F489886

General Info

Members Datasets Scaffolds Average Seq Length
1091 411 910 464

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10001787|Ga0307412_100017874
Length 492
Sequence VQPRAGVYRMNPPLSRKQQLLKRHRRNKRMGLLLALVVLVSLGVAVAWWLPLVLAVLGWVAHEAWFADHLFYSPRDDYQYSFPPFTQQPKVHLNAGRLQLDEGVILDDGATLVLALRVKSTWLGRFIDPCVELLGGESADRQTFERGVSGLRYLNLSEQGDVLSRGELRLRGRFCRVSGEPMLWSFTAPQIQRQRVMVIAPHADDAELAAYGLYSQADEAWIVTLTAGEIEAEHYQRMGLDRVEAARLKGRLRAWDSIAVPRWAGVPEAHCVQLGYFCLQLAAMQAAPNQPQGSREADLSDTRLFRQLNPFVLPGDADGAPTWNNLLADLRELLLKARPEVIVLPHPTLDPHPDHLCAHDALMQALEGLEWQPNTLLGYANHLHDNDRWPMGNAGEGVALPPVFEPAQVMQPLSLPLSLAAQRDKAMALGMMHDLQPPAPLKRRLRRWIQYALTRRVRSVYGDNDFFRKSVRRHELFWRLTTVKHRQHINDA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231023 Pseudomonas sp. GM80 Isolate Nodule
18 2511231024 Pseudomonas sp. GM84 Isolate Nodule
19 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
20 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
21 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
22 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
23 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
24 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
25 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
26 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
27 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
28 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
29 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
30 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
31 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
32 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
33 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
34 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
35 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
36 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
37 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
38 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
39 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
40 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
41 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
42 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
43 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
44 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
45 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
46 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
47 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
48 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
49 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
50 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
51 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
52 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
53 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
54 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
55 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
56 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
57 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
58 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
59 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
60 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
61 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
62 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
63 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
64 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
65 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
66 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
67 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
68 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
69 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
70 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
71 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
72 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
73 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
74 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
75 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
76 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
77 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
78 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
79 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
80 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
81 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
82 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
83 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
84 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
85 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
86 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
87 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
88 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
89 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
90 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
91 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
92 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
93 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
94 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
95 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
96 2765235841 Pseudomonas putida AA7 Isolate Unclassified
97 2773857670 Pseudomonas sp. 478 Isolate Unclassified
98 2773857673 Pseudomonas sp. 443 Isolate Unclassified
99 2784132063 Pseudomonas sp. 424 Isolate Unclassified
100 2784132072 Pseudomonas sp. 460 Isolate Unclassified
101 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
102 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
103 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
104 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
105 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
106 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
107 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
108 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
109 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
110 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
111 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
112 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
113 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
114 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
115 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
116 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
117 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
118 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
119 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
120 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
121 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
122 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
123 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
124 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
125 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
126 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
127 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
128 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
129 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
130 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
131 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
132 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
133 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
134 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
135 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
136 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
137 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
138 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
139 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
140 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
141 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
142 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
143 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
144 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
145 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
146 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
147 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
148 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
149 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
150 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
151 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
152 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
153 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
154 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
155 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
156 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
157 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
158 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
159 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
160 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
161 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
162 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
163 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
164 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
165 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
166 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
167 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
168 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
169 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
170 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
171 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
172 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
173 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
174 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
175 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
176 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
177 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
178 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
179 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
180 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
181 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
182 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
183 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
184 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
185 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
186 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
187 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
188 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
189 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
190 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
191 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
192 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
193 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
194 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
195 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
196 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
197 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
200 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
201 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
202 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
203 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
204 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
205 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
206 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
207 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
208 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
209 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
210 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
211 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
212 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
213 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
214 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
220 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
221 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
223 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
225 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
245 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
246 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
251 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
252 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
259 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
260 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
261 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
262 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
263 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
264 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
265 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
266 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
267 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
268 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
269 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
270 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
271 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
272 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
273 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
274 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
275 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
276 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
277 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
278 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
279 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
280 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
281 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
282 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
283 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
284 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
285 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
286 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
287 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
288 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
291 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
297 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
308 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
313 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
314 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
315 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
339 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
342 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
343 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
344 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
347 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
348 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
349 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
352 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
353 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
354 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
355 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
356 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
357 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
358 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
359 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
373 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
374 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
375 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
376 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
377 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
378 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
379 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
380 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
381 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
385 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
389 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
390 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
391 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
392 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
393 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
394 8052494512 Pseudomonas putida LD6 Isolate Unclassified
395 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
396 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
397 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
398 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
399 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
400 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
401 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
402 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
403 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
404 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
405 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
406 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
407 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
408 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
409 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
410 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
411 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.41
Metatranscriptomes 0
Isolates 16.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.86
Nodule 2.47
Rhizoplane 5.13
Rhizosphere 74.24
Stem 0
Stem Tuber 0
Unclassified 13.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_87 2124908027 Bacteria 56496
2 SwRhRL2b_contig_2389706 2162886007 Bacteria 5301
3 JGI25162J39368_1000179 3300002737 Bacteria 68307
4 JGI25162J39368_1000182 3300002737 Bacteria 67382
5 JGI25163J39215_1000324 3300002771 Bacteria 15948
6 JGI25163J39215_1000479 3300002771 Bacteria 12040
7 JGI25164J39214_1000145 3300002772 Bacteria 68307
8 JGI25164J39214_1000148 3300002772 Bacteria 67382
9 JGI25165J46597_1000266 3300003214 Bacteria 68307
10 JGI25165J46597_1000268 3300003214 Bacteria 67382
11 rootH1_10205636 3300003323 Bacteria 6264
12 Ga0055538_1000037 3300003751 Bacteria 190238
13 Ga0055539_1000048 3300003752 Bacteria 190238
14 Ga0055533_1000059 3300003756 Bacteria 190238
15 Ga0055532_1000096 3300003758 Bacteria 98889
16 Ga0055525_1000189 3300003759 Bacteria 75207
17 Ga0055536_1000615 3300003781 Bacteria 24257
18 Ga0055536_1001597 3300003781 Bacteria 13543
19 Ga0055530_10000374 3300003791 Bacteria 40490
20 Ga0055530_10000913 3300003791 Bacteria 24257
21 Ga0055530_10001513 3300003791 Bacteria 16818
22 Ga0055540_1000337 3300003792 Bacteria 40512
23 Ga0055540_1000646 3300003792 Bacteria 24561
24 Ga0055540_1000657 3300003792 Bacteria 24257
25 Ga0055541_1000035 3300003841 Bacteria 190238
26 Ga0065714_10000271 3300005288 Bacteria 6394
27 Ga0065714_10002407 3300005288 Bacteria 25040
28 Ga0065714_10002555 3300005288 Bacteria 14479
29 Ga0065714_10005071 3300005288 Bacteria 5266
30 Ga0065714_10007731 3300005288 Bacteria 4682
31 Ga0065714_10017866 3300005288 Bacteria 1684
32 Ga0065714_10065252 3300005288 Bacteria 11462
33 Ga0065704_10071239 3300005289 Bacteria 12316
34 Ga0065715_10003345 3300005293 Bacteria 5314
35 Ga0070670_100004108 3300005331 Bacteria 12165
36 Ga0070670_100008123 3300005331 Bacteria 8932
37 Ga0070661_100000078 3300005344 Bacteria 77449
38 Ga0070669_100007551 3300005353 Bacteria 7785
39 Ga0070669_100009189 3300005353 Bacteria 7041
40 Ga0070662_100001096 3300005457 Bacteria 16494
41 Ga0070662_100062359 3300005457 Bacteria 2723
42 Ga0068853_100000210 3300005539 Bacteria 41425
43 Ga0070665_100065453 3300005548 Bacteria 3646
44 Ga0070665_100162812 3300005548 Bacteria 2233
45 Ga0070664_100010072 3300005564 Bacteria 7663
46 Ga0070664_100013220 3300005564 Bacteria 6722
47 Ga0068851_10000004 3300005834 Bacteria 269685
48 Ga0075364_10031283 3300006051 Bacteria 3419
49 Ga0075432_10000601 3300006058 Bacteria 10900
50 Ga0075432_10001012 3300006058 Bacteria 8913
51 Ga0075432_10014361 3300006058 Bacteria 2698
52 Ga0075432_10014569 3300006058 Bacteria 2677
53 Ga0075432_10042754 3300006058 Bacteria 1586
54 Ga0075432_10043348 3300006058 Bacteria 1576
55 Ga0075432_10044040 3300006058 Bacteria 1564
56 Ga0099823_1006343 3300006944 Bacteria 11927
57 Ga0099823_1012277 3300006944 Bacteria 8666
58 Ga0079104_1000638 3300006946 Bacteria 34050
59 Ga0079104_1000654 3300006946 Bacteria 33184
60 Ga0099826_10032053 3300006948 Bacteria 3793
61 Ga0105251_10000382 3300009011 Bacteria 43597
62 Ga0105251_10003990 3300009011 Bacteria 10440
63 Ga0105251_10004137 3300009011 Bacteria 10117
64 Ga0105251_10004613 3300009011 Bacteria 9294
65 Ga0105251_10004877 3300009011 Bacteria 8956
66 Ga0105251_10005498 3300009011 Bacteria 8256
67 Ga0105251_10006384 3300009011 Bacteria 7526
68 Ga0105251_10006856 3300009011 Bacteria 7166
69 Ga0105251_10009645 3300009011 Bacteria 5682
70 Ga0105251_10028086 3300009011 Bacteria 2846
71 Ga0105251_10029622 3300009011 Bacteria 2756
72 Ga0105251_10053821 3300009011 Bacteria 1913
73 Ga0105244_10004027 3300009036 Bacteria 10263
74 Ga0105244_10004304 3300009036 Bacteria 9849
75 Ga0105244_10005221 3300009036 Bacteria 8684
76 Ga0105244_10005741 3300009036 Bacteria 8188
77 Ga0105244_10006252 3300009036 Bacteria 7756
78 Ga0105244_10010072 3300009036 Bacteria 5754
79 Ga0105244_10013180 3300009036 Bacteria 4842
80 Ga0105244_10016139 3300009036 Bacteria 4262
81 Ga0105244_10021132 3300009036 Bacteria 3605
82 Ga0105244_10032063 3300009036 Bacteria 2785
83 Ga0105244_10035333 3300009036 Bacteria 2626
84 Ga0105244_10056253 3300009036 Bacteria 1992
85 Ga0105244_10058303 3300009036 Bacteria 1949
86 Ga0105250_10000423 3300009092 Bacteria 30845
87 Ga0105250_10002893 3300009092 Bacteria 8387
88 Ga0105250_10058044 3300009092 Bacteria 1553
89 Ga0105243_10001058 3300009148 Bacteria 25181
90 Ga0105243_10001664 3300009148 Bacteria 19255
91 Ga0105243_10039999 3300009148 Bacteria 3659
92 Ga0105242_10006961 3300009176 Bacteria 8728
93 Ga0105237_10002728 3300009545 Bacteria 21553
94 Ga0105249_10029651 3300009553 Bacteria 4942
95 Ga0105246_10000489 3300011119 Bacteria 21461
96 Ga0105246_10002969 3300011119 Bacteria 10280
97 Ga0105246_10009646 3300011119 Bacteria 5949
98 Ga0157373_10003369 3300013100 Bacteria 12086
99 Ga0157373_10005239 3300013100 Bacteria 9733
100 Ga0157373_10006181 3300013100 Bacteria 8949
101 Ga0157373_10008297 3300013100 Bacteria 7717
102 Ga0157373_10011715 3300013100 Bacteria 6441
103 Ga0157373_10050703 3300013100 Bacteria 2955
104 Ga0157373_10070416 3300013100 Bacteria 2471
105 Ga0157373_10077249 3300013100 Bacteria 2349
106 Ga0157373_10090492 3300013100 Bacteria 2155
107 Ga0157371_10000839 3300013102 Bacteria 35135
108 Ga0157371_10003830 3300013102 Bacteria 13425
109 Ga0157371_10004311 3300013102 Bacteria 12477
110 Ga0157370_10008375 3300013104 Bacteria 11154
111 Ga0157370_10027380 3300013104 Bacteria 5621
112 Ga0157370_10080225 3300013104 Bacteria 3072
113 Ga0157370_10166590 3300013104 Bacteria 2049
114 Ga0157369_10007148 3300013105 Bacteria 12867
115 Ga0157369_10008222 3300013105 Bacteria 11963
116 Ga0157369_10021358 3300013105 Bacteria 7240
117 Ga0163162_10006614 3300013306 Bacteria 11232
118 Ga0157372_10001292 3300013307 Bacteria 27076
119 Ga0157372_10012481 3300013307 Bacteria 9054
120 Ga0157375_10014105 3300013308 Bacteria 7126
121 Ga0157375_10018201 3300013308 Bacteria 6367
122 Ga0182008_10000659 3300014497 Bacteria 25061
123 Ga0182008_10003185 3300014497 Bacteria 10029
124 Ga0182008_10003945 3300014497 Bacteria 8780
125 Ga0182008_10004154 3300014497 Bacteria 8525
126 Ga0182008_10008895 3300014497 Bacteria 5447
127 Ga0182008_10031954 3300014497 Bacteria 2647
128 Ga0182008_10036750 3300014497 Bacteria 2450
129 Ga0182008_10041511 3300014497 Bacteria 2294
130 Ga0182008_10060592 3300014497 Bacteria 1866
131 Ga0182008_10073853 3300014497 Bacteria 1678
132 Ga0182006_1000865 3300015261 Bacteria 20335
133 Ga0182006_1002130 3300015261 Bacteria 11017
134 Ga0182006_1002538 3300015261 Bacteria 9916
135 Ga0182006_1002882 3300015261 Bacteria 9140
136 Ga0182006_1006834 3300015261 Bacteria 5266
137 Ga0182006_1007785 3300015261 Bacteria 4885
138 Ga0182006_1008021 3300015261 Bacteria 4798
139 Ga0182007_10000541 3300015262 Bacteria 22282
140 Ga0182007_10011480 3300015262 Bacteria 3447
141 Ga0182007_10037098 3300015262 Bacteria 1637
142 Ga0182005_1000461 3300015265 Bacteria 21298
143 Ga0182005_1003299 3300015265 Bacteria 5515
144 Ga0182005_1012050 3300015265 Bacteria 2449
145 Ga0182005_1017127 3300015265 Bacteria 2007
146 Ga0182005_1018006 3300015265 Bacteria 1954
147 Ga0182005_1018937 3300015265 Bacteria 1900
148 Ga0163161_10008731 3300017792 Bacteria 7005
149 Ga0163161_10009569 3300017792 Bacteria 6701
150 Ga0163161_10011258 3300017792 Bacteria 6197
151 Ga0163161_10017309 3300017792 Bacteria 5043
152 Ga0163161_10025965 3300017792 Bacteria 4148
153 Ga0163161_10040996 3300017792 Bacteria 3326
154 Ga0209435_100426 3300025206 Bacteria 8855
155 Ga0209760_100181 3300025207 Bacteria 33125
156 Ga0209760_100215 3300025207 Bacteria 25872
157 Ga0209784_100028 3300025224 Bacteria 357464
158 Ga0209566_100028 3300025225 Bacteria 357464
159 Ga0209674_100047 3300025226 Bacteria 357464
160 Ga0209147_100031 3300025229 Bacteria 357464
161 Ga0209563_100050 3300025230 Bacteria 357464
162 Ga0207427_100014 3300025231 Bacteria 561361
163 Ga0207427_100016 3300025231 Bacteria 538697
164 Ga0209437_100011 3300025233 Bacteria 818520
165 Ga0209437_100016 3300025233 Bacteria 710118
166 Ga0209258_100150 3300025242 Bacteria 161813
167 Ga0209646_1000165 3300025246 Bacteria 88117
168 Ga0209677_100029 3300025253 Bacteria 357464
169 Ga0209233_1000019 3300025261 Bacteria 818520
170 Ga0209233_1000036 3300025261 Bacteria 561361
171 Ga0209675_1007790 3300025291 Bacteria 4039
172 Ga0209676_1000025 3300025292 Bacteria 577569
173 Ga0209676_1000032 3300025292 Bacteria 469558
174 Ga0209676_1002421 3300025292 Bacteria 13299
175 Ga0209050_1000025 3300025298 Bacteria 528225
176 Ga0209050_1000028 3300025298 Bacteria 477133
177 Ga0209050_1001079 3300025298 Bacteria 33360
178 Ga0209050_1001508 3300025298 Bacteria 24613
179 Ga0209051_1000026 3300025303 Bacteria 413311
180 Ga0209051_1000080 3300025303 Bacteria 199694
181 Ga0209051_1000334 3300025303 Bacteria 70713
182 Ga0209257_1000034 3300025304 Bacteria 662719
183 Ga0209257_1019157 3300025304 Bacteria 2592
184 Ga0207656_10000007 3300025321 Bacteria 289154
185 Ga0207696_1000057 3300025711 Bacteria 249404
186 Ga0207696_1000074 3300025711 Bacteria 215333
187 Ga0207696_1000229 3300025711 Bacteria 79025
188 Ga0207696_1001793 3300025711 Bacteria 11084
189 Ga0207655_1000014 3300025728 Bacteria 607124
190 Ga0207655_1000474 3300025728 Bacteria 51960
191 Ga0207655_1000565 3300025728 Bacteria 45949
192 Ga0207655_1000777 3300025728 Bacteria 35181
193 Ga0207655_1002792 3300025728 Bacteria 13564
194 Ga0207655_1003504 3300025728 Bacteria 11639
195 Ga0207655_1004010 3300025728 Bacteria 10640
196 Ga0207655_1004125 3300025728 Bacteria 10440
197 Ga0207655_1005640 3300025728 Bacteria 8465
198 Ga0207655_1005928 3300025728 Bacteria 8184
199 Ga0207655_1009639 3300025728 Bacteria 5972
200 Ga0207655_1011746 3300025728 Bacteria 5182
201 Ga0207655_1016731 3300025728 Bacteria 3996
202 Ga0207655_1026247 3300025728 Bacteria 2801
203 Ga0207713_1000031 3300025735 Bacteria 283971
204 Ga0207713_1000759 3300025735 Bacteria 30004
205 Ga0207713_1000763 3300025735 Bacteria 29784
206 Ga0207713_1001215 3300025735 Bacteria 21550
207 Ga0207713_1001550 3300025735 Bacteria 18076
208 Ga0207713_1001942 3300025735 Bacteria 15635
209 Ga0207713_1003265 3300025735 Bacteria 11173
210 Ga0207713_1003705 3300025735 Bacteria 10273
211 Ga0207713_1003852 3300025735 Bacteria 10015
212 Ga0207713_1004732 3300025735 Bacteria 8755
213 Ga0207713_1005940 3300025735 Bacteria 7534
214 Ga0207713_1006872 3300025735 Bacteria 6847
215 Ga0207713_1008135 3300025735 Bacteria 6080
216 Ga0207713_1014266 3300025735 Bacteria 4140
217 Ga0207713_1019362 3300025735 Bacteria 3331
218 Ga0207713_1020038 3300025735 Bacteria 3254
219 Ga0207671_10000015 3300025914 Bacteria 439607
220 Ga0207649_10000001 3300025920 Bacteria 537851
221 Ga0207681_10000480 3300025923 Bacteria 27941
222 Ga0207681_10007523 3300025923 Bacteria 6672
223 Ga0207650_10000868 3300025925 Bacteria 22902
224 Ga0207650_10001153 3300025925 Bacteria 19401
225 Ga0207706_10000624 3300025933 Bacteria 37622
226 Ga0207706_10006068 3300025933 Bacteria 11230
227 Ga0207686_10004833 3300025934 Bacteria 7240
228 Ga0207709_10000022 3300025935 Bacteria 383573
229 Ga0207709_10000578 3300025935 Bacteria 30734
230 Ga0207709_10011620 3300025935 Bacteria 4855
231 Ga0207679_10000011 3300025945 Bacteria 346112
232 Ga0207679_10009671 3300025945 Bacteria 6181
233 Ga0207712_10050930 3300025961 Bacteria 2893
234 Ga0207639_10000706 3300026041 Bacteria 22900
235 Ga0209281_1000026 3300027111 Bacteria 465877
236 Ga0209281_1000033 3300027111 Bacteria 383539
237 Ga0209281_1001566 3300027111 Bacteria 12537
238 Ga0209389_1000044 3300027296 Bacteria 122917
239 Ga0209371_1000473 3300027312 Bacteria 39544
240 Ga0209282_1033152 3300027666 Bacteria 3150
241 Ga0207428_10007988 3300027907 Bacteria 9606
242 Ga0207428_10028455 3300027907 Bacteria 4644
243 Ga0207428_10032366 3300027907 Bacteria 4302
244 Ga0207428_10116693 3300027907 Bacteria 2050
245 Ga0268266_10097104 3300028379 Bacteria 2591
246 Ga0307517_10029705 3300028786 Bacteria 6439
247 Ga0268256_1000399 3300030500 Bacteria 39584
248 Ga0316181_1024646 3300030744 Bacteria 10911
249 Ga0265316_10048058 3300031344 Bacteria 3372
250 Ga0307509_10012737 3300031507 Bacteria 10022
251 Ga0307408_100002000 3300031548 Bacteria 14729
252 Ga0307408_100021746 3300031548 Bacteria 4345
253 Ga0307405_10000898 3300031731 Bacteria 11816
254 Ga0307412_10001787 3300031911 Bacteria 11884
255 Ga0307412_10005902 3300031911 Bacteria 6897
256 Ga0307412_10069839 3300031911 Bacteria 2392
257 Ga0307414_10084382 3300032004 Bacteria 2336
258 Ga0307411_10001539 3300032005 Bacteria 9524
259 Ga0439438_001378 3300041405 Bacteria 10719
260 Ga0439438_002269 3300041405 Bacteria 8240
261 Ga0439438_002357 3300041405 Bacteria 8058
262 Ga0439438_003653 3300041405 Bacteria 6147
263 Ga0439438_004508 3300041405 Bacteria 5317
264 Ga0439438_008136 3300041405 Bacteria 3511
265 Ga0439447_001145 3300041407 Bacteria 9655
266 Ga0439447_001731 3300041407 Bacteria 7996
267 Ga0439447_001958 3300041407 Bacteria 7552
268 Ga0439447_007915 3300041407 Bacteria 3330
269 Ga0439447_011676 3300041407 Bacteria 2552
270 Ga0439466_0000909 3300041411 Bacteria 11275
271 Ga0439466_0002064 3300041411 Bacteria 7874
272 Ga0439466_0003666 3300041411 Bacteria 5928
273 Ga0439466_0004339 3300041411 Bacteria 5471
274 Ga0439466_0004653 3300041411 Bacteria 5271
275 Ga0439466_0011844 3300041411 Bacteria 3220
276 Ga0439466_0030039 3300041411 Bacteria 1866
277 Ga0439432_000297 3300042006 Bacteria 17862
278 Ga0439432_001015 3300042006 Bacteria 10606
279 Ga0439432_001566 3300042006 Bacteria 8592
280 Ga0439432_002942 3300042006 Bacteria 6345
281 Ga0439432_007896 3300042006 Bacteria 3751
282 Ga0439451_000331 3300042009 Bacteria 9183
283 Ga0439451_010410 3300042009 Bacteria 1874
284 Ga0439452_000474 3300042010 Bacteria 22539
285 Ga0439452_000564 3300042010 Bacteria 19451
286 Ga0439452_001259 3300042010 Bacteria 10751
287 Ga0439452_001613 3300042010 Bacteria 8917
288 Ga0439456_000149 3300042013 Bacteria 20807
289 Ga0439456_000482 3300042013 Bacteria 8705
290 Ga0439456_000834 3300042013 Bacteria 6235
291 Ga0439456_001914 3300042013 Bacteria 4191
292 Ga0439463_000964 3300042016 Bacteria 7844
293 Ga0439463_001162 3300042016 Bacteria 7039
294 Ga0439463_001490 3300042016 Bacteria 6186
295 Ga0450911_000837 3300042115 Bacteria 8396
296 Ga0450920_000090 3300042122 Bacteria 12063
297 Ga0450922_000081 3300042124 Bacteria 8892
298 Ga0450923_000068 3300042125 Bacteria 8299
299 Ga0450891_001279 3300042129 Bacteria 2612
300 Ga0450898_000158 3300042134 Bacteria 6917
301 Ga0450902_000058 3300042137 Bacteria 10573
302 Ga0450902_000150 3300042137 Bacteria 7835
303 Ga0450902_006281 3300042137 Bacteria 1818
304 Ga0450903_001104 3300042138 Bacteria 5125
305 Ga0450904_000670 3300042139 Bacteria 6117
306 Ga0450905_000098 3300042142 Bacteria 8505
307 Ga0450905_005057 3300042142 Bacteria 1765
308 Ga0450906_000245 3300042145 Bacteria 10444
309 Ga0450906_000879 3300042145 Bacteria 6577
310 Ga0450907_000624 3300042146 Bacteria 9364
311 Ga0450907_000702 3300042146 Bacteria 8627
312 Ga0450910_000278 3300042147 Bacteria 5933
313 Ga0439446_0000304 3300042156 Bacteria 9338
314 Ga0450908_006369 3300042184 Bacteria 2245
315 Ga0450909_000098 3300042185 Bacteria 8517
316 Ga0439434_0000748 3300042435 Bacteria 9333
317 Ga0439460_0002529 3300042461 Bacteria 4416
318 Ga0450901_000055 3300042533 Bacteria 11189
319 Ga0495617_001442 3300046452 Bacteria 10439
320 Ga0495617_004215 3300046452 Bacteria 5257
321 Ga0495617_005152 3300046452 Bacteria 4666
322 Ga0495617_005547 3300046452 Bacteria 4465
323 Ga0495617_027753 3300046452 Bacteria 1903
324 Ga0495617_041264 3300046452 Bacteria 1542
325 Ga0495617_043035 3300046452 Bacteria 1508
326 Ga0495627_000175 3300046453 Bacteria 72658
327 Ga0495627_002112 3300046453 Bacteria 10057
328 Ga0495627_002590 3300046453 Bacteria 8550
329 Ga0495627_003266 3300046453 Bacteria 7267
330 Ga0495627_022603 3300046453 Bacteria 2068
331 Ga0495627_031185 3300046453 Bacteria 1685
332 Ga0495603_0005302 3300046455 Bacteria 7686
333 Ga0495590_0001798 3300046457 Bacteria 9082
334 Ga0495590_0002250 3300046457 Bacteria 8055
335 Ga0495590_0004093 3300046457 Bacteria 5913
336 Ga0495590_0006346 3300046457 Bacteria 4620
337 Ga0495590_0020215 3300046457 Bacteria 2366
338 Ga0495590_0041490 3300046457 Bacteria 1604
339 Ga0495591_000161 3300046458 Bacteria 71199
340 Ga0495591_000417 3300046458 Bacteria 35343
341 Ga0495591_001031 3300046458 Bacteria 18858
342 Ga0495591_002193 3300046458 Bacteria 11159
343 Ga0495591_002423 3300046458 Bacteria 10395
344 Ga0495591_002736 3300046458 Bacteria 9549
345 Ga0495591_003299 3300046458 Bacteria 8435
346 Ga0495591_003482 3300046458 Bacteria 8104
347 Ga0495591_003597 3300046458 Bacteria 7906
348 Ga0495591_013428 3300046458 Bacteria 2996
349 Ga0495591_017373 3300046458 Bacteria 2472
350 Ga0495591_019776 3300046458 Bacteria 2244
351 Ga0495591_023991 3300046458 Bacteria 1942
352 Ga0495629_0018010 3300046459 Bacteria 5062
353 Ga0495638_0005442 3300046460 Bacteria 9468
354 Ga0495638_0006204 3300046460 Bacteria 8732
355 Ga0495638_0007873 3300046460 Bacteria 7603
356 Ga0495638_0016914 3300046460 Bacteria 4875
357 Ga0495638_0018664 3300046460 Bacteria 4602
358 Ga0495638_0030597 3300046460 Bacteria 3463
359 Ga0495638_0105714 3300046460 Bacteria 1677
360 Ga0495653_0002977 3300046463 Bacteria 13568
361 Ga0495653_0005805 3300046463 Bacteria 10100
362 Ga0495653_0008679 3300046463 Bacteria 8329
363 Ga0495653_0017736 3300046463 Bacteria 5786
364 Ga0495650_0002247 3300046471 Bacteria 16153
365 Ga0495650_0003440 3300046471 Bacteria 11550
366 Ga0495650_0004934 3300046471 Bacteria 8911
367 Ga0495650_0005336 3300046471 Bacteria 8386
368 Ga0495650_0005720 3300046471 Bacteria 7962
369 Ga0495650_0006998 3300046471 Bacteria 6886
370 Ga0495650_0034243 3300046471 Bacteria 2251
371 Ga0495582_0018283 3300046473 Bacteria 3834
372 Ga0495605_0000062 3300046474 Bacteria 143176
373 Ga0495605_0000646 3300046474 Bacteria 26667
374 Ga0495605_0000833 3300046474 Bacteria 21773
375 Ga0495605_0000975 3300046474 Bacteria 19463
376 Ga0495605_0003152 3300046474 Bacteria 9924
377 Ga0495605_0003776 3300046474 Bacteria 8985
378 Ga0495605_0003985 3300046474 Bacteria 8726
379 Ga0495605_0004432 3300046474 Bacteria 8253
380 Ga0495605_0005813 3300046474 Bacteria 7138
381 Ga0495605_0013836 3300046474 Bacteria 4433
382 Ga0495605_0029610 3300046474 Bacteria 2815
383 Ga0495605_0075626 3300046474 Bacteria 1583
384 Ga0495639_0000316 3300046475 Bacteria 23437
385 Ga0495639_0007211 3300046475 Bacteria 4771
386 Ga0495584_0002234 3300046491 Bacteria 11049
387 Ga0495584_0002560 3300046491 Bacteria 10250
388 Ga0495584_0002571 3300046491 Bacteria 10237
389 Ga0495584_0002775 3300046491 Bacteria 9787
390 Ga0495584_0011921 3300046491 Bacteria 4443
391 Ga0495584_0012532 3300046491 Bacteria 4328
392 Ga0495584_0012837 3300046491 Bacteria 4275
393 Ga0495584_0012855 3300046491 Bacteria 4272
394 Ga0495584_0018002 3300046491 Bacteria 3591
395 Ga0495584_0019847 3300046491 Bacteria 3415
396 Ga0495584_0033928 3300046491 Bacteria 2582
397 Ga0495585_0000557 3300046492 Bacteria 35226
398 Ga0495585_0005299 3300046492 Bacteria 8147
399 Ga0495585_0006374 3300046492 Bacteria 7330
400 Ga0495585_0006903 3300046492 Bacteria 6995
401 Ga0495585_0007075 3300046492 Bacteria 6898
402 Ga0495585_0007890 3300046492 Bacteria 6474
403 Ga0495585_0010370 3300046492 Bacteria 5549
404 Ga0495585_0042400 3300046492 Bacteria 2549
405 Ga0495585_0043445 3300046492 Bacteria 2514
406 Ga0495585_0052382 3300046492 Bacteria 2259
407 Ga0495594_0004554 3300046499 Bacteria 7131
408 Ga0495594_0016045 3300046499 Bacteria 3940
409 Ga0495596_0000758 3300046500 Bacteria 19744
410 Ga0495596_0007877 3300046500 Bacteria 4771
411 Ga0495607_0000527 3300046501 Bacteria 37600
412 Ga0495607_0000732 3300046501 Bacteria 31512
413 Ga0495607_0000795 3300046501 Bacteria 29922
414 Ga0495607_0007446 3300046501 Bacteria 7574
415 Ga0495607_0008264 3300046501 Bacteria 7121
416 Ga0495607_0009018 3300046501 Bacteria 6781
417 Ga0495607_0011074 3300046501 Bacteria 6021
418 Ga0495607_0011245 3300046501 Bacteria 5970
419 Ga0495607_0012045 3300046501 Bacteria 5724
420 Ga0495607_0012445 3300046501 Bacteria 5617
421 Ga0495607_0012968 3300046501 Bacteria 5480
422 Ga0495607_0015365 3300046501 Bacteria 4964
423 Ga0495607_0015979 3300046501 Bacteria 4851
424 Ga0495607_0018460 3300046501 Bacteria 4448
425 Ga0495607_0023336 3300046501 Bacteria 3873
426 Ga0495607_0023599 3300046501 Bacteria 3847
427 Ga0495607_0029518 3300046501 Bacteria 3373
428 Ga0495607_0060837 3300046501 Bacteria 2148
429 Ga0495607_0072760 3300046501 Bacteria 1913
430 Ga0495583_0000015 3300046506 Bacteria 316392
431 Ga0495583_0000821 3300046506 Bacteria 38030
432 Ga0495583_0001873 3300046506 Bacteria 19571
433 Ga0495583_0002202 3300046506 Bacteria 17276
434 Ga0495583_0003311 3300046506 Bacteria 12483
435 Ga0495583_0003317 3300046506 Bacteria 12475
436 Ga0495583_0004552 3300046506 Bacteria 9862
437 Ga0495583_0004556 3300046506 Bacteria 9860
438 Ga0495583_0006466 3300046506 Bacteria 7657
439 Ga0495583_0007403 3300046506 Bacteria 6908
440 Ga0495583_0008953 3300046506 Bacteria 6040
441 Ga0495606_0000352 3300046507 Bacteria 78743
442 Ga0495606_0005707 3300046507 Bacteria 11777
443 Ga0495606_0008397 3300046507 Bacteria 8986
444 Ga0495606_0008932 3300046507 Bacteria 8580
445 Ga0495606_0008985 3300046507 Bacteria 8548
446 Ga0495606_0008987 3300046507 Bacteria 8548
447 Ga0495606_0015973 3300046507 Bacteria 5750
448 Ga0495606_0021664 3300046507 Bacteria 4701
449 Ga0495606_0035692 3300046507 Bacteria 3396
450 Ga0495610_0003697 3300046512 Bacteria 11729
451 Ga0495610_0003975 3300046512 Bacteria 11176
452 Ga0495610_0005381 3300046512 Bacteria 9130
453 Ga0495610_0006139 3300046512 Bacteria 8369
454 Ga0495610_0006509 3300046512 Bacteria 8015
455 Ga0495610_0009977 3300046512 Bacteria 5938
456 Ga0495610_0016511 3300046512 Bacteria 4245
457 Ga0495610_0017463 3300046512 Bacteria 4089
458 Ga0495610_0022506 3300046512 Bacteria 3446
459 Ga0495610_0023099 3300046512 Bacteria 3388
460 Ga0495610_0082914 3300046512 Bacteria 1468
461 Ga0495616_0004193 3300046513 Bacteria 9136
462 Ga0495616_0004894 3300046513 Bacteria 8368
463 Ga0495616_0065705 3300046513 Bacteria 1766
464 Ga0495616_0079819 3300046513 Bacteria 1567
465 Ga0495620_0000050 3300046515 Bacteria 105651
466 Ga0495620_0000091 3300046515 Bacteria 73076
467 Ga0495620_0002084 3300046515 Bacteria 11621
468 Ga0495620_0003226 3300046515 Bacteria 9351
469 Ga0495620_0004405 3300046515 Bacteria 7938
470 Ga0495620_0005551 3300046515 Bacteria 7029
471 Ga0495620_0005884 3300046515 Bacteria 6807
472 Ga0495620_0017960 3300046515 Bacteria 3513
473 Ga0495630_0013898 3300046517 Bacteria 5855
474 Ga0495630_0028393 3300046517 Bacteria 4157
475 Ga0495631_0000717 3300046518 Bacteria 21274
476 Ga0495631_0002121 3300046518 Bacteria 11486
477 Ga0495631_0002629 3300046518 Bacteria 10028
478 Ga0495631_0003220 3300046518 Bacteria 8984
479 Ga0495631_0003554 3300046518 Bacteria 8523
480 Ga0495631_0018649 3300046518 Bacteria 3263
481 Ga0495631_0025862 3300046518 Bacteria 2699
482 Ga0495631_0028916 3300046518 Bacteria 2526
483 Ga0495632_0000679 3300046519 Bacteria 31086
484 Ga0495632_0001245 3300046519 Bacteria 21589
485 Ga0495632_0001634 3300046519 Bacteria 18383
486 Ga0495632_0003263 3300046519 Bacteria 11608
487 Ga0495632_0003440 3300046519 Bacteria 11237
488 Ga0495632_0005417 3300046519 Bacteria 8439
489 Ga0495632_0005798 3300046519 Bacteria 8099
490 Ga0495632_0007681 3300046519 Bacteria 6734
491 Ga0495632_0007992 3300046519 Bacteria 6565
492 Ga0495632_0008330 3300046519 Bacteria 6375
493 Ga0495632_0014844 3300046519 Bacteria 4391
494 Ga0495632_0018512 3300046519 Bacteria 3822
495 Ga0495632_0025841 3300046519 Bacteria 3100
496 Ga0495632_0037473 3300046519 Bacteria 2460
497 Ga0495637_0000020 3300046520 Bacteria 181611
498 Ga0495637_0000857 3300046520 Bacteria 19891
499 Ga0495637_0000916 3300046520 Bacteria 18923
500 Ga0495637_0003453 3300046520 Bacteria 8399
501 Ga0495637_0003999 3300046520 Bacteria 7692
502 Ga0495637_0004412 3300046520 Bacteria 7302
503 Ga0495637_0006304 3300046520 Bacteria 5968
504 Ga0495637_0006539 3300046520 Bacteria 5840
505 Ga0495637_0006694 3300046520 Bacteria 5769
506 Ga0495637_0006756 3300046520 Bacteria 5740
507 Ga0495637_0010548 3300046520 Bacteria 4463
508 Ga0495637_0015819 3300046520 Bacteria 3533
509 Ga0495637_0027717 3300046520 Bacteria 2531
510 Ga0495637_0030050 3300046520 Bacteria 2412
511 Ga0495643_0000501 3300046522 Bacteria 49358
512 Ga0495643_0001992 3300046522 Bacteria 17077
513 Ga0495643_0004407 3300046522 Bacteria 9860
514 Ga0495643_0006391 3300046522 Bacteria 7779
515 Ga0495643_0008423 3300046522 Bacteria 6527
516 Ga0495643_0021643 3300046522 Bacteria 3684
517 Ga0495643_0036666 3300046522 Bacteria 2692
518 Ga0495644_0000395 3300046523 Bacteria 19560
519 Ga0495644_0001131 3300046523 Bacteria 10939
520 Ga0495644_0002024 3300046523 Bacteria 8157
521 Ga0495644_0003187 3300046523 Bacteria 6483
522 Ga0495648_0000635 3300046524 Bacteria 37534
523 Ga0495648_0002359 3300046524 Bacteria 17539
524 Ga0495648_0005871 3300046524 Bacteria 10094
525 Ga0495648_0007286 3300046524 Bacteria 8874
526 Ga0495648_0007786 3300046524 Bacteria 8523
527 Ga0495648_0009611 3300046524 Bacteria 7465
528 Ga0495648_0010230 3300046524 Bacteria 7165
529 Ga0495648_0010567 3300046524 Bacteria 7019
530 Ga0495648_0010792 3300046524 Bacteria 6936
531 Ga0495648_0020440 3300046524 Bacteria 4617
532 Ga0495648_0020486 3300046524 Bacteria 4610
533 Ga0495648_0034369 3300046524 Bacteria 3299
534 Ga0495648_0047789 3300046524 Bacteria 2641
535 Ga0495648_0050432 3300046524 Bacteria 2542
536 Ga0495648_0052536 3300046524 Bacteria 2475
537 Ga0495648_0089079 3300046524 Bacteria 1733
538 Ga0495666_0004668 3300046526 Bacteria 6931
539 Ga0495666_0006861 3300046526 Bacteria 5718
540 Ga0495642_0000462 3300046528 Bacteria 21321
541 Ga0495642_0000588 3300046528 Bacteria 18225
542 Ga0495642_0003542 3300046528 Bacteria 6150
543 Ga0495652_0104187 3300046529 Bacteria 2295
544 Ga0495654_0002259 3300046530 Bacteria 12463
545 Ga0495654_0002450 3300046530 Bacteria 11943
546 Ga0495654_0003122 3300046530 Bacteria 10288
547 Ga0495654_0004405 3300046530 Bacteria 8367
548 Ga0495654_0004876 3300046530 Bacteria 7897
549 Ga0495654_0005097 3300046530 Bacteria 7680
550 Ga0495654_0005388 3300046530 Bacteria 7443
551 Ga0495654_0006091 3300046530 Bacteria 6916
552 Ga0495654_0010256 3300046530 Bacteria 5099
553 Ga0495654_0025539 3300046530 Bacteria 3042
554 Ga0495654_0034362 3300046530 Bacteria 2558
555 Ga0495654_0038971 3300046530 Bacteria 2373
556 Ga0495654_0042102 3300046530 Bacteria 2269
557 Ga0495654_0054671 3300046530 Bacteria 1935
558 Ga0495587_0002748 3300046536 Bacteria 11735
559 Ga0495587_0004096 3300046536 Bacteria 9644
560 Ga0495609_0000165 3300046538 Bacteria 69573
561 Ga0495609_0000372 3300046538 Bacteria 38530
562 Ga0495609_0000461 3300046538 Bacteria 33185
563 Ga0495609_0001391 3300046538 Bacteria 16250
564 Ga0495609_0002232 3300046538 Bacteria 12117
565 Ga0495609_0003520 3300046538 Bacteria 8937
566 Ga0495597_0000124 3300046542 Bacteria 69872
567 Ga0495597_0004961 3300046542 Bacteria 7152
568 Ga0495597_0005020 3300046542 Bacteria 7097
569 Ga0495597_0005981 3300046542 Bacteria 6348
570 Ga0495597_0012884 3300046542 Bacteria 4023
571 Ga0495597_0015538 3300046542 Bacteria 3603
572 Ga0495597_0017888 3300046542 Bacteria 3329
573 Ga0495597_0023503 3300046542 Bacteria 2850
574 Ga0495597_0048473 3300046542 Bacteria 1879
575 Ga0495597_0055128 3300046542 Bacteria 1744
576 Ga0495645_0063449 3300046543 Bacteria 2675
577 Ga0495622_0002049 3300046557 Bacteria 9848
578 Ga0495622_0002492 3300046557 Bacteria 8904
579 Ga0495622_0003950 3300046557 Bacteria 6923
580 Ga0495622_0004299 3300046557 Bacteria 6631
581 Ga0495622_0005291 3300046557 Bacteria 5987
582 Ga0495622_0054103 3300046557 Bacteria 1862
583 Ga0495633_0000084 3300046558 Bacteria 124972
584 Ga0495633_0003099 3300046558 Bacteria 11283
585 Ga0495633_0027320 3300046558 Bacteria 2790
586 Ga0495633_0055934 3300046558 Bacteria 1854
587 Ga0495656_0054829 3300046615 Bacteria 1716
588 Ga0495668_0001744 3300046616 Bacteria 19951
589 Ga0495668_0009370 3300046616 Bacteria 6019
590 Ga0495668_0023514 3300046616 Bacteria 3512
591 Ga0495668_0064802 3300046616 Bacteria 2011
592 Ga0495634_0005296 3300046642 Bacteria 9954
593 Ga0495634_0028440 3300046642 Bacteria 3880
594 Ga0495611_0000318 3300046648 Bacteria 32266
595 Ga0495611_0002031 3300046648 Bacteria 9563
596 Ga0495611_0005232 3300046648 Bacteria 5558
597 Ga0495625_0000133 3300046660 Bacteria 115381
598 Ga0495625_0008067 3300046660 Bacteria 9028
599 Ga0495625_0008510 3300046660 Bacteria 8746
600 Ga0495625_0008907 3300046660 Bacteria 8484
601 Ga0495625_0013453 3300046660 Bacteria 6576
602 Ga0495625_0017703 3300046660 Bacteria 5574
603 Ga0495625_0022594 3300046660 Bacteria 4819
604 Ga0495625_0052138 3300046660 Bacteria 2930
605 Ga0495625_0071999 3300046660 Bacteria 2424
606 Ga0495625_0092714 3300046660 Bacteria 2086
607 Ga0495635_0004126 3300046663 Bacteria 10068
608 Ga0495659_0000605 3300046664 Bacteria 13217
609 Ga0495661_0000065 3300046665 Bacteria 129298
610 Ga0495661_0000370 3300046665 Bacteria 48701
611 Ga0495661_0000542 3300046665 Bacteria 39039
612 Ga0495661_0003277 3300046665 Bacteria 12025
613 Ga0495661_0005588 3300046665 Bacteria 8919
614 Ga0495661_0009858 3300046665 Bacteria 6533
615 Ga0495661_0013533 3300046665 Bacteria 5476
616 Ga0495661_0030863 3300046665 Bacteria 3408
617 Ga0495661_0073602 3300046665 Bacteria 1990
618 Ga0495661_0089797 3300046665 Bacteria 1750
619 Ga0495588_0016240 3300046674 Bacteria 3596
620 Ga0495657_0042211 3300046675 Bacteria 3116
621 Ga0495623_0004261 3300046679 Bacteria 9423
622 Ga0495623_0011177 3300046679 Bacteria 5808
623 Ga0495646_0003424 3300046680 Bacteria 9863
624 Ga0495669_0001514 3300046684 Bacteria 9576
625 Ga0495669_0032199 3300046684 Bacteria 2304
626 Ga0495613_0008930 3300046689 Bacteria 7437
627 Ga0495613_0010283 3300046689 Bacteria 6950
628 Ga0495624_0005967 3300046690 Bacteria 8700
629 Ga0495670_0002336 3300046691 Bacteria 9357
630 Ga0495670_0002653 3300046691 Bacteria 8828
631 Ga0495670_0004237 3300046691 Bacteria 7029
632 Ga0495670_0005926 3300046691 Bacteria 5984
633 Ga0495670_0009794 3300046691 Bacteria 4710
634 Ga0495670_0012068 3300046691 Bacteria 4251
635 Ga0495670_0049082 3300046691 Bacteria 2111
636 Ga0495670_0081437 3300046691 Bacteria 1649
637 Ga0495670_0094953 3300046691 Bacteria 1529
638 Ga0495671_0000786 3300046692 Bacteria 22790
639 Ga0495671_0001310 3300046692 Bacteria 16964
640 Ga0495671_0003320 3300046692 Bacteria 9942
641 Ga0495671_0003487 3300046692 Bacteria 9647
642 Ga0495671_0004310 3300046692 Bacteria 8547
643 Ga0495671_0006160 3300046692 Bacteria 6962
644 Ga0495671_0009354 3300046692 Bacteria 5471
645 Ga0495671_0021574 3300046692 Bacteria 3381
646 Ga0495671_0043790 3300046692 Bacteria 2246
647 Ga0495671_0073632 3300046692 Bacteria 1676
648 Ga0495649_0003199 3300046694 Bacteria 11193
649 Ga0495649_0003370 3300046694 Bacteria 10823
650 Ga0495649_0004320 3300046694 Bacteria 9316
651 Ga0495649_0004350 3300046694 Bacteria 9284
652 Ga0495649_0004814 3300046694 Bacteria 8741
653 Ga0495649_0004985 3300046694 Bacteria 8538
654 Ga0495649_0006039 3300046694 Bacteria 7572
655 Ga0495649_0017665 3300046694 Bacteria 4022
656 Ga0495649_0032303 3300046694 Bacteria 2883
657 Ga0495649_0038300 3300046694 Bacteria 2631
658 Ga0495649_0047724 3300046694 Bacteria 2328
659 Ga0495649_0067940 3300046694 Bacteria 1912
660 Ga0495589_0000941 3300046794 Bacteria 17855
661 Ga0495589_0003249 3300046794 Bacteria 8860
662 Ga0495589_0003604 3300046794 Bacteria 8368
663 Ga0495589_0004711 3300046794 Bacteria 7242
664 Ga0495589_0004783 3300046794 Bacteria 7198
665 Ga0495589_0006037 3300046794 Bacteria 6400
666 Ga0495589_0013427 3300046794 Bacteria 4226
667 Ga0495589_0014107 3300046794 Bacteria 4118
668 Ga0495589_0025126 3300046794 Bacteria 3024
669 Ga0495589_0030589 3300046794 Bacteria 2711
670 Ga0495600_0066338 3300046809 Bacteria 2359
671 Ga0495660_0001082 3300046810 Bacteria 19519
672 Ga0495660_0001226 3300046810 Bacteria 17879
673 Ga0495660_0002767 3300046810 Bacteria 11064
674 Ga0495660_0005352 3300046810 Bacteria 7685
675 Ga0495660_0005441 3300046810 Bacteria 7621
676 Ga0495660_0005610 3300046810 Bacteria 7503
677 Ga0495660_0005629 3300046810 Bacteria 7489
678 Ga0495660_0006590 3300046810 Bacteria 6861
679 Ga0495660_0007568 3300046810 Bacteria 6376
680 Ga0495660_0008262 3300046810 Bacteria 6097
681 Ga0495660_0009867 3300046810 Bacteria 5555
682 Ga0495660_0011202 3300046810 Bacteria 5206
683 Ga0495660_0011598 3300046810 Bacteria 5112
684 Ga0495660_0021434 3300046810 Bacteria 3700
685 Ga0495660_0060844 3300046810 Bacteria 2027
686 Ga0495581_0004162 3300047315 Bacteria 8339
687 Ga0495604_0005247 3300047317 Bacteria 10269
688 Ga0495604_0007882 3300047317 Bacteria 8435
689 Ga0495604_0031110 3300047317 Bacteria 4235
690 Ga0495636_0026959 3300047318 Bacteria 2339
691 Ga0495674_0011022 3300047319 Bacteria 8535
692 Ga0495672_0000763 3300047320 Bacteria 35066
693 Ga0495672_0001738 3300047320 Bacteria 21056
694 Ga0495672_0002133 3300047320 Bacteria 18537
695 Ga0495672_0003189 3300047320 Bacteria 14258
696 Ga0495672_0004228 3300047320 Bacteria 11862
697 Ga0495672_0005299 3300047320 Bacteria 10264
698 Ga0495672_0006667 3300047320 Bacteria 8867
699 Ga0495672_0012989 3300047320 Bacteria 5768
700 Ga0495672_0014504 3300047320 Bacteria 5395
701 Ga0495672_0019001 3300047320 Bacteria 4545
702 Ga0495672_0020646 3300047320 Bacteria 4310
703 Ga0495672_0024790 3300047320 Bacteria 3856
704 Ga0495672_0030072 3300047320 Bacteria 3412
705 Ga0495672_0037898 3300047320 Bacteria 2946
706 Ga0495672_0045538 3300047320 Bacteria 2624
707 Ga0495672_0080463 3300047320 Bacteria 1817
708 Ga0495676_0001453 3300047321 Bacteria 20460
709 Ga0495676_0015179 3300047321 Bacteria 6869
710 Ga0495680_0002151 3300047322 Bacteria 20443
711 Ga0495680_0007525 3300047322 Bacteria 9969
712 Ga0495680_0020467 3300047322 Bacteria 5566
713 Ga0495680_0032203 3300047322 Bacteria 4260
714 Ga0495683_0000109 3300047323 Bacteria 84488
715 Ga0495683_0001899 3300047323 Bacteria 13070
716 Ga0495683_0002029 3300047323 Bacteria 12545
717 Ga0495683_0002933 3300047323 Bacteria 10094
718 Ga0495683_0003501 3300047323 Bacteria 9139
719 Ga0495683_0004084 3300047323 Bacteria 8361
720 Ga0495683_0007161 3300047323 Bacteria 6050
721 Ga0495683_0007282 3300047323 Bacteria 6002
722 Ga0495683_0022247 3300047323 Bacteria 3260
723 Ga0495687_002205 3300047443 Bacteria 16130
724 Ga0495687_003021 3300047443 Bacteria 12667
725 Ga0495687_004728 3300047443 Bacteria 9018
726 Ga0495687_005256 3300047443 Bacteria 8318
727 Ga0495675_0001494 3300047444 Bacteria 14159
728 Ga0495675_0020858 3300047444 Bacteria 4170
729 Ga0495677_0002169 3300047445 Bacteria 7770
730 Ga0495679_000132 3300047446 Bacteria 66186
731 Ga0495679_000786 3300047446 Bacteria 20140
732 Ga0495679_001747 3300047446 Bacteria 11954
733 Ga0495679_001764 3300047446 Bacteria 11873
734 Ga0495679_002919 3300047446 Bacteria 8464
735 Ga0495679_004218 3300047446 Bacteria 6688
736 Ga0495679_005028 3300047446 Bacteria 5946
737 Ga0495679_011058 3300047446 Bacteria 3506
738 Ga0495679_017212 3300047446 Bacteria 2592
739 Ga0495685_001013 3300047447 Bacteria 8555
740 Ga0495685_021998 3300047447 Bacteria 2194
741 Ga0495673_0001132 3300047469 Bacteria 22874
742 Ga0495673_0002691 3300047469 Bacteria 12232
743 Ga0495673_0002700 3300047469 Bacteria 12205
744 Ga0495673_0003605 3300047469 Bacteria 10145
745 Ga0495673_0003616 3300047469 Bacteria 10117
746 Ga0495673_0003897 3300047469 Bacteria 9598
747 Ga0495673_0004960 3300047469 Bacteria 8186
748 Ga0495673_0009479 3300047469 Bacteria 5389
749 Ga0495673_0010120 3300047469 Bacteria 5156
750 Ga0495673_0012839 3300047469 Bacteria 4420
751 Ga0495673_0012892 3300047469 Bacteria 4408
752 Ga0495673_0018597 3300047469 Bacteria 3498
753 Ga0495673_0019020 3300047469 Bacteria 3448
754 Ga0495673_0023398 3300047469 Bacteria 3005
755 Ga0495673_0025486 3300047469 Bacteria 2838
756 Ga0495673_0050299 3300047469 Bacteria 1829
757 Ga0495673_0069321 3300047469 Bacteria 1487
758 Ga0495681_0003486 3300047470 Bacteria 10947
759 Ga0495681_0004928 3300047470 Bacteria 9012
760 Ga0495681_0005992 3300047470 Bacteria 8058
761 Ga0495681_0006923 3300047470 Bacteria 7352
762 Ga0495681_0007905 3300047470 Bacteria 6723
763 Ga0495681_0008795 3300047470 Bacteria 6287
764 Ga0495681_0010681 3300047470 Bacteria 5538
765 Ga0495681_0012063 3300047470 Bacteria 5099
766 Ga0495681_0013880 3300047470 Bacteria 4653
767 Ga0495681_0028279 3300047470 Bacteria 2887
768 Ga0495681_0068372 3300047470 Bacteria 1616
769 Ga0495681_0070876 3300047470 Bacteria 1579
770 Ga0495681_0079462 3300047470 Bacteria 1467
771 Ga0495686_0013084 3300047472 Bacteria 5776
772 Ga0495593_0009495 3300047673 Bacteria 5644
773 Ga0495593_0009814 3300047673 Bacteria 5556
774 Ga0495593_0020888 3300047673 Bacteria 3661
775 Ga0495593_0021299 3300047673 Bacteria 3623
776 Ga0495602_0012782 3300048088 Bacteria 8608
777 Ga0495626_0000218 3300048091 Bacteria 68820
778 Ga0495626_0001181 3300048091 Bacteria 21704
779 Ga0495626_0001539 3300048091 Bacteria 18101
780 Ga0495626_0002337 3300048091 Bacteria 13373
781 Ga0495626_0003094 3300048091 Bacteria 10908
782 Ga0495626_0003755 3300048091 Bacteria 9568
783 Ga0495626_0004073 3300048091 Bacteria 9107
784 Ga0495626_0004685 3300048091 Bacteria 8298
785 Ga0495626_0007844 3300048091 Bacteria 5912
786 Ga0496101_0045109 3300048904 Bacteria 3157
787 Ga0496102_0006443 3300048905 Bacteria 10010
788 Ga0496103_0003292 3300048906 Bacteria 9886
789 Ga0496106_0022906 3300048909 Bacteria 4639
790 Ga0496108_0231525 3300048911 Bacteria 1607
791 Ga0496110_0018823 3300048913 Bacteria 5800
792 Ga0496110_0055940 3300048913 Bacteria 3472
793 Ga0496110_0070650 3300048913 Bacteria 3094
794 Ga0496112_0029719 3300048915 Bacteria 5287
795 Ga0496116_0000567 3300048919 Bacteria 49501
796 Ga0496116_0002335 3300048919 Bacteria 20086
797 Ga0496116_0007729 3300048919 Bacteria 9463
798 Ga0496116_0009039 3300048919 Bacteria 8552
799 Ga0496117_0004132 3300048920 Bacteria 16242
800 Ga0496117_0005799 3300048920 Bacteria 12808
801 Ga0496117_0006333 3300048920 Bacteria 12042
802 Ga0496117_0006819 3300048920 Bacteria 11371
803 Ga0496117_0007457 3300048920 Bacteria 10678
804 Ga0496117_0007691 3300048920 Bacteria 10436
805 Ga0496117_0008601 3300048920 Bacteria 9673
806 Ga0496117_0008611 3300048920 Bacteria 9666
807 Ga0496117_0010405 3300048920 Bacteria 8485
808 Ga0496117_0024127 3300048920 Bacteria 4821
809 Ga0496117_0051700 3300048920 Bacteria 2902
810 Ga0496117_0107499 3300048920 Bacteria 1747
811 Ga0496118_0003766 3300048921 Bacteria 18744
812 Ga0496118_0007288 3300048921 Bacteria 11777
813 Ga0496118_0009376 3300048921 Bacteria 9904
814 Ga0496118_0010498 3300048921 Bacteria 9167
815 Ga0496118_0010678 3300048921 Bacteria 9053
816 Ga0496118_0012074 3300048921 Bacteria 8338
817 Ga0496118_0013784 3300048921 Bacteria 7617
818 Ga0496118_0022519 3300048921 Bacteria 5504
819 Ga0496118_0026725 3300048921 Bacteria 4907
820 Ga0496118_0076257 3300048921 Bacteria 2385
821 Ga0496119_0000448 3300048922 Bacteria 56340
822 Ga0496119_0005376 3300048922 Bacteria 12307
823 Ga0496119_0014154 3300048922 Bacteria 6267
824 Ga0496120_0002907 3300048923 Bacteria 16370
825 Ga0496120_0003881 3300048923 Bacteria 13099
826 Ga0496120_0018637 3300048923 Bacteria 4465
827 Ga0496120_0040699 3300048923 Bacteria 2728
828 Ga0496120_0044695 3300048923 Bacteria 2571
829 Ga0496120_0055424 3300048923 Bacteria 2241
830 Ga0496121_0001560 3300048924 Bacteria 38266
831 Ga0496121_0001800 3300048924 Bacteria 34643
832 Ga0496121_0010098 3300048924 Bacteria 10707
833 Ga0496121_0016315 3300048924 Bacteria 7676
834 Ga0496121_0026333 3300048924 Bacteria 5483
835 Ga0496121_0060484 3300048924 Bacteria 3115
836 Ga0496121_0065631 3300048924 Bacteria 2952
837 Ga0496121_0071007 3300048924 Bacteria 2801
838 Ga0496121_0185490 3300048924 Bacteria 1496
839 Ga0496122_0002785 3300048925 Bacteria 24040
840 Ga0496122_0003657 3300048925 Bacteria 19977
841 Ga0496122_0009085 3300048925 Bacteria 10539
842 Ga0496122_0009984 3300048925 Bacteria 9884
843 Ga0496122_0010675 3300048925 Bacteria 9428
844 Ga0496122_0011040 3300048925 Bacteria 9221
845 Ga0496122_0012166 3300048925 Bacteria 8605
846 Ga0496122_0018998 3300048925 Bacteria 6305
847 Ga0496122_0039847 3300048925 Bacteria 3741
848 Ga0496122_0117215 3300048925 Bacteria 1729
849 Ga0496122_0125532 3300048925 Bacteria 1643
850 Ga0496123_0002915 3300048926 Bacteria 20004
851 Ga0496123_0003938 3300048926 Bacteria 16091
852 Ga0496123_0005315 3300048926 Bacteria 13027
853 Ga0496123_0007305 3300048926 Bacteria 10475
854 Ga0496123_0011821 3300048926 Bacteria 7513
855 Ga0496123_0016257 3300048926 Bacteria 6052
856 Ga0496123_0023127 3300048926 Bacteria 4766
857 Ga0496123_0054848 3300048926 Bacteria 2620
858 Ga0496123_0064330 3300048926 Bacteria 2338
859 Ga0496124_0003647 3300048927 Bacteria 18659
860 Ga0496124_0003932 3300048927 Bacteria 17752
861 Ga0496124_0007242 3300048927 Bacteria 11842
862 Ga0496124_0011500 3300048927 Bacteria 8839
863 Ga0496124_0012129 3300048927 Bacteria 8541
864 Ga0496124_0014080 3300048927 Bacteria 7757
865 Ga0496124_0025506 3300048927 Bacteria 5353
866 Ga0496124_0027879 3300048927 Bacteria 5059
867 Ga0496124_0030336 3300048927 Bacteria 4801
868 Ga0496124_0037701 3300048927 Bacteria 4202
869 Ga0496124_0042366 3300048927 Bacteria 3921
870 Ga0496124_0042755 3300048927 Bacteria 3899
871 Ga0496124_0063222 3300048927 Bacteria 3093
872 Ga0496124_0063870 3300048927 Bacteria 3074
873 Ga0496124_0070812 3300048927 Bacteria 2891
874 Ga0496124_0163209 3300048927 Bacteria 1734
875 Ga0496124_0168060 3300048927 Bacteria 1702
876 Ga0496124_0177857 3300048927 Bacteria 1640
877 Ga0496125_0002691 3300048928 Bacteria 22622
878 Ga0496125_0008678 3300048928 Bacteria 10586
879 Ga0496125_0010314 3300048928 Bacteria 9458
880 Ga0496125_0011129 3300048928 Bacteria 9022
881 Ga0496125_0014498 3300048928 Bacteria 7674
882 Ga0496125_0016256 3300048928 Bacteria 7153
883 Ga0496125_0018923 3300048928 Bacteria 6518
884 Ga0496125_0037749 3300048928 Bacteria 4195
885 Ga0496125_0045268 3300048928 Bacteria 3707
886 Ga0496125_0049620 3300048928 Bacteria 3485
887 Ga0496125_0077354 3300048928 Bacteria 2565
888 Ga0496126_0007398 3300048929 Bacteria 12044
889 Ga0496126_0030921 3300048929 Bacteria 5066
890 Ga0496126_0094636 3300048929 Bacteria 2621
891 Ga0495678_000017 3300049459 Bacteria 282592
892 Ga0495678_001528 3300049459 Bacteria 17886
893 Ga0495678_002999 3300049459 Bacteria 10754
894 Ga0495678_003980 3300049459 Bacteria 8829
895 Ga0495678_004635 3300049459 Bacteria 7886
896 Ga0495678_004726 3300049459 Bacteria 7771
897 Ga0495678_005439 3300049459 Bacteria 7030
898 Ga0495678_009655 3300049459 Bacteria 4748
899 Ga0495678_012381 3300049459 Bacteria 4047
900 Ga0495678_026483 3300049459 Bacteria 2474
901 Ga0495678_045026 3300049459 Bacteria 1743
902 Ga0495682_0000235 3300049460 Bacteria 43660
903 Ga0495682_0000783 3300049460 Bacteria 20150
904 Ga0495682_0007614 3300049460 Bacteria 4299
905 Ga0495682_0019980 3300049460 Bacteria 2515
906 Ga0495682_0040278 3300049460 Bacteria 1713
907 Ga0501034_0000524 3300049571 Bacteria 61505
908 nmdc:mga00v17_120516_c1 3300050491 Bacteria 1670
909 nmdc:mga08x19_103421_c1 3300050514 Bacteria 1892
910 Ga0500634_0000569 3300053161 Bacteria 12222

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042138 Ga0450903_001104 Ga0450903_001104_3921_5111 374
2 3300046452 Ga0495617_043035 Ga0495617_043035_262_1467 380
3 3300046492 Ga0495585_0006903 Ga0495585_0006903_10_1215 380
4 3300046810 Ga0495660_0060844 Ga0495660_0060844_14_1225 381
5 3300050514 nmdc:mga08x19_103421_c1 nmdc:mga08x19_103421_c1_669_1880 381
6 3300048927 Ga0496124_0063222 Ga0496124_0063222_1580_3007 387
7 3300015262 Ga0182007_10011480 Ga0182007_100114802 410
8 3300005353 Ga0070669_100009189 Ga0070669_1000091894 413
9 3300009011 Ga0105251_10004613 Ga0105251_100046133 413
10 3300013100 Ga0157373_10050703 Ga0157373_100507032 413
11 3300014497 Ga0182008_10041511 Ga0182008_100415111 413
12 3300005564 Ga0070664_100010072 Ga0070664_1000100724 415
13 3300005834 Ga0068851_10000004 Ga0068851_10000004202 415
14 3300025321 Ga0207656_10000007 Ga0207656_1000000754 415
15 3300025735 Ga0207713_1003705 Ga0207713_10037056 415
16 3300025923 Ga0207681_10000480 Ga0207681_100004806 415
17 3300025945 Ga0207679_10009671 Ga0207679_100096713 415
18 3300046458 Ga0495591_000161 Ga0495591_000161_64164_65573 417
19 3300046501 Ga0495607_0000795 Ga0495607_0000795_23691_25100 417
20 3300005288 Ga0065714_10002555 Ga0065714_100025556 419
21 3300013100 Ga0157373_10090492 Ga0157373_100904921 419
22 3300048925 Ga0496122_0009085 Ga0496122_0009085_6854_8227 419
23 3300048926 Ga0496123_0007305 Ga0496123_0007305_2263_3636 419
24 3300048928 Ga0496125_0008678 Ga0496125_0008678_6840_8213 419
25 3300009011 Ga0105251_10003990 Ga0105251_100039904 420
26 3300009011 Ga0105251_10006856 Ga0105251_100068564 420
27 3300025735 Ga0207713_1006872 Ga0207713_10068724 420
28 3300046471 Ga0495650_0005720 Ga0495650_0005720_4719_6128 420
29 3300046474 Ga0495605_0000062 Ga0495605_0000062_78962_80371 420
30 3300046499 Ga0495594_0004554 Ga0495594_0004554_1314_2723 420
31 3300046501 Ga0495607_0018460 Ga0495607_0018460_1765_3174 420
32 3300046506 Ga0495583_0000015 Ga0495583_0000015_252224_253633 420
33 3300046515 Ga0495620_0000050 Ga0495620_0000050_62747_64156 420
34 3300046518 Ga0495631_0002629 Ga0495631_0002629_6802_8211 420
35 3300046520 Ga0495637_0006694 Ga0495637_0006694_1654_3063 420
36 3300046524 Ga0495648_0005871 Ga0495648_0005871_2340_3743 420
37 3300046524 Ga0495648_0010230 Ga0495648_0010230_4758_6167 420
38 3300046530 Ga0495654_0004405 Ga0495654_0004405_4827_6224 420
39 3300046530 Ga0495654_0010256 Ga0495654_0010256_1934_3343 420
40 3300046538 Ga0495609_0000165 Ga0495609_0000165_5398_6807 420
41 3300046542 Ga0495597_0017888 Ga0495597_0017888_1736_3145 420
42 3300046558 Ga0495633_0000084 Ga0495633_0000084_60802_62211 420
43 3300046648 Ga0495611_0002031 Ga0495611_0002031_7457_8866 420
44 3300046665 Ga0495661_0000065 Ga0495661_0000065_62769_64178 420
45 3300046794 Ga0495589_0003604 Ga0495589_0003604_1832_3241 420
46 3300046810 Ga0495660_0011202 Ga0495660_0011202_3437_4846 420
47 3300047323 Ga0495683_0000109 Ga0495683_0000109_20316_21725 420
48 3300047446 Ga0495679_000786 Ga0495679_000786_16602_18011 420
49 3300047469 Ga0495673_0012892 Ga0495673_0012892_2065_3474 420
50 3300047470 Ga0495681_0008795 Ga0495681_0008795_4915_6276 420
51 3300047470 Ga0495681_0068372 Ga0495681_0068372_92_1498 420
52 3300048925 Ga0496122_0018998 Ga0496122_0018998_1105_2514 420
53 3300048926 Ga0496123_0011821 Ga0496123_0011821_2313_3722 420
54 3300049459 Ga0495678_000017 Ga0495678_000017_218416_219825 420
55 3300011119 Ga0105246_10000489 Ga0105246_100004894 421
56 3300017792 Ga0163161_10011258 Ga0163161_100112584 421
57 3300025735 Ga0207713_1003852 Ga0207713_10038527 421
58 3300042013 Ga0439456_000834 Ga0439456_000834_916_2322 421
59 3300046542 Ga0495597_0000124 Ga0495597_0000124_4188_5627 421
60 3300046810 Ga0495660_0001082 Ga0495660_0001082_2346_3785 421
61 3300048928 Ga0496125_0018923 Ga0496125_0018923_976_2376 421
62 3300005548 Ga0070665_100162812 Ga0070665_1001628122 422
63 3300014497 Ga0182008_10060592 Ga0182008_100605922 422
64 3300025292 Ga0209676_1000025 Ga0209676_1000025222 422
65 3300025298 Ga0209050_1001508 Ga0209050_100150810 422
66 3300025303 Ga0209051_1000026 Ga0209051_100002617 422
67 3300025304 Ga0209257_1000034 Ga0209257_1000034222 422
68 3300025728 Ga0207655_1004010 Ga0207655_10040102 422
69 3300028379 Ga0268266_10097104 Ga0268266_100971042 422
70 3300048927 Ga0496124_0014080 Ga0496124_0014080_4563_5990 422
71 3300009011 Ga0105251_10000382 Ga0105251_1000038220 423
72 3300013100 Ga0157373_10077249 Ga0157373_100772491 423
73 3300046453 Ga0495627_002590 Ga0495627_002590_6233_7639 423
74 3300046501 Ga0495607_0029518 Ga0495607_0029518_929_2335 423
75 3300046519 Ga0495632_0008330 Ga0495632_0008330_4057_5463 423
76 3300046520 Ga0495637_0000916 Ga0495637_0000916_2037_3446 423
77 3300046665 Ga0495661_0009858 Ga0495661_0009858_5059_6468 423
78 3300047469 Ga0495673_0001132 Ga0495673_0001132_3220_4659 423
79 3300049459 Ga0495678_001528 Ga0495678_001528_9729_11138 423
80 3300046501 Ga0495607_0015979 Ga0495607_0015979_2797_4206 424
81 3300046506 Ga0495583_0004556 Ga0495583_0004556_2088_3497 424
82 3300046518 Ga0495631_0002121 Ga0495631_0002121_141_1550 424
83 3300046519 Ga0495632_0001245 Ga0495632_0001245_14126_15535 424
84 3300046522 Ga0495643_0001992 Ga0495643_0001992_1868_3277 424
85 3300046524 Ga0495648_0002359 Ga0495648_0002359_13695_15104 424
86 3300046660 Ga0495625_0013453 Ga0495625_0013453_4251_5660 424
87 3300046692 Ga0495671_0001310 Ga0495671_0001310_2370_3779 424
88 3300047320 Ga0495672_0019001 Ga0495672_0019001_2857_4266 424
89 3300047469 Ga0495673_0003605 Ga0495673_0003605_6364_7773 424
90 3300049459 Ga0495678_004726 Ga0495678_004726_4436_5845 424
91 3300003781 Ga0055536_1001597 Ga0055536_10015974 425
92 3300003791 Ga0055530_10001513 Ga0055530_100015139 425
93 3300003792 Ga0055540_1000646 Ga0055540_100064613 425
94 3300009036 Ga0105244_10004027 Ga0105244_100040279 425
95 3300046471 Ga0495650_0002247 Ga0495650_0002247_12613_14052 425
96 3300046474 Ga0495605_0000646 Ga0495605_0000646_9704_11113 425
97 3300046506 Ga0495583_0002202 Ga0495583_0002202_1896_3305 425
98 3300003781 Ga0055536_1000615 Ga0055536_100061512 426
99 3300003791 Ga0055530_10000913 Ga0055530_1000091312 426
100 3300003792 Ga0055540_1000657 Ga0055540_100065712 426
101 3300025292 Ga0209676_1000032 Ga0209676_1000032390 426
102 3300025298 Ga0209050_1000025 Ga0209050_1000025391 426
103 3300025303 Ga0209051_1000334 Ga0209051_100033410 426
104 3300047322 Ga0495680_0020467 Ga0495680_0020467_1803_3236 426
105 3300025735 Ga0207713_1000031 Ga0207713_1000031178 427
106 3300042145 Ga0450906_000245 Ga0450906_000245_7153_8565 427
107 3300046515 Ga0495620_0005884 Ga0495620_0005884_4524_5930 427
108 3300046538 Ga0495609_0000461 Ga0495609_0000461_15555_16964 427
109 3300015261 Ga0182006_1002130 Ga0182006_10021304 428
110 3300042129 Ga0450891_001279 Ga0450891_001279_777_2222 428
111 3300031911 Ga0307412_10069839 Ga0307412_100698392 429
112 3300041407 Ga0439447_011676 Ga0439447_011676_467_1879 429
113 3300046458 Ga0495591_002423 Ga0495591_002423_2381_3790 429
114 3300046471 Ga0495650_0034243 Ga0495650_0034243_198_1610 429
115 3300046501 Ga0495607_0007446 Ga0495607_0007446_4163_5596 429
116 3300046501 Ga0495607_0023599 Ga0495607_0023599_704_2113 429
117 3300046506 Ga0495583_0001873 Ga0495583_0001873_2442_3851 429
118 3300046507 Ga0495606_0000352 Ga0495606_0000352_17017_18426 429
119 3300046512 Ga0495610_0022506 Ga0495610_0022506_1869_3281 429
120 3300046518 Ga0495631_0018649 Ga0495631_0018649_213_1652 429
121 3300046520 Ga0495637_0000020 Ga0495637_0000020_30714_32123 429
122 3300046523 Ga0495644_0001131 Ga0495644_0001131_2331_3740 429
123 3300046524 Ga0495648_0020486 Ga0495648_0020486_2951_4360 429
124 3300046557 Ga0495622_0002492 Ga0495622_0002492_5008_6417 429
125 3300046648 Ga0495611_0000318 Ga0495611_0000318_16057_17466 429
126 3300046694 Ga0495649_0017665 Ga0495649_0017665_1854_3263 429
127 3300047321 Ga0495676_0001453 Ga0495676_0001453_16619_18028 429
128 3300047446 Ga0495679_000132 Ga0495679_000132_14379_15788 429
129 3300048091 Ga0495626_0000218 Ga0495626_0000218_16517_17926 429
130 3300046458 Ga0495591_000417 Ga0495591_000417_16929_18338 430
131 3300046491 Ga0495584_0012532 Ga0495584_0012532_2413_3822 430
132 3300046665 Ga0495661_0000542 Ga0495661_0000542_21128_22537 430
133 3300046684 Ga0495669_0032199 Ga0495669_0032199_20_1378 430
134 3300046691 Ga0495670_0012068 Ga0495670_0012068_1963_3393 430
135 3300048913 Ga0496110_0055940 Ga0496110_0055940_1288_2697 430
136 3300048927 Ga0496124_0030336 Ga0496124_0030336_2654_4063 430
137 3300027111 Ga0209281_1001566 Ga0209281_10015669 431
138 3300032005 Ga0307411_10001539 Ga0307411_100015396 431
139 3300042013 Ga0439456_000482 Ga0439456_000482_5384_6796 431
140 3300042137 Ga0450902_000058 Ga0450902_000058_7801_9204 431
141 3300042533 Ga0450901_000055 Ga0450901_000055_7551_8954 431
142 3300046507 Ga0495606_0015973 Ga0495606_0015973_10_1347 431
143 3300009036 Ga0105244_10004304 Ga0105244_100043044 432
144 3300028786 Ga0307517_10029705 Ga0307517_100297053 432
145 3300031507 Ga0307509_10012737 Ga0307509_100127374 432
146 3300046506 Ga0495583_0000821 Ga0495583_0000821_21513_22952 432
147 3300046519 Ga0495632_0005417 Ga0495632_0005417_4912_6351 432
148 3300046520 Ga0495637_0015819 Ga0495637_0015819_1880_3319 432
149 3300046665 Ga0495661_0000370 Ga0495661_0000370_15549_16988 432
150 3300047470 Ga0495681_0070876 Ga0495681_0070876_44_1444 432
151 3300048904 Ga0496101_0045109 Ga0496101_0045109_198_1607 432
152 3300048924 Ga0496121_0010098 Ga0496121_0010098_7746_9155 432
153 3300048925 Ga0496122_0003657 Ga0496122_0003657_2294_3703 432
154 3300048926 Ga0496123_0002915 Ga0496123_0002915_2321_3730 432
155 3300006058 Ga0075432_10014569 Ga0075432_100145692 433
156 3300025728 Ga0207655_1003504 Ga0207655_10035044 433
157 3300041405 Ga0439438_003653 Ga0439438_003653_827_2227 433
158 3300042010 Ga0439452_000564 Ga0439452_000564_15771_17171 433
159 3300046512 Ga0495610_0003975 Ga0495610_0003975_7460_8857 433
160 3300005344 Ga0070661_100000078 Ga0070661_1000000785 434
161 3300005564 Ga0070664_100013220 Ga0070664_1000132205 434
162 3300006051 Ga0075364_10031283 Ga0075364_100312833 434
163 3300006058 Ga0075432_10042754 Ga0075432_100427541 434
164 3300025728 Ga0207655_1005640 Ga0207655_10056405 434
165 3300025728 Ga0207655_1011746 Ga0207655_10117464 434
166 3300025914 Ga0207671_10000015 Ga0207671_10000015305 434
167 3300025920 Ga0207649_10000001 Ga0207649_10000001183 434
168 3300025934 Ga0207686_10004833 Ga0207686_100048336 434
169 3300025945 Ga0207679_10000011 Ga0207679_10000011183 434
170 3300046512 Ga0495610_0082914 Ga0495610_0082914_105_1445 434
171 3300015261 Ga0182006_1000865 Ga0182006_100086515 435
172 3300046474 Ga0495605_0004432 Ga0495605_0004432_5881_7290 435
173 3300046492 Ga0495585_0007075 Ga0495585_0007075_81_1490 435
174 3300046507 Ga0495606_0008397 Ga0495606_0008397_5808_7217 435
175 3300046543 Ga0495645_0063449 Ga0495645_0063449_12_1376 435
176 3300046660 Ga0495625_0000133 Ga0495625_0000133_50436_51845 435
177 3300048921 Ga0496118_0022519 Ga0496118_0022519_526_1935 435
178 3300048924 Ga0496121_0001560 Ga0496121_0001560_15477_16886 435
179 3300048925 Ga0496122_0039847 Ga0496122_0039847_2183_3592 435
180 3300048926 Ga0496123_0054848 Ga0496123_0054848_663_2072 435
181 3300048928 Ga0496125_0077354 Ga0496125_0077354_836_2236 435
182 3300009036 Ga0105244_10016139 Ga0105244_100161392 436
183 3300009176 Ga0105242_10006961 Ga0105242_100069618 436
184 3300009545 Ga0105237_10002728 Ga0105237_100027286 436
185 3300011119 Ga0105246_10009646 Ga0105246_100096463 436
186 3300013100 Ga0157373_10011715 Ga0157373_100117154 436
187 3300013105 Ga0157369_10021358 Ga0157369_100213583 436
188 3300013308 Ga0157375_10018201 Ga0157375_100182014 436
189 3300031548 Ga0307408_100021746 Ga0307408_1000217462 436
190 3300042139 Ga0450904_000670 Ga0450904_000670_4555_5955 436
191 3300046501 Ga0495607_0011245 Ga0495607_0011245_222_1634 436
192 3300046616 Ga0495668_0009370 Ga0495668_0009370_537_1946 436
193 3300047469 Ga0495673_0009479 Ga0495673_0009479_2067_3476 436
194 3300013307 Ga0157372_10001292 Ga0157372_1000129216 437
195 3300014497 Ga0182008_10003185 Ga0182008_100031854 437
196 3300046512 Ga0495610_0009977 Ga0495610_0009977_2559_3956 437
197 3300047470 Ga0495681_0004928 Ga0495681_0004928_5576_7030 437
198 3300048922 Ga0496119_0000448 Ga0496119_0000448_30678_32108 437
199 3300048923 Ga0496120_0002907 Ga0496120_0002907_14236_15666 437
200 3300025291 Ga0209675_1007790 Ga0209675_10077904 438
201 3300025728 Ga0207655_1000777 Ga0207655_10007772 438
202 3300042006 Ga0439432_000297 Ga0439432_000297_12722_14134 438
203 3300042010 Ga0439452_000474 Ga0439452_000474_3729_5141 438
204 3300048911 Ga0496108_0231525 Ga0496108_0231525_132_1535 438
205 3300048927 Ga0496124_0168060 Ga0496124_0168060_110_1513 438
206 3300048928 Ga0496125_0045268 Ga0496125_0045268_507_1910 438
207 3300002737 JGI25162J39368_1000182 JGI25162J39368_100018212 439
208 3300002771 JGI25163J39215_1000479 JGI25163J39215_10004797 439
209 3300002772 JGI25164J39214_1000148 JGI25164J39214_100014812 439
210 3300003214 JGI25165J46597_1000268 JGI25165J46597_100026812 439
211 3300013100 Ga0157373_10005239 Ga0157373_100052397 439
212 3300025207 Ga0209760_100215 Ga0209760_10021510 439
213 3300025231 Ga0207427_100014 Ga0207427_100014420 439
214 3300025233 Ga0209437_100016 Ga0209437_100016217 439
215 3300025261 Ga0209233_1000036 Ga0209233_1000036420 439
216 3300032004 Ga0307414_10084382 Ga0307414_100843822 439
217 3300042016 Ga0439463_000964 Ga0439463_000964_2114_3475 439
218 3300009011 Ga0105251_10004137 Ga0105251_100041374 440
219 3300013102 Ga0157371_10000839 Ga0157371_1000083912 440
220 3300013105 Ga0157369_10008222 Ga0157369_100082229 440
221 3300014497 Ga0182008_10000659 Ga0182008_1000065910 440
222 3300014497 Ga0182008_10003945 Ga0182008_100039455 440
223 3300017792 Ga0163161_10008731 Ga0163161_100087313 440
224 3300046463 Ga0495653_0008679 Ga0495653_0008679_5074_6510 440
225 3300046515 Ga0495620_0002084 Ga0495620_0002084_8381_9781 440
226 3300046648 Ga0495611_0005232 Ga0495611_0005232_3968_5365 440
227 3300046689 Ga0495613_0010283 Ga0495613_0010283_5359_6795 440
228 3300046690 Ga0495624_0005967 Ga0495624_0005967_1902_3338 440
229 3300046794 Ga0495589_0004783 Ga0495589_0004783_780_2186 440
230 3300047317 Ga0495604_0031110 Ga0495604_0031110_1357_2793 440
231 3300047320 Ga0495672_0006667 Ga0495672_0006667_1853_3289 440
232 3300047321 Ga0495676_0015179 Ga0495676_0015179_88_1524 440
233 3300047322 Ga0495680_0032203 Ga0495680_0032203_1817_3253 440
234 3300047446 Ga0495679_002919 Ga0495679_002919_1590_2990 440
235 3300047446 Ga0495679_004218 Ga0495679_004218_931_2337 440
236 3300047469 Ga0495673_0002700 Ga0495673_0002700_2459_3859 440
237 3300047673 Ga0495593_0020888 Ga0495593_0020888_869_2305 440
238 3300048088 Ga0495602_0012782 Ga0495602_0012782_5347_6783 440
239 3300048920 Ga0496117_0008601 Ga0496117_0008601_2037_3443 440
240 3300048922 Ga0496119_0014154 Ga0496119_0014154_4607_6013 440
241 3300048923 Ga0496120_0040699 Ga0496120_0040699_428_1834 440
242 3300048924 Ga0496121_0001800 Ga0496121_0001800_14428_15840 440
243 3300048925 Ga0496122_0117215 Ga0496122_0117215_88_1494 440
244 3300048927 Ga0496124_0012129 Ga0496124_0012129_6203_7609 440
245 3300048927 Ga0496124_0027879 Ga0496124_0027879_119_1516 440
246 3300009011 Ga0105251_10028086 Ga0105251_100280862 441
247 3300046458 Ga0495591_001031 Ga0495591_001031_2090_3499 441
248 3300046458 Ga0495591_003482 Ga0495591_003482_1756_3156 441
249 3300046500 Ga0495596_0007877 Ga0495596_0007877_926_2335 441
250 3300046501 Ga0495607_0012445 Ga0495607_0012445_1128_2528 441
251 3300046501 Ga0495607_0012968 Ga0495607_0012968_2046_3458 441
252 3300046512 Ga0495610_0005381 Ga0495610_0005381_2123_3532 441
253 3300046522 Ga0495643_0021643 Ga0495643_0021643_196_1626 441
254 3300046530 Ga0495654_0005388 Ga0495654_0005388_2837_4237 441
255 3300046538 Ga0495609_0000372 Ga0495609_0000372_21125_22534 441
256 3300046694 Ga0495649_0006039 Ga0495649_0006039_5217_6617 441
257 3300048927 Ga0496124_0042755 Ga0496124_0042755_1891_3342 441
258 3300046452 Ga0495617_004215 Ga0495617_004215_971_2371 442
259 3300046471 Ga0495650_0003440 Ga0495650_0003440_2014_3414 442
260 3300046491 Ga0495584_0002571 Ga0495584_0002571_499_1899 442
261 3300046501 Ga0495607_0000732 Ga0495607_0000732_27786_29195 442
262 3300046501 Ga0495607_0009018 Ga0495607_0009018_321_1721 442
263 3300046507 Ga0495606_0005707 Ga0495606_0005707_8546_9946 442
264 3300046512 Ga0495610_0003697 Ga0495610_0003697_1852_3252 442
265 3300046515 Ga0495620_0004405 Ga0495620_0004405_3597_5006 442
266 3300046518 Ga0495631_0025862 Ga0495631_0025862_255_1655 442
267 3300046519 Ga0495632_0003263 Ga0495632_0003263_8348_9748 442
268 3300046523 Ga0495644_0000395 Ga0495644_0000395_15689_17101 442
269 3300046524 Ga0495648_0009611 Ga0495648_0009611_2301_3701 442
270 3300046542 Ga0495597_0015538 Ga0495597_0015538_2156_3568 442
271 3300046660 Ga0495625_0022594 Ga0495625_0022594_3205_4605 442
272 3300046665 Ga0495661_0013533 Ga0495661_0013533_3362_4762 442
273 3300046691 Ga0495670_0005926 Ga0495670_0005926_2987_4387 442
274 3300048091 Ga0495626_0001181 Ga0495626_0001181_2291_3691 442
275 3300048923 Ga0496120_0018637 Ga0496120_0018637_1271_2668 442
276 3300005457 Ga0070662_100062359 Ga0070662_1000623592 443
277 3300025735 Ga0207713_1000763 Ga0207713_100076319 443
278 3300025933 Ga0207706_10006068 Ga0207706_100060686 443
279 3300031731 Ga0307405_10000898 Ga0307405_100008984 443
280 3300031911 Ga0307412_10005902 Ga0307412_100059024 443
281 3300047469 Ga0495673_0019020 Ga0495673_0019020_1804_3216 443
282 3300048919 Ga0496116_0009039 Ga0496116_0009039_1754_3190 443
283 3300048920 Ga0496117_0024127 Ga0496117_0024127_1595_3031 443
284 3300048921 Ga0496118_0026725 Ga0496118_0026725_1681_3117 443
285 3300048923 Ga0496120_0055424 Ga0496120_0055424_783_2219 443
286 3300048924 Ga0496121_0016315 Ga0496121_0016315_5691_7127 443
287 3300048927 Ga0496124_0003932 Ga0496124_0003932_13969_15381 443
288 3300048927 Ga0496124_0063870 Ga0496124_0063870_68_1465 443
289 3300048927 Ga0496124_0070812 Ga0496124_0070812_1313_2749 443
290 3300005548 Ga0070665_100065453 Ga0070665_1000654533 444
291 3300009092 Ga0105250_10000423 Ga0105250_1000042317 444
292 3300025711 Ga0207696_1000229 Ga0207696_100022952 444
293 3300025735 Ga0207713_1014266 Ga0207713_10142663 444
294 3300025925 Ga0207650_10001153 Ga0207650_1000115314 444
295 3300042134 Ga0450898_000158 Ga0450898_000158_453_1850 444
296 3300046665 Ga0495661_0030863 Ga0495661_0030863_1898_3307 444
297 3300048920 Ga0496117_0005799 Ga0496117_0005799_5845_7248 444
298 3300048920 Ga0496117_0006819 Ga0496117_0006819_1700_3097 444
299 3300048921 Ga0496118_0003766 Ga0496118_0003766_5885_7288 444
300 3300048921 Ga0496118_0007288 Ga0496118_0007288_8278_9675 444
301 3300048921 Ga0496118_0010678 Ga0496118_0010678_2321_3718 444
302 3300048923 Ga0496120_0044695 Ga0496120_0044695_116_1513 444
303 3300048924 Ga0496121_0071007 Ga0496121_0071007_709_2106 444
304 3300048925 Ga0496122_0002785 Ga0496122_0002785_15519_16922 444
305 3300048925 Ga0496122_0125532 Ga0496122_0125532_69_1466 444
306 3300048926 Ga0496123_0005315 Ga0496123_0005315_7070_8473 444
307 3300048926 Ga0496123_0016257 Ga0496123_0016257_1056_2453 444
308 3300048928 Ga0496125_0037749 Ga0496125_0037749_1187_2590 444
309 3300048929 Ga0496126_0007398 Ga0496126_0007398_8282_9679 444
310 3300009011 Ga0105251_10005498 Ga0105251_100054982 445
311 3300013100 Ga0157373_10008297 Ga0157373_100082975 445
312 3300015261 Ga0182006_1006834 Ga0182006_10068345 445
313 3300015261 Ga0182006_1008021 Ga0182006_10080214 445
314 3300015265 Ga0182005_1018937 Ga0182005_10189372 445
315 3300025711 Ga0207696_1000057 Ga0207696_100005753 445
316 3300025735 Ga0207713_1003265 Ga0207713_10032652 445
317 3300042115 Ga0450911_000837 Ga0450911_000837_2554_3984 445
318 3300046460 Ga0495638_0007873 Ga0495638_0007873_4190_5620 445
319 3300046474 Ga0495605_0000975 Ga0495605_0000975_15715_17124 445
320 3300046491 Ga0495584_0011921 Ga0495584_0011921_1998_3428 445
321 3300046492 Ga0495585_0005299 Ga0495585_0005299_4454_5884 445
322 3300046501 Ga0495607_0023336 Ga0495607_0023336_422_1834 445
323 3300046501 Ga0495607_0060837 Ga0495607_0060837_641_2050 445
324 3300046501 Ga0495607_0072760 Ga0495607_0072760_172_1608 445
325 3300046506 Ga0495583_0004552 Ga0495583_0004552_2008_3417 445
326 3300046507 Ga0495606_0035692 Ga0495606_0035692_1422_2831 445
327 3300046512 Ga0495610_0006509 Ga0495610_0006509_2056_3486 445
328 3300046513 Ga0495616_0065705 Ga0495616_0065705_178_1608 445
329 3300046519 Ga0495632_0007681 Ga0495632_0007681_4310_5740 445
330 3300046524 Ga0495648_0089079 Ga0495648_0089079_193_1623 445
331 3300046530 Ga0495654_0042102 Ga0495654_0042102_373_1746 445
332 3300046542 Ga0495597_0004961 Ga0495597_0004961_3774_5204 445
333 3300046692 Ga0495671_0004310 Ga0495671_0004310_5332_6768 445
334 3300046692 Ga0495671_0006160 Ga0495671_0006160_4765_6177 445
335 3300046694 Ga0495649_0038300 Ga0495649_0038300_159_1589 445
336 3300047320 Ga0495672_0012989 Ga0495672_0012989_2226_3635 445
337 3300047446 Ga0495679_001764 Ga0495679_001764_8230_9603 445
338 3300047446 Ga0495679_011058 Ga0495679_011058_278_1714 445
339 3300047469 Ga0495673_0018597 Ga0495673_0018597_180_1589 445
340 3300047472 Ga0495686_0013084 Ga0495686_0013084_103_1533 445
341 3300048926 Ga0496123_0023127 Ga0496123_0023127_2617_4053 445
342 3300049460 Ga0495682_0000783 Ga0495682_0000783_16716_18125 445
343 iso_pu_bacteria 8056161164 8056164393 445
344 3300009011 Ga0105251_10004877 Ga0105251_100048773 446
345 3300009011 Ga0105251_10053821 Ga0105251_100538211 446
346 3300009092 Ga0105250_10058044 Ga0105250_100580441 446
347 3300013307 Ga0157372_10012481 Ga0157372_100124816 446
348 3300015265 Ga0182005_1012050 Ga0182005_10120502 446
349 3300015265 Ga0182005_1017127 Ga0182005_10171272 446
350 3300025735 Ga0207713_1001215 Ga0207713_100121516 446
351 3300025735 Ga0207713_1001550 Ga0207713_10015506 446
352 3300025735 Ga0207713_1019362 Ga0207713_10193622 446
353 3300046452 Ga0495617_005547 Ga0495617_005547_1790_3226 446
354 3300046452 Ga0495617_027753 Ga0495617_027753_334_1776 446
355 3300046459 Ga0495629_0018010 Ga0495629_0018010_2485_3918 446
356 3300046463 Ga0495653_0002977 Ga0495653_0002977_9837_11270 446
357 3300046473 Ga0495582_0018283 Ga0495582_0018283_1928_3361 446
358 3300046474 Ga0495605_0003985 Ga0495605_0003985_1780_3216 446
359 3300046474 Ga0495605_0013836 Ga0495605_0013836_1211_2653 446
360 3300046491 Ga0495584_0018002 Ga0495584_0018002_1860_3302 446
361 3300046492 Ga0495585_0043445 Ga0495585_0043445_792_2228 446
362 3300046492 Ga0495585_0052382 Ga0495585_0052382_698_2140 446
363 3300046501 Ga0495607_0008264 Ga0495607_0008264_386_1828 446
364 3300046515 Ga0495620_0003226 Ga0495620_0003226_1825_3267 446
365 3300046517 Ga0495630_0013898 Ga0495630_0013898_1927_3360 446
366 3300046518 Ga0495631_0000717 Ga0495631_0000717_17808_19250 446
367 3300046524 Ga0495648_0007786 Ga0495648_0007786_5195_6592 446
368 3300046524 Ga0495648_0010567 Ga0495648_0010567_4008_5450 446
369 3300046530 Ga0495654_0006091 Ga0495654_0006091_195_1637 446
370 3300046536 Ga0495587_0002748 Ga0495587_0002748_7445_8878 446
371 3300046558 Ga0495633_0003099 Ga0495633_0003099_2018_3460 446
372 3300046642 Ga0495634_0028440 Ga0495634_0028440_119_1552 446
373 3300046660 Ga0495625_0008067 Ga0495625_0008067_5801_7237 446
374 3300046660 Ga0495625_0071999 Ga0495625_0071999_343_1785 446
375 3300046665 Ga0495661_0089797 Ga0495661_0089797_202_1644 446
376 3300046680 Ga0495646_0003424 Ga0495646_0003424_1842_3275 446
377 3300046689 Ga0495613_0008930 Ga0495613_0008930_1814_3247 446
378 3300046692 Ga0495671_0073632 Ga0495671_0073632_117_1499 446
379 3300046694 Ga0495649_0004985 Ga0495649_0004985_5317_6753 446
380 3300046810 Ga0495660_0021434 Ga0495660_0021434_2044_3477 446
381 3300047317 Ga0495604_0005247 Ga0495604_0005247_6797_8230 446
382 3300047322 Ga0495680_0002151 Ga0495680_0002151_17759_19192 446
383 3300047323 Ga0495683_0001899 Ga0495683_0001899_2030_3472 446
384 3300047444 Ga0495675_0001494 Ga0495675_0001494_1354_2787 446
385 3300047469 Ga0495673_0003616 Ga0495673_0003616_1808_3241 446
386 3300047469 Ga0495673_0004960 Ga0495673_0004960_1830_3266 446
387 3300047469 Ga0495673_0010120 Ga0495673_0010120_2400_3842 446
388 3300048927 Ga0496124_0177857 Ga0496124_0177857_176_1618 446
389 3300048928 Ga0496125_0010314 Ga0496125_0010314_1823_3229 446
390 3300048928 Ga0496125_0011129 Ga0496125_0011129_2053_3495 446
391 3300005288 Ga0065714_10007731 Ga0065714_100077313 447
392 3300013104 Ga0157370_10080225 Ga0157370_100802253 447
393 3300046499 Ga0495594_0016045 Ga0495594_0016045_1796_3229 447
394 3300046557 Ga0495622_0054103 Ga0495622_0054103_101_1534 447
395 3300046665 Ga0495661_0003277 Ga0495661_0003277_8264_9661 447
396 3300047673 Ga0495593_0009814 Ga0495593_0009814_1665_3098 447
397 3300048920 Ga0496117_0010405 Ga0496117_0010405_5288_6724 447
398 3300048921 Ga0496118_0013784 Ga0496118_0013784_881_2317 447
399 3300053161 Ga0500634_0000569 Ga0500634_0000569_2369_3766 447
400 iso_pu_bacteria 8056115690 8056116779 447
401 3300005288 Ga0065714_10005071 Ga0065714_100050711 448
402 3300005353 Ga0070669_100007551 Ga0070669_1000075514 448
403 3300009011 Ga0105251_10006384 Ga0105251_100063847 448
404 3300013104 Ga0157370_10008375 Ga0157370_100083756 448
405 3300014497 Ga0182008_10004154 Ga0182008_100041545 448
406 3300014497 Ga0182008_10036750 Ga0182008_100367502 448
407 3300015265 Ga0182005_1018006 Ga0182005_10180061 448
408 3300025711 Ga0207696_1001793 Ga0207696_10017937 448
409 3300025735 Ga0207713_1005940 Ga0207713_10059401 448
410 3300025923 Ga0207681_10007523 Ga0207681_100075234 448
411 3300046453 Ga0495627_031185 Ga0495627_031185_213_1655 448
412 3300046458 Ga0495591_017373 Ga0495591_017373_235_1677 448
413 3300046475 Ga0495639_0007211 Ga0495639_0007211_2154_3596 448
414 3300046520 Ga0495637_0003453 Ga0495637_0003453_1781_3223 448
415 3300046520 Ga0495637_0027717 Ga0495637_0027717_1054_2508 448
416 3300046530 Ga0495654_0034362 Ga0495654_0034362_845_2287 448
417 3300046538 Ga0495609_0003520 Ga0495609_0003520_1870_3312 448
418 3300046691 Ga0495670_0002653 Ga0495670_0002653_1790_3232 448
419 3300046694 Ga0495649_0047724 Ga0495649_0047724_855_2309 448
420 3300046694 Ga0495649_0067940 Ga0495649_0067940_351_1793 448
421 3300046810 Ga0495660_0005610 Ga0495660_0005610_1802_3244 448
422 3300047470 Ga0495681_0007905 Ga0495681_0007905_1983_3425 448
423 3300048924 Ga0496121_0026333 Ga0496121_0026333_1875_3317 448
424 3300048928 Ga0496125_0049620 Ga0496125_0049620_488_1930 448
425 iso_pu_bacteria 2599185167 2599398809 448
426 iso_pu_bacteria 2599185179 2599450864 448
427 iso_pu_bacteria 2599185190 2599514191 448
428 iso_pu_bacteria 2599185191 2599518791 448
429 iso_pu_bacteria 2599185290 2599893474 448
430 iso_pu_bacteria 2643221565 2643841034 448
431 iso_pu_bacteria 2834028612 2834032170 448
432 iso_pu_bacteria 2912963787 2912964226 448
433 iso_pu_bacteria 2923586266 2923589833 448
434 iso_pu_bacteria 2929189879 2929190340 448
435 iso_pu_bacteria 2931369376 2931371801 448
436 iso_pu_bacteria 2931390751 2931391422 448
437 iso_pu_bacteria 2998139840 2998140511 448
438 iso_pu_bacteria 8054285046 8054290963 448
439 3300006944 Ga0099823_1006343 Ga0099823_10063437 449
440 3300009036 Ga0105244_10010072 Ga0105244_100100724 449
441 3300017792 Ga0163161_10017309 Ga0163161_100173093 449
442 3300027296 Ga0209389_1000044 Ga0209389_100004428 449
443 3300041405 Ga0439438_002357 Ga0439438_002357_5322_6734 449
444 3300041407 Ga0439447_007915 Ga0439447_007915_148_1560 449
445 3300041411 Ga0439466_0003666 Ga0439466_0003666_1942_3354 449
446 3300042137 Ga0450902_006281 Ga0450902_006281_183_1613 449
447 3300046453 Ga0495627_003266 Ga0495627_003266_5713_7149 449
448 3300046458 Ga0495591_002736 Ga0495591_002736_6238_7674 449
449 3300046474 Ga0495605_0029610 Ga0495605_0029610_975_2384 449
450 3300046512 Ga0495610_0006139 Ga0495610_0006139_2302_3687 449
451 3300046513 Ga0495616_0004193 Ga0495616_0004193_5945_7381 449
452 3300046518 Ga0495631_0003220 Ga0495631_0003220_2251_3636 449
453 3300046519 Ga0495632_0037473 Ga0495632_0037473_958_2394 449
454 3300046524 Ga0495648_0007286 Ga0495648_0007286_1752_3188 449
455 3300046530 Ga0495654_0002450 Ga0495654_0002450_8708_10144 449
456 3300046558 Ga0495633_0027320 Ga0495633_0027320_131_1567 449
457 3300047446 Ga0495679_001747 Ga0495679_001747_8226_9611 449
458 3300047446 Ga0495679_005028 Ga0495679_005028_2024_3457 449
459 3300048091 Ga0495626_0004073 Ga0495626_0004073_5774_7210 449
460 3300049459 Ga0495678_004635 Ga0495678_004635_1115_2551 449
461 iso_pu_bacteria 2554235341 2555667469 449
462 iso_pu_bacteria 2599185160 2599356690 449
463 iso_pu_bacteria 2599185161 2599363278 449
464 iso_pu_bacteria 2599185162 2599369770 449
465 iso_pu_bacteria 2599185163 2599376387 449
466 iso_pu_bacteria 2599185164 2599381795 449
467 iso_pu_bacteria 2599185165 2599388061 449
468 iso_pu_bacteria 2599185166 2599395415 449
469 iso_pu_bacteria 2599185168 2599407180 449
470 iso_pu_bacteria 2599185181 2599463523 449
471 iso_pu_bacteria 2599185182 2599469127 449
472 iso_pu_bacteria 2599185186 2599492542 449
473 iso_pu_bacteria 2599185288 2599883527 449
474 iso_pu_bacteria 2599185303 2599950713 449
475 iso_pu_bacteria 2599185356 2600216152 449
476 iso_pu_bacteria 2600255313 2601776319 449
477 iso_pu_bacteria 2667528171 2671099920 449
478 iso_pu_bacteria 2738541294 2738807859 449
479 iso_pu_bacteria 2738541309 2738895219 449
480 iso_pu_bacteria 2808606385 2808976611 449
481 iso_pu_bacteria 2808606388 2808991951 449
482 iso_pu_bacteria 2818991464 2819705264 449
483 iso_pu_bacteria 2852612431 2852617122 449
484 iso_pu_bacteria 2852667396 2852671889 449
485 iso_pu_bacteria 2917070673 2917071219 449
486 iso_pu_bacteria 2935353572 2935359047 449
487 iso_pu_bacteria 3007395558 3007399664 449
488 iso_pu_bacteria 3007419365 3007420061 449
489 iso_pu_bacteria 637000220 637317864 449
490 iso_pu_bacteria 8019769354 8019770348 449
491 iso_pu_bacteria 8054503363 8054504012 449
492 3300009036 Ga0105244_10006252 Ga0105244_100062522 450
493 3300025728 Ga0207655_1002792 Ga0207655_10027924 450
494 3300025728 Ga0207655_1016731 Ga0207655_10167312 450
495 3300025935 Ga0207709_10000022 Ga0207709_10000022218 450
496 3300046457 Ga0495590_0020215 Ga0495590_0020215_548_1960 450
497 3300046460 Ga0495638_0006204 Ga0495638_0006204_1951_3363 450
498 3300046529 Ga0495652_0104187 Ga0495652_0104187_277_1695 450
499 3300047320 Ga0495672_0005299 Ga0495672_0005299_6860_8272 450
500 3300048913 Ga0496110_0070650 Ga0496110_0070650_1410_2822 450
501 iso_pu_bacteria 2511231006 2511263757 450
502 iso_pu_bacteria 2512047018 2512325995 450
503 iso_pu_bacteria 2582580891 2583789766 450
504 iso_pu_bacteria 2597489887 2597855700 450
505 iso_pu_bacteria 2599185185 2599485602 450
506 iso_pu_bacteria 2599185257 2599806731 450
507 iso_pu_bacteria 2600254931 2600364839 450
508 iso_pu_bacteria 2671180172 2671772382 450
509 iso_pu_bacteria 2740892503 2743735117 450
510 iso_pu_bacteria 2923153595 2923154112 450
511 iso_pu_bacteria 2984286254 2984291947 450
512 iso_pu_bacteria 3007872151 3007876172 450
513 iso_pu_bacteria 8015687852 8015688361 450
514 iso_pu_bacteria 8055770955 8055771458 450
515 3300013100 Ga0157373_10006181 Ga0157373_100061811 451
516 3300013306 Ga0163162_10006614 Ga0163162_100066147 451
517 3300041405 Ga0439438_004508 Ga0439438_004508_721_2163 451
518 3300041411 Ga0439466_0002064 Ga0439466_0002064_1685_3127 451
519 3300042006 Ga0439432_007896 Ga0439432_007896_2165_3607 451
520 3300042010 Ga0439452_001259 Ga0439452_001259_7249_8691 451
521 3300046458 Ga0495591_003597 Ga0495591_003597_4610_6022 451
522 3300046519 Ga0495632_0005798 Ga0495632_0005798_1695_3149 451
523 3300046519 Ga0495632_0007992 Ga0495632_0007992_1786_3198 451
524 3300046520 Ga0495637_0030050 Ga0495637_0030050_935_2389 451
525 3300046530 Ga0495654_0025539 Ga0495654_0025539_1396_2808 451
526 3300046692 Ga0495671_0009354 Ga0495671_0009354_2068_3480 451
527 3300046694 Ga0495649_0003370 Ga0495649_0003370_2553_3965 451
528 3300046794 Ga0495589_0004711 Ga0495589_0004711_59_1513 451
529 3300047320 Ga0495672_0002133 Ga0495672_0002133_15133_16545 451
530 3300047323 Ga0495683_0007161 Ga0495683_0007161_2571_3983 451
531 iso_pu_bacteria 2806310745 2807454637 451
532 3300003323 rootH1_10205636 rootH1_102056363 452
533 3300005288 Ga0065714_10065252 Ga0065714_100652525 452
534 3300005331 Ga0070670_100008123 Ga0070670_1000081233 452
535 3300006058 Ga0075432_10001012 Ga0075432_100010123 452
536 3300006058 Ga0075432_10044040 Ga0075432_100440401 452
537 3300009036 Ga0105244_10005741 Ga0105244_100057415 452
538 3300009092 Ga0105250_10002893 Ga0105250_100028937 452
539 3300011119 Ga0105246_10002969 Ga0105246_100029696 452
540 3300013308 Ga0157375_10014105 Ga0157375_100141053 452
541 3300014497 Ga0182008_10073853 Ga0182008_100738532 452
542 3300015262 Ga0182007_10037098 Ga0182007_100370981 452
543 3300015265 Ga0182005_1003299 Ga0182005_10032994 452
544 3300017792 Ga0163161_10009569 Ga0163161_100095694 452
545 3300017792 Ga0163161_10025965 Ga0163161_100259652 452
546 3300025728 Ga0207655_1005928 Ga0207655_10059283 452
547 3300027907 Ga0207428_10116693 Ga0207428_101166931 452
548 3300042013 Ga0439456_000149 Ga0439456_000149_17143_18543 452
549 3300042137 Ga0450902_000150 Ga0450902_000150_4931_6331 452
550 3300046458 Ga0495591_013428 Ga0495591_013428_387_1787 452
551 3300046475 Ga0495639_0000316 Ga0495639_0000316_3066_4499 452
552 3300046491 Ga0495584_0002775 Ga0495584_0002775_3100_4545 452
553 3300046492 Ga0495585_0006374 Ga0495585_0006374_1811_3211 452
554 3300046501 Ga0495607_0012045 Ga0495607_0012045_3693_5093 452
555 3300046518 Ga0495631_0028916 Ga0495631_0028916_197_1642 452
556 3300046519 Ga0495632_0018512 Ga0495632_0018512_1669_3069 452
557 3300046522 Ga0495643_0006391 Ga0495643_0006391_1286_2686 452
558 3300046524 Ga0495648_0052536 Ga0495648_0052536_447_1892 452
559 3300046526 Ga0495666_0006861 Ga0495666_0006861_1846_3279 452
560 3300046542 Ga0495597_0005981 Ga0495597_0005981_3552_4952 452
561 3300046542 Ga0495597_0012884 Ga0495597_0012884_739_2139 452
562 3300046542 Ga0495597_0048473 Ga0495597_0048473_379_1779 452
563 3300046557 Ga0495622_0004299 Ga0495622_0004299_485_1918 452
564 3300046691 Ga0495670_0002336 Ga0495670_0002336_6957_8357 452
565 3300046692 Ga0495671_0000786 Ga0495671_0000786_2355_3800 452
566 3300046692 Ga0495671_0003487 Ga0495671_0003487_1139_2539 452
567 3300046794 Ga0495589_0025126 Ga0495589_0025126_295_1695 452
568 3300046810 Ga0495660_0008262 Ga0495660_0008262_731_2131 452
569 3300047315 Ga0495581_0004162 Ga0495581_0004162_5157_6590 452
570 3300047323 Ga0495683_0004084 Ga0495683_0004084_5139_6584 452
571 3300047470 Ga0495681_0013880 Ga0495681_0013880_753_2153 452
572 3300047673 Ga0495593_0021299 Ga0495593_0021299_2018_3451 452
573 3300048091 Ga0495626_0002337 Ga0495626_0002337_3082_4515 452
574 3300049459 Ga0495678_005439 Ga0495678_005439_3703_5103 452
575 iso_pu_bacteria 2597489888 2597861709 452
576 iso_pu_bacteria 2599185189 2599506472 452
577 iso_pu_bacteria 2599185212 2599616661 452
578 iso_pu_bacteria 2599185311 2599994799 452
579 iso_pu_bacteria 2599185316 2600027025 452
580 iso_pu_bacteria 2599185318 2600034616 452
581 iso_pu_bacteria 2599185319 2600043422 452
582 iso_pu_bacteria 2599185322 2600062734 452
583 iso_pu_bacteria 2599185323 2600068451 452
584 iso_pu_bacteria 2599185325 2600077713 452
585 iso_pu_bacteria 2600255296 2601692392 452
586 iso_pu_bacteria 2619619299 2621302137 452
587 iso_pu_bacteria 2643221571 2643872576 452
588 iso_pu_bacteria 2643221713 2644619692 452
589 iso_pu_bacteria 2721755607 2723246603 452
590 iso_pu_bacteria 2738541265 2738674128 452
591 iso_pu_bacteria 2738541282 2738752521 452
592 iso_pu_bacteria 2738541303 2738861562 452
593 iso_pu_bacteria 2816332298 2817488453 452
594 iso_pu_bacteria 2842826826 2842830537 452
595 iso_pu_bacteria 2842837860 2842838680 452
596 iso_pu_bacteria 2860867994 2860868479 452
597 iso_pu_bacteria 2919385768 2919389726 452
598 iso_pu_bacteria 2939651529 2939655344 452
599 iso_pu_bacteria 8054347763 8054350088 452
600 iso_pu_bacteria 8056148874 8056152519 452
601 3300009036 Ga0105244_10035333 Ga0105244_100353332 453
602 3300009148 Ga0105243_10001058 Ga0105243_100010587 453
603 3300009148 Ga0105243_10001664 Ga0105243_1000166410 453
604 3300009553 Ga0105249_10029651 Ga0105249_100296514 453
605 3300025935 Ga0207709_10000578 Ga0207709_1000057812 453
606 3300025961 Ga0207712_10050930 Ga0207712_100509303 453
607 3300041411 Ga0439466_0000909 Ga0439466_0000909_7891_9297 453
608 3300042006 Ga0439432_002942 Ga0439432_002942_2085_3539 453
609 3300042009 Ga0439451_010410 Ga0439451_010410_222_1655 453
610 3300042013 Ga0439456_001914 Ga0439456_001914_2518_3972 453
611 3300042142 Ga0450905_005057 Ga0450905_005057_179_1612 453
612 3300046457 Ga0495590_0041490 Ga0495590_0041490_92_1546 453
613 3300046460 Ga0495638_0016914 Ga0495638_0016914_3317_4771 453
614 3300046474 Ga0495605_0075626 Ga0495605_0075626_29_1432 453
615 3300046491 Ga0495584_0012855 Ga0495584_0012855_940_2394 453
616 3300046506 Ga0495583_0003317 Ga0495583_0003317_2819_4216 453
617 3300046512 Ga0495610_0017463 Ga0495610_0017463_565_2019 453
618 3300046515 Ga0495620_0017960 Ga0495620_0017960_278_1732 453
619 3300046524 Ga0495648_0050432 Ga0495648_0050432_815_2269 453
620 3300046530 Ga0495654_0002259 Ga0495654_0002259_2807_4204 453
621 3300046530 Ga0495654_0004876 Ga0495654_0004876_958_2412 453
622 3300046530 Ga0495654_0038971 Ga0495654_0038971_865_2319 453
623 3300046542 Ga0495597_0055128 Ga0495597_0055128_123_1577 453
624 3300046558 Ga0495633_0055934 Ga0495633_0055934_103_1557 453
625 3300046660 Ga0495625_0092714 Ga0495625_0092714_565_2019 453
626 3300046665 Ga0495661_0073602 Ga0495661_0073602_381_1835 453
627 3300046691 Ga0495670_0081437 Ga0495670_0081437_109_1563 453
628 3300046794 Ga0495589_0003249 Ga0495589_0003249_1793_3247 453
629 3300047323 Ga0495683_0002933 Ga0495683_0002933_2548_4002 453
630 3300047470 Ga0495681_0012063 Ga0495681_0012063_2258_3712 453
631 3300048919 Ga0496116_0000567 Ga0496116_0000567_33661_35073 453
632 3300048920 Ga0496117_0004132 Ga0496117_0004132_7148_8560 453
633 3300048921 Ga0496118_0012074 Ga0496118_0012074_2904_4316 453
634 3300048925 Ga0496122_0009984 Ga0496122_0009984_2267_3679 453
635 3300048926 Ga0496123_0003938 Ga0496123_0003938_3339_4751 453
636 iso_pu_bacteria 2511231010 2511288742 453
637 iso_pu_bacteria 2511231011 2511297393 453
638 iso_pu_bacteria 2511231023 2511367735 453
639 iso_pu_bacteria 2600255318 2601797880 453
640 iso_pu_bacteria 2603880185 2606076637 453
641 iso_pu_bacteria 2603880199 2606128949 453
642 iso_pu_bacteria 2623620443 2624478267 453
643 iso_pu_bacteria 2651869719 2652546873 453
644 iso_pu_bacteria 2713897149 2715755521 453
645 iso_pu_bacteria 2773857673 2774134781 453
646 iso_pu_bacteria 2784132063 2784261000 453
647 iso_pu_bacteria 2808606361 2808855989 453
648 iso_pu_bacteria 2808606376 2808922696 453
649 iso_pu_bacteria 2808606378 2808936069 453
650 iso_pu_bacteria 2808606380 2808944383 453
651 iso_pu_bacteria 2808606383 2808964434 453
652 iso_pu_bacteria 2808606389 2808999322 453
653 iso_pu_bacteria 2808606445 2809218025 453
654 iso_pu_bacteria 2818991456 2819657278 453
655 iso_pu_bacteria 2852657418 2852660406 453
656 iso_pu_bacteria 2878029506 2878030209 453
657 iso_pu_bacteria 2880230671 2880231159 453
658 iso_pu_bacteria 2908446538 2908447075 453
659 iso_pu_bacteria 2919063839 2919066108 453
660 iso_pu_bacteria 2946006987 2946012466 453
661 iso_pu_bacteria 2988728565 2988732250 453
662 iso_pu_bacteria 3007614139 3007617828 453
663 iso_pu_bacteria 3007718800 3007720306 453
664 iso_pu_bacteria 3007866637 3007872118 453
665 iso_pu_bacteria 8056131705 8056132381 453
666 iso_pu_bacteria 8056172158 8056176662 453
667 iso_pu_bacteria 8056569372 8056572366 453
668 3300013100 Ga0157373_10070416 Ga0157373_100704162 454
669 3300042016 Ga0439463_001162 Ga0439463_001162_5182_6588 454
670 3300046520 Ga0495637_0006304 Ga0495637_0006304_2243_3688 454
671 3300046660 Ga0495625_0017703 Ga0495625_0017703_3342_4787 454
672 3300049459 Ga0495678_002999 Ga0495678_002999_2106_3551 454
673 iso_pu_bacteria 2511231004 2511256109 454
674 iso_pu_bacteria 2511231008 2511278863 454
675 iso_pu_bacteria 2511231012 2511303336 454
676 iso_pu_bacteria 2511231014 2511316359 454
677 iso_pu_bacteria 2511231015 2511319405 454
678 iso_pu_bacteria 2511231016 2511323509 454
679 iso_pu_bacteria 2511231017 2511330948 454
680 iso_pu_bacteria 2511231020 2511349154 454
681 iso_pu_bacteria 2623620446 2624489809 454
682 iso_pu_bacteria 2643221589 2643954857 454
683 iso_pu_bacteria 2643221602 2644024497 454
684 iso_pu_bacteria 2643221650 2644282027 454
685 iso_pu_bacteria 2738543015 2739260015 454
686 iso_pu_bacteria 2808606377 2808933129 454
687 iso_pu_bacteria 2808606381 2808955251 454
688 iso_pu_bacteria 2808606382 2808955918 454
689 iso_pu_bacteria 2825651385 2825654221 454
690 iso_pu_bacteria 2860339153 2860343594 454
691 iso_pu_bacteria 2904550169 2904555525 454
692 iso_pu_bacteria 2919155634 2919157633 454
693 iso_pu_bacteria 2919456309 2919460034 454
694 iso_pu_bacteria 2919697872 2919698911 454
695 iso_pu_bacteria 2931396565 2931398889 454
696 iso_pu_bacteria 2939636861 2939641155 454
697 iso_pu_bacteria 3007511990 3007517961 454
698 iso_pu_bacteria 8019775933 8019777385 454
699 iso_pu_bacteria 8056125926 8056126519 454
700 3300009036 Ga0105244_10005221 Ga0105244_100052216 455
701 3300009036 Ga0105244_10013180 Ga0105244_100131804 455
702 3300009036 Ga0105244_10021132 Ga0105244_100211321 455
703 3300009148 Ga0105243_10039999 Ga0105243_100399994 455
704 3300014497 Ga0182008_10008895 Ga0182008_100088954 455
705 3300015261 Ga0182006_1002882 Ga0182006_10028825 455
706 3300015262 Ga0182007_10000541 Ga0182007_100005414 455
707 3300015265 Ga0182005_1000461 Ga0182005_100046116 455
708 3300025728 Ga0207655_1000565 Ga0207655_100056525 455
709 3300025728 Ga0207655_1009639 Ga0207655_10096394 455
710 3300025935 Ga0207709_10011620 Ga0207709_100116204 455
711 3300027312 Ga0209371_1000473 Ga0209371_10004737 455
712 3300030500 Ga0268256_1000399 Ga0268256_10003997 455
713 3300042006 Ga0439432_001015 Ga0439432_001015_2111_3514 455
714 3300042142 Ga0450905_000098 Ga0450905_000098_5239_6642 455
715 3300046501 Ga0495607_0000527 Ga0495607_0000527_14131_15540 455
716 3300046506 Ga0495583_0008953 Ga0495583_0008953_2616_4061 455
717 3300046515 Ga0495620_0000091 Ga0495620_0000091_8206_9609 455
718 3300046519 Ga0495632_0000679 Ga0495632_0000679_27420_28823 455
719 3300046522 Ga0495643_0000501 Ga0495643_0000501_8225_9628 455
720 3300046522 Ga0495643_0004407 Ga0495643_0004407_2929_4332 455
721 3300046522 Ga0495643_0008423 Ga0495643_0008423_2480_3925 455
722 3300046524 Ga0495648_0000635 Ga0495648_0000635_33896_35299 455
723 3300046524 Ga0495648_0020440 Ga0495648_0020440_2716_4161 455
724 3300046616 Ga0495668_0023514 Ga0495668_0023514_366_1775 455
725 3300046664 Ga0495659_0000605 Ga0495659_0000605_3203_4648 455
726 3300046694 Ga0495649_0004814 Ga0495649_0004814_5391_6836 455
727 3300046794 Ga0495589_0000941 Ga0495589_0000941_532_1977 455
728 3300046794 Ga0495589_0013427 Ga0495589_0013427_2458_3903 455
729 3300046810 Ga0495660_0001226 Ga0495660_0001226_2443_3852 455
730 3300046810 Ga0495660_0011598 Ga0495660_0011598_1907_3352 455
731 3300047323 Ga0495683_0002029 Ga0495683_0002029_9854_11299 455
732 3300047443 Ga0495687_002205 Ga0495687_002205_9267_10712 455
733 3300047443 Ga0495687_004728 Ga0495687_004728_5589_7034 455
734 3300048909 Ga0496106_0022906 Ga0496106_0022906_854_2299 455
735 3300048919 Ga0496116_0002335 Ga0496116_0002335_17567_19012 455
736 3300048920 Ga0496117_0007457 Ga0496117_0007457_6898_8301 455
737 3300048920 Ga0496117_0007691 Ga0496117_0007691_6901_8304 455
738 3300048920 Ga0496117_0051700 Ga0496117_0051700_485_1930 455
739 3300048921 Ga0496118_0010498 Ga0496118_0010498_5533_6936 455
740 3300048921 Ga0496118_0076257 Ga0496118_0076257_483_1928 455
741 3300048924 Ga0496121_0065631 Ga0496121_0065631_1284_2687 455
742 3300048924 Ga0496121_0185490 Ga0496121_0185490_33_1436 455
743 3300048925 Ga0496122_0010675 Ga0496122_0010675_5920_7365 455
744 3300048926 Ga0496123_0064330 Ga0496123_0064330_38_1483 455
745 3300048927 Ga0496124_0011500 Ga0496124_0011500_3357_4760 455
746 3300048927 Ga0496124_0042366 Ga0496124_0042366_2409_3854 455
747 3300048928 Ga0496125_0002691 Ga0496125_0002691_17538_18941 455
748 3300048928 Ga0496125_0014498 Ga0496125_0014498_4145_5548 455
749 3300048929 Ga0496126_0030921 Ga0496126_0030921_1940_3343 455
750 3300049571 Ga0501034_0000524 Ga0501034_0000524_27572_28975 455
751 iso_pu_bacteria 2511231024 2511375617 455
752 iso_pu_bacteria 2554235132 2554818042 455
753 iso_pu_bacteria 2599185307 2599973006 455
754 iso_pu_bacteria 2606217733 2608380652 455
755 iso_pu_bacteria 2765235841 2765581654 455
756 iso_pu_bacteria 3007803356 3007808582 455
757 iso_pu_bacteria 8052494512 8052495092 455
758 iso_pu_bacteria 8054929484 8054930750 455
759 iso_pu_bacteria 8055878733 8055879928 455
760 iso_pu_bacteria 8056120720 8056125423 455
761 3300003791 Ga0055530_10000374 Ga0055530_1000037413 456
762 3300003792 Ga0055540_1000337 Ga0055540_100033712 456
763 3300006946 Ga0079104_1000654 Ga0079104_100065413 456
764 3300009011 Ga0105251_10009645 Ga0105251_100096453 456
765 3300009036 Ga0105244_10058303 Ga0105244_100583032 456
766 3300014497 Ga0182008_10031954 Ga0182008_100319542 456
767 3300025298 Ga0209050_1000028 Ga0209050_1000028310 456
768 3300025303 Ga0209051_1000080 Ga0209051_1000080143 456
769 3300025304 Ga0209257_1019157 Ga0209257_10191572 456
770 3300025728 Ga0207655_1000014 Ga0207655_1000014186 456
771 3300025735 Ga0207713_1001942 Ga0207713_100194211 456
772 3300025735 Ga0207713_1004732 Ga0207713_10047326 456
773 3300027111 Ga0209281_1000026 Ga0209281_1000026345 456
774 3300031344 Ga0265316_10048058 Ga0265316_100480582 456
775 3300041405 Ga0439438_008136 Ga0439438_008136_1971_3425 456
776 3300042006 Ga0439432_001566 Ga0439432_001566_6155_7567 456
777 3300046452 Ga0495617_001442 Ga0495617_001442_7105_8517 456
778 3300046453 Ga0495627_002112 Ga0495627_002112_6958_8370 456
779 3300046453 Ga0495627_022603 Ga0495627_022603_346_1758 456
780 3300046457 Ga0495590_0002250 Ga0495590_0002250_2008_3420 456
781 3300046458 Ga0495591_002193 Ga0495591_002193_6975_8387 456
782 3300046458 Ga0495591_003299 Ga0495591_003299_776_2182 456
783 3300046460 Ga0495638_0018664 Ga0495638_0018664_2584_3996 456
784 3300046460 Ga0495638_0030597 Ga0495638_0030597_255_1667 456
785 3300046460 Ga0495638_0105714 Ga0495638_0105714_105_1547 456
786 3300046471 Ga0495650_0005336 Ga0495650_0005336_1898_3310 456
787 3300046491 Ga0495584_0019847 Ga0495584_0019847_1776_3188 456
788 3300046500 Ga0495596_0000758 Ga0495596_0000758_16732_18144 456
789 3300046501 Ga0495607_0015365 Ga0495607_0015365_1942_3354 456
790 3300046507 Ga0495606_0008985 Ga0495606_0008985_6258_7664 456
791 3300046507 Ga0495606_0021664 Ga0495606_0021664_735_2147 456
792 3300046512 Ga0495610_0016511 Ga0495610_0016511_1865_3277 456
793 3300046515 Ga0495620_0005551 Ga0495620_0005551_1869_3281 456
794 3300046518 Ga0495631_0003554 Ga0495631_0003554_439_1851 456
795 3300046519 Ga0495632_0014844 Ga0495632_0014844_423_1835 456
796 3300046520 Ga0495637_0000857 Ga0495637_0000857_15984_17396 456
797 3300046520 Ga0495637_0004412 Ga0495637_0004412_3623_5035 456
798 3300046522 Ga0495643_0036666 Ga0495643_0036666_841_2253 456
799 3300046523 Ga0495644_0002024 Ga0495644_0002024_1906_3318 456
800 3300046523 Ga0495644_0003187 Ga0495644_0003187_2080_3492 456
801 3300046524 Ga0495648_0034369 Ga0495648_0034369_1143_2555 456
802 3300046530 Ga0495654_0003122 Ga0495654_0003122_1932_3344 456
803 3300046530 Ga0495654_0005097 Ga0495654_0005097_5296_6741 456
804 3300046542 Ga0495597_0023503 Ga0495597_0023503_999_2411 456
805 3300046616 Ga0495668_0001744 Ga0495668_0001744_15983_17395 456
806 3300046660 Ga0495625_0008510 Ga0495625_0008510_1954_3366 456
807 3300046665 Ga0495661_0005588 Ga0495661_0005588_6586_7992 456
808 3300046691 Ga0495670_0049082 Ga0495670_0049082_530_1942 456
809 3300046692 Ga0495671_0021574 Ga0495671_0021574_180_1634 456
810 3300046694 Ga0495649_0004350 Ga0495649_0004350_1717_3129 456
811 3300046794 Ga0495589_0006037 Ga0495589_0006037_1964_3376 456
812 3300046810 Ga0495660_0007568 Ga0495660_0007568_3878_5290 456
813 3300047320 Ga0495672_0037898 Ga0495672_0037898_1243_2697 456
814 3300047323 Ga0495683_0007282 Ga0495683_0007282_1779_3191 456
815 3300047323 Ga0495683_0022247 Ga0495683_0022247_68_1480 456
816 3300047469 Ga0495673_0069321 Ga0495673_0069321_57_1469 456
817 3300047470 Ga0495681_0003486 Ga0495681_0003486_2554_3966 456
818 3300047470 Ga0495681_0079462 Ga0495681_0079462_16_1428 456
819 3300048091 Ga0495626_0003094 Ga0495626_0003094_7001_8413 456
820 3300048091 Ga0495626_0003755 Ga0495626_0003755_5616_7070 456
821 3300048920 Ga0496117_0107499 Ga0496117_0107499_133_1587 456
822 3300048927 Ga0496124_0025506 Ga0496124_0025506_148_1602 456
823 3300048927 Ga0496124_0163209 Ga0496124_0163209_192_1598 456
824 3300048929 Ga0496126_0094636 Ga0496126_0094636_183_1589 456
825 3300049459 Ga0495678_012381 Ga0495678_012381_1892_3304 456
826 3300049460 Ga0495682_0019980 Ga0495682_0019980_1022_2476 456
827 iso_pu_bacteria 2511231156 2511822500 456
828 iso_pu_bacteria 8057798959 8057802750 456
829 3300005331 Ga0070670_100004108 Ga0070670_1000041084 457
830 3300006946 Ga0079104_1000638 Ga0079104_100063813 457
831 3300006948 Ga0099826_10032053 Ga0099826_100320533 457
832 3300009011 Ga0105251_10029622 Ga0105251_100296222 457
833 3300009036 Ga0105244_10056253 Ga0105244_100562532 457
834 3300015261 Ga0182006_1007785 Ga0182006_10077853 457
835 3300025735 Ga0207713_1000759 Ga0207713_100075911 457
836 3300025925 Ga0207650_10000868 Ga0207650_100008686 457
837 3300027111 Ga0209281_1000033 Ga0209281_1000033182 457
838 3300027666 Ga0209282_1033152 Ga0209282_10331522 457
839 3300041411 Ga0439466_0004339 Ga0439466_0004339_2525_3940 457
840 3300042009 Ga0439451_000331 Ga0439451_000331_4241_5656 457
841 3300042016 Ga0439463_001490 Ga0439463_001490_144_1589 457
842 3300046452 Ga0495617_041264 Ga0495617_041264_56_1510 457
843 3300046458 Ga0495591_023991 Ga0495591_023991_407_1861 457
844 3300046474 Ga0495605_0003776 Ga0495605_0003776_7156_8598 457
845 3300046492 Ga0495585_0042400 Ga0495585_0042400_24_1478 457
846 3300046506 Ga0495583_0006466 Ga0495583_0006466_1868_3322 457
847 3300046507 Ga0495606_0008932 Ga0495606_0008932_5007_6422 457
848 3300046507 Ga0495606_0008987 Ga0495606_0008987_5296_6711 457
849 3300046512 Ga0495610_0023099 Ga0495610_0023099_1912_3366 457
850 3300046520 Ga0495637_0003999 Ga0495637_0003999_5559_6995 457
851 3300046520 Ga0495637_0006756 Ga0495637_0006756_3862_5277 457
852 3300046524 Ga0495648_0047789 Ga0495648_0047789_274_1728 457
853 3300046557 Ga0495622_0003950 Ga0495622_0003950_4227_5681 457
854 3300046674 Ga0495588_0016240 Ga0495588_0016240_227_1681 457
855 3300046691 Ga0495670_0004237 Ga0495670_0004237_82_1536 457
856 3300046694 Ga0495649_0004320 Ga0495649_0004320_5939_7393 457
857 3300046794 Ga0495589_0030589 Ga0495589_0030589_538_1974 457
858 3300046810 Ga0495660_0005441 Ga0495660_0005441_1994_3430 457
859 3300046810 Ga0495660_0005629 Ga0495660_0005629_524_1960 457
860 3300047320 Ga0495672_0014504 Ga0495672_0014504_3511_4926 457
861 3300047443 Ga0495687_003021 Ga0495687_003021_9229_10683 457
862 3300047469 Ga0495673_0012839 Ga0495673_0012839_2027_3481 457
863 3300047469 Ga0495673_0023398 Ga0495673_0023398_1409_2845 457
864 3300047470 Ga0495681_0005992 Ga0495681_0005992_1833_3248 457
865 3300047470 Ga0495681_0028279 Ga0495681_0028279_851_2266 457
866 3300048091 Ga0495626_0001539 Ga0495626_0001539_1048_2502 457
867 3300048925 Ga0496122_0012166 Ga0496122_0012166_5251_6666 457
868 3300049459 Ga0495678_009655 Ga0495678_009655_2267_3721 457
869 3300049459 Ga0495678_045026 Ga0495678_045026_293_1729 457
870 iso_pu_bacteria 2904518522 2904519614 457
871 2162886007 SwRhRL2b_contig_2389706 SwRhRL2b_0147.00000680 458
872 3300005288 Ga0065714_10002407 Ga0065714_100024074 458
873 3300005289 Ga0065704_10071239 Ga0065704_100712395 458
874 3300005457 Ga0070662_100001096 Ga0070662_1000010967 458
875 3300005539 Ga0068853_100000210 Ga0068853_10000021025 458
876 3300006058 Ga0075432_10014361 Ga0075432_100143612 458
877 3300006944 Ga0099823_1012277 Ga0099823_10122775 458
878 3300013100 Ga0157373_10003369 Ga0157373_100033699 458
879 3300013102 Ga0157371_10003830 Ga0157371_1000383010 458
880 3300013102 Ga0157371_10004311 Ga0157371_100043119 458
881 3300013104 Ga0157370_10166590 Ga0157370_101665902 458
882 3300013105 Ga0157369_10007148 Ga0157369_100071484 458
883 3300015261 Ga0182006_1002538 Ga0182006_10025385 458
884 3300025292 Ga0209676_1002421 Ga0209676_10024214 458
885 3300025298 Ga0209050_1001079 Ga0209050_100107914 458
886 3300025711 Ga0207696_1000074 Ga0207696_1000074117 458
887 3300025728 Ga0207655_1000474 Ga0207655_100047418 458
888 3300025728 Ga0207655_1004125 Ga0207655_10041254 458
889 3300025728 Ga0207655_1026247 Ga0207655_10262472 458
890 3300025735 Ga0207713_1008135 Ga0207713_10081355 458
891 3300025735 Ga0207713_1020038 Ga0207713_10200382 458
892 3300025933 Ga0207706_10000624 Ga0207706_1000062415 458
893 3300026041 Ga0207639_10000706 Ga0207639_1000070613 458
894 3300027907 Ga0207428_10028455 Ga0207428_100284554 458
895 3300027907 Ga0207428_10032366 Ga0207428_100323662 458
896 3300031548 Ga0307408_100002000 Ga0307408_10000200012 458
897 3300041407 Ga0439447_001145 Ga0439447_001145_1824_3257 458
898 3300041411 Ga0439466_0011844 Ga0439466_0011844_37_1470 458
899 3300046460 Ga0495638_0005442 Ga0495638_0005442_2746_4179 458
900 3300046463 Ga0495653_0005805 Ga0495653_0005805_6674_8107 458
901 3300046474 Ga0495605_0003152 Ga0495605_0003152_6461_7894 458
902 3300046517 Ga0495630_0028393 Ga0495630_0028393_177_1610 458
903 3300046526 Ga0495666_0004668 Ga0495666_0004668_200_1633 458
904 3300046536 Ga0495587_0004096 Ga0495587_0004096_3877_5310 458
905 3300046642 Ga0495634_0005296 Ga0495634_0005296_2224_3657 458
906 3300046660 Ga0495625_0008907 Ga0495625_0008907_1917_3350 458
907 3300046663 Ga0495635_0004126 Ga0495635_0004126_6661_8094 458
908 3300046675 Ga0495657_0042211 Ga0495657_0042211_1505_2938 458
909 3300046679 Ga0495623_0004261 Ga0495623_0004261_6171_7604 458
910 3300046679 Ga0495623_0011177 Ga0495623_0011177_1694_3127 458
911 3300046810 Ga0495660_0002767 Ga0495660_0002767_1407_2819 458
912 3300047317 Ga0495604_0007882 Ga0495604_0007882_5161_6594 458
913 3300047319 Ga0495674_0011022 Ga0495674_0011022_6314_7747 458
914 3300047320 Ga0495672_0080463 Ga0495672_0080463_232_1665 458
915 3300047322 Ga0495680_0007525 Ga0495680_0007525_6565_7998 458
916 3300047444 Ga0495675_0020858 Ga0495675_0020858_190_1623 458
917 3300047470 Ga0495681_0010681 Ga0495681_0010681_2269_3711 458
918 3300048905 Ga0496102_0006443 Ga0496102_0006443_6632_8065 458
919 3300048906 Ga0496103_0003292 Ga0496103_0003292_2126_3559 458
920 3300048919 Ga0496116_0007729 Ga0496116_0007729_6287_7720 458
921 3300048920 Ga0496117_0006333 Ga0496117_0006333_8494_9909 458
922 3300048920 Ga0496117_0008611 Ga0496117_0008611_1920_3353 458
923 3300048921 Ga0496118_0009376 Ga0496118_0009376_2137_3570 458
924 3300048922 Ga0496119_0005376 Ga0496119_0005376_8530_9942 458
925 3300048923 Ga0496120_0003881 Ga0496120_0003881_3156_4568 458
926 3300048924 Ga0496121_0060484 Ga0496121_0060484_1267_2703 458
927 3300048925 Ga0496122_0011040 Ga0496122_0011040_2104_3516 458
928 3300048927 Ga0496124_0007242 Ga0496124_0007242_8213_9625 458
929 3300048928 Ga0496125_0016256 Ga0496125_0016256_2854_4266 458
930 3300049460 Ga0495682_0000235 Ga0495682_0000235_18884_20311 458
931 iso_pu_bacteria 2511231018 2511337811 458
932 iso_pu_bacteria 2511231019 2511344573 458
933 iso_pu_bacteria 2511231021 2511354453 458
934 iso_pu_bacteria 2599185302 2599944681 458
935 iso_pu_bacteria 2599185304 2599957301 458
936 iso_pu_bacteria 2599185309 2599983252 458
937 iso_pu_bacteria 2599185310 2599991639 458
938 iso_pu_bacteria 2599185312 2600000938 458
939 iso_pu_bacteria 2599185320 2600048259 458
940 iso_pu_bacteria 2643221633 2644190191 458
941 iso_pu_bacteria 2738543004 2739200507 458
942 iso_pu_bacteria 2773857670 2774119509 458
943 iso_pu_bacteria 2784132072 2784315920 458
944 iso_pu_bacteria 8056155041 8056158561 458
945 iso_pu_bacteria 8056177738 8056182998 458
946 3300031911 Ga0307412_10001787 Ga0307412_100017874 459
947 3300046453 Ga0495627_000175 Ga0495627_000175_62521_63960 459
948 3300046542 Ga0495597_0005020 Ga0495597_0005020_3772_5214 459
949 3300047470 Ga0495681_0006923 Ga0495681_0006923_3772_5214 459
950 3300048913 Ga0496110_0018823 Ga0496110_0018823_2228_3661 459
951 3300048927 Ga0496124_0003647 Ga0496124_0003647_2438_3871 459
952 iso_pu_bacteria 2554235231 2555245104 459
953 3300002737 JGI25162J39368_1000179 JGI25162J39368_100017948 460
954 3300002771 JGI25163J39215_1000324 JGI25163J39215_10003244 460
955 3300002772 JGI25164J39214_1000145 JGI25164J39214_100014548 460
956 3300003214 JGI25165J46597_1000266 JGI25165J46597_100026611 460
957 3300003751 Ga0055538_1000037 Ga0055538_100003750 460
958 3300003752 Ga0055539_1000048 Ga0055539_100004850 460
959 3300003756 Ga0055533_1000059 Ga0055533_100005950 460
960 3300003758 Ga0055532_1000096 Ga0055532_100009629 460
961 3300003759 Ga0055525_1000189 Ga0055525_100018950 460
962 3300003841 Ga0055541_1000035 Ga0055541_1000035110 460
963 3300025206 Ga0209435_100426 Ga0209435_1004266 460
964 3300025207 Ga0209760_100181 Ga0209760_10018110 460
965 3300025224 Ga0209784_100028 Ga0209784_100028109 460
966 3300025225 Ga0209566_100028 Ga0209566_100028109 460
967 3300025226 Ga0209674_100047 Ga0209674_100047109 460
968 3300025229 Ga0209147_100031 Ga0209147_100031109 460
969 3300025230 Ga0209563_100050 Ga0209563_100050109 460
970 3300025231 Ga0207427_100016 Ga0207427_100016211 460
971 3300025233 Ga0209437_100011 Ga0209437_100011400 460
972 3300025242 Ga0209258_100150 Ga0209258_10015064 460
973 3300025246 Ga0209646_1000165 Ga0209646_100016546 460
974 3300025253 Ga0209677_100029 Ga0209677_100029109 460
975 3300025261 Ga0209233_1000019 Ga0209233_1000019400 460
976 3300047320 Ga0495672_0004228 Ga0495672_0004228_7168_8592 460
977 3300048915 Ga0496112_0029719 Ga0496112_0029719_251_1687 460
978 iso_pu_bacteria 2597489889 2597867432 460
979 iso_pu_bacteria 2675903420 2677898912 460
980 iso_pu_bacteria 2945961074 2945967636 460
981 iso_pu_bacteria 2946027586 2946028687 460
982 iso_pu_bacteria 2947233263 2947235216 460
983 3300046557 Ga0495622_0005291 Ga0495622_0005291_3275_4702 461
984 3300006058 Ga0075432_10000601 Ga0075432_100006019 462
985 3300006058 Ga0075432_10043348 Ga0075432_100433481 462
986 3300009036 Ga0105244_10032063 Ga0105244_100320632 462
987 3300027907 Ga0207428_10007988 Ga0207428_100079889 462
988 3300030744 Ga0316181_1024646 Ga0316181_102464610 462
989 3300041405 Ga0439438_001378 Ga0439438_001378_7705_9159 462
990 3300041405 Ga0439438_002269 Ga0439438_002269_5808_7238 462
991 3300041407 Ga0439447_001731 Ga0439447_001731_5657_7111 462
992 3300041411 Ga0439466_0030039 Ga0439466_0030039_112_1566 462
993 3300042010 Ga0439452_001613 Ga0439452_001613_5911_7341 462
994 3300042122 Ga0450920_000090 Ga0450920_000090_1555_3009 462
995 3300042124 Ga0450922_000081 Ga0450922_000081_1762_3216 462
996 3300042125 Ga0450923_000068 Ga0450923_000068_5780_7234 462
997 3300042145 Ga0450906_000879 Ga0450906_000879_1329_2783 462
998 3300042146 Ga0450907_000624 Ga0450907_000624_2123_3553 462
999 3300042146 Ga0450907_000702 Ga0450907_000702_867_2321 462
1000 3300042147 Ga0450910_000278 Ga0450910_000278_1571_3025 462
1001 3300042156 Ga0439446_0000304 Ga0439446_0000304_6332_7762 462
1002 3300042184 Ga0450908_006369 Ga0450908_006369_774_2228 462
1003 3300042435 Ga0439434_0000748 Ga0439434_0000748_2100_3530 462
1004 3300046452 Ga0495617_005152 Ga0495617_005152_1213_2667 462
1005 3300046455 Ga0495603_0005302 Ga0495603_0005302_4161_5591 462
1006 3300046457 Ga0495590_0001798 Ga0495590_0001798_5604_7058 462
1007 3300046457 Ga0495590_0004093 Ga0495590_0004093_507_1937 462
1008 3300046457 Ga0495590_0006346 Ga0495590_0006346_3045_4490 462
1009 3300046458 Ga0495591_019776 Ga0495591_019776_29_1459 462
1010 3300046463 Ga0495653_0017736 Ga0495653_0017736_2415_3860 462
1011 3300046471 Ga0495650_0004934 Ga0495650_0004934_1862_3292 462
1012 3300046471 Ga0495650_0006998 Ga0495650_0006998_5234_6679 462
1013 3300046474 Ga0495605_0000833 Ga0495605_0000833_18054_19508 462
1014 3300046474 Ga0495605_0005813 Ga0495605_0005813_2508_3938 462
1015 3300046491 Ga0495584_0002234 Ga0495584_0002234_2459_3889 462
1016 3300046491 Ga0495584_0002560 Ga0495584_0002560_7220_8665 462
1017 3300046491 Ga0495584_0012837 Ga0495584_0012837_561_1991 462
1018 3300046491 Ga0495584_0033928 Ga0495584_0033928_957_2411 462
1019 3300046492 Ga0495585_0000557 Ga0495585_0000557_31799_33229 462
1020 3300046492 Ga0495585_0007890 Ga0495585_0007890_1844_3274 462
1021 3300046492 Ga0495585_0010370 Ga0495585_0010370_919_2349 462
1022 3300046501 Ga0495607_0011074 Ga0495607_0011074_1607_3052 462
1023 3300046506 Ga0495583_0003311 Ga0495583_0003311_10967_12397 462
1024 3300046506 Ga0495583_0007403 Ga0495583_0007403_1853_3283 462
1025 3300046513 Ga0495616_0004894 Ga0495616_0004894_1282_2727 462
1026 3300046513 Ga0495616_0079819 Ga0495616_0079819_29_1459 462
1027 3300046519 Ga0495632_0001634 Ga0495632_0001634_14768_16198 462
1028 3300046519 Ga0495632_0003440 Ga0495632_0003440_2279_3724 462
1029 3300046520 Ga0495637_0006539 Ga0495637_0006539_1869_3314 462
1030 3300046520 Ga0495637_0010548 Ga0495637_0010548_2070_3500 462
1031 3300046524 Ga0495648_0010792 Ga0495648_0010792_4569_6023 462
1032 3300046528 Ga0495642_0000462 Ga0495642_0000462_17380_18834 462
1033 3300046528 Ga0495642_0000588 Ga0495642_0000588_2025_3455 462
1034 3300046528 Ga0495642_0003542 Ga0495642_0003542_2823_4268 462
1035 3300046530 Ga0495654_0054671 Ga0495654_0054671_119_1549 462
1036 3300046538 Ga0495609_0001391 Ga0495609_0001391_1874_3319 462
1037 3300046538 Ga0495609_0002232 Ga0495609_0002232_8118_9548 462
1038 3300046557 Ga0495622_0002049 Ga0495622_0002049_2135_3565 462
1039 3300046615 Ga0495656_0054829 Ga0495656_0054829_170_1600 462
1040 3300046616 Ga0495668_0064802 Ga0495668_0064802_30_1460 462
1041 3300046660 Ga0495625_0052138 Ga0495625_0052138_739_2169 462
1042 3300046684 Ga0495669_0001514 Ga0495669_0001514_3124_4554 462
1043 3300046691 Ga0495670_0009794 Ga0495670_0009794_81_1511 462
1044 3300046691 Ga0495670_0094953 Ga0495670_0094953_18_1448 462
1045 3300046692 Ga0495671_0003320 Ga0495671_0003320_2411_3841 462
1046 3300046692 Ga0495671_0043790 Ga0495671_0043790_78_1508 462
1047 3300046694 Ga0495649_0003199 Ga0495649_0003199_2293_3738 462
1048 3300046694 Ga0495649_0032303 Ga0495649_0032303_339_1793 462
1049 3300046794 Ga0495589_0014107 Ga0495589_0014107_11_1441 462
1050 3300046809 Ga0495600_0066338 Ga0495600_0066338_719_2164 462
1051 3300046810 Ga0495660_0005352 Ga0495660_0005352_4446_5876 462
1052 3300046810 Ga0495660_0006590 Ga0495660_0006590_3201_4631 462
1053 3300046810 Ga0495660_0009867 Ga0495660_0009867_215_1645 462
1054 3300047318 Ga0495636_0026959 Ga0495636_0026959_170_1615 462
1055 3300047320 Ga0495672_0000763 Ga0495672_0000763_18866_20311 462
1056 3300047320 Ga0495672_0003189 Ga0495672_0003189_10764_12218 462
1057 3300047320 Ga0495672_0020646 Ga0495672_0020646_865_2295 462
1058 3300047320 Ga0495672_0024790 Ga0495672_0024790_1699_3129 462
1059 3300047320 Ga0495672_0030072 Ga0495672_0030072_1906_3360 462
1060 3300047320 Ga0495672_0045538 Ga0495672_0045538_1087_2517 462
1061 3300047443 Ga0495687_005256 Ga0495687_005256_4605_6059 462
1062 3300047445 Ga0495677_0002169 Ga0495677_0002169_657_2087 462
1063 3300047446 Ga0495679_017212 Ga0495679_017212_1076_2506 462
1064 3300047447 Ga0495685_001013 Ga0495685_001013_6225_7670 462
1065 3300047447 Ga0495685_021998 Ga0495685_021998_570_2000 462
1066 3300047469 Ga0495673_0002691 Ga0495673_0002691_8409_9839 462
1067 3300047469 Ga0495673_0003897 Ga0495673_0003897_726_2171 462
1068 3300047469 Ga0495673_0025486 Ga0495673_0025486_1321_2775 462
1069 3300047469 Ga0495673_0050299 Ga0495673_0050299_78_1508 462
1070 3300047673 Ga0495593_0009495 Ga0495593_0009495_4093_5523 462
1071 3300048091 Ga0495626_0004685 Ga0495626_0004685_2231_3661 462
1072 3300048091 Ga0495626_0007844 Ga0495626_0007844_2260_3705 462
1073 3300048927 Ga0496124_0037701 Ga0496124_0037701_1773_3203 462
1074 3300049459 Ga0495678_003980 Ga0495678_003980_5381_6826 462
1075 3300049459 Ga0495678_026483 Ga0495678_026483_387_1817 462
1076 3300049460 Ga0495682_0007614 Ga0495682_0007614_267_1697 462
1077 3300050491 nmdc:mga00v17_120516_c1 nmdc:mga00v17_120516_c1_133_1587 462
1078 2124908027 MRS2a_Contig_87 MRS2a_00716360 466
1079 3300005288 Ga0065714_10000271 Ga0065714_100002712 466
1080 3300005288 Ga0065714_10017866 Ga0065714_100178662 466
1081 3300005293 Ga0065715_10003345 Ga0065715_100033452 466
1082 3300013104 Ga0157370_10027380 Ga0157370_100273804 466
1083 3300017792 Ga0163161_10040996 Ga0163161_100409961 466
1084 3300041407 Ga0439447_001958 Ga0439447_001958_1565_3007 466
1085 3300041411 Ga0439466_0004653 Ga0439466_0004653_3386_4828 466
1086 3300042185 Ga0450909_000098 Ga0450909_000098_1258_2700 466
1087 3300042461 Ga0439460_0002529 Ga0439460_0002529_2658_4100 466
1088 3300046519 Ga0495632_0025841 Ga0495632_0025841_1561_3003 466
1089 3300047320 Ga0495672_0001738 Ga0495672_0001738_3865_5307 466
1090 3300047323 Ga0495683_0003501 Ga0495683_0003501_7213_8655 466
1091 3300049460 Ga0495682_0040278 Ga0495682_0040278_254_1696 466

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

197

366

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fdf-assembly4.cif.gz_D crystal structure of s. pombe dnmt2 methyltransferase 0.6852 303 355
5hlz-assembly2.cif.gz_G structure of pro-activin a complex at 2.85 a resolution 0.6173 88 162
1q7t-assembly1.cif.gz_A rv1170 (mshb) from mycobacterium tuberculosis 0.5995 170 409
5xvs-assembly1.cif.gz_A crystal structure of udp-glcnac 2-epimerase neuc complexed with udp 0.5995 171 341
6sf2-assembly1.cif.gz_F ternary complex of human bone morphogenetic protein 9 (bmp9) growth factor domain, its prodomain and extracellular domain of activin receptor-like kinase 1 (alk1). 0.5983 80 165
ID Description Score Start End Superfamily
af_Q54C64_7_186_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.6575 163 345 3.40.50.10320
af_Q2G0L0_1_219_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.6239 171 459 3.40.50.10320
af_C6KT83_16_229_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.6179 169 357 3.40.50.10320
af_L0T643_2_220_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.614 164 459 3.40.50.10320
af_D4YWC2_19_236_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.6118 169 423 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A836ZIQ8-F1-model_v4 deleted 0.9626 163 314
AF-A0A1H0U336-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9437 5 460
AF-A0A656YRI4-F1-model_v4 deleted 0.9421 50 458
AF-A0A7Y2KWR7-F1-model_v4 PIG-L family deacetylase 0.9418 163 458
AF-A0A836ZIQ8-F1-model_v4 deleted 0.9383 163 314

Feature Viewer

pLDDT pTM Quality
83.26 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map