F489891
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1091 | 553 | 2182 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0024154|Ga0496121_0024154_685_1383 |
| Length | 232 |
| Sequence | MHQFGYNHVVYLVEAARWTVALSLIAFAGGSILGFFLALARVQPGSGLVRKLALVSMRLFQATPLLMQLFMFYFGLSIIGLELSAWASASIALIVYTGTFLGEIWQGCIQAVPKGQSDAGKALALTYSQRMSRIILPQAVRIALAPSVGFLVQVIKSTSLASIVGFAELIRASQMVNNVTLRPLLVYSIVMLIYFVLCWPLSLWSRHLERRLAAKGRTVDATVKPELQVVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 87 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 189 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 197 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 198 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 199 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 200 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 201 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 202 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 203 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 204 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 205 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 230 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 231 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 232 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 233 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 234 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 235 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 238 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 239 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 240 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 241 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 242 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 243 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 244 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 245 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 246 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 247 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 248 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 249 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 250 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 251 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 252 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 253 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 254 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 255 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 256 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 257 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 320 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 323 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 341 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 342 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 344 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 353 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 358 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 359 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 362 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 364 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 365 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 366 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 368 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 369 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 375 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 376 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 377 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 379 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 381 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 382 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 385 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 390 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 391 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 392 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 393 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 394 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 395 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 396 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 397 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 398 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 399 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 400 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 401 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 402 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 403 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 404 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 405 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 406 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 407 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 408 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 409 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 410 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 411 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 412 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 413 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 414 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 415 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 416 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 417 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 418 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 419 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 420 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 421 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 422 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 423 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 424 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 425 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 426 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 427 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 428 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 429 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 430 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 431 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 432 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 433 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 434 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 435 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 436 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 437 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 438 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 439 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 440 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 441 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 442 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 443 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 444 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 445 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 446 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 447 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 448 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 449 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 450 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 451 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 452 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 453 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 454 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 455 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 456 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 457 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 458 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 459 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 460 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 461 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 462 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 463 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 464 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 465 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 466 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 467 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 468 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 469 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 470 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 471 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 472 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 473 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 474 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 475 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 476 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 477 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 478 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 479 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 480 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 481 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 482 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 483 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 484 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 485 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 486 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 487 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 488 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 489 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 490 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 491 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 492 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 493 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 494 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 495 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 496 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 497 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 498 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 499 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 500 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 501 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 502 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 503 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 504 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 505 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 506 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 507 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 508 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 509 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 510 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 511 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 512 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 513 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 514 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 515 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 516 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 517 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 518 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 519 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 520 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 521 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 522 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 523 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 524 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 525 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 526 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 527 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 528 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 529 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 530 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 531 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 532 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 533 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 534 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 535 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 536 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 537 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 538 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 539 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 540 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 541 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 542 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 543 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 544 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 545 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 546 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 547 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 548 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 549 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 550 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 551 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 552 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 553 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.3 |
| Metatranscriptomes | 0.55 |
| Isolates | 18.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 25.11 |
| Nodule | 7.79 |
| Rhizoplane | 3.48 |
| Rhizosphere | 48.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496121_0024154 | 3300048924 | Bacteria | 5823 |
| 2 | JGI24739J22299_10017252 | 3300001989 | Bacteria | 2607 |
| 3 | JGI25156J39149_1000197 | 3300002705 | Bacteria | 42157 |
| 4 | JGI25162J39368_1000069 | 3300002737 | Bacteria | 125244 |
| 5 | JGI25154J39366_1001559 | 3300002738 | Bacteria | 7886 |
| 6 | JGI25158J39367_1002784 | 3300002739 | Bacteria | 2776 |
| 7 | JGI25157J39369_1000239 | 3300002741 | Bacteria | 42158 |
| 8 | JGI25152J39213_1013570 | 3300002773 | Bacteria | 1691 |
| 9 | JGI25152J39213_1020352 | 3300002773 | Bacteria | 1186 |
| 10 | JGI25150J39212_1012541 | 3300002774 | Bacteria | 1498 |
| 11 | JGI25159J45721_1030586 | 3300002987 | Bacteria | 873 |
| 12 | JGI25151J46595_10000912 | 3300003187 | Bacteria | 23122 |
| 13 | JGI25151J46595_10001106 | 3300003187 | Bacteria | 19788 |
| 14 | JGI25151J46595_10002242 | 3300003187 | Bacteria | 11876 |
| 15 | JGI25151J46595_10017903 | 3300003187 | Bacteria | 3058 |
| 16 | JGI25151J46595_10056756 | 3300003187 | Bacteria | 1282 |
| 17 | JGI25151J46595_10076514 | 3300003187 | Bacteria | 988 |
| 18 | JGI25165J46597_1000018 | 3300003214 | Bacteria | 374701 |
| 19 | JGI25153J46596_10016995 | 3300003215 | Bacteria | 2885 |
| 20 | JGI25153J46596_10033586 | 3300003215 | Bacteria | 1691 |
| 21 | rootH1_10031181 | 3300003316 | Bacteria | 2128 |
| 22 | Ga0006562J51391_1048428 | 3300003578 | Bacteria | 1460 |
| 23 | Ga0006562J51391_1089020 | 3300003578 | Bacteria | 1303 |
| 24 | JGI25404J52841_10033220 | 3300003659 | Bacteria | 1100 |
| 25 | Ga0055535_1000625 | 3300003761 | Bacteria | 28582 |
| 26 | Ga0055542_1000087 | 3300003762 | Bacteria | 123666 |
| 27 | Ga0055529_1000904 | 3300003763 | Bacteria | 16503 |
| 28 | Ga0055526_1004955 | 3300003771 | Bacteria | 7819 |
| 29 | Ga0055526_1037798 | 3300003771 | Bacteria | 1255 |
| 30 | Ga0055526_1041428 | 3300003771 | Bacteria | 1147 |
| 31 | Ga0055537_1000544 | 3300003773 | Bacteria | 21755 |
| 32 | Ga0055537_1001201 | 3300003773 | Bacteria | 10978 |
| 33 | Ga0055537_1001648 | 3300003773 | Bacteria | 8347 |
| 34 | Ga0055537_1007410 | 3300003773 | Bacteria | 2648 |
| 35 | Ga0055524_1000973 | 3300003775 | Bacteria | 17954 |
| 36 | Ga0055524_1010583 | 3300003775 | Bacteria | 3663 |
| 37 | Ga0055524_1017548 | 3300003775 | Bacteria | 2522 |
| 38 | Ga0055524_1042099 | 3300003775 | Bacteria | 1141 |
| 39 | Ga0055536_1002305 | 3300003781 | Bacteria | 10814 |
| 40 | Ga0055536_1012752 | 3300003781 | Bacteria | 3089 |
| 41 | Ga0055534_1000273 | 3300003784 | Bacteria | 35227 |
| 42 | Ga0055534_1000470 | 3300003784 | Bacteria | 22861 |
| 43 | Ga0055534_1000494 | 3300003784 | Bacteria | 21755 |
| 44 | Ga0055534_1003656 | 3300003784 | Bacteria | 4767 |
| 45 | Ga0055528_1003260 | 3300003790 | Bacteria | 8269 |
| 46 | Ga0055528_1005515 | 3300003790 | Bacteria | 5872 |
| 47 | Ga0055528_1005551 | 3300003790 | Bacteria | 5844 |
| 48 | Ga0055528_1017013 | 3300003790 | Bacteria | 2540 |
| 49 | Ga0055530_10000492 | 3300003791 | Bacteria | 34175 |
| 50 | Ga0055530_10010401 | 3300003791 | Bacteria | 3441 |
| 51 | Ga0055530_10044594 | 3300003791 | Bacteria | 1063 |
| 52 | Ga0055540_1001711 | 3300003792 | Bacteria | 12623 |
| 53 | Ga0055540_1002128 | 3300003792 | Bacteria | 10807 |
| 54 | Ga0055540_1006032 | 3300003792 | Bacteria | 4907 |
| 55 | Ga0055540_1014097 | 3300003792 | Bacteria | 2402 |
| 56 | Ga0055531_10000397 | 3300003794 | Bacteria | 41683 |
| 57 | Ga0055531_10000729 | 3300003794 | Bacteria | 27835 |
| 58 | Ga0055531_10001138 | 3300003794 | Bacteria | 20582 |
| 59 | Ga0055531_10001242 | 3300003794 | Bacteria | 19363 |
| 60 | Ga0055531_10001938 | 3300003794 | Bacteria | 14455 |
| 61 | Ga0058692_1005109 | 3300003856 | Bacteria | 3777 |
| 62 | Ga0055543_1011426 | 3300004625 | Bacteria | 1817 |
| 63 | Ga0065165_1001097 | 3300005262 | Bacteria | 32174 |
| 64 | Ga0065165_1002200 | 3300005262 | Bacteria | 17486 |
| 65 | Ga0065165_1004159 | 3300005262 | Bacteria | 9265 |
| 66 | Ga0065165_1039354 | 3300005262 | Bacteria | 1417 |
| 67 | Ga0065165_1054412 | 3300005262 | Bacteria | 1121 |
| 68 | Ga0065714_10006671 | 3300005288 | Bacteria | 3478 |
| 69 | Ga0065704_10018558 | 3300005289 | Bacteria | 2098 |
| 70 | Ga0070658_10017213 | 3300005327 | Bacteria | 5784 |
| 71 | Ga0070658_10302886 | 3300005327 | Bacteria | 1363 |
| 72 | Ga0070658_10816950 | 3300005327 | Bacteria | 810 |
| 73 | Ga0070676_10197030 | 3300005328 | Bacteria | 1318 |
| 74 | Ga0070683_100001096 | 3300005329 | Bacteria | 20384 |
| 75 | Ga0070670_100060064 | 3300005331 | Bacteria | 3264 |
| 76 | Ga0070670_100439201 | 3300005331 | Bacteria | 1155 |
| 77 | Ga0068869_100134442 | 3300005334 | Bacteria | 1904 |
| 78 | Ga0070680_100077659 | 3300005336 | Bacteria | 2734 |
| 79 | Ga0070680_100485840 | 3300005336 | Bacteria | 1056 |
| 80 | Ga0068868_100048109 | 3300005338 | Bacteria | 3344 |
| 81 | Ga0070660_100006803 | 3300005339 | Bacteria | 7935 |
| 82 | Ga0070660_100193642 | 3300005339 | Bacteria | 1647 |
| 83 | Ga0070661_100001103 | 3300005344 | Bacteria | 18993 |
| 84 | Ga0070661_100119325 | 3300005344 | Bacteria | 1974 |
| 85 | Ga0070661_100439330 | 3300005344 | Bacteria | 1037 |
| 86 | Ga0070692_10297828 | 3300005345 | Bacteria | 984 |
| 87 | Ga0070669_100126607 | 3300005353 | Bacteria | 1955 |
| 88 | Ga0070669_100493304 | 3300005353 | Bacteria | 1015 |
| 89 | Ga0070671_100001731 | 3300005355 | Bacteria | 16589 |
| 90 | Ga0070671_100007662 | 3300005355 | Bacteria | 8632 |
| 91 | Ga0070674_100322706 | 3300005356 | Bacteria | 1238 |
| 92 | Ga0070673_100002957 | 3300005364 | Bacteria | 10477 |
| 93 | Ga0070659_100007948 | 3300005366 | Bacteria | 7728 |
| 94 | Ga0070659_100017622 | 3300005366 | Bacteria | 5379 |
| 95 | Ga0070659_100217087 | 3300005366 | Bacteria | 1578 |
| 96 | Ga0070667_100025826 | 3300005367 | Bacteria | 4885 |
| 97 | Ga0070709_10391818 | 3300005434 | Bacteria | 1035 |
| 98 | Ga0070678_100331899 | 3300005456 | Bacteria | 1302 |
| 99 | Ga0070678_100579375 | 3300005456 | Bacteria | 999 |
| 100 | Ga0070662_100019503 | 3300005457 | Bacteria | 4604 |
| 101 | Ga0070662_100400495 | 3300005457 | Bacteria | 1133 |
| 102 | Ga0070662_100741545 | 3300005457 | Bacteria | 833 |
| 103 | Ga0068867_100302199 | 3300005459 | Bacteria | 1319 |
| 104 | Ga0070679_100026744 | 3300005530 | Bacteria | 5673 |
| 105 | Ga0070679_100054342 | 3300005530 | Bacteria | 3987 |
| 106 | Ga0070679_100352608 | 3300005530 | Bacteria | 1419 |
| 107 | Ga0070679_100731008 | 3300005530 | Bacteria | 933 |
| 108 | Ga0070679_100949201 | 3300005530 | Bacteria | 804 |
| 109 | Ga0070684_100004228 | 3300005535 | Bacteria | 10874 |
| 110 | Ga0068853_100005290 | 3300005539 | Bacteria | 10103 |
| 111 | Ga0068853_100025317 | 3300005539 | Bacteria | 4979 |
| 112 | Ga0068853_100043331 | 3300005539 | Bacteria | 3849 |
| 113 | Ga0068853_100091642 | 3300005539 | Bacteria | 2673 |
| 114 | Ga0068853_100177581 | 3300005539 | Bacteria | 1930 |
| 115 | Ga0070672_100011366 | 3300005543 | Bacteria | 6208 |
| 116 | Ga0070672_100300081 | 3300005543 | Bacteria | 1361 |
| 117 | Ga0070672_100463449 | 3300005543 | Bacteria | 1093 |
| 118 | Ga0070693_100005182 | 3300005547 | Bacteria | 6236 |
| 119 | Ga0070693_100037504 | 3300005547 | Bacteria | 2703 |
| 120 | Ga0070665_100034493 | 3300005548 | Bacteria | 5089 |
| 121 | Ga0070665_100494019 | 3300005548 | Bacteria | 1235 |
| 122 | Ga0068855_100008931 | 3300005563 | Bacteria | 12114 |
| 123 | Ga0068855_100023191 | 3300005563 | Bacteria | 7435 |
| 124 | Ga0068855_100232591 | 3300005563 | Bacteria | 2063 |
| 125 | Ga0070664_100003886 | 3300005564 | Bacteria | 12056 |
| 126 | Ga0070664_100008256 | 3300005564 | Bacteria | 8421 |
| 127 | Ga0070664_100035223 | 3300005564 | Bacteria | 4202 |
| 128 | Ga0068857_100150767 | 3300005577 | Bacteria | 2106 |
| 129 | Ga0068857_100650792 | 3300005577 | Bacteria | 999 |
| 130 | Ga0068854_100002503 | 3300005578 | Bacteria | 11399 |
| 131 | Ga0068856_100011574 | 3300005614 | Bacteria | 8557 |
| 132 | Ga0068856_100073839 | 3300005614 | Bacteria | 3377 |
| 133 | Ga0068856_100189093 | 3300005614 | Bacteria | 2073 |
| 134 | Ga0068856_100580147 | 3300005614 | Bacteria | 1143 |
| 135 | Ga0068852_100002132 | 3300005616 | Bacteria | 13562 |
| 136 | Ga0068852_100008877 | 3300005616 | Bacteria | 7435 |
| 137 | Ga0068852_100785744 | 3300005616 | Bacteria | 965 |
| 138 | Ga0068859_101566843 | 3300005617 | Bacteria | 727 |
| 139 | Ga0068864_100041516 | 3300005618 | Bacteria | 3934 |
| 140 | Ga0068864_100098816 | 3300005618 | Bacteria | 2585 |
| 141 | Ga0068864_100563475 | 3300005618 | Bacteria | 1102 |
| 142 | Ga0068864_101135215 | 3300005618 | Bacteria | 779 |
| 143 | Ga0068866_10428922 | 3300005718 | Bacteria | 859 |
| 144 | Ga0068851_10001036 | 3300005834 | Bacteria | 12077 |
| 145 | Ga0068851_10013404 | 3300005834 | Bacteria | 3881 |
| 146 | Ga0068863_100387960 | 3300005841 | Bacteria | 1364 |
| 147 | Ga0068860_100498273 | 3300005843 | Bacteria | 1216 |
| 148 | Ga0081540_1000001 | 3300005983 | Bacteria | 293507 |
| 149 | Ga0081539_10011653 | 3300005985 | Bacteria | 6918 |
| 150 | Ga0075365_10119863 | 3300006038 | Bacteria | 1814 |
| 151 | Ga0075365_10514958 | 3300006038 | Bacteria | 846 |
| 152 | Ga0075368_10007452 | 3300006042 | Bacteria | 3861 |
| 153 | Ga0075368_10009279 | 3300006042 | Bacteria | 3535 |
| 154 | Ga0075363_100149641 | 3300006048 | Bacteria | 1317 |
| 155 | Ga0075363_100194871 | 3300006048 | Bacteria | 1156 |
| 156 | Ga0075364_10043751 | 3300006051 | Bacteria | 2911 |
| 157 | Ga0075364_10121371 | 3300006051 | Bacteria | 1749 |
| 158 | Ga0075364_10132498 | 3300006051 | Bacteria | 1673 |
| 159 | Ga0075364_10245132 | 3300006051 | Bacteria | 1217 |
| 160 | Ga0075364_10454599 | 3300006051 | Bacteria | 875 |
| 161 | Ga0075364_10566178 | 3300006051 | Bacteria | 777 |
| 162 | Ga0075432_10011542 | 3300006058 | Bacteria | 3002 |
| 163 | Ga0075432_10097420 | 3300006058 | Bacteria | 1083 |
| 164 | Ga0075362_10008375 | 3300006177 | Bacteria | 3951 |
| 165 | Ga0075362_10015340 | 3300006177 | Bacteria | 3114 |
| 166 | Ga0075362_10068895 | 3300006177 | Bacteria | 1612 |
| 167 | Ga0075362_10125015 | 3300006177 | Bacteria | 1220 |
| 168 | Ga0075362_10131574 | 3300006177 | Bacteria | 1190 |
| 169 | Ga0075367_10020216 | 3300006178 | Bacteria | 3704 |
| 170 | Ga0075367_10228947 | 3300006178 | Bacteria | 1164 |
| 171 | Ga0075367_10378842 | 3300006178 | Bacteria | 894 |
| 172 | Ga0075369_10010312 | 3300006186 | Bacteria | 3652 |
| 173 | Ga0075366_10031124 | 3300006195 | Bacteria | 3139 |
| 174 | Ga0075366_10148815 | 3300006195 | Bacteria | 1417 |
| 175 | Ga0097621_100146079 | 3300006237 | Bacteria | 2025 |
| 176 | Ga0097621_100445735 | 3300006237 | Bacteria | 1165 |
| 177 | Ga0097621_100697246 | 3300006237 | Bacteria | 935 |
| 178 | Ga0075370_10001140 | 3300006353 | Bacteria | 11147 |
| 179 | Ga0075370_10001936 | 3300006353 | Bacteria | 9342 |
| 180 | Ga0075370_10014295 | 3300006353 | Bacteria | 4234 |
| 181 | Ga0075370_10031122 | 3300006353 | Bacteria | 2978 |
| 182 | Ga0075370_10035802 | 3300006353 | Bacteria | 2787 |
| 183 | Ga0068871_100230495 | 3300006358 | Bacteria | 1607 |
| 184 | Ga0068871_100596188 | 3300006358 | Bacteria | 1004 |
| 185 | Ga0079104_1005275 | 3300006946 | Bacteria | 5207 |
| 186 | Ga0099826_10000053 | 3300006948 | Bacteria | 72398 |
| 187 | Ga0099826_10000135 | 3300006948 | Bacteria | 31697 |
| 188 | Ga0099826_10000408 | 3300006948 | Bacteria | 20307 |
| 189 | Ga0099826_10009692 | 3300006948 | Bacteria | 7192 |
| 190 | Ga0099826_10063502 | 3300006948 | Bacteria | 2386 |
| 191 | Ga0105244_10061912 | 3300009036 | Bacteria | 1882 |
| 192 | Ga0105240_10010218 | 3300009093 | Bacteria | 13210 |
| 193 | Ga0105240_10027927 | 3300009093 | Bacteria | 7381 |
| 194 | Ga0105245_10421667 | 3300009098 | Bacteria | 1338 |
| 195 | Ga0105243_10004536 | 3300009148 | Bacteria | 10972 |
| 196 | Ga0105243_10006125 | 3300009148 | Bacteria | 9302 |
| 197 | Ga0105243_10728975 | 3300009148 | Bacteria | 969 |
| 198 | Ga0105241_10197717 | 3300009174 | Bacteria | 1677 |
| 199 | Ga0105242_10116195 | 3300009176 | Bacteria | 2289 |
| 200 | Ga0105242_10182665 | 3300009176 | Bacteria | 1851 |
| 201 | Ga0105248_10022313 | 3300009177 | Bacteria | 7019 |
| 202 | Ga0105248_10405449 | 3300009177 | Bacteria | 1535 |
| 203 | Ga0105237_10197175 | 3300009545 | Bacteria | 2013 |
| 204 | Ga0105237_10214553 | 3300009545 | Bacteria | 1924 |
| 205 | Ga0105237_10582625 | 3300009545 | Bacteria | 1126 |
| 206 | Ga0105238_10010711 | 3300009551 | Bacteria | 9210 |
| 207 | Ga0105238_10051831 | 3300009551 | Bacteria | 4126 |
| 208 | Ga0105238_10083755 | 3300009551 | Bacteria | 3178 |
| 209 | Ga0105239_11155729 | 3300010375 | Bacteria | 892 |
| 210 | Ga0105239_11158671 | 3300010375 | Bacteria | 890 |
| 211 | Ga0105246_10437945 | 3300011119 | Bacteria | 1095 |
| 212 | Ga0157373_10003196 | 3300013100 | Bacteria | 12388 |
| 213 | Ga0157373_10037357 | 3300013100 | Bacteria | 3482 |
| 214 | Ga0157371_10000005 | 3300013102 | Bacteria | 416456 |
| 215 | Ga0157371_10269629 | 3300013102 | Bacteria | 1228 |
| 216 | Ga0157370_10000036 | 3300013104 | Bacteria | 136933 |
| 217 | Ga0157370_10006235 | 3300013104 | Bacteria | 13208 |
| 218 | Ga0157370_10012371 | 3300013104 | Bacteria | 8853 |
| 219 | Ga0157370_10079644 | 3300013104 | Bacteria | 3085 |
| 220 | Ga0157369_10008755 | 3300013105 | Bacteria | 11590 |
| 221 | Ga0157369_10148403 | 3300013105 | Bacteria | 2479 |
| 222 | Ga0157369_10371569 | 3300013105 | Bacteria | 1484 |
| 223 | Ga0157374_10106980 | 3300013296 | Bacteria | 2688 |
| 224 | Ga0163162_10165664 | 3300013306 | Bacteria | 2334 |
| 225 | Ga0163162_10240918 | 3300013306 | Bacteria | 1940 |
| 226 | Ga0163162_10537508 | 3300013306 | Bacteria | 1297 |
| 227 | Ga0163162_10831348 | 3300013306 | Bacteria | 1039 |
| 228 | Ga0157372_10034372 | 3300013307 | Bacteria | 5573 |
| 229 | Ga0157372_10149374 | 3300013307 | Bacteria | 2696 |
| 230 | Ga0157375_10228180 | 3300013308 | Bacteria | 2021 |
| 231 | Ga0157375_10342998 | 3300013308 | Bacteria | 1659 |
| 232 | Ga0157375_10441668 | 3300013308 | Bacteria | 1467 |
| 233 | Ga0157375_10986304 | 3300013308 | Bacteria | 983 |
| 234 | Ga0163163_10274774 | 3300014325 | Bacteria | 1736 |
| 235 | Ga0182008_10001904 | 3300014497 | Bacteria | 13501 |
| 236 | Ga0182008_10004300 | 3300014497 | Bacteria | 8340 |
| 237 | Ga0182008_10004309 | 3300014497 | Bacteria | 8328 |
| 238 | Ga0182008_10018378 | 3300014497 | Bacteria | 3620 |
| 239 | Ga0182008_10026105 | 3300014497 | Bacteria | 2963 |
| 240 | Ga0182008_10033309 | 3300014497 | Bacteria | 2585 |
| 241 | Ga0157379_10196452 | 3300014968 | Bacteria | 1823 |
| 242 | Ga0157376_10100256 | 3300014969 | Bacteria | 2528 |
| 243 | Ga0157376_10385972 | 3300014969 | Bacteria | 1350 |
| 244 | Ga0182006_1038793 | 3300015261 | Bacteria | 1882 |
| 245 | Ga0182006_1055979 | 3300015261 | Bacteria | 1503 |
| 246 | Ga0182006_1098533 | 3300015261 | Bacteria | 1041 |
| 247 | Ga0182006_1113178 | 3300015261 | Bacteria | 950 |
| 248 | Ga0182007_10000278 | 3300015262 | Bacteria | 33960 |
| 249 | Ga0182007_10006630 | 3300015262 | Bacteria | 4956 |
| 250 | Ga0182007_10007196 | 3300015262 | Bacteria | 4693 |
| 251 | Ga0182007_10163702 | 3300015262 | Bacteria | 762 |
| 252 | Ga0182005_1029422 | 3300015265 | Bacteria | 1498 |
| 253 | Ga0182005_1057456 | 3300015265 | Bacteria | 1061 |
| 254 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 255 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 256 | Ga0163161_10000598 | 3300017792 | Bacteria | 28842 |
| 257 | Ga0163161_10002565 | 3300017792 | Bacteria | 12976 |
| 258 | Ga0163161_10008944 | 3300017792 | Bacteria | 6925 |
| 259 | Ga0163161_10010182 | 3300017792 | Bacteria | 6509 |
| 260 | Ga0163161_10082600 | 3300017792 | Bacteria | 2367 |
| 261 | Ga0163161_10088707 | 3300017792 | Bacteria | 2286 |
| 262 | Ga0163161_10131056 | 3300017792 | Bacteria | 1891 |
| 263 | Ga0163161_10219816 | 3300017792 | Bacteria | 1471 |
| 264 | Ga0163161_10263133 | 3300017792 | Bacteria | 1347 |
| 265 | Ga0213872_10000161 | 3300021361 | Bacteria | 61406 |
| 266 | Ga0213872_10001576 | 3300021361 | Bacteria | 14538 |
| 267 | Ga0209435_100089 | 3300025206 | Bacteria | 42209 |
| 268 | Ga0209436_104844 | 3300025208 | Bacteria | 3228 |
| 269 | Ga0209672_101712 | 3300025228 | Bacteria | 7040 |
| 270 | Ga0209672_103043 | 3300025228 | Bacteria | 3655 |
| 271 | Ga0209672_110906 | 3300025228 | Bacteria | 1203 |
| 272 | Ga0209147_100510 | 3300025229 | Bacteria | 22609 |
| 273 | Ga0209147_100652 | 3300025229 | Bacteria | 18097 |
| 274 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 275 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 276 | Ga0209258_100199 | 3300025242 | Bacteria | 123718 |
| 277 | Ga0209258_104563 | 3300025242 | Bacteria | 2590 |
| 278 | Ga0207425_1006727 | 3300025245 | Bacteria | 3112 |
| 279 | Ga0207425_1054598 | 3300025245 | Bacteria | 719 |
| 280 | Ga0209646_1000293 | 3300025246 | Bacteria | 42209 |
| 281 | Ga0209026_1000364 | 3300025250 | Bacteria | 42209 |
| 282 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 283 | Ga0209148_1000179 | 3300025254 | Bacteria | 126083 |
| 284 | Ga0209759_1000508 | 3300025256 | Bacteria | 42209 |
| 285 | Ga0209129_1000071 | 3300025258 | Bacteria | 210729 |
| 286 | Ga0209129_1000249 | 3300025258 | Bacteria | 56453 |
| 287 | Ga0209129_1002464 | 3300025258 | Bacteria | 9057 |
| 288 | Ga0209129_1003880 | 3300025258 | Bacteria | 6226 |
| 289 | Ga0209129_1011174 | 3300025258 | Bacteria | 2167 |
| 290 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 291 | Ga0209565_1000083 | 3300025263 | Bacteria | 154007 |
| 292 | Ga0209565_1000138 | 3300025263 | Bacteria | 101729 |
| 293 | Ga0209565_1000225 | 3300025263 | Bacteria | 63291 |
| 294 | Ga0209565_1001961 | 3300025263 | Bacteria | 8060 |
| 295 | Ga0209565_1020057 | 3300025263 | Bacteria | 1417 |
| 296 | Ga0209455_1005323 | 3300025272 | Bacteria | 4003 |
| 297 | Ga0209673_1000064 | 3300025273 | Bacteria | 254712 |
| 298 | Ga0209673_1000178 | 3300025273 | Bacteria | 128628 |
| 299 | Ga0209673_1000329 | 3300025273 | Bacteria | 87170 |
| 300 | Ga0209673_1000534 | 3300025273 | Bacteria | 62274 |
| 301 | Ga0209673_1000546 | 3300025273 | Bacteria | 61140 |
| 302 | Ga0209673_1001554 | 3300025273 | Bacteria | 20714 |
| 303 | Ga0209673_1006108 | 3300025273 | Bacteria | 5907 |
| 304 | Ga0209673_1011314 | 3300025273 | Bacteria | 3686 |
| 305 | Ga0209673_1021401 | 3300025273 | Bacteria | 2261 |
| 306 | Ga0209673_1067931 | 3300025273 | Bacteria | 860 |
| 307 | Ga0209130_1000489 | 3300025284 | Bacteria | 40639 |
| 308 | Ga0209130_1000773 | 3300025284 | Bacteria | 27625 |
| 309 | Ga0209130_1000889 | 3300025284 | Bacteria | 24355 |
| 310 | Ga0209130_1002267 | 3300025284 | Bacteria | 9923 |
| 311 | Ga0209130_1010307 | 3300025284 | Bacteria | 2586 |
| 312 | Ga0209675_1000036 | 3300025291 | Bacteria | 254712 |
| 313 | Ga0209675_1000081 | 3300025291 | Bacteria | 154007 |
| 314 | Ga0209675_1000458 | 3300025291 | Bacteria | 31329 |
| 315 | Ga0209675_1000573 | 3300025291 | Bacteria | 26547 |
| 316 | Ga0209675_1000726 | 3300025291 | Bacteria | 22391 |
| 317 | Ga0209675_1001085 | 3300025291 | Bacteria | 16755 |
| 318 | Ga0209675_1004179 | 3300025291 | Bacteria | 6532 |
| 319 | Ga0209675_1032892 | 3300025291 | Bacteria | 1209 |
| 320 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 321 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 322 | Ga0209676_1000162 | 3300025292 | Bacteria | 159931 |
| 323 | Ga0209676_1000757 | 3300025292 | Bacteria | 43636 |
| 324 | Ga0209676_1001007 | 3300025292 | Bacteria | 33026 |
| 325 | Ga0209676_1007094 | 3300025292 | Bacteria | 5363 |
| 326 | Ga0209676_1018153 | 3300025292 | Bacteria | 2462 |
| 327 | Ga0209676_1028115 | 3300025292 | Bacteria | 1757 |
| 328 | Ga0209676_1065877 | 3300025292 | Bacteria | 880 |
| 329 | Ga0209025_1000121 | 3300025294 | Bacteria | 208700 |
| 330 | Ga0209025_1000168 | 3300025294 | Bacteria | 162386 |
| 331 | Ga0209025_1000220 | 3300025294 | Bacteria | 136977 |
| 332 | Ga0209025_1000544 | 3300025294 | Bacteria | 70638 |
| 333 | Ga0209025_1001108 | 3300025294 | Bacteria | 38669 |
| 334 | Ga0209025_1001466 | 3300025294 | Bacteria | 30784 |
| 335 | Ga0209025_1008041 | 3300025294 | Bacteria | 7682 |
| 336 | Ga0209025_1021707 | 3300025294 | Bacteria | 3444 |
| 337 | Ga0209025_1022779 | 3300025294 | Bacteria | 3305 |
| 338 | Ga0209025_1022812 | 3300025294 | Bacteria | 3301 |
| 339 | Ga0209025_1062080 | 3300025294 | Bacteria | 1389 |
| 340 | Ga0209025_1098582 | 3300025294 | Bacteria | 932 |
| 341 | Ga0209564_1000239 | 3300025295 | Bacteria | 119761 |
| 342 | Ga0209564_1000287 | 3300025295 | Bacteria | 102328 |
| 343 | Ga0209564_1002099 | 3300025295 | Bacteria | 17049 |
| 344 | Ga0209564_1004174 | 3300025295 | Bacteria | 9027 |
| 345 | Ga0209564_1020032 | 3300025295 | Bacteria | 2471 |
| 346 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 347 | Ga0209758_1002782 | 3300025297 | Bacteria | 17126 |
| 348 | Ga0209758_1005551 | 3300025297 | Bacteria | 9617 |
| 349 | Ga0209758_1012650 | 3300025297 | Bacteria | 4696 |
| 350 | Ga0209758_1012867 | 3300025297 | Bacteria | 4634 |
| 351 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 352 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 353 | Ga0209050_1001089 | 3300025298 | Bacteria | 33034 |
| 354 | Ga0209050_1010883 | 3300025298 | Bacteria | 4409 |
| 355 | Ga0209050_1011437 | 3300025298 | Bacteria | 4207 |
| 356 | Ga0209050_1022072 | 3300025298 | Bacteria | 2294 |
| 357 | Ga0209050_1027972 | 3300025298 | Bacteria | 1842 |
| 358 | Ga0209256_1000081 | 3300025299 | Bacteria | 222908 |
| 359 | Ga0209256_1000470 | 3300025299 | Bacteria | 60553 |
| 360 | Ga0209256_1001206 | 3300025299 | Bacteria | 28955 |
| 361 | Ga0209256_1004326 | 3300025299 | Bacteria | 9027 |
| 362 | Ga0209256_1007583 | 3300025299 | Bacteria | 5300 |
| 363 | Ga0209256_1023119 | 3300025299 | Bacteria | 1862 |
| 364 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 365 | Ga0207426_1000095 | 3300025302 | Bacteria | 274234 |
| 366 | Ga0207426_1000176 | 3300025302 | Bacteria | 159819 |
| 367 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 368 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 369 | Ga0209051_1000113 | 3300025303 | Bacteria | 152417 |
| 370 | Ga0209051_1000274 | 3300025303 | Bacteria | 84662 |
| 371 | Ga0209051_1000347 | 3300025303 | Bacteria | 68841 |
| 372 | Ga0209051_1000367 | 3300025303 | Bacteria | 65677 |
| 373 | Ga0209051_1000373 | 3300025303 | Bacteria | 64348 |
| 374 | Ga0209051_1000375 | 3300025303 | Bacteria | 63742 |
| 375 | Ga0209051_1000553 | 3300025303 | Bacteria | 45537 |
| 376 | Ga0209051_1000583 | 3300025303 | Bacteria | 43428 |
| 377 | Ga0209051_1010791 | 3300025303 | Bacteria | 4572 |
| 378 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 379 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 380 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 381 | Ga0209257_1000286 | 3300025304 | Bacteria | 111738 |
| 382 | Ga0209257_1000449 | 3300025304 | Bacteria | 77522 |
| 383 | Ga0209257_1000866 | 3300025304 | Bacteria | 43105 |
| 384 | Ga0209257_1006354 | 3300025304 | Bacteria | 7670 |
| 385 | Ga0209257_1008169 | 3300025304 | Bacteria | 6058 |
| 386 | Ga0209257_1015259 | 3300025304 | Bacteria | 3215 |
| 387 | Ga0207656_10000704 | 3300025321 | Bacteria | 10951 |
| 388 | Ga0207656_10014809 | 3300025321 | Bacteria | 3012 |
| 389 | Ga0207656_10063725 | 3300025321 | Bacteria | 1623 |
| 390 | Ga0207655_1002072 | 3300025728 | Bacteria | 16828 |
| 391 | Ga0207682_10053981 | 3300025893 | Bacteria | 1668 |
| 392 | Ga0207688_10164791 | 3300025901 | Bacteria | 1316 |
| 393 | Ga0207680_10363756 | 3300025903 | Bacteria | 1018 |
| 394 | Ga0207645_10375932 | 3300025907 | Bacteria | 953 |
| 395 | Ga0207643_10069814 | 3300025908 | Bacteria | 2020 |
| 396 | Ga0207705_10246089 | 3300025909 | Bacteria | 1363 |
| 397 | Ga0207705_10251493 | 3300025909 | Bacteria | 1348 |
| 398 | Ga0207707_10254859 | 3300025912 | Bacteria | 1524 |
| 399 | Ga0207695_10067576 | 3300025913 | Bacteria | 3666 |
| 400 | Ga0207695_10103057 | 3300025913 | Bacteria | 2846 |
| 401 | Ga0207695_10454631 | 3300025913 | Bacteria | 1164 |
| 402 | Ga0207671_10112041 | 3300025914 | Bacteria | 2077 |
| 403 | Ga0207671_10128694 | 3300025914 | Bacteria | 1942 |
| 404 | Ga0207671_10741066 | 3300025914 | Bacteria | 781 |
| 405 | Ga0207657_10012553 | 3300025919 | Bacteria | 8355 |
| 406 | Ga0207657_10353658 | 3300025919 | Bacteria | 1158 |
| 407 | Ga0207649_10038780 | 3300025920 | Bacteria | 2886 |
| 408 | Ga0207649_10094843 | 3300025920 | Bacteria | 1962 |
| 409 | Ga0207652_10150007 | 3300025921 | Bacteria | 2087 |
| 410 | Ga0207652_10228451 | 3300025921 | Bacteria | 1677 |
| 411 | Ga0207652_10599279 | 3300025921 | Bacteria | 988 |
| 412 | Ga0207694_10014406 | 3300025924 | Bacteria | 5960 |
| 413 | Ga0207694_10057945 | 3300025924 | Bacteria | 3013 |
| 414 | Ga0207650_10008936 | 3300025925 | Bacteria | 6846 |
| 415 | Ga0207650_10227158 | 3300025925 | Bacteria | 1504 |
| 416 | Ga0207659_10173289 | 3300025926 | Bacteria | 1703 |
| 417 | Ga0207687_10186622 | 3300025927 | Bacteria | 1610 |
| 418 | Ga0207687_10324063 | 3300025927 | Bacteria | 1248 |
| 419 | Ga0207687_10821508 | 3300025927 | Bacteria | 793 |
| 420 | Ga0207644_10040844 | 3300025931 | Bacteria | 3279 |
| 421 | Ga0207706_10075641 | 3300025933 | Bacteria | 2961 |
| 422 | Ga0207706_10306336 | 3300025933 | Bacteria | 1383 |
| 423 | Ga0207686_10143107 | 3300025934 | Bacteria | 1655 |
| 424 | Ga0207709_10000205 | 3300025935 | Bacteria | 77131 |
| 425 | Ga0207709_10000775 | 3300025935 | Bacteria | 25131 |
| 426 | Ga0207709_10001443 | 3300025935 | Bacteria | 16593 |
| 427 | Ga0207709_10026435 | 3300025935 | Bacteria | 3334 |
| 428 | Ga0207670_10115274 | 3300025936 | Bacteria | 1943 |
| 429 | Ga0207669_10305795 | 3300025937 | Bacteria | 1210 |
| 430 | Ga0207669_10373259 | 3300025937 | Bacteria | 1109 |
| 431 | Ga0207704_10737480 | 3300025938 | Bacteria | 818 |
| 432 | Ga0207691_10003117 | 3300025940 | Bacteria | 16191 |
| 433 | Ga0207691_10099686 | 3300025940 | Bacteria | 2594 |
| 434 | Ga0207691_10183259 | 3300025940 | Bacteria | 1829 |
| 435 | Ga0207691_10213107 | 3300025940 | Bacteria | 1677 |
| 436 | Ga0207689_10092172 | 3300025942 | Bacteria | 2489 |
| 437 | Ga0207661_10248391 | 3300025944 | Bacteria | 1580 |
| 438 | Ga0207679_10004885 | 3300025945 | Bacteria | 8355 |
| 439 | Ga0207679_10069827 | 3300025945 | Bacteria | 2645 |
| 440 | Ga0207667_10039072 | 3300025949 | Bacteria | 5060 |
| 441 | Ga0207667_10064795 | 3300025949 | Bacteria | 3814 |
| 442 | Ga0207667_10281405 | 3300025949 | Bacteria | 1700 |
| 443 | Ga0207651_10001658 | 3300025960 | Bacteria | 10220 |
| 444 | Ga0207651_10472957 | 3300025960 | Bacteria | 1079 |
| 445 | Ga0207668_10149909 | 3300025972 | Bacteria | 1804 |
| 446 | Ga0207668_10532612 | 3300025972 | Bacteria | 1015 |
| 447 | Ga0207640_10023587 | 3300025981 | Bacteria | 3700 |
| 448 | Ga0207640_10213151 | 3300025981 | Bacteria | 1473 |
| 449 | Ga0207640_10366858 | 3300025981 | Bacteria | 1162 |
| 450 | Ga0207658_10029339 | 3300025986 | Bacteria | 3884 |
| 451 | Ga0207677_10326456 | 3300026023 | Bacteria | 1277 |
| 452 | Ga0207703_10630473 | 3300026035 | Bacteria | 1016 |
| 453 | Ga0207639_10039065 | 3300026041 | Bacteria | 3534 |
| 454 | Ga0207639_10350688 | 3300026041 | Bacteria | 1318 |
| 455 | Ga0207639_10630024 | 3300026041 | Bacteria | 991 |
| 456 | Ga0207678_10002002 | 3300026067 | Bacteria | 18551 |
| 457 | Ga0207702_10016299 | 3300026078 | Bacteria | 6151 |
| 458 | Ga0207702_10054569 | 3300026078 | Bacteria | 3387 |
| 459 | Ga0207702_10363759 | 3300026078 | Bacteria | 1387 |
| 460 | Ga0207702_10381692 | 3300026078 | Bacteria | 1355 |
| 461 | Ga0207641_10183018 | 3300026088 | Bacteria | 1920 |
| 462 | Ga0207641_10226137 | 3300026088 | Bacteria | 1737 |
| 463 | Ga0207648_10105730 | 3300026089 | Bacteria | 2469 |
| 464 | Ga0207676_10030082 | 3300026095 | Bacteria | 4072 |
| 465 | Ga0207676_10034484 | 3300026095 | Bacteria | 3832 |
| 466 | Ga0207676_10135625 | 3300026095 | Bacteria | 2099 |
| 467 | Ga0207674_10007917 | 3300026116 | Bacteria | 12341 |
| 468 | Ga0207674_10157222 | 3300026116 | Bacteria | 2228 |
| 469 | Ga0207674_10195272 | 3300026116 | Bacteria | 1974 |
| 470 | Ga0207698_10002093 | 3300026142 | Bacteria | 11776 |
| 471 | Ga0207698_10004842 | 3300026142 | Bacteria | 8245 |
| 472 | Ga0207698_10992278 | 3300026142 | Bacteria | 850 |
| 473 | Ga0209281_1011677 | 3300027111 | Bacteria | 1957 |
| 474 | Ga0209371_1005256 | 3300027312 | Bacteria | 5221 |
| 475 | Ga0209282_1000521 | 3300027666 | Bacteria | 18596 |
| 476 | Ga0209282_1001174 | 3300027666 | Bacteria | 14074 |
| 477 | Ga0209282_1137457 | 3300027666 | Bacteria | 1199 |
| 478 | Ga0207428_10303229 | 3300027907 | Bacteria | 1182 |
| 479 | Ga0268266_10016386 | 3300028379 | Bacteria | 6337 |
| 480 | Ga0268266_10222780 | 3300028379 | Bacteria | 1735 |
| 481 | Ga0268265_10293161 | 3300028380 | Bacteria | 1461 |
| 482 | Ga0268264_10222893 | 3300028381 | Bacteria | 1737 |
| 483 | Ga0268264_11404748 | 3300028381 | Bacteria | 709 |
| 484 | Ga0307515_10000152 | 3300028794 | Bacteria | 167305 |
| 485 | Ga0307515_10014281 | 3300028794 | Bacteria | 14746 |
| 486 | Ga0307512_10206815 | 3300030522 | Bacteria | 1051 |
| 487 | Ga0316177_1192376 | 3300030731 | Bacteria | 3822 |
| 488 | Ga0314311_1055507 | 3300030733 | Bacteria | 11059 |
| 489 | Ga0316179_1038668 | 3300030734 | Bacteria | 3056 |
| 490 | Ga0316178_1036717 | 3300030735 | Bacteria | 5475 |
| 491 | Ga0316180_1138007 | 3300030736 | Bacteria | 1441 |
| 492 | Ga0316183_1051137 | 3300030742 | Bacteria | 5822 |
| 493 | Ga0316181_1003089 | 3300030744 | Bacteria | 973 |
| 494 | Ga0316182_1122964 | 3300030745 | Bacteria | 4127 |
| 495 | Ga0316182_1388324 | 3300030745 | Bacteria | 4148 |
| 496 | Ga0265328_10097000 | 3300031239 | Bacteria | 1090 |
| 497 | Ga0265325_10004238 | 3300031241 | Bacteria | 9105 |
| 498 | Ga0265331_10098030 | 3300031250 | Bacteria | 1351 |
| 499 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 500 | Ga0265327_10000777 | 3300031251 | Bacteria | 49259 |
| 501 | Ga0265327_10008172 | 3300031251 | Bacteria | 7854 |
| 502 | Ga0265327_10036761 | 3300031251 | Bacteria | 2688 |
| 503 | Ga0307513_10065904 | 3300031456 | Bacteria | 3809 |
| 504 | Ga0307513_10090119 | 3300031456 | Bacteria | 3129 |
| 505 | Ga0307408_100003858 | 3300031548 | Bacteria | 10198 |
| 506 | Ga0307408_100111775 | 3300031548 | Bacteria | 2099 |
| 507 | Ga0307408_100177221 | 3300031548 | Bacteria | 1706 |
| 508 | Ga0307408_100332892 | 3300031548 | Bacteria | 1283 |
| 509 | Ga0307408_100355467 | 3300031548 | Bacteria | 1244 |
| 510 | Ga0307408_100444291 | 3300031548 | Bacteria | 1123 |
| 511 | Ga0307408_100665219 | 3300031548 | Bacteria | 932 |
| 512 | Ga0265313_10030042 | 3300031595 | Bacteria | 2803 |
| 513 | Ga0307514_10062787 | 3300031649 | Bacteria | 2823 |
| 514 | Ga0307514_10124915 | 3300031649 | Bacteria | 1785 |
| 515 | Ga0307405_10007105 | 3300031731 | Bacteria | 5567 |
| 516 | Ga0307405_10186499 | 3300031731 | Bacteria | 1494 |
| 517 | Ga0307410_11059536 | 3300031852 | Bacteria | 701 |
| 518 | Ga0307406_10002407 | 3300031901 | Bacteria | 10164 |
| 519 | Ga0307406_10006868 | 3300031901 | Bacteria | 6300 |
| 520 | Ga0307406_10634622 | 3300031901 | Bacteria | 885 |
| 521 | Ga0307407_10200361 | 3300031903 | Bacteria | 1337 |
| 522 | Ga0307412_10011637 | 3300031911 | Bacteria | 5101 |
| 523 | Ga0307412_10029890 | 3300031911 | Bacteria | 3423 |
| 524 | Ga0307412_10052063 | 3300031911 | Bacteria | 2709 |
| 525 | Ga0307412_10081391 | 3300031911 | Bacteria | 2239 |
| 526 | Ga0307412_10090438 | 3300031911 | Bacteria | 2139 |
| 527 | Ga0307412_10544762 | 3300031911 | Bacteria | 973 |
| 528 | Ga0307412_11012476 | 3300031911 | Bacteria | 734 |
| 529 | Ga0307409_100494442 | 3300031995 | Bacteria | 1190 |
| 530 | Ga0307416_100002355 | 3300032002 | Bacteria | 10811 |
| 531 | Ga0307416_100248852 | 3300032002 | Bacteria | 1728 |
| 532 | Ga0307416_100273917 | 3300032002 | Bacteria | 1659 |
| 533 | Ga0307416_100839362 | 3300032002 | Bacteria | 1016 |
| 534 | Ga0307414_10053714 | 3300032004 | Bacteria | 2811 |
| 535 | Ga0307414_10272027 | 3300032004 | Bacteria | 1419 |
| 536 | Ga0307414_10346528 | 3300032004 | Bacteria | 1273 |
| 537 | Ga0307414_10353223 | 3300032004 | Bacteria | 1262 |
| 538 | Ga0307414_10516729 | 3300032004 | Bacteria | 1059 |
| 539 | Ga0307411_10126489 | 3300032005 | Bacteria | 1860 |
| 540 | Ga0307411_10127142 | 3300032005 | Bacteria | 1855 |
| 541 | Ga0307411_10154694 | 3300032005 | Bacteria | 1709 |
| 542 | Ga0307411_10178818 | 3300032005 | Bacteria | 1608 |
| 543 | Ga0307411_10331449 | 3300032005 | Bacteria | 1233 |
| 544 | Ga0307411_10407642 | 3300032005 | Bacteria | 1125 |
| 545 | Ga0307411_10477974 | 3300032005 | Bacteria | 1048 |
| 546 | Ga0307415_100426498 | 3300032126 | Bacteria | 1140 |
| 547 | Ga0307510_10031385 | 3300033180 | Bacteria | 6004 |
| 548 | Ga0395899_0001942 | 3300037312 | Bacteria | 17020 |
| 549 | Ga0395899_0037564 | 3300037312 | Bacteria | 3630 |
| 550 | Ga0395900_0007000 | 3300037418 | Bacteria | 11682 |
| 551 | Ga0395900_0031551 | 3300037418 | Bacteria | 5446 |
| 552 | Ga0395900_0328009 | 3300037418 | Bacteria | 1509 |
| 553 | Ga0395900_0426841 | 3300037418 | Bacteria | 1285 |
| 554 | Ga0395898_0005430 | 3300037466 | Bacteria | 13766 |
| 555 | Ga0395898_0023388 | 3300037466 | Bacteria | 6246 |
| 556 | Ga0395898_0160759 | 3300037466 | Bacteria | 2148 |
| 557 | Ga0395898_0284077 | 3300037466 | Bacteria | 1579 |
| 558 | Ga0395905_0007138 | 3300037471 | Bacteria | 11170 |
| 559 | Ga0395905_0022261 | 3300037471 | Bacteria | 5997 |
| 560 | Ga0395905_0034921 | 3300037471 | Bacteria | 4720 |
| 561 | Ga0395905_0134156 | 3300037471 | Bacteria | 2329 |
| 562 | Ga0395905_0288704 | 3300037471 | Bacteria | 1527 |
| 563 | Ga0395901_0053458 | 3300038443 | Bacteria | 4196 |
| 564 | Ga0395901_0087292 | 3300038443 | Bacteria | 3261 |
| 565 | Ga0395901_0089104 | 3300038443 | Bacteria | 3228 |
| 566 | Ga0395901_0098619 | 3300038443 | Bacteria | 3063 |
| 567 | Ga0395901_0126807 | 3300038443 | Bacteria | 2682 |
| 568 | Ga0395901_0161306 | 3300038443 | Bacteria | 2355 |
| 569 | Ga0395901_0241940 | 3300038443 | Bacteria | 1882 |
| 570 | Ga0395901_0291445 | 3300038443 | Bacteria | 1694 |
| 571 | Ga0400483_082990 | 3300039062 | Bacteria | 17925 |
| 572 | Ga0436361_0042902 | 3300039447 | Bacteria | 14654 |
| 573 | Ga0436361_0481133 | 3300039447 | Bacteria | 61506 |
| 574 | Ga0439436_0040093 | 3300041404 | Bacteria | 1343 |
| 575 | Ga0439439_0125455 | 3300041406 | Bacteria | 718 |
| 576 | Ga0439466_0047929 | 3300041411 | Bacteria | 1407 |
| 577 | Ga0439465_0011629 | 3300041413 | Bacteria | 2762 |
| 578 | Ga0439465_0050689 | 3300041413 | Bacteria | 1358 |
| 579 | Ga0451789_1335968 | 3300041443 | Bacteria | 888 |
| 580 | Ga0451807_1518065 | 3300041486 | Bacteria | 1391 |
| 581 | Ga0451841_0497166 | 3300041498 | Bacteria | 881 |
| 582 | Ga0451849_0678049 | 3300041505 | Bacteria | 1012 |
| 583 | Ga0451843_0558905 | 3300041509 | Bacteria | 962 |
| 584 | Ga0451855_0724113 | 3300041511 | Bacteria | 1287 |
| 585 | Ga0451853_1561911 | 3300041512 | Bacteria | 11386 |
| 586 | Ga0439433_0045643 | 3300041999 | Bacteria | 1026 |
| 587 | Ga0439442_007281 | 3300042002 | Bacteria | 2224 |
| 588 | Ga0439445_0005785 | 3300042004 | Bacteria | 2826 |
| 589 | Ga0439445_0064595 | 3300042004 | Bacteria | 1005 |
| 590 | Ga0439432_018005 | 3300042006 | Bacteria | 2365 |
| 591 | Ga0439432_077720 | 3300042006 | Bacteria | 1007 |
| 592 | Ga0439449_0003797 | 3300042007 | Bacteria | 5846 |
| 593 | Ga0439449_0027720 | 3300042007 | Bacteria | 2113 |
| 594 | Ga0439449_0029793 | 3300042007 | Bacteria | 2033 |
| 595 | Ga0439449_0055546 | 3300042007 | Bacteria | 1462 |
| 596 | Ga0439449_0058086 | 3300042007 | Bacteria | 1428 |
| 597 | Ga0439452_007125 | 3300042010 | Bacteria | 3445 |
| 598 | Ga0439452_053252 | 3300042010 | Bacteria | 921 |
| 599 | Ga0439457_039037 | 3300042014 | Bacteria | 1057 |
| 600 | Ga0439462_0072097 | 3300042015 | Bacteria | 938 |
| 601 | Ga0450911_000935 | 3300042115 | Bacteria | 7664 |
| 602 | Ga0450921_001087 | 3300042123 | Bacteria | 1550 |
| 603 | Ga0450921_007383 | 3300042123 | Bacteria | 873 |
| 604 | Ga0450923_001056 | 3300042125 | Bacteria | 3472 |
| 605 | Ga0450923_025537 | 3300042125 | Bacteria | 1178 |
| 606 | Ga0450890_003439 | 3300042127 | Bacteria | 2102 |
| 607 | Ga0450906_001534 | 3300042145 | Bacteria | 5047 |
| 608 | Ga0450906_011587 | 3300042145 | Bacteria | 1646 |
| 609 | Ga0450907_018413 | 3300042146 | Bacteria | 1169 |
| 610 | Ga0450908_007977 | 3300042184 | Bacteria | 1986 |
| 611 | Ga0450908_018068 | 3300042184 | Bacteria | 1249 |
| 612 | Ga0450908_030656 | 3300042184 | Bacteria | 934 |
| 613 | Ga0450918_000934 | 3300042531 | Bacteria | 6099 |
| 614 | Ga0450918_021669 | 3300042531 | Bacteria | 1122 |
| 615 | Ga0451577_0066420 | 3300042876 | Bacteria | 3217 |
| 616 | Ga0466969_0152924 | 3300044656 | Bacteria | 1062 |
| 617 | Ga0466965_0182478 | 3300044683 | Bacteria | 1107 |
| 618 | Ga0453684_0516077 | 3300044712 | Bacteria | 1321 |
| 619 | Ga0453684_0546791 | 3300044712 | Bacteria | 1276 |
| 620 | Ga0466957_0189471 | 3300044842 | Bacteria | 1347 |
| 621 | Ga0451576_0585814 | 3300045051 | Bacteria | 1172 |
| 622 | Ga0466967_0443681 | 3300045976 | Bacteria | 1268 |
| 623 | Ga0495627_003930 | 3300046453 | Bacteria | 6357 |
| 624 | Ga0495627_013261 | 3300046453 | Bacteria | 2902 |
| 625 | Ga0495603_0165527 | 3300046455 | Bacteria | 1282 |
| 626 | Ga0495629_0352332 | 3300046459 | Bacteria | 1004 |
| 627 | Ga0495638_0007637 | 3300046460 | Bacteria | 7732 |
| 628 | Ga0495650_0015654 | 3300046471 | Bacteria | 3880 |
| 629 | Ga0495582_0153466 | 3300046473 | Bacteria | 1308 |
| 630 | Ga0495639_0003490 | 3300046475 | Bacteria | 6800 |
| 631 | Ga0495607_0000252 | 3300046501 | Bacteria | 57555 |
| 632 | Ga0495606_0173958 | 3300046507 | Bacteria | 1247 |
| 633 | Ga0495606_0196526 | 3300046507 | Bacteria | 1152 |
| 634 | Ga0495610_0080827 | 3300046512 | Bacteria | 1493 |
| 635 | Ga0495610_0080849 | 3300046512 | Bacteria | 1493 |
| 636 | Ga0495616_0000916 | 3300046513 | Bacteria | 21218 |
| 637 | Ga0495616_0023039 | 3300046513 | Bacteria | 3356 |
| 638 | Ga0495618_0286256 | 3300046514 | Bacteria | 1027 |
| 639 | Ga0495620_0008895 | 3300046515 | Bacteria | 5367 |
| 640 | Ga0495628_0380461 | 3300046516 | Bacteria | 1034 |
| 641 | Ga0495630_0222885 | 3300046517 | Bacteria | 1440 |
| 642 | Ga0495631_0000233 | 3300046518 | Bacteria | 38235 |
| 643 | Ga0495631_0095683 | 3300046518 | Bacteria | 1278 |
| 644 | Ga0495637_0008199 | 3300046520 | Bacteria | 5138 |
| 645 | Ga0495637_0010611 | 3300046520 | Bacteria | 4449 |
| 646 | Ga0495637_0140069 | 3300046520 | Bacteria | 918 |
| 647 | Ga0495648_0137089 | 3300046524 | Bacteria | 1293 |
| 648 | Ga0495663_0064363 | 3300046525 | Bacteria | 1157 |
| 649 | Ga0495663_0095518 | 3300046525 | Bacteria | 973 |
| 650 | Ga0495642_0100047 | 3300046528 | Bacteria | 1233 |
| 651 | Ga0495654_0090347 | 3300046530 | Bacteria | 1422 |
| 652 | Ga0495621_0016352 | 3300046539 | Bacteria | 2380 |
| 653 | Ga0495621_0020533 | 3300046539 | Bacteria | 2169 |
| 654 | Ga0495621_0042258 | 3300046539 | Bacteria | 1604 |
| 655 | Ga0495621_0114909 | 3300046539 | Bacteria | 1035 |
| 656 | Ga0495622_0014993 | 3300046557 | Bacteria | 3604 |
| 657 | Ga0495633_0003443 | 3300046558 | Bacteria | 10531 |
| 658 | Ga0495633_0060037 | 3300046558 | Bacteria | 1782 |
| 659 | Ga0495633_0150745 | 3300046558 | Bacteria | 1074 |
| 660 | Ga0495667_0235221 | 3300046559 | Bacteria | 1168 |
| 661 | Ga0495656_0000108 | 3300046615 | Bacteria | 33050 |
| 662 | Ga0495656_0003752 | 3300046615 | Bacteria | 5158 |
| 663 | Ga0495656_0034326 | 3300046615 | Bacteria | 2076 |
| 664 | Ga0495625_0000057 | 3300046660 | Bacteria | 181623 |
| 665 | Ga0495625_0000637 | 3300046660 | Bacteria | 50416 |
| 666 | Ga0495625_0098883 | 3300046660 | Bacteria | 2006 |
| 667 | Ga0495625_0108633 | 3300046660 | Bacteria | 1898 |
| 668 | Ga0495659_0084499 | 3300046664 | Bacteria | 1210 |
| 669 | Ga0495661_0360397 | 3300046665 | Bacteria | 714 |
| 670 | Ga0495588_0018926 | 3300046674 | Bacteria | 3366 |
| 671 | Ga0495588_0039983 | 3300046674 | Bacteria | 2390 |
| 672 | Ga0495647_0085866 | 3300046681 | Bacteria | 1283 |
| 673 | Ga0495647_0133047 | 3300046681 | Bacteria | 1055 |
| 674 | Ga0495670_0155104 | 3300046691 | Bacteria | 1201 |
| 675 | Ga0495671_0001282 | 3300046692 | Bacteria | 17146 |
| 676 | Ga0495671_0020509 | 3300046692 | Bacteria | 3482 |
| 677 | Ga0495636_0116299 | 3300047318 | Bacteria | 1180 |
| 678 | Ga0495676_0007868 | 3300047321 | Bacteria | 9777 |
| 679 | Ga0495677_0028439 | 3300047445 | Bacteria | 2030 |
| 680 | Ga0495681_0002764 | 3300047470 | Bacteria | 12417 |
| 681 | Ga0495684_0583206 | 3300047471 | Bacteria | 757 |
| 682 | Ga0495686_0001297 | 3300047472 | Bacteria | 28173 |
| 683 | Ga0495593_0005660 | 3300047673 | Bacteria | 7376 |
| 684 | Ga0495593_0078652 | 3300047673 | Bacteria | 1708 |
| 685 | Ga0495614_0003894 | 3300048089 | Bacteria | 6704 |
| 686 | Ga0495615_0062668 | 3300048090 | Bacteria | 985 |
| 687 | Ga0496101_0002803 | 3300048904 | Bacteria | 10698 |
| 688 | Ga0496101_0009650 | 3300048904 | Bacteria | 6349 |
| 689 | Ga0496101_0455762 | 3300048904 | Bacteria | 1009 |
| 690 | Ga0496102_0003435 | 3300048905 | Bacteria | 13428 |
| 691 | Ga0496102_0004534 | 3300048905 | Bacteria | 11740 |
| 692 | Ga0496102_0030993 | 3300048905 | Bacteria | 4791 |
| 693 | Ga0496103_0013210 | 3300048906 | Bacteria | 4896 |
| 694 | Ga0496103_0236151 | 3300048906 | Bacteria | 1176 |
| 695 | Ga0496104_0006268 | 3300048907 | Bacteria | 10455 |
| 696 | Ga0496104_0045610 | 3300048907 | Bacteria | 4124 |
| 697 | Ga0496104_0137938 | 3300048907 | Bacteria | 2343 |
| 698 | Ga0496105_0002236 | 3300048908 | Bacteria | 14021 |
| 699 | Ga0496105_0381014 | 3300048908 | Bacteria | 1122 |
| 700 | Ga0496106_0011540 | 3300048909 | Bacteria | 6531 |
| 701 | Ga0496106_0165973 | 3300048909 | Bacteria | 1748 |
| 702 | Ga0496106_0340134 | 3300048909 | Bacteria | 1205 |
| 703 | Ga0496108_0170429 | 3300048911 | Bacteria | 1883 |
| 704 | Ga0496108_0201964 | 3300048911 | Bacteria | 1725 |
| 705 | Ga0496108_0397048 | 3300048911 | Bacteria | 1204 |
| 706 | Ga0496110_0038468 | 3300048913 | Bacteria | 4163 |
| 707 | Ga0496110_0231827 | 3300048913 | Bacteria | 1679 |
| 708 | Ga0496111_0236653 | 3300048914 | Bacteria | 1356 |
| 709 | Ga0496112_0712570 | 3300048915 | Bacteria | 931 |
| 710 | Ga0496113_0159675 | 3300048916 | Bacteria | 1782 |
| 711 | Ga0496114_0102391 | 3300048917 | Bacteria | 2446 |
| 712 | Ga0496114_0179880 | 3300048917 | Bacteria | 1846 |
| 713 | Ga0496116_0022162 | 3300048919 | Bacteria | 4769 |
| 714 | Ga0496116_0026734 | 3300048919 | Bacteria | 4210 |
| 715 | Ga0496116_0035145 | 3300048919 | Bacteria | 3524 |
| 716 | Ga0496116_0145520 | 3300048919 | Bacteria | 1325 |
| 717 | Ga0496116_0192403 | 3300048919 | Bacteria | 1078 |
| 718 | Ga0496117_0000030 | 3300048920 | Bacteria | 389141 |
| 719 | Ga0496117_0002266 | 3300048920 | Bacteria | 24847 |
| 720 | Ga0496117_0016902 | 3300048920 | Bacteria | 6120 |
| 721 | Ga0496117_0086801 | 3300048920 | Bacteria | 2031 |
| 722 | Ga0496117_0116370 | 3300048920 | Bacteria | 1652 |
| 723 | Ga0496117_0173575 | 3300048920 | Bacteria | 1248 |
| 724 | Ga0496118_0003433 | 3300048921 | Bacteria | 19953 |
| 725 | Ga0496118_0003748 | 3300048921 | Bacteria | 18793 |
| 726 | Ga0496118_0011117 | 3300048921 | Bacteria | 8829 |
| 727 | Ga0496118_0079459 | 3300048921 | Bacteria | 2314 |
| 728 | Ga0496118_0101001 | 3300048921 | Bacteria | 1949 |
| 729 | Ga0496119_0006742 | 3300048922 | Bacteria | 10543 |
| 730 | Ga0496119_0024993 | 3300048922 | Bacteria | 4182 |
| 731 | Ga0496120_0000148 | 3300048923 | Bacteria | 116605 |
| 732 | Ga0496120_0247637 | 3300048923 | Bacteria | 838 |
| 733 | Ga0496121_0008570 | 3300048924 | Bacteria | 11979 |
| 734 | Ga0496121_0045401 | 3300048924 | Bacteria | 3776 |
| 735 | Ga0496121_0066020 | 3300048924 | Bacteria | 2940 |
| 736 | Ga0496121_0123171 | 3300048924 | Bacteria | 1954 |
| 737 | Ga0496121_0180394 | 3300048924 | Bacteria | 1524 |
| 738 | Ga0496121_0248526 | 3300048924 | Bacteria | 1235 |
| 739 | Ga0496121_0305559 | 3300048924 | Bacteria | 1077 |
| 740 | Ga0496122_0000050 | 3300048925 | Bacteria | 267874 |
| 741 | Ga0496122_0000565 | 3300048925 | Bacteria | 75875 |
| 742 | Ga0496122_0001461 | 3300048925 | Bacteria | 38115 |
| 743 | Ga0496122_0005040 | 3300048925 | Bacteria | 15971 |
| 744 | Ga0496122_0055769 | 3300048925 | Bacteria | 2953 |
| 745 | Ga0496122_0068837 | 3300048925 | Bacteria | 2539 |
| 746 | Ga0496122_0093644 | 3300048925 | Bacteria | 2037 |
| 747 | Ga0496122_0113078 | 3300048925 | Bacteria | 1775 |
| 748 | Ga0496122_0172882 | 3300048925 | Bacteria | 1299 |
| 749 | Ga0496123_0000023 | 3300048926 | Bacteria | 346894 |
| 750 | Ga0496123_0000179 | 3300048926 | Bacteria | 127833 |
| 751 | Ga0496123_0000247 | 3300048926 | Bacteria | 109186 |
| 752 | Ga0496123_0001600 | 3300048926 | Bacteria | 30686 |
| 753 | Ga0496123_0029502 | 3300048926 | Bacteria | 4036 |
| 754 | Ga0496123_0041436 | 3300048926 | Bacteria | 3192 |
| 755 | Ga0496123_0043777 | 3300048926 | Bacteria | 3070 |
| 756 | Ga0496123_0152383 | 3300048926 | Bacteria | 1245 |
| 757 | Ga0496123_0230881 | 3300048926 | Bacteria | 926 |
| 758 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 759 | Ga0496124_0001021 | 3300048927 | Bacteria | 44387 |
| 760 | Ga0496124_0002705 | 3300048927 | Bacteria | 22653 |
| 761 | Ga0496124_0016756 | 3300048927 | Bacteria | 6949 |
| 762 | Ga0496124_0021012 | 3300048927 | Bacteria | 6020 |
| 763 | Ga0496124_0144906 | 3300048927 | Bacteria | 1870 |
| 764 | Ga0496124_0180198 | 3300048927 | Bacteria | 1627 |
| 765 | Ga0496124_0230138 | 3300048927 | Bacteria | 1386 |
| 766 | Ga0496125_0000161 | 3300048928 | Bacteria | 150707 |
| 767 | Ga0496125_0000171 | 3300048928 | Bacteria | 145308 |
| 768 | Ga0496125_0027820 | 3300048928 | Bacteria | 5116 |
| 769 | Ga0496125_0035255 | 3300048928 | Bacteria | 4394 |
| 770 | Ga0496125_0042236 | 3300048928 | Bacteria | 3886 |
| 771 | Ga0496125_0094490 | 3300048928 | Bacteria | 2227 |
| 772 | Ga0496125_0095746 | 3300048928 | Bacteria | 2207 |
| 773 | Ga0496125_0116994 | 3300048928 | Bacteria | 1913 |
| 774 | Ga0496125_0205763 | 3300048928 | Bacteria | 1283 |
| 775 | Ga0496125_0226980 | 3300048928 | Bacteria | 1198 |
| 776 | Ga0496125_0254557 | 3300048928 | Bacteria | 1105 |
| 777 | Ga0496125_0292768 | 3300048928 | Bacteria | 1001 |
| 778 | Ga0496126_0027931 | 3300048929 | Bacteria | 5381 |
| 779 | Ga0501031_0013513 | 3300049568 | Bacteria | 5321 |
| 780 | Ga0501032_0003246 | 3300049569 | Bacteria | 12503 |
| 781 | Ga0501033_0000059 | 3300049570 | Bacteria | 105311 |
| 782 | Ga0501033_0001825 | 3300049570 | Bacteria | 18567 |
| 783 | Ga0501034_0078279 | 3300049571 | Bacteria | 3311 |
| 784 | Ga0501034_0092587 | 3300049571 | Bacteria | 3019 |
| 785 | Ga0501034_0345391 | 3300049571 | Bacteria | 1417 |
| 786 | Ga0501036_0008122 | 3300049572 | Bacteria | 8600 |
| 787 | Ga0501037_0002561 | 3300049573 | Bacteria | 13135 |
| 788 | Ga0501037_0009063 | 3300049573 | Bacteria | 7293 |
| 789 | Ga0501037_0114231 | 3300049573 | Bacteria | 1944 |
| 790 | Ga0501037_0414562 | 3300049573 | Bacteria | 922 |
| 791 | Ga0501037_0456101 | 3300049573 | Bacteria | 871 |
| 792 | Ga0501038_0073454 | 3300049574 | Bacteria | 2896 |
| 793 | Ga0501038_0605245 | 3300049574 | Bacteria | 829 |
| 794 | Ga0501043_0000090 | 3300049579 | Bacteria | 81336 |
| 795 | Ga0501043_0000828 | 3300049579 | Bacteria | 27461 |
| 796 | Ga0501043_0134025 | 3300049579 | Bacteria | 1941 |
| 797 | Ga0501043_0312175 | 3300049579 | Bacteria | 1200 |
| 798 | Ga0501046_0000126 | 3300049580 | Bacteria | 81334 |
| 799 | Ga0501046_0033515 | 3300049580 | Bacteria | 4148 |
| 800 | Ga0501047_0000160 | 3300049581 | Bacteria | 81946 |
| 801 | Ga0501047_0076941 | 3300049581 | Bacteria | 3211 |
| 802 | Ga0501048_0000040 | 3300049582 | Bacteria | 63031 |
| 803 | Ga0501249_009632 | 3300049679 | Bacteria | 2010 |
| 804 | Ga0501252_019446 | 3300049682 | Bacteria | 877 |
| 805 | Ga0501225_0007904 | 3300049705 | Bacteria | 3069 |
| 806 | Ga0501262_000028 | 3300049759 | Bacteria | 19106 |
| 807 | Ga0501262_000393 | 3300049759 | Bacteria | 5317 |
| 808 | Ga0501266_030019 | 3300049763 | Bacteria | 773 |
| 809 | Ga0501035_0000213 | 3300049822 | Bacteria | 69670 |
| 810 | Ga0501035_0002403 | 3300049822 | Bacteria | 18351 |
| 811 | Ga0501035_0169553 | 3300049822 | Bacteria | 1886 |
| 812 | Ga0501035_0304843 | 3300049822 | Bacteria | 1341 |
| 813 | Ga0501035_0395444 | 3300049822 | Bacteria | 1150 |
| 814 | Ga0501044_0000045 | 3300049823 | Bacteria | 148353 |
| 815 | Ga0501044_0009438 | 3300049823 | Bacteria | 10627 |
| 816 | Ga0501044_0198289 | 3300049823 | Bacteria | 1966 |
| 817 | Ga0501045_0035981 | 3300049824 | Bacteria | 3595 |
| 818 | nmdc:mga03683_128261_c1 | 3300050489 | Bacteria | 1133 |
| 819 | nmdc:mga03683_136111_c1 | 3300050489 | Bacteria | 1102 |
| 820 | nmdc:mga03683_205984_c1 | 3300050489 | Bacteria | 904 |
| 821 | nmdc:mga03683_26366_c1 | 3300050489 | Bacteria | 2292 |
| 822 | nmdc:mga03683_34001_c1 | 3300050489 | Bacteria | 2061 |
| 823 | nmdc:mga03683_41053_c1 | 3300050489 | Bacteria | 1900 |
| 824 | nmdc:mga03683_78960_c1 | 3300050489 | Bacteria | 1418 |
| 825 | nmdc:mga03n38_164100_c1 | 3300050490 | Bacteria | 1127 |
| 826 | nmdc:mga03n38_21477_c1 | 3300050490 | Bacteria | 2598 |
| 827 | nmdc:mga00v17_171779_c1 | 3300050491 | Bacteria | 1398 |
| 828 | nmdc:mga00v17_213293_c1 | 3300050491 | Bacteria | 1249 |
| 829 | nmdc:mga00v17_55892_c1 | 3300050491 | Bacteria | 2412 |
| 830 | nmdc:mga00v17_5989_c1 | 3300050491 | Bacteria | 6433 |
| 831 | nmdc:mga00v17_700_c1 | 3300050491 | Bacteria | 18378 |
| 832 | nmdc:mga0yw44_185856_c1 | 3300050492 | Bacteria | 1369 |
| 833 | nmdc:mga0yw44_4974_c1 | 3300050492 | Bacteria | 6201 |
| 834 | nmdc:mga0yw44_76476_c1 | 3300050492 | Bacteria | 2090 |
| 835 | nmdc:mga0k408_140873_c1 | 3300050493 | Bacteria | 1435 |
| 836 | nmdc:mga0k408_264627_c1 | 3300050493 | Bacteria | 1027 |
| 837 | nmdc:mga0k408_29093_c1 | 3300050493 | Bacteria | 3143 |
| 838 | nmdc:mga0k408_78681_c1 | 3300050493 | Bacteria | 1929 |
| 839 | nmdc:mga06z11_1446_c1 | 3300050494 | Bacteria | 8826 |
| 840 | nmdc:mga07m45_1027_c1 | 3300050496 | Bacteria | 12374 |
| 841 | nmdc:mga07m45_278739_c1 | 3300050496 | Bacteria | 973 |
| 842 | nmdc:mga07m45_3652_c1 | 3300050496 | Bacteria | 7431 |
| 843 | nmdc:mga07m45_59_c1 | 3300050496 | Bacteria | 45010 |
| 844 | nmdc:mga07m45_8066_c1 | 3300050496 | Bacteria | 5399 |
| 845 | nmdc:mga08x19_447026_c1 | 3300050514 | Bacteria | 909 |
| 846 | nmdc:mga0sz30_13103_c1 | 3300050516 | Bacteria | 3240 |
| 847 | nmdc:mga0sz30_29872_c1 | 3300050516 | Bacteria | 2249 |
| 848 | nmdc:mga0sz30_5751_c1 | 3300050516 | Bacteria | 4565 |
| 849 | Ga0500643_009198 | 3300053087 | Bacteria | 3796 |
| 850 | Ga0500651_0000029 | 3300053093 | Bacteria | 113528 |
| 851 | Ga0500651_0157988 | 3300053093 | Bacteria | 1357 |
| 852 | Ga0500641_0099616 | 3300053096 | Bacteria | 1246 |
| 853 | Ga0500556_0000102 | 3300053104 | Bacteria | 76549 |
| 854 | Ga0500560_000085 | 3300053107 | Bacteria | 9184 |
| 855 | Ga0500571_000896 | 3300053110 | Bacteria | 13015 |
| 856 | Ga0500572_094070 | 3300053111 | Bacteria | 952 |
| 857 | Ga0500592_025006 | 3300053116 | Bacteria | 963 |
| 858 | Ga0500593_000625 | 3300053117 | Bacteria | 13599 |
| 859 | Ga0500593_109834 | 3300053117 | Bacteria | 1135 |
| 860 | Ga0500594_0003141 | 3300053118 | Bacteria | 3611 |
| 861 | Ga0500594_0014303 | 3300053118 | Bacteria | 1898 |
| 862 | Ga0500608_002231 | 3300053122 | Bacteria | 6993 |
| 863 | Ga0500655_014612 | 3300053133 | Bacteria | 1437 |
| 864 | Ga0500658_0000243 | 3300053134 | Bacteria | 25613 |
| 865 | Ga0500658_0000358 | 3300053134 | Bacteria | 20187 |
| 866 | Ga0500658_0004281 | 3300053134 | Bacteria | 5348 |
| 867 | Ga0500559_0000021 | 3300053136 | Bacteria | 129980 |
| 868 | Ga0500559_0070922 | 3300053136 | Bacteria | 1568 |
| 869 | Ga0500559_0084981 | 3300053136 | Bacteria | 1443 |
| 870 | Ga0500559_0134986 | 3300053136 | Bacteria | 1153 |
| 871 | Ga0500561_0000067 | 3300053137 | Bacteria | 20534 |
| 872 | Ga0500564_037142 | 3300053138 | Bacteria | 2246 |
| 873 | Ga0500568_0004013 | 3300053139 | Bacteria | 7983 |
| 874 | Ga0500573_0216890 | 3300053140 | Bacteria | 1006 |
| 875 | Ga0500574_000803 | 3300053141 | Bacteria | 4234 |
| 876 | Ga0500574_039051 | 3300053141 | Bacteria | 1316 |
| 877 | Ga0500577_0025912 | 3300053142 | Bacteria | 1990 |
| 878 | Ga0500616_0039096 | 3300053153 | Bacteria | 2559 |
| 879 | Ga0500624_000351 | 3300053157 | Bacteria | 15016 |
| 880 | Ga0500627_0000393 | 3300053158 | Bacteria | 11732 |
| 881 | Ga0500627_0008574 | 3300053158 | Bacteria | 3640 |
| 882 | Ga0500633_0078818 | 3300053160 | Bacteria | 1189 |
| 883 | Ga0500634_0054964 | 3300053161 | Bacteria | 2132 |
| 884 | Ga0500634_0117040 | 3300053161 | Bacteria | 1304 |
| 885 | Ga0500634_0167315 | 3300053161 | Bacteria | 1006 |
| 886 | Ga0500636_0000012 | 3300053177 | Bacteria | 132207 |
| 887 | Ga0500645_030395 | 3300053730 | Bacteria | 1626 |
| 888 | Ga0500645_043394 | 3300053730 | Bacteria | 1324 |
| 889 | Ga0500596_009403 | 3300053735 | Bacteria | 1526 |
| 890 | Ga0587090_000032 | 3300059510 | Bacteria | 7356 |
| 891 | Ga0587091_001375 | 3300059511 | Bacteria | 2609 |
| 892 | Ga0587067_000808 | 3300059640 | Bacteria | 3050 |
| 893 | Ga0587072_000287 | 3300059643 | Bacteria | 4707 |
| 894 | 2512035855 | 2511231221 | Bacteria | 6846400 |
| 895 | 2512532045 | 2512047086 | Bacteria | 6850303 |
| 896 | 2513230249 | 2513020051 | Bacteria | 6053213 |
| 897 | 2513574137 | 2513237084 | Bacteria | 7231967 |
| 898 | 2513696050 | 2513237101 | Bacteria | 7952346 |
| 899 | 2514000133 | 2513237159 | Bacteria | 6810126 |
| 900 | 2537873135 | 2537561587 | Bacteria | 5425293 |
| 901 | 2554244482 | 2554235003 | Bacteria | 5877155 |
| 902 | 2559297673 | 2558860242 | Bacteria | 5568029 |
| 903 | 2566035776 | 2565956521 | Bacteria | 4468993 |
| 904 | 2599603738 | 2599185210 | Bacteria | 5624189 |
| 905 | 2599622683 | 2599185214 | Bacteria | 8209958 |
| 906 | 2599623988 | 2599185214 | Bacteria | 8209958 |
| 907 | 2599671162 | 2599185226 | Bacteria | 8233575 |
| 908 | 2599671999 | 2599185226 | Bacteria | 8233575 |
| 909 | 2599679801 | 2599185227 | Bacteria | 8246414 |
| 910 | 2599681919 | 2599185227 | Bacteria | 8246414 |
| 911 | 2599691817 | 2599185229 | Bacteria | 8216126 |
| 912 | 2599693932 | 2599185229 | Bacteria | 8216126 |
| 913 | 2601612467 | 2600255279 | Bacteria | 5605316 |
| 914 | 2601749008 | 2600255308 | Bacteria | 5611129 |
| 915 | 2643867529 | 2643221570 | Bacteria | 5103772 |
| 916 | 2643917498 | 2643221582 | Bacteria | 5804683 |
| 917 | 2643990452 | 2643221596 | Bacteria | 5006805 |
| 918 | 2644058590 | 2643221609 | Bacteria | 6756331 |
| 919 | 2644070794 | 2643221611 | Bacteria | 6820941 |
| 920 | 2644295029 | 2643221652 | Bacteria | 5140275 |
| 921 | 2644328753 | 2643221658 | Bacteria | 6064537 |
| 922 | 2644398078 | 2643221672 | Bacteria | 6322190 |
| 923 | 2644413864 | 2643221674 | Bacteria | 3919126 |
| 924 | 2644467422 | 2643221683 | Bacteria | 5749203 |
| 925 | 2644469216 | 2643221683 | Bacteria | 5749203 |
| 926 | 2644522672 | 2643221693 | Bacteria | 5513853 |
| 927 | 2671113082 | 2667528174 | Bacteria | 6435400 |
| 928 | 2719667018 | 2718217997 | Bacteria | 6740740 |
| 929 | 2720493438 | 2718218199 | Bacteria | 6740745 |
| 930 | 2723846283 | 2721755755 | Bacteria | 8322773 |
| 931 | 2738718584 | 2738541277 | Bacteria | 7458140 |
| 932 | 2738722098 | 2738541277 | Bacteria | 7458140 |
| 933 | 2738881186 | 2738541307 | Bacteria | 8606193 |
| 934 | 2738884710 | 2738541307 | Bacteria | 8606193 |
| 935 | 2739244113 | 2738543012 | Bacteria | 7115078 |
| 936 | 2739252449 | 2738543013 | Bacteria | 5618633 |
| 937 | 2739252603 | 2738543013 | Bacteria | 5618633 |
| 938 | 2739280602 | 2738543019 | Bacteria | 7459457 |
| 939 | 2739282462 | 2738543019 | Bacteria | 7459457 |
| 940 | 2739610908 | 2739367655 | Bacteria | 4051151 |
| 941 | 2793297141 | 2791355256 | Bacteria | 6798008 |
| 942 | 2793337333 | 2791355262 | Bacteria | 6774204 |
| 943 | 2793352243 | 2791355265 | Bacteria | 6539969 |
| 944 | 2805927572 | 2802429605 | Bacteria | 6875453 |
| 945 | 2805936046 | 2802429606 | Bacteria | 6346811 |
| 946 | 2806049026 | 2802429633 | Bacteria | 7341974 |
| 947 | 2806065806 | 2802429636 | Bacteria | 7597525 |
| 948 | 2806077302 | 2802429637 | Bacteria | 7067217 |
| 949 | 2808989184 | 2808606387 | Bacteria | 5697198 |
| 950 | 2816472439 | 2816332133 | Bacteria | 7249298 |
| 951 | 2819557720 | 2818991439 | Bacteria | 6907412 |
| 952 | 2819596435 | 2818991446 | Bacteria | 7757362 |
| 953 | 2819599976 | 2818991446 | Bacteria | 7757362 |
| 954 | 2828306055 | 2828305725 | Bacteria | 4916900 |
| 955 | 2831267148 | 2831265667 | Bacteria | 7184833 |
| 956 | 2831270230 | 2831265667 | Bacteria | 7184833 |
| 957 | 2838031603 | 2838029111 | Bacteria | 6603031 |
| 958 | 2838056233 | 2838054893 | Bacteria | 7451788 |
| 959 | 2838059963 | 2838054893 | Bacteria | 7451788 |
| 960 | 2838679893 | 2838675328 | Bacteria | 4909118 |
| 961 | 2838717690 | 2838714209 | Bacteria | 5525906 |
| 962 | 2838724464 | 2838719591 | Bacteria | 5523910 |
| 963 | 2838729594 | 2838724970 | Bacteria | 4908691 |
| 964 | 2841850033 | 2841846520 | Bacteria | 5345850 |
| 965 | 2841861182 | 2841859092 | Bacteria | 5436171 |
| 966 | 2841868056 | 2841864319 | Bacteria | 6742987 |
| 967 | 2842128505 | 2842124991 | Bacteria | 5346824 |
| 968 | 2842134575 | 2842130223 | Bacteria | 4909145 |
| 969 | 2842156593 | 2842152218 | Bacteria | 4908957 |
| 970 | 2842173935 | 2842170452 | Bacteria | 5525737 |
| 971 | 2842180214 | 2842175837 | Bacteria | 4908771 |
| 972 | 2842192213 | 2842187318 | Bacteria | 5524014 |
| 973 | 2842197067 | 2842192696 | Bacteria | 6147454 |
| 974 | 2842206467 | 2842205361 | Bacteria | 6340321 |
| 975 | 2842216507 | 2842211629 | Bacteria | 5523832 |
| 976 | 2842229249 | 2842224351 | Bacteria | 5524473 |
| 977 | 2842279924 | 2842278818 | Bacteria | 6340002 |
| 978 | 2842287553 | 2842285085 | Bacteria | 6011953 |
| 979 | 2842345126 | 2842341865 | Bacteria | 7003929 |
| 980 | 2842369965 | 2842363717 | Bacteria | 6844742 |
| 981 | 2842398401 | 2842395702 | Bacteria | 6780583 |
| 982 | 2842404918 | 2842402390 | Bacteria | 6681310 |
| 983 | 2842411500 | 2842409023 | Bacteria | 6687331 |
| 984 | 2842418049 | 2842415677 | Bacteria | 6596907 |
| 985 | 2842478335 | 2842475841 | Bacteria | 6603183 |
| 986 | 2842505719 | 2842502639 | Bacteria | 6604161 |
| 987 | 2842518551 | 2842515876 | Bacteria | 5436280 |
| 988 | 2842523679 | 2842521101 | Bacteria | 6569494 |
| 989 | 2842680442 | 2842677519 | Bacteria | 5615038 |
| 990 | 2842682401 | 2842677519 | Bacteria | 5615038 |
| 991 | 2842736041 | 2842733646 | Bacteria | 5716726 |
| 992 | 2842748272 | 2842747753 | Bacteria | 5578255 |
| 993 | 2857547402 | 2857542790 | Bacteria | 5326616 |
| 994 | 2857580357 | 2857576091 | Bacteria | 5465855 |
| 995 | 2869252205 | 2869249662 | Bacteria | 6868783 |
| 996 | 2869270921 | 2869264136 | Bacteria | 6880765 |
| 997 | 2871463899 | 2871459585 | Bacteria | 6866887 |
| 998 | 2874132027 | 2874131515 | Bacteria | 6820270 |
| 999 | 2874610752 | 2874604998 | Bacteria | 7834745 |
| 1000 | 2876811676 | 2876808645 | Bacteria | 8824342 |
| 1001 | 2879118834 | 2879110137 | Bacteria | 8907982 |
| 1002 | 2881929425 | 2881927736 | Bacteria | 3993927 |
| 1003 | 2885199570 | 2885198086 | Bacteria | 7212419 |
| 1004 | 2885204827 | 2885198086 | Bacteria | 7212419 |
| 1005 | 2885213157 | 2885211737 | Bacteria | 7212420 |
| 1006 | 2885218486 | 2885211737 | Bacteria | 7212420 |
| 1007 | 2887380275 | 2887375801 | Bacteria | 5334027 |
| 1008 | 2889039269 | 2889033259 | Bacteria | 9099371 |
| 1009 | 2891374330 | 2891373044 | Bacteria | 5202277 |
| 1010 | 2899793088 | 2899792073 | Bacteria | 4926588 |
| 1011 | 2899849710 | 2899845264 | Bacteria | 5672268 |
| 1012 | 2899926077 | 2899924645 | Bacteria | 7487985 |
| 1013 | 2899931145 | 2899924645 | Bacteria | 7487985 |
| 1014 | 2903752807 | 2903748898 | Bacteria | 9972761 |
| 1015 | 2904452285 | 2904449895 | Bacteria | 6927402 |
| 1016 | 2904454815 | 2904449895 | Bacteria | 6927402 |
| 1017 | 2904458569 | 2904456579 | Bacteria | 6819253 |
| 1018 | 2904462612 | 2904456579 | Bacteria | 6819253 |
| 1019 | 2904481386 | 2904479285 | Bacteria | 5073931 |
| 1020 | 2904546798 | 2904541872 | Bacteria | 8915136 |
| 1021 | 2904548652 | 2904541872 | Bacteria | 8915136 |
| 1022 | 2906368560 | 2906363423 | Bacteria | 6856682 |
| 1023 | 2906372527 | 2906370794 | Bacteria | 6881062 |
| 1024 | 2906396023 | 2906393657 | Bacteria | 6790866 |
| 1025 | 2917705653 | 2917699015 | Bacteria | 7043791 |
| 1026 | 2919117970 | 2919114240 | Bacteria | 5700270 |
| 1027 | 2919412869 | 2919408235 | Bacteria | 6149349 |
| 1028 | 2919464055 | 2919462493 | Bacteria | 5817112 |
| 1029 | 2919466338 | 2919462493 | Bacteria | 5817112 |
| 1030 | 2922362086 | 2922361189 | Bacteria | 7436256 |
| 1031 | 2923561822 | 2923556063 | Bacteria | 6793593 |
| 1032 | 2924717677 | 2924710171 | Bacteria | 6752351 |
| 1033 | 2926757739 | 2926754445 | Bacteria | 5964435 |
| 1034 | 2926764636 | 2926760298 | Bacteria | 5505990 |
| 1035 | 2928038077 | 2928037797 | Bacteria | 7273642 |
| 1036 | 2928041527 | 2928037797 | Bacteria | 7273642 |
| 1037 | 2928046317 | 2928044640 | Bacteria | 7271509 |
| 1038 | 2928049091 | 2928044640 | Bacteria | 7271509 |
| 1039 | 2928052299 | 2928051484 | Bacteria | 7773759 |
| 1040 | 2928054012 | 2928051484 | Bacteria | 7773759 |
| 1041 | 2928065030 | 2928064002 | Bacteria | 7419480 |
| 1042 | 2928065765 | 2928064002 | Bacteria | 7419480 |
| 1043 | 2928077433 | 2928070936 | Bacteria | 8062541 |
| 1044 | 2928077909 | 2928070936 | Bacteria | 8062541 |
| 1045 | 2928087369 | 2928084124 | Bacteria | 7159212 |
| 1046 | 2928088694 | 2928084124 | Bacteria | 7159212 |
| 1047 | 2928115455 | 2928115317 | Bacteria | 6477646 |
| 1048 | 2929164271 | 2929160207 | Bacteria | 9075316 |
| 1049 | 2929164682 | 2929160207 | Bacteria | 9075316 |
| 1050 | 2929522213 | 2929520902 | Bacteria | 6765052 |
| 1051 | 2929523851 | 2929520902 | Bacteria | 6765052 |
| 1052 | 2932422769 | 2932422444 | Bacteria | 4678430 |
| 1053 | 2933010354 | 2933006813 | Bacteria | 4912075 |
| 1054 | 2933014177 | 2933011516 | Bacteria | 5439334 |
| 1055 | 2933597223 | 2933594066 | Bacteria | 5594265 |
| 1056 | 2945910707 | 2945909444 | Bacteria | 7065066 |
| 1057 | 2945913031 | 2945909444 | Bacteria | 7065066 |
| 1058 | 2945946603 | 2945945610 | Bacteria | 5951079 |
| 1059 | 2945946867 | 2945945610 | Bacteria | 5951079 |
| 1060 | 2945976326 | 2945972063 | Bacteria | 6086495 |
| 1061 | 2945976582 | 2945972063 | Bacteria | 6086495 |
| 1062 | 2945984684 | 2945984333 | Bacteria | 7358892 |
| 1063 | 2945987120 | 2945984333 | Bacteria | 7358892 |
| 1064 | 2954768001 | 2954767861 | Bacteria | 5535784 |
| 1065 | 2954771619 | 2954767861 | Bacteria | 5535784 |
| 1066 | 2965043416 | 2965040258 | Bacteria | 6855979 |
| 1067 | 2965093081 | 2965089291 | Bacteria | 6866420 |
| 1068 | 2977954330 | 2977950692 | Bacteria | 6893264 |
| 1069 | 2979090253 | 2979089926 | Bacteria | 5670289 |
| 1070 | 2979095783 | 2979095461 | Bacteria | 5669583 |
| 1071 | 2979102760 | 2979100975 | Bacteria | 5423623 |
| 1072 | 2984509351 | 2984509177 | Bacteria | 5274802 |
| 1073 | 2984519949 | 2984518228 | Bacteria | 5277463 |
| 1074 | 2984537681 | 2984537506 | Bacteria | 5277481 |
| 1075 | 2984604429 | 2984601300 | Bacteria | 5455244 |
| 1076 | 3004200819 | 3004195979 | Bacteria | 6776956 |
| 1077 | 650844118 | 650716007 | Bacteria | 5573770 |
| 1078 | 8003573306 | 8003570095 | Bacteria | 5747666 |
| 1079 | 8004318478 | 8004312739 | Bacteria | 7444653 |
| 1080 | 8004363284 | 8004361976 | Bacteria | 6858373 |
| 1081 | 8005294753 | 8005289223 | Bacteria | 6634003 |
| 1082 | 8005486369 | 8005484373 | Bacteria | 6297373 |
| 1083 | 8005647488 | 8005645114 | Bacteria | 6950293 |
| 1084 | 8005700975 | 8005695170 | Bacteria | 6912330 |
| 1085 | 8006964664 | 8006964411 | Bacteria | 8966052 |
| 1086 | 8006991986 | 8006984368 | Bacteria | 9651211 |
| 1087 | 8006999919 | 8006994254 | Bacteria | 8309700 |
| 1088 | 8018178360 | 8018176218 | Bacteria | 6896178 |
| 1089 | 8024505167 | 8024501048 | Bacteria | 6427847 |
| 1090 | 8056387600 | 8056382006 | Bacteria | 6408074 |
| 1091 | 8056680335 | 8056673599 | Bacteria | 7871253 |
| 1092 | Ga0496121_0024154 | |||
| 1093 | JGI24739J22299_10017252 | |||
| 1094 | JGI25156J39149_1000197 | |||
| 1095 | JGI25162J39368_1000069 | |||
| 1096 | JGI25154J39366_1001559 | |||
| 1097 | JGI25158J39367_1002784 | |||
| 1098 | JGI25157J39369_1000239 | |||
| 1099 | JGI25152J39213_1013570 | |||
| 1100 | JGI25152J39213_1020352 | |||
| 1101 | JGI25150J39212_1012541 | |||
| 1102 | JGI25159J45721_1030586 | |||
| 1103 | JGI25151J46595_10000912 | |||
| 1104 | JGI25151J46595_10001106 | |||
| 1105 | JGI25151J46595_10002242 | |||
| 1106 | JGI25151J46595_10017903 | |||
| 1107 | JGI25151J46595_10056756 | |||
| 1108 | JGI25151J46595_10076514 | |||
| 1109 | JGI25165J46597_1000018 | |||
| 1110 | JGI25153J46596_10016995 | |||
| 1111 | JGI25153J46596_10033586 | |||
| 1112 | rootH1_10031181 | |||
| 1113 | Ga0006562J51391_1048428 | |||
| 1114 | Ga0006562J51391_1089020 | |||
| 1115 | JGI25404J52841_10033220 | |||
| 1116 | Ga0055535_1000625 | |||
| 1117 | Ga0055542_1000087 | |||
| 1118 | Ga0055529_1000904 | |||
| 1119 | Ga0055526_1004955 | |||
| 1120 | Ga0055526_1037798 | |||
| 1121 | Ga0055526_1041428 | |||
| 1122 | Ga0055537_1000544 | |||
| 1123 | Ga0055537_1001201 | |||
| 1124 | Ga0055537_1001648 | |||
| 1125 | Ga0055537_1007410 | |||
| 1126 | Ga0055524_1000973 | |||
| 1127 | Ga0055524_1010583 | |||
| 1128 | Ga0055524_1017548 | |||
| 1129 | Ga0055524_1042099 | |||
| 1130 | Ga0055536_1002305 | |||
| 1131 | Ga0055536_1012752 | |||
| 1132 | Ga0055534_1000273 | |||
| 1133 | Ga0055534_1000470 | |||
| 1134 | Ga0055534_1000494 | |||
| 1135 | Ga0055534_1003656 | |||
| 1136 | Ga0055528_1003260 | |||
| 1137 | Ga0055528_1005515 | |||
| 1138 | Ga0055528_1005551 | |||
| 1139 | Ga0055528_1017013 | |||
| 1140 | Ga0055530_10000492 | |||
| 1141 | Ga0055530_10010401 | |||
| 1142 | Ga0055530_10044594 | |||
| 1143 | Ga0055540_1001711 | |||
| 1144 | Ga0055540_1002128 | |||
| 1145 | Ga0055540_1006032 | |||
| 1146 | Ga0055540_1014097 | |||
| 1147 | Ga0055531_10000397 | |||
| 1148 | Ga0055531_10000729 | |||
| 1149 | Ga0055531_10001138 | |||
| 1150 | Ga0055531_10001242 | |||
| 1151 | Ga0055531_10001938 | |||
| 1152 | Ga0058692_1005109 | |||
| 1153 | Ga0055543_1011426 | |||
| 1154 | Ga0065165_1001097 | |||
| 1155 | Ga0065165_1002200 | |||
| 1156 | Ga0065165_1004159 | |||
| 1157 | Ga0065165_1039354 | |||
| 1158 | Ga0065165_1054412 | |||
| 1159 | Ga0065714_10006671 | |||
| 1160 | Ga0065704_10018558 | |||
| 1161 | Ga0070658_10017213 | |||
| 1162 | Ga0070658_10302886 | |||
| 1163 | Ga0070658_10816950 | |||
| 1164 | Ga0070676_10197030 | |||
| 1165 | Ga0070683_100001096 | |||
| 1166 | Ga0070670_100060064 | |||
| 1167 | Ga0070670_100439201 | |||
| 1168 | Ga0068869_100134442 | |||
| 1169 | Ga0070680_100077659 | |||
| 1170 | Ga0070680_100485840 | |||
| 1171 | Ga0068868_100048109 | |||
| 1172 | Ga0070660_100006803 | |||
| 1173 | Ga0070660_100193642 | |||
| 1174 | Ga0070661_100001103 | |||
| 1175 | Ga0070661_100119325 | |||
| 1176 | Ga0070661_100439330 | |||
| 1177 | Ga0070692_10297828 | |||
| 1178 | Ga0070669_100126607 | |||
| 1179 | Ga0070669_100493304 | |||
| 1180 | Ga0070671_100001731 | |||
| 1181 | Ga0070671_100007662 | |||
| 1182 | Ga0070674_100322706 | |||
| 1183 | Ga0070673_100002957 | |||
| 1184 | Ga0070659_100007948 | |||
| 1185 | Ga0070659_100017622 | |||
| 1186 | Ga0070659_100217087 | |||
| 1187 | Ga0070667_100025826 | |||
| 1188 | Ga0070709_10391818 | |||
| 1189 | Ga0070678_100331899 | |||
| 1190 | Ga0070678_100579375 | |||
| 1191 | Ga0070662_100019503 | |||
| 1192 | Ga0070662_100400495 | |||
| 1193 | Ga0070662_100741545 | |||
| 1194 | Ga0068867_100302199 | |||
| 1195 | Ga0070679_100026744 | |||
| 1196 | Ga0070679_100054342 | |||
| 1197 | Ga0070679_100352608 | |||
| 1198 | Ga0070679_100731008 | |||
| 1199 | Ga0070679_100949201 | |||
| 1200 | Ga0070684_100004228 | |||
| 1201 | Ga0068853_100005290 | |||
| 1202 | Ga0068853_100025317 | |||
| 1203 | Ga0068853_100043331 | |||
| 1204 | Ga0068853_100091642 | |||
| 1205 | Ga0068853_100177581 | |||
| 1206 | Ga0070672_100011366 | |||
| 1207 | Ga0070672_100300081 | |||
| 1208 | Ga0070672_100463449 | |||
| 1209 | Ga0070693_100005182 | |||
| 1210 | Ga0070693_100037504 | |||
| 1211 | Ga0070665_100034493 | |||
| 1212 | Ga0070665_100494019 | |||
| 1213 | Ga0068855_100008931 | |||
| 1214 | Ga0068855_100023191 | |||
| 1215 | Ga0068855_100232591 | |||
| 1216 | Ga0070664_100003886 | |||
| 1217 | Ga0070664_100008256 | |||
| 1218 | Ga0070664_100035223 | |||
| 1219 | Ga0068857_100150767 | |||
| 1220 | Ga0068857_100650792 | |||
| 1221 | Ga0068854_100002503 | |||
| 1222 | Ga0068856_100011574 | |||
| 1223 | Ga0068856_100073839 | |||
| 1224 | Ga0068856_100189093 | |||
| 1225 | Ga0068856_100580147 | |||
| 1226 | Ga0068852_100002132 | |||
| 1227 | Ga0068852_100008877 | |||
| 1228 | Ga0068852_100785744 | |||
| 1229 | Ga0068859_101566843 | |||
| 1230 | Ga0068864_100041516 | |||
| 1231 | Ga0068864_100098816 | |||
| 1232 | Ga0068864_100563475 | |||
| 1233 | Ga0068864_101135215 | |||
| 1234 | Ga0068866_10428922 | |||
| 1235 | Ga0068851_10001036 | |||
| 1236 | Ga0068851_10013404 | |||
| 1237 | Ga0068863_100387960 | |||
| 1238 | Ga0068860_100498273 | |||
| 1239 | Ga0081540_1000001 | |||
| 1240 | Ga0081539_10011653 | |||
| 1241 | Ga0075365_10119863 | |||
| 1242 | Ga0075365_10514958 | |||
| 1243 | Ga0075368_10007452 | |||
| 1244 | Ga0075368_10009279 | |||
| 1245 | Ga0075363_100149641 | |||
| 1246 | Ga0075363_100194871 | |||
| 1247 | Ga0075364_10043751 | |||
| 1248 | Ga0075364_10121371 | |||
| 1249 | Ga0075364_10132498 | |||
| 1250 | Ga0075364_10245132 | |||
| 1251 | Ga0075364_10454599 | |||
| 1252 | Ga0075364_10566178 | |||
| 1253 | Ga0075432_10011542 | |||
| 1254 | Ga0075432_10097420 | |||
| 1255 | Ga0075362_10008375 | |||
| 1256 | Ga0075362_10015340 | |||
| 1257 | Ga0075362_10068895 | |||
| 1258 | Ga0075362_10125015 | |||
| 1259 | Ga0075362_10131574 | |||
| 1260 | Ga0075367_10020216 | |||
| 1261 | Ga0075367_10228947 | |||
| 1262 | Ga0075367_10378842 | |||
| 1263 | Ga0075369_10010312 | |||
| 1264 | Ga0075366_10031124 | |||
| 1265 | Ga0075366_10148815 | |||
| 1266 | Ga0097621_100146079 | |||
| 1267 | Ga0097621_100445735 | |||
| 1268 | Ga0097621_100697246 | |||
| 1269 | Ga0075370_10001140 | |||
| 1270 | Ga0075370_10001936 | |||
| 1271 | Ga0075370_10014295 | |||
| 1272 | Ga0075370_10031122 | |||
| 1273 | Ga0075370_10035802 | |||
| 1274 | Ga0068871_100230495 | |||
| 1275 | Ga0068871_100596188 | |||
| 1276 | Ga0079104_1005275 | |||
| 1277 | Ga0099826_10000053 | |||
| 1278 | Ga0099826_10000135 | |||
| 1279 | Ga0099826_10000408 | |||
| 1280 | Ga0099826_10009692 | |||
| 1281 | Ga0099826_10063502 | |||
| 1282 | Ga0105244_10061912 | |||
| 1283 | Ga0105240_10010218 | |||
| 1284 | Ga0105240_10027927 | |||
| 1285 | Ga0105245_10421667 | |||
| 1286 | Ga0105243_10004536 | |||
| 1287 | Ga0105243_10006125 | |||
| 1288 | Ga0105243_10728975 | |||
| 1289 | Ga0105241_10197717 | |||
| 1290 | Ga0105242_10116195 | |||
| 1291 | Ga0105242_10182665 | |||
| 1292 | Ga0105248_10022313 | |||
| 1293 | Ga0105248_10405449 | |||
| 1294 | Ga0105237_10197175 | |||
| 1295 | Ga0105237_10214553 | |||
| 1296 | Ga0105237_10582625 | |||
| 1297 | Ga0105238_10010711 | |||
| 1298 | Ga0105238_10051831 | |||
| 1299 | Ga0105238_10083755 | |||
| 1300 | Ga0105239_11155729 | |||
| 1301 | Ga0105239_11158671 | |||
| 1302 | Ga0105246_10437945 | |||
| 1303 | Ga0157373_10003196 | |||
| 1304 | Ga0157373_10037357 | |||
| 1305 | Ga0157371_10000005 | |||
| 1306 | Ga0157371_10269629 | |||
| 1307 | Ga0157370_10000036 | |||
| 1308 | Ga0157370_10006235 | |||
| 1309 | Ga0157370_10012371 | |||
| 1310 | Ga0157370_10079644 | |||
| 1311 | Ga0157369_10008755 | |||
| 1312 | Ga0157369_10148403 | |||
| 1313 | Ga0157369_10371569 | |||
| 1314 | Ga0157374_10106980 | |||
| 1315 | Ga0163162_10165664 | |||
| 1316 | Ga0163162_10240918 | |||
| 1317 | Ga0163162_10537508 | |||
| 1318 | Ga0163162_10831348 | |||
| 1319 | Ga0157372_10034372 | |||
| 1320 | Ga0157372_10149374 | |||
| 1321 | Ga0157375_10228180 | |||
| 1322 | Ga0157375_10342998 | |||
| 1323 | Ga0157375_10441668 | |||
| 1324 | Ga0157375_10986304 | |||
| 1325 | Ga0163163_10274774 | |||
| 1326 | Ga0182008_10001904 | |||
| 1327 | Ga0182008_10004300 | |||
| 1328 | Ga0182008_10004309 | |||
| 1329 | Ga0182008_10018378 | |||
| 1330 | Ga0182008_10026105 | |||
| 1331 | Ga0182008_10033309 | |||
| 1332 | Ga0157379_10196452 | |||
| 1333 | Ga0157376_10100256 | |||
| 1334 | Ga0157376_10385972 | |||
| 1335 | Ga0182006_1038793 | |||
| 1336 | Ga0182006_1055979 | |||
| 1337 | Ga0182006_1098533 | |||
| 1338 | Ga0182006_1113178 | |||
| 1339 | Ga0182007_10000278 | |||
| 1340 | Ga0182007_10006630 | |||
| 1341 | Ga0182007_10007196 | |||
| 1342 | Ga0182007_10163702 | |||
| 1343 | Ga0182005_1029422 | |||
| 1344 | Ga0182005_1057456 | |||
| 1345 | Ga0183362_10001 | |||
| 1346 | Ga0183362_10003 | |||
| 1347 | Ga0163161_10000598 | |||
| 1348 | Ga0163161_10002565 | |||
| 1349 | Ga0163161_10008944 | |||
| 1350 | Ga0163161_10010182 | |||
| 1351 | Ga0163161_10082600 | |||
| 1352 | Ga0163161_10088707 | |||
| 1353 | Ga0163161_10131056 | |||
| 1354 | Ga0163161_10219816 | |||
| 1355 | Ga0163161_10263133 | |||
| 1356 | Ga0213872_10000161 | |||
| 1357 | Ga0213872_10001576 | |||
| 1358 | Ga0209435_100089 | |||
| 1359 | Ga0209436_104844 | |||
| 1360 | Ga0209672_101712 | |||
| 1361 | Ga0209672_103043 | |||
| 1362 | Ga0209672_110906 | |||
| 1363 | Ga0209147_100510 | |||
| 1364 | Ga0209147_100652 | |||
| 1365 | Ga0209437_100022 | |||
| 1366 | Ga0209258_100009 | |||
| 1367 | Ga0209258_100199 | |||
| 1368 | Ga0209258_104563 | |||
| 1369 | Ga0207425_1006727 | |||
| 1370 | Ga0207425_1054598 | |||
| 1371 | Ga0209646_1000293 | |||
| 1372 | Ga0209026_1000364 | |||
| 1373 | Ga0209148_1000007 | |||
| 1374 | Ga0209148_1000179 | |||
| 1375 | Ga0209759_1000508 | |||
| 1376 | Ga0209129_1000071 | |||
| 1377 | Ga0209129_1000249 | |||
| 1378 | Ga0209129_1002464 | |||
| 1379 | Ga0209129_1003880 | |||
| 1380 | Ga0209129_1011174 | |||
| 1381 | Ga0209233_1000031 | |||
| 1382 | Ga0209565_1000083 | |||
| 1383 | Ga0209565_1000138 | |||
| 1384 | Ga0209565_1000225 | |||
| 1385 | Ga0209565_1001961 | |||
| 1386 | Ga0209565_1020057 | |||
| 1387 | Ga0209455_1005323 | |||
| 1388 | Ga0209673_1000064 | |||
| 1389 | Ga0209673_1000178 | |||
| 1390 | Ga0209673_1000329 | |||
| 1391 | Ga0209673_1000534 | |||
| 1392 | Ga0209673_1000546 | |||
| 1393 | Ga0209673_1001554 | |||
| 1394 | Ga0209673_1006108 | |||
| 1395 | Ga0209673_1011314 | |||
| 1396 | Ga0209673_1021401 | |||
| 1397 | Ga0209673_1067931 | |||
| 1398 | Ga0209130_1000489 | |||
| 1399 | Ga0209130_1000773 | |||
| 1400 | Ga0209130_1000889 | |||
| 1401 | Ga0209130_1002267 | |||
| 1402 | Ga0209130_1010307 | |||
| 1403 | Ga0209675_1000036 | |||
| 1404 | Ga0209675_1000081 | |||
| 1405 | Ga0209675_1000458 | |||
| 1406 | Ga0209675_1000573 | |||
| 1407 | Ga0209675_1000726 | |||
| 1408 | Ga0209675_1001085 | |||
| 1409 | Ga0209675_1004179 | |||
| 1410 | Ga0209675_1032892 | |||
| 1411 | Ga0209676_1000004 | |||
| 1412 | Ga0209676_1000005 | |||
| 1413 | Ga0209676_1000162 | |||
| 1414 | Ga0209676_1000757 | |||
| 1415 | Ga0209676_1001007 | |||
| 1416 | Ga0209676_1007094 | |||
| 1417 | Ga0209676_1018153 | |||
| 1418 | Ga0209676_1028115 | |||
| 1419 | Ga0209676_1065877 | |||
| 1420 | Ga0209025_1000121 | |||
| 1421 | Ga0209025_1000168 | |||
| 1422 | Ga0209025_1000220 | |||
| 1423 | Ga0209025_1000544 | |||
| 1424 | Ga0209025_1001108 | |||
| 1425 | Ga0209025_1001466 | |||
| 1426 | Ga0209025_1008041 | |||
| 1427 | Ga0209025_1021707 | |||
| 1428 | Ga0209025_1022779 | |||
| 1429 | Ga0209025_1022812 | |||
| 1430 | Ga0209025_1062080 | |||
| 1431 | Ga0209025_1098582 | |||
| 1432 | Ga0209564_1000239 | |||
| 1433 | Ga0209564_1000287 | |||
| 1434 | Ga0209564_1002099 | |||
| 1435 | Ga0209564_1004174 | |||
| 1436 | Ga0209564_1020032 | |||
| 1437 | Ga0209758_1000027 | |||
| 1438 | Ga0209758_1002782 | |||
| 1439 | Ga0209758_1005551 | |||
| 1440 | Ga0209758_1012650 | |||
| 1441 | Ga0209758_1012867 | |||
| 1442 | Ga0209050_1000002 | |||
| 1443 | Ga0209050_1000007 | |||
| 1444 | Ga0209050_1001089 | |||
| 1445 | Ga0209050_1010883 | |||
| 1446 | Ga0209050_1011437 | |||
| 1447 | Ga0209050_1022072 | |||
| 1448 | Ga0209050_1027972 | |||
| 1449 | Ga0209256_1000081 | |||
| 1450 | Ga0209256_1000470 | |||
| 1451 | Ga0209256_1001206 | |||
| 1452 | Ga0209256_1004326 | |||
| 1453 | Ga0209256_1007583 | |||
| 1454 | Ga0209256_1023119 | |||
| 1455 | Ga0207426_1000027 | |||
| 1456 | Ga0207426_1000095 | |||
| 1457 | Ga0207426_1000176 | |||
| 1458 | Ga0209051_1000002 | |||
| 1459 | Ga0209051_1000009 | |||
| 1460 | Ga0209051_1000113 | |||
| 1461 | Ga0209051_1000274 | |||
| 1462 | Ga0209051_1000347 | |||
| 1463 | Ga0209051_1000367 | |||
| 1464 | Ga0209051_1000373 | |||
| 1465 | Ga0209051_1000375 | |||
| 1466 | Ga0209051_1000553 | |||
| 1467 | Ga0209051_1000583 | |||
| 1468 | Ga0209051_1010791 | |||
| 1469 | Ga0209257_1000002 | |||
| 1470 | Ga0209257_1000011 | |||
| 1471 | Ga0209257_1000012 | |||
| 1472 | Ga0209257_1000286 | |||
| 1473 | Ga0209257_1000449 | |||
| 1474 | Ga0209257_1000866 | |||
| 1475 | Ga0209257_1006354 | |||
| 1476 | Ga0209257_1008169 | |||
| 1477 | Ga0209257_1015259 | |||
| 1478 | Ga0207656_10000704 | |||
| 1479 | Ga0207656_10014809 | |||
| 1480 | Ga0207656_10063725 | |||
| 1481 | Ga0207655_1002072 | |||
| 1482 | Ga0207682_10053981 | |||
| 1483 | Ga0207688_10164791 | |||
| 1484 | Ga0207680_10363756 | |||
| 1485 | Ga0207645_10375932 | |||
| 1486 | Ga0207643_10069814 | |||
| 1487 | Ga0207705_10246089 | |||
| 1488 | Ga0207705_10251493 | |||
| 1489 | Ga0207707_10254859 | |||
| 1490 | Ga0207695_10067576 | |||
| 1491 | Ga0207695_10103057 | |||
| 1492 | Ga0207695_10454631 | |||
| 1493 | Ga0207671_10112041 | |||
| 1494 | Ga0207671_10128694 | |||
| 1495 | Ga0207671_10741066 | |||
| 1496 | Ga0207657_10012553 | |||
| 1497 | Ga0207657_10353658 | |||
| 1498 | Ga0207649_10038780 | |||
| 1499 | Ga0207649_10094843 | |||
| 1500 | Ga0207652_10150007 | |||
| 1501 | Ga0207652_10228451 | |||
| 1502 | Ga0207652_10599279 | |||
| 1503 | Ga0207694_10014406 | |||
| 1504 | Ga0207694_10057945 | |||
| 1505 | Ga0207650_10008936 | |||
| 1506 | Ga0207650_10227158 | |||
| 1507 | Ga0207659_10173289 | |||
| 1508 | Ga0207687_10186622 | |||
| 1509 | Ga0207687_10324063 | |||
| 1510 | Ga0207687_10821508 | |||
| 1511 | Ga0207644_10040844 | |||
| 1512 | Ga0207706_10075641 | |||
| 1513 | Ga0207706_10306336 | |||
| 1514 | Ga0207686_10143107 | |||
| 1515 | Ga0207709_10000205 | |||
| 1516 | Ga0207709_10000775 | |||
| 1517 | Ga0207709_10001443 | |||
| 1518 | Ga0207709_10026435 | |||
| 1519 | Ga0207670_10115274 | |||
| 1520 | Ga0207669_10305795 | |||
| 1521 | Ga0207669_10373259 | |||
| 1522 | Ga0207704_10737480 | |||
| 1523 | Ga0207691_10003117 | |||
| 1524 | Ga0207691_10099686 | |||
| 1525 | Ga0207691_10183259 | |||
| 1526 | Ga0207691_10213107 | |||
| 1527 | Ga0207689_10092172 | |||
| 1528 | Ga0207661_10248391 | |||
| 1529 | Ga0207679_10004885 | |||
| 1530 | Ga0207679_10069827 | |||
| 1531 | Ga0207667_10039072 | |||
| 1532 | Ga0207667_10064795 | |||
| 1533 | Ga0207667_10281405 | |||
| 1534 | Ga0207651_10001658 | |||
| 1535 | Ga0207651_10472957 | |||
| 1536 | Ga0207668_10149909 | |||
| 1537 | Ga0207668_10532612 | |||
| 1538 | Ga0207640_10023587 | |||
| 1539 | Ga0207640_10213151 | |||
| 1540 | Ga0207640_10366858 | |||
| 1541 | Ga0207658_10029339 | |||
| 1542 | Ga0207677_10326456 | |||
| 1543 | Ga0207703_10630473 | |||
| 1544 | Ga0207639_10039065 | |||
| 1545 | Ga0207639_10350688 | |||
| 1546 | Ga0207639_10630024 | |||
| 1547 | Ga0207678_10002002 | |||
| 1548 | Ga0207702_10016299 | |||
| 1549 | Ga0207702_10054569 | |||
| 1550 | Ga0207702_10363759 | |||
| 1551 | Ga0207702_10381692 | |||
| 1552 | Ga0207641_10183018 | |||
| 1553 | Ga0207641_10226137 | |||
| 1554 | Ga0207648_10105730 | |||
| 1555 | Ga0207676_10030082 | |||
| 1556 | Ga0207676_10034484 | |||
| 1557 | Ga0207676_10135625 | |||
| 1558 | Ga0207674_10007917 | |||
| 1559 | Ga0207674_10157222 | |||
| 1560 | Ga0207674_10195272 | |||
| 1561 | Ga0207698_10002093 | |||
| 1562 | Ga0207698_10004842 | |||
| 1563 | Ga0207698_10992278 | |||
| 1564 | Ga0209281_1011677 | |||
| 1565 | Ga0209371_1005256 | |||
| 1566 | Ga0209282_1000521 | |||
| 1567 | Ga0209282_1001174 | |||
| 1568 | Ga0209282_1137457 | |||
| 1569 | Ga0207428_10303229 | |||
| 1570 | Ga0268266_10016386 | |||
| 1571 | Ga0268266_10222780 | |||
| 1572 | Ga0268265_10293161 | |||
| 1573 | Ga0268264_10222893 | |||
| 1574 | Ga0268264_11404748 | |||
| 1575 | Ga0307515_10000152 | |||
| 1576 | Ga0307515_10014281 | |||
| 1577 | Ga0307512_10206815 | |||
| 1578 | Ga0316177_1192376 | |||
| 1579 | Ga0314311_1055507 | |||
| 1580 | Ga0316179_1038668 | |||
| 1581 | Ga0316178_1036717 | |||
| 1582 | Ga0316180_1138007 | |||
| 1583 | Ga0316183_1051137 | |||
| 1584 | Ga0316181_1003089 | |||
| 1585 | Ga0316182_1122964 | |||
| 1586 | Ga0316182_1388324 | |||
| 1587 | Ga0265328_10097000 | |||
| 1588 | Ga0265325_10004238 | |||
| 1589 | Ga0265331_10098030 | |||
| 1590 | Ga0265327_10000028 | |||
| 1591 | Ga0265327_10000777 | |||
| 1592 | Ga0265327_10008172 | |||
| 1593 | Ga0265327_10036761 | |||
| 1594 | Ga0307513_10065904 | |||
| 1595 | Ga0307513_10090119 | |||
| 1596 | Ga0307408_100003858 | |||
| 1597 | Ga0307408_100111775 | |||
| 1598 | Ga0307408_100177221 | |||
| 1599 | Ga0307408_100332892 | |||
| 1600 | Ga0307408_100355467 | |||
| 1601 | Ga0307408_100444291 | |||
| 1602 | Ga0307408_100665219 | |||
| 1603 | Ga0265313_10030042 | |||
| 1604 | Ga0307514_10062787 | |||
| 1605 | Ga0307514_10124915 | |||
| 1606 | Ga0307405_10007105 | |||
| 1607 | Ga0307405_10186499 | |||
| 1608 | Ga0307410_11059536 | |||
| 1609 | Ga0307406_10002407 | |||
| 1610 | Ga0307406_10006868 | |||
| 1611 | Ga0307406_10634622 | |||
| 1612 | Ga0307407_10200361 | |||
| 1613 | Ga0307412_10011637 | |||
| 1614 | Ga0307412_10029890 | |||
| 1615 | Ga0307412_10052063 | |||
| 1616 | Ga0307412_10081391 | |||
| 1617 | Ga0307412_10090438 | |||
| 1618 | Ga0307412_10544762 | |||
| 1619 | Ga0307412_11012476 | |||
| 1620 | Ga0307409_100494442 | |||
| 1621 | Ga0307416_100002355 | |||
| 1622 | Ga0307416_100248852 | |||
| 1623 | Ga0307416_100273917 | |||
| 1624 | Ga0307416_100839362 | |||
| 1625 | Ga0307414_10053714 | |||
| 1626 | Ga0307414_10272027 | |||
| 1627 | Ga0307414_10346528 | |||
| 1628 | Ga0307414_10353223 | |||
| 1629 | Ga0307414_10516729 | |||
| 1630 | Ga0307411_10126489 | |||
| 1631 | Ga0307411_10127142 | |||
| 1632 | Ga0307411_10154694 | |||
| 1633 | Ga0307411_10178818 | |||
| 1634 | Ga0307411_10331449 | |||
| 1635 | Ga0307411_10407642 | |||
| 1636 | Ga0307411_10477974 | |||
| 1637 | Ga0307415_100426498 | |||
| 1638 | Ga0307510_10031385 | |||
| 1639 | Ga0395899_0001942 | |||
| 1640 | Ga0395899_0037564 | |||
| 1641 | Ga0395900_0007000 | |||
| 1642 | Ga0395900_0031551 | |||
| 1643 | Ga0395900_0328009 | |||
| 1644 | Ga0395900_0426841 | |||
| 1645 | Ga0395898_0005430 | |||
| 1646 | Ga0395898_0023388 | |||
| 1647 | Ga0395898_0160759 | |||
| 1648 | Ga0395898_0284077 | |||
| 1649 | Ga0395905_0007138 | |||
| 1650 | Ga0395905_0022261 | |||
| 1651 | Ga0395905_0034921 | |||
| 1652 | Ga0395905_0134156 | |||
| 1653 | Ga0395905_0288704 | |||
| 1654 | Ga0395901_0053458 | |||
| 1655 | Ga0395901_0087292 | |||
| 1656 | Ga0395901_0089104 | |||
| 1657 | Ga0395901_0098619 | |||
| 1658 | Ga0395901_0126807 | |||
| 1659 | Ga0395901_0161306 | |||
| 1660 | Ga0395901_0241940 | |||
| 1661 | Ga0395901_0291445 | |||
| 1662 | Ga0400483_082990 | |||
| 1663 | Ga0436361_0042902 | |||
| 1664 | Ga0436361_0481133 | |||
| 1665 | Ga0439436_0040093 | |||
| 1666 | Ga0439439_0125455 | |||
| 1667 | Ga0439466_0047929 | |||
| 1668 | Ga0439465_0011629 | |||
| 1669 | Ga0439465_0050689 | |||
| 1670 | Ga0451789_1335968 | |||
| 1671 | Ga0451807_1518065 | |||
| 1672 | Ga0451841_0497166 | |||
| 1673 | Ga0451849_0678049 | |||
| 1674 | Ga0451843_0558905 | |||
| 1675 | Ga0451855_0724113 | |||
| 1676 | Ga0451853_1561911 | |||
| 1677 | Ga0439433_0045643 | |||
| 1678 | Ga0439442_007281 | |||
| 1679 | Ga0439445_0005785 | |||
| 1680 | Ga0439445_0064595 | |||
| 1681 | Ga0439432_018005 | |||
| 1682 | Ga0439432_077720 | |||
| 1683 | Ga0439449_0003797 | |||
| 1684 | Ga0439449_0027720 | |||
| 1685 | Ga0439449_0029793 | |||
| 1686 | Ga0439449_0055546 | |||
| 1687 | Ga0439449_0058086 | |||
| 1688 | Ga0439452_007125 | |||
| 1689 | Ga0439452_053252 | |||
| 1690 | Ga0439457_039037 | |||
| 1691 | Ga0439462_0072097 | |||
| 1692 | Ga0450911_000935 | |||
| 1693 | Ga0450921_001087 | |||
| 1694 | Ga0450921_007383 | |||
| 1695 | Ga0450923_001056 | |||
| 1696 | Ga0450923_025537 | |||
| 1697 | Ga0450890_003439 | |||
| 1698 | Ga0450906_001534 | |||
| 1699 | Ga0450906_011587 | |||
| 1700 | Ga0450907_018413 | |||
| 1701 | Ga0450908_007977 | |||
| 1702 | Ga0450908_018068 | |||
| 1703 | Ga0450908_030656 | |||
| 1704 | Ga0450918_000934 | |||
| 1705 | Ga0450918_021669 | |||
| 1706 | Ga0451577_0066420 | |||
| 1707 | Ga0466969_0152924 | |||
| 1708 | Ga0466965_0182478 | |||
| 1709 | Ga0453684_0516077 | |||
| 1710 | Ga0453684_0546791 | |||
| 1711 | Ga0466957_0189471 | |||
| 1712 | Ga0451576_0585814 | |||
| 1713 | Ga0466967_0443681 | |||
| 1714 | Ga0495627_003930 | |||
| 1715 | Ga0495627_013261 | |||
| 1716 | Ga0495603_0165527 | |||
| 1717 | Ga0495629_0352332 | |||
| 1718 | Ga0495638_0007637 | |||
| 1719 | Ga0495650_0015654 | |||
| 1720 | Ga0495582_0153466 | |||
| 1721 | Ga0495639_0003490 | |||
| 1722 | Ga0495607_0000252 | |||
| 1723 | Ga0495606_0173958 | |||
| 1724 | Ga0495606_0196526 | |||
| 1725 | Ga0495610_0080827 | |||
| 1726 | Ga0495610_0080849 | |||
| 1727 | Ga0495616_0000916 | |||
| 1728 | Ga0495616_0023039 | |||
| 1729 | Ga0495618_0286256 | |||
| 1730 | Ga0495620_0008895 | |||
| 1731 | Ga0495628_0380461 | |||
| 1732 | Ga0495630_0222885 | |||
| 1733 | Ga0495631_0000233 | |||
| 1734 | Ga0495631_0095683 | |||
| 1735 | Ga0495637_0008199 | |||
| 1736 | Ga0495637_0010611 | |||
| 1737 | Ga0495637_0140069 | |||
| 1738 | Ga0495648_0137089 | |||
| 1739 | Ga0495663_0064363 | |||
| 1740 | Ga0495663_0095518 | |||
| 1741 | Ga0495642_0100047 | |||
| 1742 | Ga0495654_0090347 | |||
| 1743 | Ga0495621_0016352 | |||
| 1744 | Ga0495621_0020533 | |||
| 1745 | Ga0495621_0042258 | |||
| 1746 | Ga0495621_0114909 | |||
| 1747 | Ga0495622_0014993 | |||
| 1748 | Ga0495633_0003443 | |||
| 1749 | Ga0495633_0060037 | |||
| 1750 | Ga0495633_0150745 | |||
| 1751 | Ga0495667_0235221 | |||
| 1752 | Ga0495656_0000108 | |||
| 1753 | Ga0495656_0003752 | |||
| 1754 | Ga0495656_0034326 | |||
| 1755 | Ga0495625_0000057 | |||
| 1756 | Ga0495625_0000637 | |||
| 1757 | Ga0495625_0098883 | |||
| 1758 | Ga0495625_0108633 | |||
| 1759 | Ga0495659_0084499 | |||
| 1760 | Ga0495661_0360397 | |||
| 1761 | Ga0495588_0018926 | |||
| 1762 | Ga0495588_0039983 | |||
| 1763 | Ga0495647_0085866 | |||
| 1764 | Ga0495647_0133047 | |||
| 1765 | Ga0495670_0155104 | |||
| 1766 | Ga0495671_0001282 | |||
| 1767 | Ga0495671_0020509 | |||
| 1768 | Ga0495636_0116299 | |||
| 1769 | Ga0495676_0007868 | |||
| 1770 | Ga0495677_0028439 | |||
| 1771 | Ga0495681_0002764 | |||
| 1772 | Ga0495684_0583206 | |||
| 1773 | Ga0495686_0001297 | |||
| 1774 | Ga0495593_0005660 | |||
| 1775 | Ga0495593_0078652 | |||
| 1776 | Ga0495614_0003894 | |||
| 1777 | Ga0495615_0062668 | |||
| 1778 | Ga0496101_0002803 | |||
| 1779 | Ga0496101_0009650 | |||
| 1780 | Ga0496101_0455762 | |||
| 1781 | Ga0496102_0003435 | |||
| 1782 | Ga0496102_0004534 | |||
| 1783 | Ga0496102_0030993 | |||
| 1784 | Ga0496103_0013210 | |||
| 1785 | Ga0496103_0236151 | |||
| 1786 | Ga0496104_0006268 | |||
| 1787 | Ga0496104_0045610 | |||
| 1788 | Ga0496104_0137938 | |||
| 1789 | Ga0496105_0002236 | |||
| 1790 | Ga0496105_0381014 | |||
| 1791 | Ga0496106_0011540 | |||
| 1792 | Ga0496106_0165973 | |||
| 1793 | Ga0496106_0340134 | |||
| 1794 | Ga0496108_0170429 | |||
| 1795 | Ga0496108_0201964 | |||
| 1796 | Ga0496108_0397048 | |||
| 1797 | Ga0496110_0038468 | |||
| 1798 | Ga0496110_0231827 | |||
| 1799 | Ga0496111_0236653 | |||
| 1800 | Ga0496112_0712570 | |||
| 1801 | Ga0496113_0159675 | |||
| 1802 | Ga0496114_0102391 | |||
| 1803 | Ga0496114_0179880 | |||
| 1804 | Ga0496116_0022162 | |||
| 1805 | Ga0496116_0026734 | |||
| 1806 | Ga0496116_0035145 | |||
| 1807 | Ga0496116_0145520 | |||
| 1808 | Ga0496116_0192403 | |||
| 1809 | Ga0496117_0000030 | |||
| 1810 | Ga0496117_0002266 | |||
| 1811 | Ga0496117_0016902 | |||
| 1812 | Ga0496117_0086801 | |||
| 1813 | Ga0496117_0116370 | |||
| 1814 | Ga0496117_0173575 | |||
| 1815 | Ga0496118_0003433 | |||
| 1816 | Ga0496118_0003748 | |||
| 1817 | Ga0496118_0011117 | |||
| 1818 | Ga0496118_0079459 | |||
| 1819 | Ga0496118_0101001 | |||
| 1820 | Ga0496119_0006742 | |||
| 1821 | Ga0496119_0024993 | |||
| 1822 | Ga0496120_0000148 | |||
| 1823 | Ga0496120_0247637 | |||
| 1824 | Ga0496121_0008570 | |||
| 1825 | Ga0496121_0045401 | |||
| 1826 | Ga0496121_0066020 | |||
| 1827 | Ga0496121_0123171 | |||
| 1828 | Ga0496121_0180394 | |||
| 1829 | Ga0496121_0248526 | |||
| 1830 | Ga0496121_0305559 | |||
| 1831 | Ga0496122_0000050 | |||
| 1832 | Ga0496122_0000565 | |||
| 1833 | Ga0496122_0001461 | |||
| 1834 | Ga0496122_0005040 | |||
| 1835 | Ga0496122_0055769 | |||
| 1836 | Ga0496122_0068837 | |||
| 1837 | Ga0496122_0093644 | |||
| 1838 | Ga0496122_0113078 | |||
| 1839 | Ga0496122_0172882 | |||
| 1840 | Ga0496123_0000023 | |||
| 1841 | Ga0496123_0000179 | |||
| 1842 | Ga0496123_0000247 | |||
| 1843 | Ga0496123_0001600 | |||
| 1844 | Ga0496123_0029502 | |||
| 1845 | Ga0496123_0041436 | |||
| 1846 | Ga0496123_0043777 | |||
| 1847 | Ga0496123_0152383 | |||
| 1848 | Ga0496123_0230881 | |||
| 1849 | Ga0496124_0000004 | |||
| 1850 | Ga0496124_0001021 | |||
| 1851 | Ga0496124_0002705 | |||
| 1852 | Ga0496124_0016756 | |||
| 1853 | Ga0496124_0021012 | |||
| 1854 | Ga0496124_0144906 | |||
| 1855 | Ga0496124_0180198 | |||
| 1856 | Ga0496124_0230138 | |||
| 1857 | Ga0496125_0000161 | |||
| 1858 | Ga0496125_0000171 | |||
| 1859 | Ga0496125_0027820 | |||
| 1860 | Ga0496125_0035255 | |||
| 1861 | Ga0496125_0042236 | |||
| 1862 | Ga0496125_0094490 | |||
| 1863 | Ga0496125_0095746 | |||
| 1864 | Ga0496125_0116994 | |||
| 1865 | Ga0496125_0205763 | |||
| 1866 | Ga0496125_0226980 | |||
| 1867 | Ga0496125_0254557 | |||
| 1868 | Ga0496125_0292768 | |||
| 1869 | Ga0496126_0027931 | |||
| 1870 | Ga0501031_0013513 | |||
| 1871 | Ga0501032_0003246 | |||
| 1872 | Ga0501033_0000059 | |||
| 1873 | Ga0501033_0001825 | |||
| 1874 | Ga0501034_0078279 | |||
| 1875 | Ga0501034_0092587 | |||
| 1876 | Ga0501034_0345391 | |||
| 1877 | Ga0501036_0008122 | |||
| 1878 | Ga0501037_0002561 | |||
| 1879 | Ga0501037_0009063 | |||
| 1880 | Ga0501037_0114231 | |||
| 1881 | Ga0501037_0414562 | |||
| 1882 | Ga0501037_0456101 | |||
| 1883 | Ga0501038_0073454 | |||
| 1884 | Ga0501038_0605245 | |||
| 1885 | Ga0501043_0000090 | |||
| 1886 | Ga0501043_0000828 | |||
| 1887 | Ga0501043_0134025 | |||
| 1888 | Ga0501043_0312175 | |||
| 1889 | Ga0501046_0000126 | |||
| 1890 | Ga0501046_0033515 | |||
| 1891 | Ga0501047_0000160 | |||
| 1892 | Ga0501047_0076941 | |||
| 1893 | Ga0501048_0000040 | |||
| 1894 | Ga0501249_009632 | |||
| 1895 | Ga0501252_019446 | |||
| 1896 | Ga0501225_0007904 | |||
| 1897 | Ga0501262_000028 | |||
| 1898 | Ga0501262_000393 | |||
| 1899 | Ga0501266_030019 | |||
| 1900 | Ga0501035_0000213 | |||
| 1901 | Ga0501035_0002403 | |||
| 1902 | Ga0501035_0169553 | |||
| 1903 | Ga0501035_0304843 | |||
| 1904 | Ga0501035_0395444 | |||
| 1905 | Ga0501044_0000045 | |||
| 1906 | Ga0501044_0009438 | |||
| 1907 | Ga0501044_0198289 | |||
| 1908 | Ga0501045_0035981 | |||
| 1909 | nmdc:mga03683_128261_c1 | |||
| 1910 | nmdc:mga03683_136111_c1 | |||
| 1911 | nmdc:mga03683_205984_c1 | |||
| 1912 | nmdc:mga03683_26366_c1 | |||
| 1913 | nmdc:mga03683_34001_c1 | |||
| 1914 | nmdc:mga03683_41053_c1 | |||
| 1915 | nmdc:mga03683_78960_c1 | |||
| 1916 | nmdc:mga03n38_164100_c1 | |||
| 1917 | nmdc:mga03n38_21477_c1 | |||
| 1918 | nmdc:mga00v17_171779_c1 | |||
| 1919 | nmdc:mga00v17_213293_c1 | |||
| 1920 | nmdc:mga00v17_55892_c1 | |||
| 1921 | nmdc:mga00v17_5989_c1 | |||
| 1922 | nmdc:mga00v17_700_c1 | |||
| 1923 | nmdc:mga0yw44_185856_c1 | |||
| 1924 | nmdc:mga0yw44_4974_c1 | |||
| 1925 | nmdc:mga0yw44_76476_c1 | |||
| 1926 | nmdc:mga0k408_140873_c1 | |||
| 1927 | nmdc:mga0k408_264627_c1 | |||
| 1928 | nmdc:mga0k408_29093_c1 | |||
| 1929 | nmdc:mga0k408_78681_c1 | |||
| 1930 | nmdc:mga06z11_1446_c1 | |||
| 1931 | nmdc:mga07m45_1027_c1 | |||
| 1932 | nmdc:mga07m45_278739_c1 | |||
| 1933 | nmdc:mga07m45_3652_c1 | |||
| 1934 | nmdc:mga07m45_59_c1 | |||
| 1935 | nmdc:mga07m45_8066_c1 | |||
| 1936 | nmdc:mga08x19_447026_c1 | |||
| 1937 | nmdc:mga0sz30_13103_c1 | |||
| 1938 | nmdc:mga0sz30_29872_c1 | |||
| 1939 | nmdc:mga0sz30_5751_c1 | |||
| 1940 | Ga0500643_009198 | |||
| 1941 | Ga0500651_0000029 | |||
| 1942 | Ga0500651_0157988 | |||
| 1943 | Ga0500641_0099616 | |||
| 1944 | Ga0500556_0000102 | |||
| 1945 | Ga0500560_000085 | |||
| 1946 | Ga0500571_000896 | |||
| 1947 | Ga0500572_094070 | |||
| 1948 | Ga0500592_025006 | |||
| 1949 | Ga0500593_000625 | |||
| 1950 | Ga0500593_109834 | |||
| 1951 | Ga0500594_0003141 | |||
| 1952 | Ga0500594_0014303 | |||
| 1953 | Ga0500608_002231 | |||
| 1954 | Ga0500655_014612 | |||
| 1955 | Ga0500658_0000243 | |||
| 1956 | Ga0500658_0000358 | |||
| 1957 | Ga0500658_0004281 | |||
| 1958 | Ga0500559_0000021 | |||
| 1959 | Ga0500559_0070922 | |||
| 1960 | Ga0500559_0084981 | |||
| 1961 | Ga0500559_0134986 | |||
| 1962 | Ga0500561_0000067 | |||
| 1963 | Ga0500564_037142 | |||
| 1964 | Ga0500568_0004013 | |||
| 1965 | Ga0500573_0216890 | |||
| 1966 | Ga0500574_000803 | |||
| 1967 | Ga0500574_039051 | |||
| 1968 | Ga0500577_0025912 | |||
| 1969 | Ga0500616_0039096 | |||
| 1970 | Ga0500624_000351 | |||
| 1971 | Ga0500627_0000393 | |||
| 1972 | Ga0500627_0008574 | |||
| 1973 | Ga0500633_0078818 | |||
| 1974 | Ga0500634_0054964 | |||
| 1975 | Ga0500634_0117040 | |||
| 1976 | Ga0500634_0167315 | |||
| 1977 | Ga0500636_0000012 | |||
| 1978 | Ga0500645_030395 | |||
| 1979 | Ga0500645_043394 | |||
| 1980 | Ga0500596_009403 | |||
| 1981 | Ga0587090_000032 | |||
| 1982 | Ga0587091_001375 | |||
| 1983 | Ga0587067_000808 | |||
| 1984 | Ga0587072_000287 | |||
| 1985 | 2512035855 | |||
| 1986 | 2512532045 | |||
| 1987 | 2513230249 | |||
| 1988 | 2513574137 | |||
| 1989 | 2513696050 | |||
| 1990 | 2514000133 | |||
| 1991 | 2537873135 | |||
| 1992 | 2554244482 | |||
| 1993 | 2559297673 | |||
| 1994 | 2566035776 | |||
| 1995 | 2599603738 | |||
| 1996 | 2599622683 | |||
| 1997 | 2599623988 | |||
| 1998 | 2599671162 | |||
| 1999 | 2599671999 | |||
| 2000 | 2599679801 | |||
| 2001 | 2599681919 | |||
| 2002 | 2599691817 | |||
| 2003 | 2599693932 | |||
| 2004 | 2601612467 | |||
| 2005 | 2601749008 | |||
| 2006 | 2643867529 | |||
| 2007 | 2643917498 | |||
| 2008 | 2643990452 | |||
| 2009 | 2644058590 | |||
| 2010 | 2644070794 | |||
| 2011 | 2644295029 | |||
| 2012 | 2644328753 | |||
| 2013 | 2644398078 | |||
| 2014 | 2644413864 | |||
| 2015 | 2644467422 | |||
| 2016 | 2644469216 | |||
| 2017 | 2644522672 | |||
| 2018 | 2671113082 | |||
| 2019 | 2719667018 | |||
| 2020 | 2720493438 | |||
| 2021 | 2723846283 | |||
| 2022 | 2738718584 | |||
| 2023 | 2738722098 | |||
| 2024 | 2738881186 | |||
| 2025 | 2738884710 | |||
| 2026 | 2739244113 | |||
| 2027 | 2739252449 | |||
| 2028 | 2739252603 | |||
| 2029 | 2739280602 | |||
| 2030 | 2739282462 | |||
| 2031 | 2739610908 | |||
| 2032 | 2793297141 | |||
| 2033 | 2793337333 | |||
| 2034 | 2793352243 | |||
| 2035 | 2805927572 | |||
| 2036 | 2805936046 | |||
| 2037 | 2806049026 | |||
| 2038 | 2806065806 | |||
| 2039 | 2806077302 | |||
| 2040 | 2808989184 | |||
| 2041 | 2816472439 | |||
| 2042 | 2819557720 | |||
| 2043 | 2819596435 | |||
| 2044 | 2819599976 | |||
| 2045 | 2828306055 | |||
| 2046 | 2831267148 | |||
| 2047 | 2831270230 | |||
| 2048 | 2838031603 | |||
| 2049 | 2838056233 | |||
| 2050 | 2838059963 | |||
| 2051 | 2838679893 | |||
| 2052 | 2838717690 | |||
| 2053 | 2838724464 | |||
| 2054 | 2838729594 | |||
| 2055 | 2841850033 | |||
| 2056 | 2841861182 | |||
| 2057 | 2841868056 | |||
| 2058 | 2842128505 | |||
| 2059 | 2842134575 | |||
| 2060 | 2842156593 | |||
| 2061 | 2842173935 | |||
| 2062 | 2842180214 | |||
| 2063 | 2842192213 | |||
| 2064 | 2842197067 | |||
| 2065 | 2842206467 | |||
| 2066 | 2842216507 | |||
| 2067 | 2842229249 | |||
| 2068 | 2842279924 | |||
| 2069 | 2842287553 | |||
| 2070 | 2842345126 | |||
| 2071 | 2842369965 | |||
| 2072 | 2842398401 | |||
| 2073 | 2842404918 | |||
| 2074 | 2842411500 | |||
| 2075 | 2842418049 | |||
| 2076 | 2842478335 | |||
| 2077 | 2842505719 | |||
| 2078 | 2842518551 | |||
| 2079 | 2842523679 | |||
| 2080 | 2842680442 | |||
| 2081 | 2842682401 | |||
| 2082 | 2842736041 | |||
| 2083 | 2842748272 | |||
| 2084 | 2857547402 | |||
| 2085 | 2857580357 | |||
| 2086 | 2869252205 | |||
| 2087 | 2869270921 | |||
| 2088 | 2871463899 | |||
| 2089 | 2874132027 | |||
| 2090 | 2874610752 | |||
| 2091 | 2876811676 | |||
| 2092 | 2879118834 | |||
| 2093 | 2881929425 | |||
| 2094 | 2885199570 | |||
| 2095 | 2885204827 | |||
| 2096 | 2885213157 | |||
| 2097 | 2885218486 | |||
| 2098 | 2887380275 | |||
| 2099 | 2889039269 | |||
| 2100 | 2891374330 | |||
| 2101 | 2899793088 | |||
| 2102 | 2899849710 | |||
| 2103 | 2899926077 | |||
| 2104 | 2899931145 | |||
| 2105 | 2903752807 | |||
| 2106 | 2904452285 | |||
| 2107 | 2904454815 | |||
| 2108 | 2904458569 | |||
| 2109 | 2904462612 | |||
| 2110 | 2904481386 | |||
| 2111 | 2904546798 | |||
| 2112 | 2904548652 | |||
| 2113 | 2906368560 | |||
| 2114 | 2906372527 | |||
| 2115 | 2906396023 | |||
| 2116 | 2917705653 | |||
| 2117 | 2919117970 | |||
| 2118 | 2919412869 | |||
| 2119 | 2919464055 | |||
| 2120 | 2919466338 | |||
| 2121 | 2922362086 | |||
| 2122 | 2923561822 | |||
| 2123 | 2924717677 | |||
| 2124 | 2926757739 | |||
| 2125 | 2926764636 | |||
| 2126 | 2928038077 | |||
| 2127 | 2928041527 | |||
| 2128 | 2928046317 | |||
| 2129 | 2928049091 | |||
| 2130 | 2928052299 | |||
| 2131 | 2928054012 | |||
| 2132 | 2928065030 | |||
| 2133 | 2928065765 | |||
| 2134 | 2928077433 | |||
| 2135 | 2928077909 | |||
| 2136 | 2928087369 | |||
| 2137 | 2928088694 | |||
| 2138 | 2928115455 | |||
| 2139 | 2929164271 | |||
| 2140 | 2929164682 | |||
| 2141 | 2929522213 | |||
| 2142 | 2929523851 | |||
| 2143 | 2932422769 | |||
| 2144 | 2933010354 | |||
| 2145 | 2933014177 | |||
| 2146 | 2933597223 | |||
| 2147 | 2945910707 | |||
| 2148 | 2945913031 | |||
| 2149 | 2945946603 | |||
| 2150 | 2945946867 | |||
| 2151 | 2945976326 | |||
| 2152 | 2945976582 | |||
| 2153 | 2945984684 | |||
| 2154 | 2945987120 | |||
| 2155 | 2954768001 | |||
| 2156 | 2954771619 | |||
| 2157 | 2965043416 | |||
| 2158 | 2965093081 | |||
| 2159 | 2977954330 | |||
| 2160 | 2979090253 | |||
| 2161 | 2979095783 | |||
| 2162 | 2979102760 | |||
| 2163 | 2984509351 | |||
| 2164 | 2984519949 | |||
| 2165 | 2984537681 | |||
| 2166 | 2984604429 | |||
| 2167 | 3004200819 | |||
| 2168 | 650844118 | |||
| 2169 | 8003573306 | |||
| 2170 | 8004318478 | |||
| 2171 | 8004363284 | |||
| 2172 | 8005294753 | |||
| 2173 | 8005486369 | |||
| 2174 | 8005647488 | |||
| 2175 | 8005700975 | |||
| 2176 | 8006964664 | |||
| 2177 | 8006991986 | |||
| 2178 | 8006999919 | |||
| 2179 | 8018178360 | |||
| 2180 | 8024505167 | |||
| 2181 | 8056387600 | |||
| 2182 | 8056680335 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
30
214
0.95
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8451 | 1 | 210 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8268 | 1 | 210 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7514 | 10 | 153 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.7321 | 18 | 203 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7234 | 11 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45768_144_364_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8663 | 17 | 210 | 1.10.3720.10 |
| af_P0AFT2_3_219_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8656 | 8 | 216 | 1.10.3720.10 |
| af_Q2FX86_270_484_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8509 | 11 | 213 | 1.10.3720.10 |
| af_P0AEQ6_1_218_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8478 | 1 | 210 | 1.10.3720.10 |
| 4ymsD00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.842 | 1 | 210 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7R261-F1-model_v4 | deleted | 0.9311 | 13 | 138 |
|
| AF-A0A2E0RD90-F1-model_v4 | deleted | 0.9227 | 13 | 158 |
|
| AF-A0A0H3GTQ0-F1-model_v4 | Amino acid ABC superfamily ATP binding cassette transporter | 0.9213 | 1 | 214 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A2V8FXA6-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.9189 | 5 | 145 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A6P1V534-F1-model_v4 | Amino acid ABC transporter permease | 0.9186 | 1 | 214 |
GO:0006865
GO:0022857 GO:0043190 |