 iso_pu_bacteria 2602042053 2603665367 460
220 iso_pu_bacteria 2602042066 2603698341 460
221 iso_pu_bacteria 2602042067 2603703208 460
222 iso_pu_bacteria 2602042103 2603837397 460
223 iso_pu_bacteria 2602042104 2603842473 460
224 iso_pu_bacteria 2602042105 2603847546 460
225 iso_pu_bacteria 2602042106 2603852617 460
226 iso_pu_bacteria 2602042109 2603866598 460
227 iso_pu_bacteria 2602042110 2603870670 460
228 iso_pu_bacteria 2602042111 2603875606 460
229 iso_pu_bacteria 2603880178 2606047861 460
230 iso_pu_bacteria 2603880184 2606069798 460
231 iso_pu_bacteria 2603880202 2606145634 460
232 iso_pu_bacteria 2603880211 2606175263 460
233 iso_pu_bacteria 2608642108 2608669387 460
234 iso_pu_bacteria 2609459761 2609913417 460
235 iso_pu_bacteria 2636415599 2637225529 460
236 iso_pu_bacteria 2648501693 2650898924 460
237 iso_pu_bacteria 2667528172 2671103142 460
238 iso_pu_bacteria 2667528173 2671110020 460
239 iso_pu_bacteria 2671180115 2671587560 460
240 iso_pu_bacteria 2675903046 2676406757 460
241 iso_pu_bacteria 2681812866 2681997710 460
242 iso_pu_bacteria 2681812869 2682006766 460
243 iso_pu_bacteria 2684622997 2686353308 460
244 iso_pu_bacteria 2687453601 2689444847 460
245 iso_pu_bacteria 2706794495 2707099127 460
246 iso_pu_bacteria 2711768156 2712470037 460
247 iso_pu_bacteria 2718217991 2719640931 460
248 iso_pu_bacteria 2738541296 2738819016 460
249 iso_pu_bacteria 2738541298 2738830828 460
250 iso_pu_bacteria 2738541306 2738872355 460
251 iso_pu_bacteria 2738543002 2739183985 460
252 iso_pu_bacteria 2738543008 2739218955 460
253 iso_pu_bacteria 2744054900 2746088190 460
254 iso_pu_bacteria 2744054901 2746096916 460
255 iso_pu_bacteria 2751185846 2753567654 460
256 iso_pu_bacteria 2751185917 2753855787 460
257 iso_pu_bacteria 2765235842 2765588781 460
258 iso_pu_bacteria 2772190666 2772438878 460
259 iso_pu_bacteria 2775506706 2775538789 460
260 iso_pu_bacteria 2775507074 2777022885 460
261 iso_pu_bacteria 2791355010 2792314757 460
262 iso_pu_bacteria 2791355137 2792839714 460
263 iso_pu_bacteria 2791355275 2793405694 460
264 iso_pu_bacteria 2806310673 2807179545 460
265 iso_pu_bacteria 2808606414 2809123617 460
266 iso_pu_bacteria 2811995292 2813729096 460
267 iso_pu_bacteria 2814123068 2814696662 460
268 iso_pu_bacteria 2821118458 2821119591 460
269 iso_pu_bacteria 2823373977 2823374572 460
270 iso_pu_bacteria 2842324504 2842325075 460
271 iso_pu_bacteria 2842348783 2842349353 460
272 iso_pu_bacteria 2842454564 2842459904 460
273 iso_pu_bacteria 2844425489 2844427338 460
274 iso_pu_bacteria 2844528606 2844530838 460
275 iso_pu_bacteria 2846540461 2846545141 460
276 iso_pu_bacteria 2847797336 2847799912 460
277 iso_pu_bacteria 2852103415 2852106933 460
278 iso_pu_bacteria 2854601825 2854604069 460
279 iso_pu_bacteria 2855195626 2855197288 460
280 iso_pu_bacteria 2858466076 2858468567 460
281 iso_pu_bacteria 2865014394 2865015210 460
282 iso_pu_bacteria 2869551831 2869554256 460
283 iso_pu_bacteria 2871272651 2871272892 460
284 iso_pu_bacteria 2871282230 2871283537 460
285 iso_pu_bacteria 2876601092 2876604327 460
286 iso_pu_bacteria 2881609920 2881612589 460
287 iso_pu_bacteria 2884086401 2884088947 460
288 iso_pu_bacteria 2885270888 2885271070 460
289 iso_pu_bacteria 2888366609 2888368900 460
290 iso_pu_bacteria 2888373701 2888378094 460
291 iso_pu_bacteria 2891670763 2891671744 460
292 iso_pu_bacteria 2900051742 2900051909 460
293 iso_pu_bacteria 2902682994 2902687342 460
294 iso_pu_bacteria 2904474040 2904477146 460
295 iso_pu_bacteria 2904483920 2904487429 460
296 iso_pu_bacteria 2904504865 2904508599 460
297 iso_pu_bacteria 2904513164 2904513610 460
298 iso_pu_bacteria 2904615490 2904623568 460
299 iso_pu_bacteria 2908669403 2908669937 460
300 iso_pu_bacteria 2919108558 2919108777 460
301 iso_pu_bacteria 2919150387 2919153313 460
302 iso_pu_bacteria 2919527303 2919528736 460
303 iso_pu_bacteria 2923634449 2923634658 460
304 iso_pu_bacteria 2927143783 2927143939 460
305 iso_pu_bacteria 2927833300 2927834289 460
306 iso_pu_bacteria 2932406140 2932408114 460
307 iso_pu_bacteria 2935625433 2935626835 460
308 iso_pu_bacteria 2937539931 2937540374 460
309 iso_pu_bacteria 2937967321 2937967495 460
310 iso_pu_bacteria 2939568625 2939569000 460
311 iso_pu_bacteria 2939573065 2939573714 460
312 iso_pu_bacteria 2939577877 2939578571 460
313 iso_pu_bacteria 2939602548 2939603392 460
314 iso_pu_bacteria 2939617950 2939619422 460
315 iso_pu_bacteria 2939642701 2939643951 460
316 iso_pu_bacteria 2945874760 2945877527 460
317 iso_pu_bacteria 2945934425 2945937696 460
318 iso_pu_bacteria 2945951305 2945953040 460
319 iso_pu_bacteria 2969079654 2969082525 460
320 iso_pu_bacteria 2971820967 2971823347 460
321 iso_pu_bacteria 2974310843 2974312296 460
322 iso_pu_bacteria 2974435778 2974438300 460
323 iso_pu_bacteria 2978975091 2978975563 460
324 iso_pu_bacteria 2984494565 2984496595 460
325 iso_pu_bacteria 2984559226 2984559583 460
326 iso_pu_bacteria 2984595703 2984597670 460
327 iso_pu_bacteria 2990261002 2990262014 460
328 iso_pu_bacteria 2990703756 2990705586 460
329 iso_pu_bacteria 3000376612 3000378800 460
330 iso_pu_bacteria 640753048 640937818 460
331 iso_pu_bacteria 641736151 642427173 460
332 iso_pu_bacteria 8004592986 8004595787 460
333 iso_pu_bacteria 8015394850 8015398138 460
334 iso_pu_bacteria 8016733728 8016736010 460
335 iso_pu_bacteria 8018221730 8018224739 460
336 iso_pu_bacteria 8018405270 8018408325 460
337 iso_pu_bacteria 8019499862 8019500590 460
338 iso_pu_bacteria 8019504834 8019506306 460
339 iso_pu_bacteria 8054844752 8054845726 460
340 iso_pu_bacteria 8054849141 8054853093 460
341 iso_pu_bacteria 8055087960 8055090949 460
342 iso_pu_bacteria 8055092621 8055094591 460
343 iso_pu_bacteria 8055097453 8055099970 460
344 iso_pu_bacteria 8055266321 8055266981 460
345 iso_pu_bacteria 8055301274 8055301703 460
346 iso_pu_bacteria 8055693939 8055696148 460
347 iso_pu_bacteria 8057304971 8057309375 460
348 3300003794 Ga0055531_10000078 Ga0055531_1000007822 461
349 3300003794 Ga0055531_10000330 Ga0055531_1000033035 461
350 3300005614 Ga0068856_100057170 Ga0068856_1000571701 461
351 3300005844 Ga0068862_100003019 Ga0068862_1000030198 461
352 3300005985 Ga0081539_10027422 Ga0081539_100274222 461
353 3300006847 Ga0075431_100000212 Ga0075431_10000021213 461
354 3300006852 Ga0075433_10018521 Ga0075433_100185212 461
355 3300006871 Ga0075434_100002612 Ga0075434_1000026122 461
356 3300009094 Ga0111539_10002448 Ga0111539_100024487 461
357 3300015262 Ga0182007_10006698 Ga0182007_100066983 461
358 3300025230 Ga0209563_104507 Ga0209563_1045072 461
359 3300025292 Ga0209676_1000089 Ga0209676_1000089241 461
360 3300025292 Ga0209676_1003882 Ga0209676_10038827 461
361 3300025298 Ga0209050_1001636 Ga0209050_100163619 461
362 3300025298 Ga0209050_1019548 Ga0209050_10195482 461
363 3300025303 Ga0209051_1030799 Ga0209051_10307992 461
364 3300025910 Ga0207684_10032253 Ga0207684_100322532 461
365 3300025949 Ga0207667_10232443 Ga0207667_102324432 461
366 3300027907 Ga0207428_10000879 Ga0207428_100008796 461
367 3300028380 Ga0268265_10012058 Ga0268265_100120583 461
368 3300028794 Ga0307515_10032973 Ga0307515_100329739 461
369 3300037471 Ga0395905_0001029 Ga0395905_0001029_31747_33132 461
370 3300037471 Ga0395905_0062446 Ga0395905_0062446_2023_3408 461
371 3300042876 Ga0451577_0001905 Ga0451577_0001905_18679_20088 461
372 3300045051 Ga0451576_0003527 Ga0451576_0003527_2480_3889 461
373 3300048920 Ga0496117_0053604 Ga0496117_0053604_1119_2510 461
374 3300049764 Ga0501267_001405 Ga0501267_001405_10_1395 461
375 3300050493 nmdc:mga0k408_7552_c1 nmdc:mga0k408_7552_c1_254_1660 461
376 3300050510 nmdc:mga06r32_270_c1 nmdc:mga06r32_270_c1_28647_30044 461
377 3300050511 nmdc:mga08y16_1648_c1 nmdc:mga08y16_1648_c1_4417_5826 461
378 3300050512 nmdc:mga0n895_44775_c1 nmdc:mga0n895_44775_c1_191_1600 461
379 3300050512 nmdc:mga0n895_66446_c1 nmdc:mga0n895_66446_c1_2107_3516 461
380 3300050515 nmdc:mga0a205_3886_c1 nmdc:mga0a205_3886_c1_3953_5362 461
381 3300050515 nmdc:mga0a205_647_c2 nmdc:mga0a205_647_c2_4591_6000 461
382 3300005548 Ga0070665_100022454 Ga0070665_1000224542 462
383 3300005563 Ga0068855_100007173 Ga0068855_1000071739 462
384 3300006358 Ga0068871_100036920 Ga0068871_1000369205 462
385 3300009177 Ga0105248_10048396 Ga0105248_100483962 462
386 3300013102 Ga0157371_10028798 Ga0157371_100287983 462
387 3300013105 Ga0157369_10002784 Ga0157369_1000278417 462
388 3300025949 Ga0207667_10012369 Ga0207667_100123693 462
389 3300037418 Ga0395900_0001108 Ga0395900_0001108_31343_32737 462
390 3300037418 Ga0395900_0046261 Ga0395900_0046261_1989_3383 462
391 3300037466 Ga0395898_0238508 Ga0395898_0238508_44_1438 462
392 3300038443 Ga0395901_0000264 Ga0395901_0000264_23155_24549 462
393 3300038443 Ga0395901_0050053 Ga0395901_0050053_2475_3869 462
394 3300042010 Ga0439452_000878 Ga0439452_000878_11240_12628 462
395 3300044712 Ga0453684_0020522 Ga0453684_0020522_7670_9061 462
396 3300046516 Ga0495628_0002511 Ga0495628_0002511_4692_6086 462
397 3300047472 Ga0495686_0000032 Ga0495686_0000032_111830_113224 462
398 3300048928 Ga0496125_0000017 Ga0496125_0000017_179604_181016 462
399 3300049571 Ga0501034_0000209 Ga0501034_0000209_48610_50004 462
400 iso_pu_bacteria 2501025501 2501073358 462
401 iso_pu_bacteria 2501025502 2501081217 462
402 iso_pu_bacteria 2501025504 2501408387 462
403 iso_pu_bacteria 2510917013 2511085987 462
404 iso_pu_bacteria 2510917014 2511096123 462
405 iso_pu_bacteria 2510917015 2511103154 462
406 iso_pu_bacteria 2513237082 2513555615 462
407 iso_pu_bacteria 2513237083 2513563441 462
408 iso_pu_bacteria 2515154123 2515691600 462
409 iso_pu_bacteria 2515154189 2516022452 462
410 iso_pu_bacteria 2856287931 2856292787 462
411 iso_pu_bacteria 2857357740 2857361021 462
412 iso_pu_bacteria 2883087390 2883088042 462
413 iso_pu_bacteria 8003955200 8003957800 462
414 3300001979 JGI24740J21852_10005053 JGI24740J21852_100050534 463
415 3300001989 JGI24739J22299_10003298 JGI24739J22299_100032983 463
416 3300002067 JGI24735J21928_10000661 JGI24735J21928_1000066111 463
417 3300002067 JGI24735J21928_10001340 JGI24735J21928_100013401 463
418 3300002067 JGI24735J21928_10002079 JGI24735J21928_100020793 463
419 3300002067 JGI24735J21928_10003369 JGI24735J21928_100033692 463
420 3300002705 JGI25156J39149_1000472 JGI25156J39149_100047214 463
421 3300002705 JGI25156J39149_1003297 JGI25156J39149_10032972 463
422 3300003214 JGI25165J46597_1000549 JGI25165J46597_100054923 463
423 3300003756 Ga0055533_1000304 Ga0055533_100030414 463
424 3300003756 Ga0055533_1003160 Ga0055533_10031601 463
425 3300003758 Ga0055532_1000039 Ga0055532_100003929 463
426 3300003760 Ga0055527_1000024 Ga0055527_100002429 463
427 3300003761 Ga0055535_1000028 Ga0055535_100002829 463
428 3300003762 Ga0055542_1000047 Ga0055542_1000047158 463
429 3300003763 Ga0055529_1000054 Ga0055529_100005429 463
430 3300005327 Ga0070658_10010343 Ga0070658_100103438 463
431 3300005327 Ga0070658_10081137 Ga0070658_100811371 463
432 3300005329 Ga0070683_100121973 Ga0070683_1001219732 463
433 3300005337 Ga0070682_100000793 Ga0070682_1000007933 463
434 3300005337 Ga0070682_100006254 Ga0070682_1000062542 463
435 3300005338 Ga0068868_100168319 Ga0068868_1001683192 463
436 3300005339 Ga0070660_100004620 Ga0070660_1000046205 463
437 3300005353 Ga0070669_100084764 Ga0070669_1000847641 463
438 3300005356 Ga0070674_100118659 Ga0070674_1001186592 463
439 3300005365 Ga0070688_100033877 Ga0070688_1000338773 463
440 3300005445 Ga0070708_100007105 Ga0070708_1000071058 463
441 3300005458 Ga0070681_10001390 Ga0070681_1000139011 463
442 3300005518 Ga0070699_100105771 Ga0070699_1001057713 463
443 3300005530 Ga0070679_100006620 Ga0070679_1000066207 463
444 3300005530 Ga0070679_100226959 Ga0070679_1002269592 463
445 3300005530 Ga0070679_100243167 Ga0070679_1002431671 463
446 3300005548 Ga0070665_100119565 Ga0070665_1001195652 463
447 3300005549 Ga0070704_100136354 Ga0070704_1001363542 463
448 3300005563 Ga0068855_100020520 Ga0068855_1000205206 463
449 3300005563 Ga0068855_100074776 Ga0068855_1000747762 463
450 3300005563 Ga0068855_100212064 Ga0068855_1002120642 463
451 3300005718 Ga0068866_10052783 Ga0068866_100527832 463
452 3300005719 Ga0068861_100255464 Ga0068861_1002554641 463
453 3300006353 Ga0075370_10000477 Ga0075370_100004774 463
454 3300006358 Ga0068871_100098076 Ga0068871_1000980762 463
455 3300007265 Ga0099794_10006613 Ga0099794_100066135 463
456 3300009011 Ga0105251_10000285 Ga0105251_1000028516 463
457 3300009094 Ga0111539_10011564 Ga0111539_100115648 463
458 3300009551 Ga0105238_10091185 Ga0105238_100911853 463
459 3300013104 Ga0157370_10007041 Ga0157370_1000704111 463
460 3300013105 Ga0157369_10098110 Ga0157369_100981103 463
461 3300013296 Ga0157374_10006893 Ga0157374_100068935 463
462 3300013297 Ga0157378_10138472 Ga0157378_101384722 463
463 3300014497 Ga0182008_10013829 Ga0182008_100138293 463
464 3300015261 Ga0182006_1025506 Ga0182006_10255062 463
465 3300020070 Ga0206356_10035754 Ga0206356_100357544 463
466 3300020082 Ga0206353_10639345 Ga0206353_106393453 463
467 3300022467 Ga0224712_10000018 Ga0224712_100000185 463
468 3300025226 Ga0209674_100013 Ga0209674_100013262 463
469 3300025226 Ga0209674_100335 Ga0209674_10033515 463
470 3300025228 Ga0209672_100010 Ga0209672_100010307 463
471 3300025228 Ga0209672_101313 Ga0209672_1013136 463
472 3300025229 Ga0209147_100006 Ga0209147_100006307 463
473 3300025230 Ga0209563_100543 Ga0209563_1005438 463
474 3300025242 Ga0209258_100010 Ga0209258_100010307 463
475 3300025254 Ga0209148_1000018 Ga0209148_1000018307 463
476 3300025256 Ga0209759_1000617 Ga0209759_100061714 463
477 3300025256 Ga0209759_1000927 Ga0209759_100092716 463
478 3300025261 Ga0209233_1000135 Ga0209233_1000135163 463
479 3300025272 Ga0209455_1000015 Ga0209455_1000015307 463
480 3300025302 Ga0207426_1001597 Ga0207426_100159710 463
481 3300025315 Ga0207697_10004020 Ga0207697_100040203 463
482 3300025728 Ga0207655_1025369 Ga0207655_10253692 463
483 3300025735 Ga0207713_1004098 Ga0207713_10040983 463
484 3300025893 Ga0207682_10000918 Ga0207682_100009188 463
485 3300025904 Ga0207647_10000967 Ga0207647_1000096721 463
486 3300025904 Ga0207647_10023902 Ga0207647_100239024 463
487 3300025907 Ga0207645_10008977 Ga0207645_100089773 463
488 3300025908 Ga0207643_10003743 Ga0207643_100037433 463
489 3300025909 Ga0207705_10022602 Ga0207705_100226023 463
490 3300025909 Ga0207705_10038189 Ga0207705_100381895 463
491 3300025913 Ga0207695_10006780 Ga0207695_1000678014 463
492 3300025918 Ga0207662_10005515 Ga0207662_100055152 463
493 3300025919 Ga0207657_10002901 Ga0207657_100029019 463
494 3300025921 Ga0207652_10067965 Ga0207652_100679652 463
495 3300025922 Ga0207646_10102705 Ga0207646_101027052 463
496 3300025924 Ga0207694_10074742 Ga0207694_100747422 463
497 3300025925 Ga0207650_10185341 Ga0207650_101853412 463
498 3300025940 Ga0207691_10041003 Ga0207691_100410034 463
499 3300025942 Ga0207689_10014493 Ga0207689_100144933 463
500 3300025945 Ga0207679_10167298 Ga0207679_101672982 463
501 3300025949 Ga0207667_10001310 Ga0207667_1000131031 463
502 3300025949 Ga0207667_10007729 Ga0207667_100077298 463
503 3300026035 Ga0207703_10148540 Ga0207703_101485401 463
504 3300026075 Ga0207708_10001819 Ga0207708_100018198 463
505 3300026089 Ga0207648_10011667 Ga0207648_100116678 463
506 3300026118 Ga0207675_100035460 Ga0207675_1000354603 463
507 3300027360 Ga0209969_1000332 Ga0209969_10003322 463
508 3300027395 Ga0209996_1002544 Ga0209996_10025442 463
509 3300027462 Ga0210000_1000407 Ga0210000_10004075 463
510 3300027471 Ga0209995_1000410 Ga0209995_10004102 463
511 3300027543 Ga0209999_1005758 Ga0209999_10057582 463
512 3300027665 Ga0209983_1008081 Ga0209983_10080812 463
513 3300027682 Ga0209971_1001442 Ga0209971_10014422 463
514 3300027876 Ga0209974_10002008 Ga0209974_100020085 463
515 3300028800 Ga0265338_10000183 Ga0265338_100001835 463
516 3300031235 Ga0265330_10000306 Ga0265330_1000030610 463
517 3300031238 Ga0265332_10000001 Ga0265332_10000001257 463
518 3300031238 Ga0265332_10015042 Ga0265332_100150424 463
519 3300031238 Ga0265332_10027357 Ga0265332_100273572 463
520 3300031239 Ga0265328_10004600 Ga0265328_100046005 463
521 3300031239 Ga0265328_10045477 Ga0265328_100454771 463
522 3300031240 Ga0265320_10027272 Ga0265320_100272721 463
523 3300031241 Ga0265325_10004772 Ga0265325_100047725 463
524 3300031242 Ga0265329_10010183 Ga0265329_100101832 463
525 3300031249 Ga0265339_10003488 Ga0265339_100034888 463
526 3300031250 Ga0265331_10020455 Ga0265331_100204551 463
527 3300031344 Ga0265316_10019116 Ga0265316_100191162 463
528 3300031344 Ga0265316_10135303 Ga0265316_101353032 463
529 3300031456 Ga0307513_10000012 Ga0307513_1000001281 463
530 3300031548 Ga0307408_100007103 Ga0307408_1000071037 463
531 3300031711 Ga0265314_10000001 Ga0265314_10000001839 463
532 3300031711 Ga0265314_10000022 Ga0265314_10000022263 463
533 3300031711 Ga0265314_10000488 Ga0265314_100004886 463
534 3300031911 Ga0307412_10000008 Ga0307412_10000008375 463
535 3300031911 Ga0307412_10008095 Ga0307412_100080954 463
536 3300032002 Ga0307416_100007037 Ga0307416_1000070377 463
537 3300032168 Ga0316593_10002011 Ga0316593_100020113 463
538 3300032168 Ga0316593_10002668 Ga0316593_100026682 463
539 3300035111 Ga0373923_0004154 Ga0373923_0004154_3072_4466 463
540 3300035113 Ga0373936_0003572 Ga0373936_0003572_2292_3686 463
541 3300035172 Ga0373955_0069961 Ga0373955_0069961_204_1598 463
542 3300035692 Ga0373935_0069008 Ga0373935_0069008_767_2161 463
543 3300037312 Ga0395899_0000041 Ga0395899_0000041_37052_38449 463
544 3300037312 Ga0395899_0054347 Ga0395899_0054347_1147_2544 463
545 3300037418 Ga0395900_0000562 Ga0395900_0000562_37064_38461 463
546 3300037418 Ga0395900_0105360 Ga0395900_0105360_837_2234 463
547 3300037418 Ga0395900_0237352 Ga0395900_0237352_67_1464 463
548 3300037466 Ga0395898_0000220 Ga0395898_0000220_108013_109410 463
549 3300037466 Ga0395898_0010158 Ga0395898_0010158_3855_5255 463
550 3300037466 Ga0395898_0090044 Ga0395898_0090044_1407_2804 463
551 3300037471 Ga0395905_0194461 Ga0395905_0194461_116_1516 463
552 3300038443 Ga0395901_0000106 Ga0395901_0000106_21421_22818 463
553 3300044673 Ga0453683_0028670 Ga0453683_0028670_1211_2602 463
554 3300044684 Ga0466966_0000066 Ga0466966_0000066_35719_37116 463
555 3300044684 Ga0466966_0009862 Ga0466966_0009862_2808_4205 463
556 3300044684 Ga0466966_0061841 Ga0466966_0061841_389_1786 463
557 3300044693 Ga0466961_0012412 Ga0466961_0012412_384_1781 463
558 3300044694 Ga0466963_0014124 Ga0466963_0014124_2381_3778 463
559 3300044842 Ga0466957_0003499 Ga0466957_0003499_1777_3174 463
560 3300044842 Ga0466957_0113767 Ga0466957_0113767_20_1417 463
561 3300045836 Ga0466958_0015896 Ga0466958_0015896_1858_3255 463
562 3300046472 Ga0495580_0002137 Ga0495580_0002137_12608_14008 463
563 3300046472 Ga0495580_0033151 Ga0495580_0033151_1258_2652 463
564 3300046477 Ga0495664_0063463 Ga0495664_0063463_103_1497 463
565 3300046515 Ga0495620_0040052 Ga0495620_0040052_123_1529 463
566 3300046516 Ga0495628_0070378 Ga0495628_0070378_1291_2691 463
567 3300046517 Ga0495630_0006847 Ga0495630_0006847_6341_7735 463
568 3300046526 Ga0495666_0000702 Ga0495666_0000702_12518_13918 463
569 3300046526 Ga0495666_0019406 Ga0495666_0019406_1433_2827 463
570 3300046533 Ga0495640_0023260 Ga0495640_0023260_1948_3348 463
571 3300046536 Ga0495587_0003186 Ga0495587_0003186_1526_2926 463
572 3300046536 Ga0495587_0016208 Ga0495587_0016208_2378_3772 463
573 3300046543 Ga0495645_0059444 Ga0495645_0059444_1180_2586 463
574 3300046675 Ga0495657_0021700 Ga0495657_0021700_1397_2791 463
575 3300046689 Ga0495613_0013934 Ga0495613_0013934_825_2219 463
576 3300046690 Ga0495624_0011860 Ga0495624_0011860_2849_4255 463
577 3300046809 Ga0495600_0003796 Ga0495600_0003796_6932_8326 463
578 3300047323 Ga0495683_0004345 Ga0495683_0004345_1314_2720 463
579 3300047446 Ga0495679_003580 Ga0495679_003580_4598_5998 463
580 3300048088 Ga0495602_0092898 Ga0495602_0092898_831_2237 463
581 3300048905 Ga0496102_0003782 Ga0496102_0003782_5991_7397 463
582 3300048909 Ga0496106_0007405 Ga0496106_0007405_30_1436 463
583 3300048911 Ga0496108_0203778 Ga0496108_0203778_296_1687 463
584 3300048913 Ga0496110_0007195 Ga0496110_0007195_809_2215 463
585 3300048915 Ga0496112_0009530 Ga0496112_0009530_7106_8512 463
586 3300048919 Ga0496116_0024574 Ga0496116_0024574_1730_3136 463
587 3300048921 Ga0496118_0002758 Ga0496118_0002758_15465_16871 463
588 3300048922 Ga0496119_0046177 Ga0496119_0046177_487_1893 463
589 3300048924 Ga0496121_0002394 Ga0496121_0002394_12988_14388 463
590 3300048925 Ga0496122_0015610 Ga0496122_0015610_1372_2778 463
591 3300048927 Ga0496124_0007879 Ga0496124_0007879_8681_10087 463
592 3300048928 Ga0496125_0011441 Ga0496125_0011441_7263_8669 463
593 3300049571 Ga0501034_0016258 Ga0501034_0016258_2283_3680 463
594 3300049572 Ga0501036_0019447 Ga0501036_0019447_327_1754 463
595 3300049574 Ga0501038_0000827 Ga0501038_0000827_10963_12390 463
596 3300049574 Ga0501038_0001518 Ga0501038_0001518_6710_8140 463
597 3300049577 Ga0501041_0026485 Ga0501041_0026485_1488_2915 463
598 3300049584 Ga0501068_0094028 Ga0501068_0094028_335_1762 463
599 3300049586 Ga0501070_0008795 Ga0501070_0008795_1559_2950 463
600 3300049590 Ga0501074_0010286 Ga0501074_0010286_1238_2629 463
601 3300049591 Ga0501075_0000195 Ga0501075_0000195_14001_15428 463
602 3300049592 Ga0501076_0000012 Ga0501076_0000012_17148_18575 463
603 3300049741 Ga0501079_0038923 Ga0501079_0038923_2032_3459 463
604 3300049742 Ga0501080_0038372 Ga0501080_0038372_76_1467 463
605 3300049742 Ga0501080_0271531 Ga0501080_0271531_20_1417 463
606 3300049743 Ga0501081_0037249 Ga0501081_0037249_1468_2895 463
607 3300050496 nmdc:mga07m45_22888_c1 nmdc:mga07m45_22888_c1_157_1581 463
608 3300050511 nmdc:mga08y16_144039_c1 nmdc:mga08y16_144039_c1_70_1461 463
609 3300050511 nmdc:mga08y16_15446_c2 nmdc:mga08y16_15446_c2_1231_2634 463
610 3300053084 Ga0495595_0036958 Ga0495595_0036958_203_1597 463
611 3300054114 Ga0501084_0061690 Ga0501084_0061690_699_2126 463
612 3300060353 Ga0501082_0001139 Ga0501082_0001139_3346_4773 463
613 3300061734 Ga0530510_0000015 Ga0530510_0000015_47623_49050 463
614 2162886007 SwRhRL2b_contig_3536331 SwRhRL2b_0214.00002410 464
615 3300001989 JGI24739J22299_10003525 JGI24739J22299_100035254 464
616 3300002737 JGI25162J39368_1000009 JGI25162J39368_1000009292 464
617 3300002737 JGI25162J39368_1003438 JGI25162J39368_10034382 464
618 3300002771 JGI25163J39215_1000112 JGI25163J39215_100011223 464
619 3300002772 JGI25164J39214_1000002 JGI25164J39214_100000253 464
620 3300002773 JGI25152J39213_1000258 JGI25152J39213_10002581 464
621 3300003751 Ga0055538_1000015 Ga0055538_1000015216 464
622 3300003752 Ga0055539_1000009 Ga0055539_1000009307 464
623 3300003756 Ga0055533_1000012 Ga0055533_100001253 464
624 3300003759 Ga0055525_1000014 Ga0055525_1000014307 464
625 3300003841 Ga0055541_1000006 Ga0055541_100000653 464
626 3300003856 Ga0058692_1000038 Ga0058692_100003857 464
627 3300003856 Ga0058692_1000101 Ga0058692_10001019 464
628 3300003856 Ga0058692_1000950 Ga0058692_10009507 464
629 3300003856 Ga0058692_1001279 Ga0058692_10012798 464
630 3300003856 Ga0058692_1001811 Ga0058692_10018116 464
631 3300003856 Ga0058692_1002584 Ga0058692_10025842 464
632 3300003856 Ga0058692_1004459 Ga0058692_10044591 464
633 3300003856 Ga0058692_1004924 Ga0058692_10049243 464
634 3300005289 Ga0065704_10000297 Ga0065704_1000029714 464
635 3300005289 Ga0065704_10000692 Ga0065704_1000069216 464
636 3300005289 Ga0065704_10002081 Ga0065704_100020817 464
637 3300005289 Ga0065704_10002617 Ga0065704_100026176 464
638 3300005289 Ga0065704_10077307 Ga0065704_100773073 464
639 3300005327 Ga0070658_10005812 Ga0070658_100058128 464
640 3300005331 Ga0070670_100048335 Ga0070670_1000483352 464
641 3300005333 Ga0070677_10015625 Ga0070677_100156252 464
642 3300005347 Ga0070668_100009558 Ga0070668_1000095583 464
643 3300005347 Ga0070668_100066843 Ga0070668_1000668432 464
644 3300005353 Ga0070669_100000476 Ga0070669_10000047614 464
645 3300005354 Ga0070675_100008919 Ga0070675_1000089195 464
646 3300005354 Ga0070675_100034221 Ga0070675_1000342212 464
647 3300005354 Ga0070675_100098914 Ga0070675_1000989142 464
648 3300005435 Ga0070714_100026726 Ga0070714_1000267265 464
649 3300005440 Ga0070705_100071640 Ga0070705_1000716403 464
650 3300005441 Ga0070700_100000738 Ga0070700_1000007389 464
651 3300005459 Ga0068867_100001861 Ga0068867_1000018619 464
652 3300005518 Ga0070699_100015392 Ga0070699_1000153922 464
653 3300005518 Ga0070699_100132447 Ga0070699_1001324472 464
654 3300005536 Ga0070697_100004779 Ga0070697_10000477910 464
655 3300005543 Ga0070672_100000456 Ga0070672_10000045611 464
656 3300005543 Ga0070672_100000976 Ga0070672_1000009764 464
657 3300005545 Ga0070695_100001230 Ga0070695_1000012309 464
658 3300005548 Ga0070665_100003098 Ga0070665_1000030987 464
659 3300005548 Ga0070665_100118642 Ga0070665_1001186422 464
660 3300005564 Ga0070664_100197713 Ga0070664_1001977132 464
661 3300005577 Ga0068857_100027883 Ga0068857_1000278832 464
662 3300005614 Ga0068856_100005735 Ga0068856_1000057356 464
663 3300005618 Ga0068864_100018323 Ga0068864_1000183237 464
664 3300005618 Ga0068864_100110145 Ga0068864_1001101453 464
665 3300005719 Ga0068861_100006376 Ga0068861_1000063767 464
666 3300005842 Ga0068858_100009422 Ga0068858_1000094223 464
667 3300005844 Ga0068862_100005097 Ga0068862_1000050979 464
668 3300005985 Ga0081539_10000276 Ga0081539_1000027666 464
669 3300006051 Ga0075364_10000919 Ga0075364_100009195 464
670 3300006844 Ga0075428_100034587 Ga0075428_1000345873 464
671 3300006844 Ga0075428_100152596 Ga0075428_1001525963 464
672 3300006847 Ga0075431_100036120 Ga0075431_1000361205 464
673 3300006871 Ga0075434_100000006 Ga0075434_10000000685 464
674 3300006880 Ga0075429_100094063 Ga0075429_1000940631 464
675 3300006881 Ga0068865_100186799 Ga0068865_1001867992 464
676 3300006914 Ga0075436_100000111 Ga0075436_10000011128 464
677 3300006946 Ga0079104_1000083 Ga0079104_100008358 464
678 3300006946 Ga0079104_1000218 Ga0079104_100021828 464
679 3300006946 Ga0079104_1000263 Ga0079104_100026317 464
680 3300006946 Ga0079104_1000292 Ga0079104_100029234 464
681 3300006946 Ga0079104_1000716 Ga0079104_10007166 464
682 3300006946 Ga0079104_1000733 Ga0079104_100073319 464
683 3300006946 Ga0079104_1002054 Ga0079104_10020549 464
684 3300007076 Ga0075435_100007410 Ga0075435_1000074107 464
685 3300009011 Ga0105251_10000002 Ga0105251_10000002256 464
686 3300009011 Ga0105251_10000470 Ga0105251_1000047030 464
687 3300009011 Ga0105251_10001242 Ga0105251_1000124216 464
688 3300009011 Ga0105251_10004066 Ga0105251_100040667 464
689 3300009011 Ga0105251_10010168 Ga0105251_100101683 464
690 3300009011 Ga0105251_10013077 Ga0105251_100130773 464
691 3300009011 Ga0105251_10036211 Ga0105251_100362112 464
692 3300009036 Ga0105244_10000368 Ga0105244_100003684 464
693 3300009036 Ga0105244_10000411 Ga0105244_1000041119 464
694 3300009036 Ga0105244_10002374 Ga0105244_100023743 464
695 3300009036 Ga0105244_10002576 Ga0105244_1000257611 464
696 3300009036 Ga0105244_10015097 Ga0105244_100150973 464
697 3300009036 Ga0105244_10034576 Ga0105244_100345762 464
698 3300009036 Ga0105244_10037225 Ga0105244_100372253 464
699 3300009036 Ga0105244_10037690 Ga0105244_100376903 464
700 3300009092 Ga0105250_10000002 Ga0105250_1000000217 464
701 3300009092 Ga0105250_10000113 Ga0105250_100001135 464
702 3300009092 Ga0105250_10000806 Ga0105250_1000080613 464
703 3300009092 Ga0105250_10000947 Ga0105250_100009477 464
704 3300009092 Ga0105250_10003409 Ga0105250_100034092 464
705 3300009094 Ga0111539_10008156 Ga0111539_100081562 464
706 3300009094 Ga0111539_10018887 Ga0111539_100188873 464
707 3300009101 Ga0105247_10000320 Ga0105247_1000032029 464
708 3300009147 Ga0114129_10294103 Ga0114129_102941031 464
709 3300009174 Ga0105241_10000002 Ga0105241_10000002440 464
710 3300009176 Ga0105242_10087887 Ga0105242_100878872 464
711 3300009553 Ga0105249_10004941 Ga0105249_100049414 464
712 3300013100 Ga0157373_10008163 Ga0157373_100081634 464
713 3300013100 Ga0157373_10008174 Ga0157373_100081746 464
714 3300013102 Ga0157371_10000008 Ga0157371_10000008212 464
715 3300013102 Ga0157371_10000782 Ga0157371_100007823 464
716 3300013102 Ga0157371_10001927 Ga0157371_100019274 464
717 3300013102 Ga0157371_10005800 Ga0157371_100058008 464
718 3300013104 Ga0157370_10002375 Ga0157370_1000237511 464
719 3300013105 Ga0157369_10021234 Ga0157369_100212344 464
720 3300013105 Ga0157369_10037413 Ga0157369_100374132 464
721 3300013306 Ga0163162_10010202 Ga0163162_100102025 464
722 3300013307 Ga0157372_10020335 Ga0157372_100203353 464
723 3300013307 Ga0157372_10022047 Ga0157372_100220473 464
724 3300013307 Ga0157372_10051752 Ga0157372_100517523 464
725 3300013307 Ga0157372_10062055 Ga0157372_100620552 464
726 3300014325 Ga0163163_10108683 Ga0163163_101086832 464
727 3300014326 Ga0157380_10008208 Ga0157380_100082081 464
728 3300014497 Ga0182008_10002656 Ga0182008_100026566 464
729 3300015679 Ga0183366_1001 Ga0183366_10011168 464
730 3300015680 Ga0183370_1001 Ga0183370_10011168 464
731 3300015685 Ga0183369_1001 Ga0183369_10011168 464
732 3300015687 Ga0183368_1001 Ga0183368_10011168 464
733 3300017792 Ga0163161_10000001 Ga0163161_100000011058 464
734 3300017792 Ga0163161_10137989 Ga0163161_101379892 464
735 3300021384 Ga0213876_10000055 Ga0213876_1000005555 464
736 3300025207 Ga0209760_100120 Ga0209760_10012040 464
737 3300025224 Ga0209784_100001 Ga0209784_1000011941 464
738 3300025225 Ga0209566_100001 Ga0209566_1000011941 464
739 3300025226 Ga0209674_100002 Ga0209674_1000021941 464
740 3300025230 Ga0209563_100002 Ga0209563_100002476 464
741 3300025231 Ga0207427_100020 Ga0207427_100020301 464
742 3300025233 Ga0209437_100001 Ga0209437_100001476 464
743 3300025233 Ga0209437_100073 Ga0209437_100073280 464
744 3300025245 Ga0207425_1008939 Ga0207425_10089392 464
745 3300025253 Ga0209677_100002 Ga0209677_100002476 464
746 3300025258 Ga0209129_1000004 Ga0209129_1000004129 464
747 3300025711 Ga0207696_1000001 Ga0207696_10000011129 464
748 3300025711 Ga0207696_1000005 Ga0207696_1000005557 464
749 3300025711 Ga0207696_1000042 Ga0207696_10000427 464
750 3300025711 Ga0207696_1000218 Ga0207696_100021814 464
751 3300025711 Ga0207696_1000292 Ga0207696_100029233 464
752 3300025711 Ga0207696_1001090 Ga0207696_100109010 464
753 3300025711 Ga0207696_1002437 Ga0207696_10024374 464
754 3300025711 Ga0207696_1018937 Ga0207696_10189372 464
755 3300025728 Ga0207655_1000001 Ga0207655_10000011227 464
756 3300025728 Ga0207655_1000009 Ga0207655_1000009414 464
757 3300025728 Ga0207655_1000037 Ga0207655_1000037289 464
758 3300025728 Ga0207655_1000061 Ga0207655_1000061161 464
759 3300025728 Ga0207655_1000063 Ga0207655_100006329 464
760 3300025728 Ga0207655_1000069 Ga0207655_100006958 464
761 3300025728 Ga0207655_1000373 Ga0207655_10003739 464
762 3300025728 Ga0207655_1001029 Ga0207655_100102920 464
763 3300025728 Ga0207655_1001262 Ga0207655_10012629 464
764 3300025728 Ga0207655_1006842 Ga0207655_10068423 464
765 3300025728 Ga0207655_1009881 Ga0207655_10098814 464
766 3300025728 Ga0207655_1012198 Ga0207655_10121981 464
767 3300025728 Ga0207655_1020643 Ga0207655_10206432 464
768 3300025728 Ga0207655_1030386 Ga0207655_10303861 464
769 3300025735 Ga0207713_1000001 Ga0207713_10000011027 464
770 3300025735 Ga0207713_1000002 Ga0207713_1000002799 464
771 3300025735 Ga0207713_1000003 Ga0207713_1000003185 464
772 3300025735 Ga0207713_1000008 Ga0207713_100000890 464
773 3300025735 Ga0207713_1000016 Ga0207713_100001694 464
774 3300025735 Ga0207713_1000029 Ga0207713_100002948 464
775 3300025735 Ga0207713_1010967 Ga0207713_10109673 464
776 3300025735 Ga0207713_1010995 Ga0207713_10109953 464
777 3300025735 Ga0207713_1014893 Ga0207713_10148932 464
778 3300025900 Ga0207710_10000113 Ga0207710_1000011329 464
779 3300025908 Ga0207643_10126312 Ga0207643_101263121 464
780 3300025911 Ga0207654_10000005 Ga0207654_10000005439 464
781 3300025925 Ga0207650_10009494 Ga0207650_100094946 464
782 3300025926 Ga0207659_10034378 Ga0207659_100343782 464
783 3300025926 Ga0207659_10075285 Ga0207659_100752853 464
784 3300025926 Ga0207659_10228995 Ga0207659_102289951 464
785 3300025927 Ga0207687_10005595 Ga0207687_100055952 464
786 3300025929 Ga0207664_10100333 Ga0207664_101003332 464
787 3300025931 Ga0207644_10045328 Ga0207644_100453282 464
788 3300025938 Ga0207704_10001490 Ga0207704_1000149013 464
789 3300025940 Ga0207691_10001622 Ga0207691_1000162212 464
790 3300025940 Ga0207691_10098706 Ga0207691_100987063 464
791 3300025972 Ga0207668_10026754 Ga0207668_100267542 464
792 3300026078 Ga0207702_10188218 Ga0207702_101882181 464
793 3300026088 Ga0207641_10024915 Ga0207641_100249156 464
794 3300026088 Ga0207641_10254521 Ga0207641_102545211 464
795 3300026089 Ga0207648_10000867 Ga0207648_1000086712 464
796 3300026095 Ga0207676_10001229 Ga0207676_100012297 464
797 3300026116 Ga0207674_10008117 Ga0207674_100081176 464
798 3300026118 Ga0207675_100005679 Ga0207675_10000567911 464
799 3300027111 Ga0209281_1000001 Ga0209281_1000001780 464
800 3300027111 Ga0209281_1000003 Ga0209281_1000003268 464
801 3300027111 Ga0209281_1000006 Ga0209281_10000061056 464
802 3300027111 Ga0209281_1000130 Ga0209281_100013057 464
803 3300027111 Ga0209281_1000181 Ga0209281_100018197 464
804 3300027111 Ga0209281_1000287 Ga0209281_100028714 464
805 3300027111 Ga0209281_1000414 Ga0209281_100041413 464
806 3300027111 Ga0209281_1000494 Ga0209281_100049426 464
807 3300027111 Ga0209281_1000638 Ga0209281_100063823 464
808 3300027111 Ga0209281_1001424 Ga0209281_10014243 464
809 3300027312 Ga0209371_1000001 Ga0209371_10000011092 464
810 3300027312 Ga0209371_1000002 Ga0209371_1000002244 464
811 3300027312 Ga0209371_1000005 Ga0209371_100000561 464
812 3300027312 Ga0209371_1000041 Ga0209371_1000041261 464
813 3300027312 Ga0209371_1000093 Ga0209371_100009378 464
814 3300027312 Ga0209371_1000109 Ga0209371_100010984 464
815 3300027312 Ga0209371_1000124 Ga0209371_100012449 464
816 3300027312 Ga0209371_1000212 Ga0209371_100021264 464
817 3300027312 Ga0209371_1000627 Ga0209371_100062725 464
818 3300027312 Ga0209371_1001196 Ga0209371_100119614 464
819 3300027312 Ga0209371_1001431 Ga0209371_100143117 464
820 3300027312 Ga0209371_1007284 Ga0209371_10072842 464
821 3300027312 Ga0209371_1009235 Ga0209371_10092352 464
822 3300027312 Ga0209371_1013581 Ga0209371_10135811 464
823 3300027378 Ga0209981_1002408 Ga0209981_10024082 464
824 3300027665 Ga0209983_1003166 Ga0209983_10031663 464
825 3300027907 Ga0207428_10019607 Ga0207428_100196072 464
826 3300028379 Ga0268266_10001737 Ga0268266_100017377 464
827 3300028380 Ga0268265_10001744 Ga0268265_1000174416 464
828 3300028380 Ga0268265_10188103 Ga0268265_101881032 464
829 3300030500 Ga0268256_1000001 Ga0268256_10000011549 464
830 3300030500 Ga0268256_1000002 Ga0268256_10000021220 464
831 3300030500 Ga0268256_1000003 Ga0268256_10000031085 464
832 3300030500 Ga0268256_1000006 Ga0268256_1000006995 464
833 3300030500 Ga0268256_1000081 Ga0268256_100008185 464
834 3300030500 Ga0268256_1000239 Ga0268256_100023949 464
835 3300030500 Ga0268256_1000489 Ga0268256_10004893 464
836 3300030500 Ga0268256_1000680 Ga0268256_10006807 464
837 3300030500 Ga0268256_1001756 Ga0268256_100175610 464
838 3300030500 Ga0268256_1005443 Ga0268256_10054434 464
839 3300030500 Ga0268256_1007040 Ga0268256_10070402 464
840 3300030500 Ga0268256_1009746 Ga0268256_10097462 464
841 3300030500 Ga0268256_1018394 Ga0268256_10183941 464
842 3300039437 Ga0436365_0971002 Ga0436365_0971002_108775_110175 464
843 3300041405 Ga0439438_000001 Ga0439438_000001_775018_776415 464
844 3300041411 Ga0439466_0000009 Ga0439466_0000009_212794_214191 464
845 3300042010 Ga0439452_000001 Ga0439452_000001_776189_777586 464
846 3300042010 Ga0439452_000028 Ga0439452_000028_143829_145229 464
847 3300042016 Ga0439463_020261 Ga0439463_020261_69_1466 464
848 3300042146 Ga0450907_000597 Ga0450907_000597_7579_8976 464
849 3300042437 Ga0439444_0000735 Ga0439444_0000735_2171_3568 464
850 3300042461 Ga0439460_0001606 Ga0439460_0001606_1129_2526 464
851 3300045051 Ga0451576_0266395 Ga0451576_0266395_360_1754 464
852 3300045976 Ga0466967_0008715 Ga0466967_0008715_5772_7166 464
853 3300046453 Ga0495627_000422 Ga0495627_000422_24662_26059 464
854 3300046458 Ga0495591_000763 Ga0495591_000763_14316_15713 464
855 3300046471 Ga0495650_0000043 Ga0495650_0000043_156904_158301 464
856 3300046471 Ga0495650_0000204 Ga0495650_0000204_97159_98556 464
857 3300046491 Ga0495584_0007246 Ga0495584_0007246_1801_3198 464
858 3300046501 Ga0495607_0000828 Ga0495607_0000828_14123_15550 464
859 3300046501 Ga0495607_0022682 Ga0495607_0022682_2395_3792 464
860 3300046507 Ga0495606_0002305 Ga0495606_0002305_10744_12141 464
861 3300046523 Ga0495644_0002657 Ga0495644_0002657_678_2075 464
862 3300046524 Ga0495648_0010354 Ga0495648_0010354_4685_6082 464
863 3300046524 Ga0495648_0025579 Ga0495648_0025579_698_2095 464
864 3300046530 Ga0495654_0000167 Ga0495654_0000167_62209_63606 464
865 3300046530 Ga0495654_0001461 Ga0495654_0001461_7494_8891 464
866 3300046530 Ga0495654_0028349 Ga0495654_0028349_1055_2452 464
867 3300046542 Ga0495597_0000768 Ga0495597_0000768_7572_8969 464
868 3300046660 Ga0495625_0002242 Ga0495625_0002242_10125_11522 464
869 3300046794 Ga0495589_0000001 Ga0495589_0000001_834106_835503 464
870 3300046810 Ga0495660_0000048 Ga0495660_0000048_17525_18922 464
871 3300047320 Ga0495672_0000002 Ga0495672_0000002_606272_607669 464
872 3300047320 Ga0495672_0000020 Ga0495672_0000020_389077_390474 464
873 3300047320 Ga0495672_0000043 Ga0495672_0000043_4892_6289 464
874 3300047446 Ga0495679_000018 Ga0495679_000018_175659_177056 464
875 3300047469 Ga0495673_0000167 Ga0495673_0000167_110128_111525 464
876 3300048903 Ga0496100_0027541 Ga0496100_0027541_979_2376 464
877 3300048904 Ga0496101_0000055 Ga0496101_0000055_66547_67944 464
878 3300048905 Ga0496102_0111644 Ga0496102_0111644_1053_2450 464
879 3300048907 Ga0496104_0014015 Ga0496104_0014015_4159_5556 464
880 3300048919 Ga0496116_0000001 Ga0496116_0000001_531917_533314 464
881 3300048919 Ga0496116_0000206 Ga0496116_0000206_41246_42643 464
882 3300048919 Ga0496116_0000305 Ga0496116_0000305_37687_39084 464
883 3300048919 Ga0496116_0004122 Ga0496116_0004122_343_1740 464
884 3300048920 Ga0496117_0000022 Ga0496117_0000022_409357_410754 464
885 3300048920 Ga0496117_0000453 Ga0496117_0000453_20677_22074 464
886 3300048920 Ga0496117_0000643 Ga0496117_0000643_3687_5084 464
887 3300048920 Ga0496117_0001475 Ga0496117_0001475_20081_21478 464
888 3300048920 Ga0496117_0002666 Ga0496117_0002666_14762_16162 464
889 3300048920 Ga0496117_0026914 Ga0496117_0026914_2983_4380 464
890 3300048920 Ga0496117_0047339 Ga0496117_0047339_45_1442 464
891 3300048921 Ga0496118_0000007 Ga0496118_0000007_165644_167041 464
892 3300048921 Ga0496118_0000085 Ga0496118_0000085_97420_98817 464
893 3300048921 Ga0496118_0000485 Ga0496118_0000485_38982_40379 464
894 3300048921 Ga0496118_0000688 Ga0496118_0000688_51222_52619 464
895 3300048921 Ga0496118_0002468 Ga0496118_0002468_11883_13280 464
896 3300048921 Ga0496118_0012028 Ga0496118_0012028_6626_8026 464
897 3300048922 Ga0496119_0000001 Ga0496119_0000001_728917_730317 464
898 3300048922 Ga0496119_0000015 Ga0496119_0000015_220826_222223 464
899 3300048922 Ga0496119_0000039 Ga0496119_0000039_172488_173885 464
900 3300048922 Ga0496119_0004502 Ga0496119_0004502_6999_8396 464
901 3300048922 Ga0496119_0011306 Ga0496119_0011306_2594_3991 464
902 3300048922 Ga0496119_0018858 Ga0496119_0018858_3159_4556 464
903 3300048922 Ga0496119_0037672 Ga0496119_0037672_271_1668 464
904 3300048922 Ga0496119_0042595 Ga0496119_0042595_431_1828 464
905 3300048922 Ga0496119_0067101 Ga0496119_0067101_33_1427 464
906 3300048923 Ga0496120_0000002 Ga0496120_0000002_511856_513253 464
907 3300048923 Ga0496120_0000016 Ga0496120_0000016_268547_269944 464
908 3300048923 Ga0496120_0000029 Ga0496120_0000029_7637_9034 464
909 3300048923 Ga0496120_0000464 Ga0496120_0000464_55658_57055 464
910 3300048923 Ga0496120_0001569 Ga0496120_0001569_8417_9814 464
911 3300048923 Ga0496120_0003871 Ga0496120_0003871_8858_10255 464
912 3300048924 Ga0496121_0017594 Ga0496121_0017594_3053_4450 464
913 3300048925 Ga0496122_0000110 Ga0496122_0000110_80716_82113 464
914 3300048925 Ga0496122_0000545 Ga0496122_0000545_57218_58618 464
915 3300048925 Ga0496122_0001733 Ga0496122_0001733_8776_10173 464
916 3300048925 Ga0496122_0031193 Ga0496122_0031193_1145_2545 464
917 3300048925 Ga0496122_0079740 Ga0496122_0079740_229_1629 464
918 3300048925 Ga0496122_0087226 Ga0496122_0087226_129_1526 464
919 3300048926 Ga0496123_0000081 Ga0496123_0000081_108030_109427 464
920 3300048926 Ga0496123_0000189 Ga0496123_0000189_50515_51915 464
921 3300048926 Ga0496123_0001180 Ga0496123_0001180_28424_29821 464
922 3300048926 Ga0496123_0002644 Ga0496123_0002644_9614_11014 464
923 3300048926 Ga0496123_0002658 Ga0496123_0002658_5444_6844 464
924 3300048926 Ga0496123_0004613 Ga0496123_0004613_4820_6217 464
925 3300048926 Ga0496123_0079637 Ga0496123_0079637_490_1893 464
926 3300048927 Ga0496124_0000066 Ga0496124_0000066_145403_146800 464
927 3300048927 Ga0496124_0000199 Ga0496124_0000199_105031_106431 464
928 3300048927 Ga0496124_0002919 Ga0496124_0002919_8752_10149 464
929 3300048927 Ga0496124_0017696 Ga0496124_0017696_941_2338 464
930 3300048927 Ga0496124_0041785 Ga0496124_0041785_1134_2537 464
931 3300048927 Ga0496124_0059103 Ga0496124_0059103_1685_3082 464
932 3300048927 Ga0496124_0063517 Ga0496124_0063517_1579_2976 464
933 3300048928 Ga0496125_0000009 Ga0496125_0000009_450658_452061 464
934 3300048929 Ga0496126_0000420 Ga0496126_0000420_80523_81920 464
935 3300048929 Ga0496126_0014745 Ga0496126_0014745_5512_6915 464
936 3300049459 Ga0495678_000354 Ga0495678_000354_20209_21606 464
937 3300049460 Ga0495682_0000001 Ga0495682_0000001_1226798_1228195 464
938 3300049568 Ga0501031_0012306 Ga0501031_0012306_3877_5271 464
939 3300049568 Ga0501031_0110400 Ga0501031_0110400_376_1773 464
940 3300049569 Ga0501032_0023797 Ga0501032_0023797_1063_2457 464
941 3300049570 Ga0501033_0003107 Ga0501033_0003107_2077_3471 464
942 3300049571 Ga0501034_0081379 Ga0501034_0081379_636_2030 464
943 3300049573 Ga0501037_0010133 Ga0501037_0010133_5293_6687 464
944 3300049574 Ga0501038_0000972 Ga0501038_0000972_16802_18196 464
945 3300049574 Ga0501038_0065637 Ga0501038_0065637_692_2086 464
946 3300049574 Ga0501038_0127638 Ga0501038_0127638_354_1748 464
947 3300049575 Ga0501039_0000686 Ga0501039_0000686_19038_20432 464
948 3300049575 Ga0501039_0058628 Ga0501039_0058628_353_1747 464
949 3300049576 Ga0501040_0000627 Ga0501040_0000627_290_1684 464
950 3300049576 Ga0501040_0028228 Ga0501040_0028228_1574_2968 464
951 3300049576 Ga0501040_0083074 Ga0501040_0083074_394_1788 464
952 3300049577 Ga0501041_0000061 Ga0501041_0000061_16511_17905 464
953 3300049578 Ga0501042_0002672 Ga0501042_0002672_1745_3139 464
954 3300049580 Ga0501046_0002154 Ga0501046_0002154_12699_14093 464
955 3300049580 Ga0501046_0086686 Ga0501046_0086686_219_1613 464
956 3300049580 Ga0501046_0109640 Ga0501046_0109640_595_1989 464
957 3300049581 Ga0501047_0016231 Ga0501047_0016231_1869_3263 464
958 3300049582 Ga0501048_0000204 Ga0501048_0000204_27593_28987 464
959 3300049586 Ga0501070_0001974 Ga0501070_0001974_10851_12245 464
960 3300049587 Ga0501071_0000332 Ga0501071_0000332_19496_20890 464
961 3300049588 Ga0501072_0002557 Ga0501072_0002557_10309_11703 464
962 3300049588 Ga0501072_0014020 Ga0501072_0014020_4559_5953 464
963 3300049588 Ga0501072_0029323 Ga0501072_0029323_2318_3712 464
964 3300049589 Ga0501073_0025893 Ga0501073_0025893_888_2282 464
965 3300049590 Ga0501074_0005475 Ga0501074_0005475_5992_7386 464
966 3300049591 Ga0501075_0001008 Ga0501075_0001008_6711_8105 464
967 3300049591 Ga0501075_0065579 Ga0501075_0065579_196_1590 464
968 3300049592 Ga0501076_0000301 Ga0501076_0000301_19546_20940 464
969 3300049593 Ga0501077_0000664 Ga0501077_0000664_16314_17708 464
970 3300049741 Ga0501079_0001433 Ga0501079_0001433_9534_10928 464
971 3300049741 Ga0501079_0006856 Ga0501079_0006856_3415_4809 464
972 3300049742 Ga0501080_0020977 Ga0501080_0020977_329_1723 464
973 3300049742 Ga0501080_0143947 Ga0501080_0143947_550_1944 464
974 3300049743 Ga0501081_0000061 Ga0501081_0000061_21416_22810 464
975 3300049743 Ga0501081_0010331 Ga0501081_0010331_3421_4815 464
976 3300049743 Ga0501081_0071466 Ga0501081_0071466_744_2138 464
977 3300049744 Ga0501083_0044026 Ga0501083_0044026_1231_2625 464
978 3300049822 Ga0501035_0006914 Ga0501035_0006914_1562_2956 464
979 3300049823 Ga0501044_0045943 Ga0501044_0045943_321_1715 464
980 3300049824 Ga0501045_0007570 Ga0501045_0007570_6024_7418 464
981 3300049824 Ga0501045_0164895 Ga0501045_0164895_100_1494 464
982 3300050507 nmdc:mga05p37_151206_c1 nmdc:mga05p37_151206_c1_61_1458 464
983 3300050510 nmdc:mga06r32_216205_c1 nmdc:mga06r32_216205_c1_332_1726 464
984 3300050511 nmdc:mga08y16_208195_c1 nmdc:mga08y16_208195_c1_203_1597 464
985 3300050511 nmdc:mga08y16_6769_c1 nmdc:mga08y16_6769_c1_10282_11679 464
986 3300050512 nmdc:mga0n895_490_c1 nmdc:mga0n895_490_c1_6732_8126 464
987 3300050513 nmdc:mga0rr50_887_c1 nmdc:mga0rr50_887_c1_2033_3427 464
988 3300050514 nmdc:mga08x19_18760_c1 nmdc:mga08x19_18760_c1_2726_4120 464
989 3300050514 nmdc:mga08x19_401_c1 nmdc:mga08x19_401_c1_5429_6823 464
990 3300053126 Ga0500621_000003 Ga0500621_000003_209505_210902 464
991 3300054114 Ga0501084_0000706 Ga0501084_0000706_22415_23809 464
992 3300054114 Ga0501084_0060319 Ga0501084_0060319_1744_3138 464
993 3300060353 Ga0501082_0000471 Ga0501082_0000471_20429_21823 464
994 3300060353 Ga0501082_0020106 Ga0501082_0020106_245_1639 464
995 3300061734 Ga0530510_0000947 Ga0530510_0000947_9883_11277 464
996 3300061734 Ga0530510_0001871 Ga0530510_0001871_10484_11878 464
997 3300048922 Ga0496119_0002165 Ga0496119_0002165_9712_11112 465
998 3300048922 Ga0496119_0002195 Ga0496119_0002195_10969_12369 465
999 3300048923 Ga0496120_0000051 Ga0496120_0000051_174045_175445 465
1000 3300048923 Ga0496120_0000092 Ga0496120_0000092_10773_12173 465
1001 3300048927 Ga0496124_0000195 Ga0496124_0000195_107987_109387 465
1002 iso_pu_bacteria 2643221570 2643867566 465
1003 iso_pu_bacteria 2643221596 2643990489 465
1004 iso_pu_bacteria 2643221652 2644294994 465
1005 iso_pu_bacteria 2990710928 2990713110 465
1006 3300007076 Ga0075435_100103023 Ga0075435_1001030232 466
1007 3300009147 Ga0114129_10447029 Ga0114129_104470291 466
1008 3300047320 Ga0495672_0006394 Ga0495672_0006394_282_1688 466
1009 3300050513 nmdc:mga0rr50_44288_c1 nmdc:mga0rr50_44288_c1_248_1657 466
1010 3300050514 nmdc:mga08x19_29490_c1 nmdc:mga08x19_29490_c1_686_2095 466
1011 3300009148 Ga0105243_10029166 Ga0105243_100291662 467
1012 3300009553 Ga0105249_10067069 Ga0105249_100670692 467
1013 3300013297 Ga0157378_10067205 Ga0157378_100672052 467
1014 3300014968 Ga0157379_10087407 Ga0157379_100874071 467
1015 3300049743 Ga0501081_0160876 Ga0501081_0160876_123_1583 467
1016 3300005563 Ga0068855_100031239 Ga0068855_1000312393 468
1017 3300014326 Ga0157380_10094703 Ga0157380_100947032 468
1018 3300025949 Ga0207667_10016418 Ga0207667_100164182 468
1019 iso_pu_bacteria 2857576091 2857577592 468
1020 3300009036 Ga0105244_10000015 Ga0105244_10000015160 471
1021 3300047319 Ga0495674_0094282 Ga0495674_0094282_190_1689 471
1022 3300009011 Ga0105251_10000304 Ga0105251_1000030417 473
1023 3300009036 Ga0105244_10000014 Ga0105244_1000001428 473
1024 3300046460 Ga0495638_0003120 Ga0495638_0003120_9965_11413 473
1025 3300046471 Ga0495650_0044171 Ga0495650_0044171_385_1830 473
1026 3300046500 Ga0495596_0011981 Ga0495596_0011981_82_1527 473
1027 3300046694 Ga0495649_0001040 Ga0495649_0001040_18419_19867 473
1028 3300047446 Ga0495679_000416 Ga0495679_000416_3094_4542 473
1029 3300048908 Ga0496105_0021709 Ga0496105_0021709_1605_3050 473
1030 3300048922 Ga0496119_0006694 Ga0496119_0006694_8759_10204 473
1031 3300048927 Ga0496124_0000425 Ga0496124_0000425_53207_54655 473
1032 3300009093 Ga0105240_10002811 Ga0105240_1000281126 475
1033 3300009545 Ga0105237_10240995 Ga0105237_102409952 475
1034 3300010375 Ga0105239_10001532 Ga0105239_1000153215 475
1035 3300013100 Ga0157373_10017295 Ga0157373_100172954 475
1036 3300013104 Ga0157370_10033077 Ga0157370_100330774 475
1037 3300013105 Ga0157369_10001258 Ga0157369_1000125810 475
1038 3300013296 Ga0157374_10000345 Ga0157374_1000034526 475
1039 3300042005 Ga0439448_0000048 Ga0439448_0000048_1472_2920 475
1040 2162886007 SwRhRL2b_contig_2274192 SwRhRL2b_0588.00005170 476
1041 2162886007 SwRhRL2b_contig_2373311 SwRhRL2b_0721.00003230 476
1042 3300009011 Ga0105251_10001277 Ga0105251_100012776 476
1043 3300009011 Ga0105251_10004030 Ga0105251_1000403010 476
1044 3300009036 Ga0105244_10027859 Ga0105244_100278592 476
1045 3300009092 Ga0105250_10001578 Ga0105250_100015787 476
1046 3300009098 Ga0105245_10009110 Ga0105245_100091102 476
1047 3300009174 Ga0105241_10006567 Ga0105241_100065673 476
1048 3300013102 Ga0157371_10066978 Ga0157371_100669782 476
1049 3300013104 Ga0157370_10003134 Ga0157370_100031349 476
1050 3300042010 Ga0439452_000246 Ga0439452_000246_23093_24523 476
1051 3300042439 Ga0439464_0010610 Ga0439464_0010610_765_2195 476
1052 3300044669 Ga0466981_0000002 Ga0466981_0000002_196041_197471 476
1053 3300046458 Ga0495591_000100 Ga0495591_000100_86709_88145 476
1054 3300046471 Ga0495650_0000005 Ga0495650_0000005_639451_640881 476
1055 3300047469 Ga0495673_0000070 Ga0495673_0000070_112582_114018 476
1056 3300048907 Ga0496104_0000091 Ga0496104_0000091_72149_73579 476
1057 3300048908 Ga0496105_0042029 Ga0496105_0042029_1853_3283 476
1058 3300048919 Ga0496116_0000822 Ga0496116_0000822_12836_14266 476
1059 3300048919 Ga0496116_0009094 Ga0496116_0009094_3171_4607 476
1060 3300048920 Ga0496117_0000020 Ga0496117_0000020_412793_414223 476
1061 3300048920 Ga0496117_0001256 Ga0496117_0001256_12685_14121 476
1062 3300048920 Ga0496117_0008999 Ga0496117_0008999_7244_8680 476
1063 3300048920 Ga0496117_0026654 Ga0496117_0026654_889_2319 476
1064 3300048920 Ga0496117_0027043 Ga0496117_0027043_631_2148 476
1065 3300048921 Ga0496118_0000015 Ga0496118_0000015_428077_429507 476
1066 3300048921 Ga0496118_0041438 Ga0496118_0041438_1258_2775 476
1067 3300048922 Ga0496119_0011262 Ga0496119_0011262_5795_7225 476
1068 3300048922 Ga0496119_0033360 Ga0496119_0033360_1954_3384 476
1069 3300048922 Ga0496119_0035126 Ga0496119_0035126_704_2134 476
1070 3300048923 Ga0496120_0004907 Ga0496120_0004907_7506_8936 476
1071 3300048923 Ga0496120_0005623 Ga0496120_0005623_7844_9274 476
1072 3300048923 Ga0496120_0020437 Ga0496120_0020437_52_1482 476
1073 3300048923 Ga0496120_0032656 Ga0496120_0032656_1454_2884 476
1074 3300048923 Ga0496120_0057626 Ga0496120_0057626_66_1496 476
1075 3300048924 Ga0496121_0004747 Ga0496121_0004747_30_1460 476
1076 3300048924 Ga0496121_0005026 Ga0496121_0005026_1256_2692 476
1077 3300048924 Ga0496121_0005621 Ga0496121_0005621_12793_14223 476
1078 3300048924 Ga0496121_0014078 Ga0496121_0014078_6365_7837 476
1079 3300048924 Ga0496121_0039393 Ga0496121_0039393_1376_2806 476
1080 3300048925 Ga0496122_0000005 Ga0496122_0000005_125657_127093 476
1081 3300048925 Ga0496122_0003163 Ga0496122_0003163_2407_3837 476
1082 3300048925 Ga0496122_0019153 Ga0496122_0019153_90_1520 476
1083 3300048926 Ga0496123_0000008 Ga0496123_0000008_503536_504972 476
1084 3300048926 Ga0496123_0004727 Ga0496123_0004727_1274_2704 476
1085 3300048926 Ga0496123_0015411 Ga0496123_0015411_90_1520 476
1086 3300048927 Ga0496124_0001064 Ga0496124_0001064_18859_20289 476
1087 3300048927 Ga0496124_0011263 Ga0496124_0011263_1509_2939 476
1088 3300048928 Ga0496125_0115379 Ga0496125_0115379_436_1866 476
1089 3300048929 Ga0496126_0000669 Ga0496126_0000669_53114_54544 476
1090 3300048929 Ga0496126_0001084 Ga0496126_0001084_43297_44727 476
1091 3300050491 nmdc:mga00v17_12685_c1 nmdc:mga00v17_12685_c1_2946_4382 476

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00206

Lyase_1

Lyase

11

333

0.98

PF10415

FumaraseC_C

Fumarase C C-terminus

399

452

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6os7-assembly1.cif.gz_B-2 e. coli fumarase mutant - r126a 0.982 15 473
4hgv-assembly1.cif.gz_C crystal structure of a fumarate hydratase 0.9818 15 419
6nz9-assembly1.cif.gz_B crystal structure of e. coli fumarase c bound to citrate at 1.53 angstrom resolution 0.9817 15 473
6os7-assembly1.cif.gz_B-2 e. coli fumarase mutant - r126a 0.9798 15 473
6nz9-assembly1.cif.gz_B crystal structure of e. coli fumarase c bound to citrate at 1.53 angstrom resolution 0.9796 15 473
ID Description Score Start End Superfamily
1fuoB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.011 421 469 1.10.40.30
5uppA03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.004 421 471 1.10.40.30
5uppB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.004 421 471 1.10.40.30
5d6bA03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.002 421 471 1.10.40.30
3tv2A03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.002 421 473 1.10.40.30
ID Description Score Start End GO Terms
AF-A0A3D5MEU9-F1-model_v4 deleted 0.9948 13 108
AF-A0A383EM57-F1-model_v4 Fumarate lyase N-terminal domain-containing protein 0.9859 17 125 GO:0005829
GO:0006531
GO:0008797
AF-A0A520BFZ4-F1-model_v4 fumarate hydratase (EC 4.2.1.2) 0.9851 261 473 GO:0004333
GO:0006099
GO:0006106
GO:0006108
AF-A0A3D5MEU9-F1-model_v4 deleted 0.9846 13 108
AF-A0A3S4GB40-F1-model_v4 Fumarate hydratase, class II (EC 4.2.1.2) 0.9843 13 142 GO:0004333
GO:0006099
GO:0006106
GO:0006108

Feature Viewer

pLDDT pTM Quality
90.23 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map