F489891

General Info

Members Datasets Scaffolds Average Seq Length
1091 553 2182 216

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0024154|Ga0496121_0024154_685_1383
Length 232
Sequence MHQFGYNHVVYLVEAARWTVALSLIAFAGGSILGFFLALARVQPGSGLVRKLALVSMRLFQATPLLMQLFMFYFGLSIIGLELSAWASASIALIVYTGTFLGEIWQGCIQAVPKGQSDAGKALALTYSQRMSRIILPQAVRIALAPSVGFLVQVIKSTSLASIVGFAELIRASQMVNNVTLRPLLVYSIVMLIYFVLCWPLSLWSRHLERRLAAKGRTVDATVKPELQVVAV

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
118 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
197 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
198 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
199 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
200 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
201 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
202 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
203 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
204 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
205 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
232 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
233 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
234 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
235 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
236 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
237 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
238 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
239 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
240 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
243 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
244 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
245 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
246 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
247 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
248 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
249 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
250 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
251 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
252 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
253 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
254 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
255 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
256 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
257 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
275 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
297 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
320 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
323 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
341 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
342 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
343 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
344 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
353 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
358 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
361 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
362 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
363 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
364 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
367 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
368 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
372 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
373 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
374 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
375 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
376 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
377 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
378 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
379 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
380 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
381 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
382 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
383 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
384 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
385 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
390 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
391 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
392 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
393 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
394 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
395 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
396 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
397 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
398 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
399 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
400 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
401 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
402 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
403 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
404 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
405 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
406 2643221570 Acidovorax sp. Root568 Isolate Unclassified
407 2643221582 Rhizobium sp. Root651 Isolate Unclassified
408 2643221596 Acidovorax sp. Root70 Isolate Unclassified
409 2643221609 Acidovorax sp. Root217 Isolate Unclassified
410 2643221611 Acidovorax sp. Root219 Isolate Unclassified
411 2643221652 Acidovorax sp. Root402 Isolate Unclassified
412 2643221658 Variovorax sp. Root411 Isolate Unclassified
413 2643221672 Variovorax sp. Root434 Isolate Unclassified
414 2643221674 Devosia sp. Root436 Isolate Unclassified
415 2643221683 Variovorax sp. Root473 Isolate Unclassified
416 2643221693 Rhizobium sp. Root491 Isolate Unclassified
417 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
418 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
419 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
420 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
421 2738541277 Variovorax sp. GV051 Isolate Unclassified
422 2738541307 Variovorax sp. GV008 Isolate Unclassified
423 2738543012 Acidovorax sp. CF301 Isolate Unclassified
424 2738543013 Variovorax sp. BT01 Isolate Unclassified
425 2738543019 Variovorax sp. GV040 Isolate Unclassified
426 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
427 2791355256 Rhizobium sp. M10 Isolate Nodule
428 2791355262 Rhizobium sp. M1 Isolate Nodule
429 2791355265 Rhizobium sp. H4 Isolate Nodule
430 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
431 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
432 2802429633 Rhizobium anhuiense J3 Isolate Nodule
433 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
434 2802429637 Rhizobium anhuiense C15 Isolate Nodule
435 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
436 2816332133 Acidovorax radicis 2721A Isolate Unclassified
437 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
438 2818991446 Variovorax sp. 1180 Isolate Unclassified
439 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
440 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
441 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
442 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
443 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
444 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
445 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
446 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
447 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
448 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
449 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
450 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
451 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
452 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
453 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
454 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
455 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
456 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
457 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
458 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
459 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
460 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
461 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
462 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
463 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
464 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
465 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
466 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
467 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
468 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
469 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
470 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
471 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
472 2842677519 Variovorax sp. R-72495 Isolate Unclassified
473 2842733646 Variovorax sp. R-72446 Isolate Unclassified
474 2842747753 Variovorax sp. R-72060 Isolate Unclassified
475 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
476 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
477 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
478 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
479 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
480 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
481 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
482 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
483 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
484 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
485 2885198086 Variovorax sp. 679 Isolate Unclassified
486 2885211737 Variovorax sp. 553 Isolate Unclassified
487 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
488 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
489 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
490 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
491 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
492 2899924645 Variovorax sp. 369 Isolate Unclassified
493 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
494 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
495 2904456579 Variovorax sp. 2002 Isolate Unclassified
496 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
497 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
498 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
499 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
500 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
501 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
502 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
503 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
504 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
505 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
506 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
507 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
508 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
509 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
510 2928037797 Variovorax sp. 1126 Isolate Unclassified
511 2928044640 Variovorax sp. 1128 Isolate Unclassified
512 2928051484 Variovorax sp. 1133 Isolate Unclassified
513 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
514 2928070936 Variovorax gossypii 1167 Isolate Unclassified
515 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
516 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
517 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
518 2929520902 Variovorax beijingensis 502 Isolate Unclassified
519 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
520 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
521 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
522 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
523 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
524 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
525 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
526 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
527 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
528 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
529 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
530 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
531 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
532 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
533 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
534 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
535 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
536 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
537 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
538 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
539 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
540 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
541 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
542 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
543 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
544 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
545 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
546 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
547 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
548 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
549 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
550 8018176218 Rhizobium sp. N122 Isolate Nodule
551 8024501048 Rhizobium sp. H4 Isolate Nodule
552 8056382006 Rhizobium croatiense 13T Isolate Nodule
553 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.3
Metatranscriptomes 0.55
Isolates 18.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 25.11
Nodule 7.79
Rhizoplane 3.48
Rhizosphere 48.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0024154 3300048924 Bacteria 5823
2 JGI24739J22299_10017252 3300001989 Bacteria 2607
3 JGI25156J39149_1000197 3300002705 Bacteria 42157
4 JGI25162J39368_1000069 3300002737 Bacteria 125244
5 JGI25154J39366_1001559 3300002738 Bacteria 7886
6 JGI25158J39367_1002784 3300002739 Bacteria 2776
7 JGI25157J39369_1000239 3300002741 Bacteria 42158
8 JGI25152J39213_1013570 3300002773 Bacteria 1691
9 JGI25152J39213_1020352 3300002773 Bacteria 1186
10 JGI25150J39212_1012541 3300002774 Bacteria 1498
11 JGI25159J45721_1030586 3300002987 Bacteria 873
12 JGI25151J46595_10000912 3300003187 Bacteria 23122
13 JGI25151J46595_10001106 3300003187 Bacteria 19788
14 JGI25151J46595_10002242 3300003187 Bacteria 11876
15 JGI25151J46595_10017903 3300003187 Bacteria 3058
16 JGI25151J46595_10056756 3300003187 Bacteria 1282
17 JGI25151J46595_10076514 3300003187 Bacteria 988
18 JGI25165J46597_1000018 3300003214 Bacteria 374701
19 JGI25153J46596_10016995 3300003215 Bacteria 2885
20 JGI25153J46596_10033586 3300003215 Bacteria 1691
21 rootH1_10031181 3300003316 Bacteria 2128
22 Ga0006562J51391_1048428 3300003578 Bacteria 1460
23 Ga0006562J51391_1089020 3300003578 Bacteria 1303
24 JGI25404J52841_10033220 3300003659 Bacteria 1100
25 Ga0055535_1000625 3300003761 Bacteria 28582
26 Ga0055542_1000087 3300003762 Bacteria 123666
27 Ga0055529_1000904 3300003763 Bacteria 16503
28 Ga0055526_1004955 3300003771 Bacteria 7819
29 Ga0055526_1037798 3300003771 Bacteria 1255
30 Ga0055526_1041428 3300003771 Bacteria 1147
31 Ga0055537_1000544 3300003773 Bacteria 21755
32 Ga0055537_1001201 3300003773 Bacteria 10978
33 Ga0055537_1001648 3300003773 Bacteria 8347
34 Ga0055537_1007410 3300003773 Bacteria 2648
35 Ga0055524_1000973 3300003775 Bacteria 17954
36 Ga0055524_1010583 3300003775 Bacteria 3663
37 Ga0055524_1017548 3300003775 Bacteria 2522
38 Ga0055524_1042099 3300003775 Bacteria 1141
39 Ga0055536_1002305 3300003781 Bacteria 10814
40 Ga0055536_1012752 3300003781 Bacteria 3089
41 Ga0055534_1000273 3300003784 Bacteria 35227
42 Ga0055534_1000470 3300003784 Bacteria 22861
43 Ga0055534_1000494 3300003784 Bacteria 21755
44 Ga0055534_1003656 3300003784 Bacteria 4767
45 Ga0055528_1003260 3300003790 Bacteria 8269
46 Ga0055528_1005515 3300003790 Bacteria 5872
47 Ga0055528_1005551 3300003790 Bacteria 5844
48 Ga0055528_1017013 3300003790 Bacteria 2540
49 Ga0055530_10000492 3300003791 Bacteria 34175
50 Ga0055530_10010401 3300003791 Bacteria 3441
51 Ga0055530_10044594 3300003791 Bacteria 1063
52 Ga0055540_1001711 3300003792 Bacteria 12623
53 Ga0055540_1002128 3300003792 Bacteria 10807
54 Ga0055540_1006032 3300003792 Bacteria 4907
55 Ga0055540_1014097 3300003792 Bacteria 2402
56 Ga0055531_10000397 3300003794 Bacteria 41683
57 Ga0055531_10000729 3300003794 Bacteria 27835
58 Ga0055531_10001138 3300003794 Bacteria 20582
59 Ga0055531_10001242 3300003794 Bacteria 19363
60 Ga0055531_10001938 3300003794 Bacteria 14455
61 Ga0058692_1005109 3300003856 Bacteria 3777
62 Ga0055543_1011426 3300004625 Bacteria 1817
63 Ga0065165_1001097 3300005262 Bacteria 32174
64 Ga0065165_1002200 3300005262 Bacteria 17486
65 Ga0065165_1004159 3300005262 Bacteria 9265
66 Ga0065165_1039354 3300005262 Bacteria 1417
67 Ga0065165_1054412 3300005262 Bacteria 1121
68 Ga0065714_10006671 3300005288 Bacteria 3478
69 Ga0065704_10018558 3300005289 Bacteria 2098
70 Ga0070658_10017213 3300005327 Bacteria 5784
71 Ga0070658_10302886 3300005327 Bacteria 1363
72 Ga0070658_10816950 3300005327 Bacteria 810
73 Ga0070676_10197030 3300005328 Bacteria 1318
74 Ga0070683_100001096 3300005329 Bacteria 20384
75 Ga0070670_100060064 3300005331 Bacteria 3264
76 Ga0070670_100439201 3300005331 Bacteria 1155
77 Ga0068869_100134442 3300005334 Bacteria 1904
78 Ga0070680_100077659 3300005336 Bacteria 2734
79 Ga0070680_100485840 3300005336 Bacteria 1056
80 Ga0068868_100048109 3300005338 Bacteria 3344
81 Ga0070660_100006803 3300005339 Bacteria 7935
82 Ga0070660_100193642 3300005339 Bacteria 1647
83 Ga0070661_100001103 3300005344 Bacteria 18993
84 Ga0070661_100119325 3300005344 Bacteria 1974
85 Ga0070661_100439330 3300005344 Bacteria 1037
86 Ga0070692_10297828 3300005345 Bacteria 984
87 Ga0070669_100126607 3300005353 Bacteria 1955
88 Ga0070669_100493304 3300005353 Bacteria 1015
89 Ga0070671_100001731 3300005355 Bacteria 16589
90 Ga0070671_100007662 3300005355 Bacteria 8632
91 Ga0070674_100322706 3300005356 Bacteria 1238
92 Ga0070673_100002957 3300005364 Bacteria 10477
93 Ga0070659_100007948 3300005366 Bacteria 7728
94 Ga0070659_100017622 3300005366 Bacteria 5379
95 Ga0070659_100217087 3300005366 Bacteria 1578
96 Ga0070667_100025826 3300005367 Bacteria 4885
97 Ga0070709_10391818 3300005434 Bacteria 1035
98 Ga0070678_100331899 3300005456 Bacteria 1302
99 Ga0070678_100579375 3300005456 Bacteria 999
100 Ga0070662_100019503 3300005457 Bacteria 4604
101 Ga0070662_100400495 3300005457 Bacteria 1133
102 Ga0070662_100741545 3300005457 Bacteria 833
103 Ga0068867_100302199 3300005459 Bacteria 1319
104 Ga0070679_100026744 3300005530 Bacteria 5673
105 Ga0070679_100054342 3300005530 Bacteria 3987
106 Ga0070679_100352608 3300005530 Bacteria 1419
107 Ga0070679_100731008 3300005530 Bacteria 933
108 Ga0070679_100949201 3300005530 Bacteria 804
109 Ga0070684_100004228 3300005535 Bacteria 10874
110 Ga0068853_100005290 3300005539 Bacteria 10103
111 Ga0068853_100025317 3300005539 Bacteria 4979
112 Ga0068853_100043331 3300005539 Bacteria 3849
113 Ga0068853_100091642 3300005539 Bacteria 2673
114 Ga0068853_100177581 3300005539 Bacteria 1930
115 Ga0070672_100011366 3300005543 Bacteria 6208
116 Ga0070672_100300081 3300005543 Bacteria 1361
117 Ga0070672_100463449 3300005543 Bacteria 1093
118 Ga0070693_100005182 3300005547 Bacteria 6236
119 Ga0070693_100037504 3300005547 Bacteria 2703
120 Ga0070665_100034493 3300005548 Bacteria 5089
121 Ga0070665_100494019 3300005548 Bacteria 1235
122 Ga0068855_100008931 3300005563 Bacteria 12114
123 Ga0068855_100023191 3300005563 Bacteria 7435
124 Ga0068855_100232591 3300005563 Bacteria 2063
125 Ga0070664_100003886 3300005564 Bacteria 12056
126 Ga0070664_100008256 3300005564 Bacteria 8421
127 Ga0070664_100035223 3300005564 Bacteria 4202
128 Ga0068857_100150767 3300005577 Bacteria 2106
129 Ga0068857_100650792 3300005577 Bacteria 999
130 Ga0068854_100002503 3300005578 Bacteria 11399
131 Ga0068856_100011574 3300005614 Bacteria 8557
132 Ga0068856_100073839 3300005614 Bacteria 3377
133 Ga0068856_100189093 3300005614 Bacteria 2073
134 Ga0068856_100580147 3300005614 Bacteria 1143
135 Ga0068852_100002132 3300005616 Bacteria 13562
136 Ga0068852_100008877 3300005616 Bacteria 7435
137 Ga0068852_100785744 3300005616 Bacteria 965
138 Ga0068859_101566843 3300005617 Bacteria 727
139 Ga0068864_100041516 3300005618 Bacteria 3934
140 Ga0068864_100098816 3300005618 Bacteria 2585
141 Ga0068864_100563475 3300005618 Bacteria 1102
142 Ga0068864_101135215 3300005618 Bacteria 779
143 Ga0068866_10428922 3300005718 Bacteria 859
144 Ga0068851_10001036 3300005834 Bacteria 12077
145 Ga0068851_10013404 3300005834 Bacteria 3881
146 Ga0068863_100387960 3300005841 Bacteria 1364
147 Ga0068860_100498273 3300005843 Bacteria 1216
148 Ga0081540_1000001 3300005983 Bacteria 293507
149 Ga0081539_10011653 3300005985 Bacteria 6918
150 Ga0075365_10119863 3300006038 Bacteria 1814
151 Ga0075365_10514958 3300006038 Bacteria 846
152 Ga0075368_10007452 3300006042 Bacteria 3861
153 Ga0075368_10009279 3300006042 Bacteria 3535
154 Ga0075363_100149641 3300006048 Bacteria 1317
155 Ga0075363_100194871 3300006048 Bacteria 1156
156 Ga0075364_10043751 3300006051 Bacteria 2911
157 Ga0075364_10121371 3300006051 Bacteria 1749
158 Ga0075364_10132498 3300006051 Bacteria 1673
159 Ga0075364_10245132 3300006051 Bacteria 1217
160 Ga0075364_10454599 3300006051 Bacteria 875
161 Ga0075364_10566178 3300006051 Bacteria 777
162 Ga0075432_10011542 3300006058 Bacteria 3002
163 Ga0075432_10097420 3300006058 Bacteria 1083
164 Ga0075362_10008375 3300006177 Bacteria 3951
165 Ga0075362_10015340 3300006177 Bacteria 3114
166 Ga0075362_10068895 3300006177 Bacteria 1612
167 Ga0075362_10125015 3300006177 Bacteria 1220
168 Ga0075362_10131574 3300006177 Bacteria 1190
169 Ga0075367_10020216 3300006178 Bacteria 3704
170 Ga0075367_10228947 3300006178 Bacteria 1164
171 Ga0075367_10378842 3300006178 Bacteria 894
172 Ga0075369_10010312 3300006186 Bacteria 3652
173 Ga0075366_10031124 3300006195 Bacteria 3139
174 Ga0075366_10148815 3300006195 Bacteria 1417
175 Ga0097621_100146079 3300006237 Bacteria 2025
176 Ga0097621_100445735 3300006237 Bacteria 1165
177 Ga0097621_100697246 3300006237 Bacteria 935
178 Ga0075370_10001140 3300006353 Bacteria 11147
179 Ga0075370_10001936 3300006353 Bacteria 9342
180 Ga0075370_10014295 3300006353 Bacteria 4234
181 Ga0075370_10031122 3300006353 Bacteria 2978
182 Ga0075370_10035802 3300006353 Bacteria 2787
183 Ga0068871_100230495 3300006358 Bacteria 1607
184 Ga0068871_100596188 3300006358 Bacteria 1004
185 Ga0079104_1005275 3300006946 Bacteria 5207
186 Ga0099826_10000053 3300006948 Bacteria 72398
187 Ga0099826_10000135 3300006948 Bacteria 31697
188 Ga0099826_10000408 3300006948 Bacteria 20307
189 Ga0099826_10009692 3300006948 Bacteria 7192
190 Ga0099826_10063502 3300006948 Bacteria 2386
191 Ga0105244_10061912 3300009036 Bacteria 1882
192 Ga0105240_10010218 3300009093 Bacteria 13210
193 Ga0105240_10027927 3300009093 Bacteria 7381
194 Ga0105245_10421667 3300009098 Bacteria 1338
195 Ga0105243_10004536 3300009148 Bacteria 10972
196 Ga0105243_10006125 3300009148 Bacteria 9302
197 Ga0105243_10728975 3300009148 Bacteria 969
198 Ga0105241_10197717 3300009174 Bacteria 1677
199 Ga0105242_10116195 3300009176 Bacteria 2289
200 Ga0105242_10182665 3300009176 Bacteria 1851
201 Ga0105248_10022313 3300009177 Bacteria 7019
202 Ga0105248_10405449 3300009177 Bacteria 1535
203 Ga0105237_10197175 3300009545 Bacteria 2013
204 Ga0105237_10214553 3300009545 Bacteria 1924
205 Ga0105237_10582625 3300009545 Bacteria 1126
206 Ga0105238_10010711 3300009551 Bacteria 9210
207 Ga0105238_10051831 3300009551 Bacteria 4126
208 Ga0105238_10083755 3300009551 Bacteria 3178
209 Ga0105239_11155729 3300010375 Bacteria 892
210 Ga0105239_11158671 3300010375 Bacteria 890
211 Ga0105246_10437945 3300011119 Bacteria 1095
212 Ga0157373_10003196 3300013100 Bacteria 12388
213 Ga0157373_10037357 3300013100 Bacteria 3482
214 Ga0157371_10000005 3300013102 Bacteria 416456
215 Ga0157371_10269629 3300013102 Bacteria 1228
216 Ga0157370_10000036 3300013104 Bacteria 136933
217 Ga0157370_10006235 3300013104 Bacteria 13208
218 Ga0157370_10012371 3300013104 Bacteria 8853
219 Ga0157370_10079644 3300013104 Bacteria 3085
220 Ga0157369_10008755 3300013105 Bacteria 11590
221 Ga0157369_10148403 3300013105 Bacteria 2479
222 Ga0157369_10371569 3300013105 Bacteria 1484
223 Ga0157374_10106980 3300013296 Bacteria 2688
224 Ga0163162_10165664 3300013306 Bacteria 2334
225 Ga0163162_10240918 3300013306 Bacteria 1940
226 Ga0163162_10537508 3300013306 Bacteria 1297
227 Ga0163162_10831348 3300013306 Bacteria 1039
228 Ga0157372_10034372 3300013307 Bacteria 5573
229 Ga0157372_10149374 3300013307 Bacteria 2696
230 Ga0157375_10228180 3300013308 Bacteria 2021
231 Ga0157375_10342998 3300013308 Bacteria 1659
232 Ga0157375_10441668 3300013308 Bacteria 1467
233 Ga0157375_10986304 3300013308 Bacteria 983
234 Ga0163163_10274774 3300014325 Bacteria 1736
235 Ga0182008_10001904 3300014497 Bacteria 13501
236 Ga0182008_10004300 3300014497 Bacteria 8340
237 Ga0182008_10004309 3300014497 Bacteria 8328
238 Ga0182008_10018378 3300014497 Bacteria 3620
239 Ga0182008_10026105 3300014497 Bacteria 2963
240 Ga0182008_10033309 3300014497 Bacteria 2585
241 Ga0157379_10196452 3300014968 Bacteria 1823
242 Ga0157376_10100256 3300014969 Bacteria 2528
243 Ga0157376_10385972 3300014969 Bacteria 1350
244 Ga0182006_1038793 3300015261 Bacteria 1882
245 Ga0182006_1055979 3300015261 Bacteria 1503
246 Ga0182006_1098533 3300015261 Bacteria 1041
247 Ga0182006_1113178 3300015261 Bacteria 950
248 Ga0182007_10000278 3300015262 Bacteria 33960
249 Ga0182007_10006630 3300015262 Bacteria 4956
250 Ga0182007_10007196 3300015262 Bacteria 4693
251 Ga0182007_10163702 3300015262 Bacteria 762
252 Ga0182005_1029422 3300015265 Bacteria 1498
253 Ga0182005_1057456 3300015265 Bacteria 1061
254 Ga0183362_10001 3300015683 Bacteria 2046624
255 Ga0183362_10003 3300015683 Bacteria 977584
256 Ga0163161_10000598 3300017792 Bacteria 28842
257 Ga0163161_10002565 3300017792 Bacteria 12976
258 Ga0163161_10008944 3300017792 Bacteria 6925
259 Ga0163161_10010182 3300017792 Bacteria 6509
260 Ga0163161_10082600 3300017792 Bacteria 2367
261 Ga0163161_10088707 3300017792 Bacteria 2286
262 Ga0163161_10131056 3300017792 Bacteria 1891
263 Ga0163161_10219816 3300017792 Bacteria 1471
264 Ga0163161_10263133 3300017792 Bacteria 1347
265 Ga0213872_10000161 3300021361 Bacteria 61406
266 Ga0213872_10001576 3300021361 Bacteria 14538
267 Ga0209435_100089 3300025206 Bacteria 42209
268 Ga0209436_104844 3300025208 Bacteria 3228
269 Ga0209672_101712 3300025228 Bacteria 7040
270 Ga0209672_103043 3300025228 Bacteria 3655
271 Ga0209672_110906 3300025228 Bacteria 1203
272 Ga0209147_100510 3300025229 Bacteria 22609
273 Ga0209147_100652 3300025229 Bacteria 18097
274 Ga0209437_100022 3300025233 Bacteria 625694
275 Ga0209258_100009 3300025242 Bacteria 996276
276 Ga0209258_100199 3300025242 Bacteria 123718
277 Ga0209258_104563 3300025242 Bacteria 2590
278 Ga0207425_1006727 3300025245 Bacteria 3112
279 Ga0207425_1054598 3300025245 Bacteria 719
280 Ga0209646_1000293 3300025246 Bacteria 42209
281 Ga0209026_1000364 3300025250 Bacteria 42209
282 Ga0209148_1000007 3300025254 Bacteria 1592273
283 Ga0209148_1000179 3300025254 Bacteria 126083
284 Ga0209759_1000508 3300025256 Bacteria 42209
285 Ga0209129_1000071 3300025258 Bacteria 210729
286 Ga0209129_1000249 3300025258 Bacteria 56453
287 Ga0209129_1002464 3300025258 Bacteria 9057
288 Ga0209129_1003880 3300025258 Bacteria 6226
289 Ga0209129_1011174 3300025258 Bacteria 2167
290 Ga0209233_1000031 3300025261 Bacteria 624646
291 Ga0209565_1000083 3300025263 Bacteria 154007
292 Ga0209565_1000138 3300025263 Bacteria 101729
293 Ga0209565_1000225 3300025263 Bacteria 63291
294 Ga0209565_1001961 3300025263 Bacteria 8060
295 Ga0209565_1020057 3300025263 Bacteria 1417
296 Ga0209455_1005323 3300025272 Bacteria 4003
297 Ga0209673_1000064 3300025273 Bacteria 254712
298 Ga0209673_1000178 3300025273 Bacteria 128628
299 Ga0209673_1000329 3300025273 Bacteria 87170
300 Ga0209673_1000534 3300025273 Bacteria 62274
301 Ga0209673_1000546 3300025273 Bacteria 61140
302 Ga0209673_1001554 3300025273 Bacteria 20714
303 Ga0209673_1006108 3300025273 Bacteria 5907
304 Ga0209673_1011314 3300025273 Bacteria 3686
305 Ga0209673_1021401 3300025273 Bacteria 2261
306 Ga0209673_1067931 3300025273 Bacteria 860
307 Ga0209130_1000489 3300025284 Bacteria 40639
308 Ga0209130_1000773 3300025284 Bacteria 27625
309 Ga0209130_1000889 3300025284 Bacteria 24355
310 Ga0209130_1002267 3300025284 Bacteria 9923
311 Ga0209130_1010307 3300025284 Bacteria 2586
312 Ga0209675_1000036 3300025291 Bacteria 254712
313 Ga0209675_1000081 3300025291 Bacteria 154007
314 Ga0209675_1000458 3300025291 Bacteria 31329
315 Ga0209675_1000573 3300025291 Bacteria 26547
316 Ga0209675_1000726 3300025291 Bacteria 22391
317 Ga0209675_1001085 3300025291 Bacteria 16755
318 Ga0209675_1004179 3300025291 Bacteria 6532
319 Ga0209675_1032892 3300025291 Bacteria 1209
320 Ga0209676_1000004 3300025292 Bacteria 1138360
321 Ga0209676_1000005 3300025292 Bacteria 1076001
322 Ga0209676_1000162 3300025292 Bacteria 159931
323 Ga0209676_1000757 3300025292 Bacteria 43636
324 Ga0209676_1001007 3300025292 Bacteria 33026
325 Ga0209676_1007094 3300025292 Bacteria 5363
326 Ga0209676_1018153 3300025292 Bacteria 2462
327 Ga0209676_1028115 3300025292 Bacteria 1757
328 Ga0209676_1065877 3300025292 Bacteria 880
329 Ga0209025_1000121 3300025294 Bacteria 208700
330 Ga0209025_1000168 3300025294 Bacteria 162386
331 Ga0209025_1000220 3300025294 Bacteria 136977
332 Ga0209025_1000544 3300025294 Bacteria 70638
333 Ga0209025_1001108 3300025294 Bacteria 38669
334 Ga0209025_1001466 3300025294 Bacteria 30784
335 Ga0209025_1008041 3300025294 Bacteria 7682
336 Ga0209025_1021707 3300025294 Bacteria 3444
337 Ga0209025_1022779 3300025294 Bacteria 3305
338 Ga0209025_1022812 3300025294 Bacteria 3301
339 Ga0209025_1062080 3300025294 Bacteria 1389
340 Ga0209025_1098582 3300025294 Bacteria 932
341 Ga0209564_1000239 3300025295 Bacteria 119761
342 Ga0209564_1000287 3300025295 Bacteria 102328
343 Ga0209564_1002099 3300025295 Bacteria 17049
344 Ga0209564_1004174 3300025295 Bacteria 9027
345 Ga0209564_1020032 3300025295 Bacteria 2471
346 Ga0209758_1000027 3300025297 Bacteria 549650
347 Ga0209758_1002782 3300025297 Bacteria 17126
348 Ga0209758_1005551 3300025297 Bacteria 9617
349 Ga0209758_1012650 3300025297 Bacteria 4696
350 Ga0209758_1012867 3300025297 Bacteria 4634
351 Ga0209050_1000002 3300025298 Bacteria 1792849
352 Ga0209050_1000007 3300025298 Bacteria 1187891
353 Ga0209050_1001089 3300025298 Bacteria 33034
354 Ga0209050_1010883 3300025298 Bacteria 4409
355 Ga0209050_1011437 3300025298 Bacteria 4207
356 Ga0209050_1022072 3300025298 Bacteria 2294
357 Ga0209050_1027972 3300025298 Bacteria 1842
358 Ga0209256_1000081 3300025299 Bacteria 222908
359 Ga0209256_1000470 3300025299 Bacteria 60553
360 Ga0209256_1001206 3300025299 Bacteria 28955
361 Ga0209256_1004326 3300025299 Bacteria 9027
362 Ga0209256_1007583 3300025299 Bacteria 5300
363 Ga0209256_1023119 3300025299 Bacteria 1862
364 Ga0207426_1000027 3300025302 Bacteria 513176
365 Ga0207426_1000095 3300025302 Bacteria 274234
366 Ga0207426_1000176 3300025302 Bacteria 159819
367 Ga0209051_1000002 3300025303 Bacteria 1631846
368 Ga0209051_1000009 3300025303 Bacteria 706778
369 Ga0209051_1000113 3300025303 Bacteria 152417
370 Ga0209051_1000274 3300025303 Bacteria 84662
371 Ga0209051_1000347 3300025303 Bacteria 68841
372 Ga0209051_1000367 3300025303 Bacteria 65677
373 Ga0209051_1000373 3300025303 Bacteria 64348
374 Ga0209051_1000375 3300025303 Bacteria 63742
375 Ga0209051_1000553 3300025303 Bacteria 45537
376 Ga0209051_1000583 3300025303 Bacteria 43428
377 Ga0209051_1010791 3300025303 Bacteria 4572
378 Ga0209257_1000002 3300025304 Bacteria 1767052
379 Ga0209257_1000011 3300025304 Bacteria 1112630
380 Ga0209257_1000012 3300025304 Bacteria 1111138
381 Ga0209257_1000286 3300025304 Bacteria 111738
382 Ga0209257_1000449 3300025304 Bacteria 77522
383 Ga0209257_1000866 3300025304 Bacteria 43105
384 Ga0209257_1006354 3300025304 Bacteria 7670
385 Ga0209257_1008169 3300025304 Bacteria 6058
386 Ga0209257_1015259 3300025304 Bacteria 3215
387 Ga0207656_10000704 3300025321 Bacteria 10951
388 Ga0207656_10014809 3300025321 Bacteria 3012
389 Ga0207656_10063725 3300025321 Bacteria 1623
390 Ga0207655_1002072 3300025728 Bacteria 16828
391 Ga0207682_10053981 3300025893 Bacteria 1668
392 Ga0207688_10164791 3300025901 Bacteria 1316
393 Ga0207680_10363756 3300025903 Bacteria 1018
394 Ga0207645_10375932 3300025907 Bacteria 953
395 Ga0207643_10069814 3300025908 Bacteria 2020
396 Ga0207705_10246089 3300025909 Bacteria 1363
397 Ga0207705_10251493 3300025909 Bacteria 1348
398 Ga0207707_10254859 3300025912 Bacteria 1524
399 Ga0207695_10067576 3300025913 Bacteria 3666
400 Ga0207695_10103057 3300025913 Bacteria 2846
401 Ga0207695_10454631 3300025913 Bacteria 1164
402 Ga0207671_10112041 3300025914 Bacteria 2077
403 Ga0207671_10128694 3300025914 Bacteria 1942
404 Ga0207671_10741066 3300025914 Bacteria 781
405 Ga0207657_10012553 3300025919 Bacteria 8355
406 Ga0207657_10353658 3300025919 Bacteria 1158
407 Ga0207649_10038780 3300025920 Bacteria 2886
408 Ga0207649_10094843 3300025920 Bacteria 1962
409 Ga0207652_10150007 3300025921 Bacteria 2087
410 Ga0207652_10228451 3300025921 Bacteria 1677
411 Ga0207652_10599279 3300025921 Bacteria 988
412 Ga0207694_10014406 3300025924 Bacteria 5960
413 Ga0207694_10057945 3300025924 Bacteria 3013
414 Ga0207650_10008936 3300025925 Bacteria 6846
415 Ga0207650_10227158 3300025925 Bacteria 1504
416 Ga0207659_10173289 3300025926 Bacteria 1703
417 Ga0207687_10186622 3300025927 Bacteria 1610
418 Ga0207687_10324063 3300025927 Bacteria 1248
419 Ga0207687_10821508 3300025927 Bacteria 793
420 Ga0207644_10040844 3300025931 Bacteria 3279
421 Ga0207706_10075641 3300025933 Bacteria 2961
422 Ga0207706_10306336 3300025933 Bacteria 1383
423 Ga0207686_10143107 3300025934 Bacteria 1655
424 Ga0207709_10000205 3300025935 Bacteria 77131
425 Ga0207709_10000775 3300025935 Bacteria 25131
426 Ga0207709_10001443 3300025935 Bacteria 16593
427 Ga0207709_10026435 3300025935 Bacteria 3334
428 Ga0207670_10115274 3300025936 Bacteria 1943
429 Ga0207669_10305795 3300025937 Bacteria 1210
430 Ga0207669_10373259 3300025937 Bacteria 1109
431 Ga0207704_10737480 3300025938 Bacteria 818
432 Ga0207691_10003117 3300025940 Bacteria 16191
433 Ga0207691_10099686 3300025940 Bacteria 2594
434 Ga0207691_10183259 3300025940 Bacteria 1829
435 Ga0207691_10213107 3300025940 Bacteria 1677
436 Ga0207689_10092172 3300025942 Bacteria 2489
437 Ga0207661_10248391 3300025944 Bacteria 1580
438 Ga0207679_10004885 3300025945 Bacteria 8355
439 Ga0207679_10069827 3300025945 Bacteria 2645
440 Ga0207667_10039072 3300025949 Bacteria 5060
441 Ga0207667_10064795 3300025949 Bacteria 3814
442 Ga0207667_10281405 3300025949 Bacteria 1700
443 Ga0207651_10001658 3300025960 Bacteria 10220
444 Ga0207651_10472957 3300025960 Bacteria 1079
445 Ga0207668_10149909 3300025972 Bacteria 1804
446 Ga0207668_10532612 3300025972 Bacteria 1015
447 Ga0207640_10023587 3300025981 Bacteria 3700
448 Ga0207640_10213151 3300025981 Bacteria 1473
449 Ga0207640_10366858 3300025981 Bacteria 1162
450 Ga0207658_10029339 3300025986 Bacteria 3884
451 Ga0207677_10326456 3300026023 Bacteria 1277
452 Ga0207703_10630473 3300026035 Bacteria 1016
453 Ga0207639_10039065 3300026041 Bacteria 3534
454 Ga0207639_10350688 3300026041 Bacteria 1318
455 Ga0207639_10630024 3300026041 Bacteria 991
456 Ga0207678_10002002 3300026067 Bacteria 18551
457 Ga0207702_10016299 3300026078 Bacteria 6151
458 Ga0207702_10054569 3300026078 Bacteria 3387
459 Ga0207702_10363759 3300026078 Bacteria 1387
460 Ga0207702_10381692 3300026078 Bacteria 1355
461 Ga0207641_10183018 3300026088 Bacteria 1920
462 Ga0207641_10226137 3300026088 Bacteria 1737
463 Ga0207648_10105730 3300026089 Bacteria 2469
464 Ga0207676_10030082 3300026095 Bacteria 4072
465 Ga0207676_10034484 3300026095 Bacteria 3832
466 Ga0207676_10135625 3300026095 Bacteria 2099
467 Ga0207674_10007917 3300026116 Bacteria 12341
468 Ga0207674_10157222 3300026116 Bacteria 2228
469 Ga0207674_10195272 3300026116 Bacteria 1974
470 Ga0207698_10002093 3300026142 Bacteria 11776
471 Ga0207698_10004842 3300026142 Bacteria 8245
472 Ga0207698_10992278 3300026142 Bacteria 850
473 Ga0209281_1011677 3300027111 Bacteria 1957
474 Ga0209371_1005256 3300027312 Bacteria 5221
475 Ga0209282_1000521 3300027666 Bacteria 18596
476 Ga0209282_1001174 3300027666 Bacteria 14074
477 Ga0209282_1137457 3300027666 Bacteria 1199
478 Ga0207428_10303229 3300027907 Bacteria 1182
479 Ga0268266_10016386 3300028379 Bacteria 6337
480 Ga0268266_10222780 3300028379 Bacteria 1735
481 Ga0268265_10293161 3300028380 Bacteria 1461
482 Ga0268264_10222893 3300028381 Bacteria 1737
483 Ga0268264_11404748 3300028381 Bacteria 709
484 Ga0307515_10000152 3300028794 Bacteria 167305
485 Ga0307515_10014281 3300028794 Bacteria 14746
486 Ga0307512_10206815 3300030522 Bacteria 1051
487 Ga0316177_1192376 3300030731 Bacteria 3822
488 Ga0314311_1055507 3300030733 Bacteria 11059
489 Ga0316179_1038668 3300030734 Bacteria 3056
490 Ga0316178_1036717 3300030735 Bacteria 5475
491 Ga0316180_1138007 3300030736 Bacteria 1441
492 Ga0316183_1051137 3300030742 Bacteria 5822
493 Ga0316181_1003089 3300030744 Bacteria 973
494 Ga0316182_1122964 3300030745 Bacteria 4127
495 Ga0316182_1388324 3300030745 Bacteria 4148
496 Ga0265328_10097000 3300031239 Bacteria 1090
497 Ga0265325_10004238 3300031241 Bacteria 9105
498 Ga0265331_10098030 3300031250 Bacteria 1351
499 Ga0265327_10000028 3300031251 Bacteria 361066
500 Ga0265327_10000777 3300031251 Bacteria 49259
501 Ga0265327_10008172 3300031251 Bacteria 7854
502 Ga0265327_10036761 3300031251 Bacteria 2688
503 Ga0307513_10065904 3300031456 Bacteria 3809
504 Ga0307513_10090119 3300031456 Bacteria 3129
505 Ga0307408_100003858 3300031548 Bacteria 10198
506 Ga0307408_100111775 3300031548 Bacteria 2099
507 Ga0307408_100177221 3300031548 Bacteria 1706
508 Ga0307408_100332892 3300031548 Bacteria 1283
509 Ga0307408_100355467 3300031548 Bacteria 1244
510 Ga0307408_100444291 3300031548 Bacteria 1123
511 Ga0307408_100665219 3300031548 Bacteria 932
512 Ga0265313_10030042 3300031595 Bacteria 2803
513 Ga0307514_10062787 3300031649 Bacteria 2823
514 Ga0307514_10124915 3300031649 Bacteria 1785
515 Ga0307405_10007105 3300031731 Bacteria 5567
516 Ga0307405_10186499 3300031731 Bacteria 1494
517 Ga0307410_11059536 3300031852 Bacteria 701
518 Ga0307406_10002407 3300031901 Bacteria 10164
519 Ga0307406_10006868 3300031901 Bacteria 6300
520 Ga0307406_10634622 3300031901 Bacteria 885
521 Ga0307407_10200361 3300031903 Bacteria 1337
522 Ga0307412_10011637 3300031911 Bacteria 5101
523 Ga0307412_10029890 3300031911 Bacteria 3423
524 Ga0307412_10052063 3300031911 Bacteria 2709
525 Ga0307412_10081391 3300031911 Bacteria 2239
526 Ga0307412_10090438 3300031911 Bacteria 2139
527 Ga0307412_10544762 3300031911 Bacteria 973
528 Ga0307412_11012476 3300031911 Bacteria 734
529 Ga0307409_100494442 3300031995 Bacteria 1190
530 Ga0307416_100002355 3300032002 Bacteria 10811
531 Ga0307416_100248852 3300032002 Bacteria 1728
532 Ga0307416_100273917 3300032002 Bacteria 1659
533 Ga0307416_100839362 3300032002 Bacteria 1016
534 Ga0307414_10053714 3300032004 Bacteria 2811
535 Ga0307414_10272027 3300032004 Bacteria 1419
536 Ga0307414_10346528 3300032004 Bacteria 1273
537 Ga0307414_10353223 3300032004 Bacteria 1262
538 Ga0307414_10516729 3300032004 Bacteria 1059
539 Ga0307411_10126489 3300032005 Bacteria 1860
540 Ga0307411_10127142 3300032005 Bacteria 1855
541 Ga0307411_10154694 3300032005 Bacteria 1709
542 Ga0307411_10178818 3300032005 Bacteria 1608
543 Ga0307411_10331449 3300032005 Bacteria 1233
544 Ga0307411_10407642 3300032005 Bacteria 1125
545 Ga0307411_10477974 3300032005 Bacteria 1048
546 Ga0307415_100426498 3300032126 Bacteria 1140
547 Ga0307510_10031385 3300033180 Bacteria 6004
548 Ga0395899_0001942 3300037312 Bacteria 17020
549 Ga0395899_0037564 3300037312 Bacteria 3630
550 Ga0395900_0007000 3300037418 Bacteria 11682
551 Ga0395900_0031551 3300037418 Bacteria 5446
552 Ga0395900_0328009 3300037418 Bacteria 1509
553 Ga0395900_0426841 3300037418 Bacteria 1285
554 Ga0395898_0005430 3300037466 Bacteria 13766
555 Ga0395898_0023388 3300037466 Bacteria 6246
556 Ga0395898_0160759 3300037466 Bacteria 2148
557 Ga0395898_0284077 3300037466 Bacteria 1579
558 Ga0395905_0007138 3300037471 Bacteria 11170
559 Ga0395905_0022261 3300037471 Bacteria 5997
560 Ga0395905_0034921 3300037471 Bacteria 4720
561 Ga0395905_0134156 3300037471 Bacteria 2329
562 Ga0395905_0288704 3300037471 Bacteria 1527
563 Ga0395901_0053458 3300038443 Bacteria 4196
564 Ga0395901_0087292 3300038443 Bacteria 3261
565 Ga0395901_0089104 3300038443 Bacteria 3228
566 Ga0395901_0098619 3300038443 Bacteria 3063
567 Ga0395901_0126807 3300038443 Bacteria 2682
568 Ga0395901_0161306 3300038443 Bacteria 2355
569 Ga0395901_0241940 3300038443 Bacteria 1882
570 Ga0395901_0291445 3300038443 Bacteria 1694
571 Ga0400483_082990 3300039062 Bacteria 17925
572 Ga0436361_0042902 3300039447 Bacteria 14654
573 Ga0436361_0481133 3300039447 Bacteria 61506
574 Ga0439436_0040093 3300041404 Bacteria 1343
575 Ga0439439_0125455 3300041406 Bacteria 718
576 Ga0439466_0047929 3300041411 Bacteria 1407
577 Ga0439465_0011629 3300041413 Bacteria 2762
578 Ga0439465_0050689 3300041413 Bacteria 1358
579 Ga0451789_1335968 3300041443 Bacteria 888
580 Ga0451807_1518065 3300041486 Bacteria 1391
581 Ga0451841_0497166 3300041498 Bacteria 881
582 Ga0451849_0678049 3300041505 Bacteria 1012
583 Ga0451843_0558905 3300041509 Bacteria 962
584 Ga0451855_0724113 3300041511 Bacteria 1287
585 Ga0451853_1561911 3300041512 Bacteria 11386
586 Ga0439433_0045643 3300041999 Bacteria 1026
587 Ga0439442_007281 3300042002 Bacteria 2224
588 Ga0439445_0005785 3300042004 Bacteria 2826
589 Ga0439445_0064595 3300042004 Bacteria 1005
590 Ga0439432_018005 3300042006 Bacteria 2365
591 Ga0439432_077720 3300042006 Bacteria 1007
592 Ga0439449_0003797 3300042007 Bacteria 5846
593 Ga0439449_0027720 3300042007 Bacteria 2113
594 Ga0439449_0029793 3300042007 Bacteria 2033
595 Ga0439449_0055546 3300042007 Bacteria 1462
596 Ga0439449_0058086 3300042007 Bacteria 1428
597 Ga0439452_007125 3300042010 Bacteria 3445
598 Ga0439452_053252 3300042010 Bacteria 921
599 Ga0439457_039037 3300042014 Bacteria 1057
600 Ga0439462_0072097 3300042015 Bacteria 938
601 Ga0450911_000935 3300042115 Bacteria 7664
602 Ga0450921_001087 3300042123 Bacteria 1550
603 Ga0450921_007383 3300042123 Bacteria 873
604 Ga0450923_001056 3300042125 Bacteria 3472
605 Ga0450923_025537 3300042125 Bacteria 1178
606 Ga0450890_003439 3300042127 Bacteria 2102
607 Ga0450906_001534 3300042145 Bacteria 5047
608 Ga0450906_011587 3300042145 Bacteria 1646
609 Ga0450907_018413 3300042146 Bacteria 1169
610 Ga0450908_007977 3300042184 Bacteria 1986
611 Ga0450908_018068 3300042184 Bacteria 1249
612 Ga0450908_030656 3300042184 Bacteria 934
613 Ga0450918_000934 3300042531 Bacteria 6099
614 Ga0450918_021669 3300042531 Bacteria 1122
615 Ga0451577_0066420 3300042876 Bacteria 3217
616 Ga0466969_0152924 3300044656 Bacteria 1062
617 Ga0466965_0182478 3300044683 Bacteria 1107
618 Ga0453684_0516077 3300044712 Bacteria 1321
619 Ga0453684_0546791 3300044712 Bacteria 1276
620 Ga0466957_0189471 3300044842 Bacteria 1347
621 Ga0451576_0585814 3300045051 Bacteria 1172
622 Ga0466967_0443681 3300045976 Bacteria 1268
623 Ga0495627_003930 3300046453 Bacteria 6357
624 Ga0495627_013261 3300046453 Bacteria 2902
625 Ga0495603_0165527 3300046455 Bacteria 1282
626 Ga0495629_0352332 3300046459 Bacteria 1004
627 Ga0495638_0007637 3300046460 Bacteria 7732
628 Ga0495650_0015654 3300046471 Bacteria 3880
629 Ga0495582_0153466 3300046473 Bacteria 1308
630 Ga0495639_0003490 3300046475 Bacteria 6800
631 Ga0495607_0000252 3300046501 Bacteria 57555
632 Ga0495606_0173958 3300046507 Bacteria 1247
633 Ga0495606_0196526 3300046507 Bacteria 1152
634 Ga0495610_0080827 3300046512 Bacteria 1493
635 Ga0495610_0080849 3300046512 Bacteria 1493
636 Ga0495616_0000916 3300046513 Bacteria 21218
637 Ga0495616_0023039 3300046513 Bacteria 3356
638 Ga0495618_0286256 3300046514 Bacteria 1027
639 Ga0495620_0008895 3300046515 Bacteria 5367
640 Ga0495628_0380461 3300046516 Bacteria 1034
641 Ga0495630_0222885 3300046517 Bacteria 1440
642 Ga0495631_0000233 3300046518 Bacteria 38235
643 Ga0495631_0095683 3300046518 Bacteria 1278
644 Ga0495637_0008199 3300046520 Bacteria 5138
645 Ga0495637_0010611 3300046520 Bacteria 4449
646 Ga0495637_0140069 3300046520 Bacteria 918
647 Ga0495648_0137089 3300046524 Bacteria 1293
648 Ga0495663_0064363 3300046525 Bacteria 1157
649 Ga0495663_0095518 3300046525 Bacteria 973
650 Ga0495642_0100047 3300046528 Bacteria 1233
651 Ga0495654_0090347 3300046530 Bacteria 1422
652 Ga0495621_0016352 3300046539 Bacteria 2380
653 Ga0495621_0020533 3300046539 Bacteria 2169
654 Ga0495621_0042258 3300046539 Bacteria 1604
655 Ga0495621_0114909 3300046539 Bacteria 1035
656 Ga0495622_0014993 3300046557 Bacteria 3604
657 Ga0495633_0003443 3300046558 Bacteria 10531
658 Ga0495633_0060037 3300046558 Bacteria 1782
659 Ga0495633_0150745 3300046558 Bacteria 1074
660 Ga0495667_0235221 3300046559 Bacteria 1168
661 Ga0495656_0000108 3300046615 Bacteria 33050
662 Ga0495656_0003752 3300046615 Bacteria 5158
663 Ga0495656_0034326 3300046615 Bacteria 2076
664 Ga0495625_0000057 3300046660 Bacteria 181623
665 Ga0495625_0000637 3300046660 Bacteria 50416
666 Ga0495625_0098883 3300046660 Bacteria 2006
667 Ga0495625_0108633 3300046660 Bacteria 1898
668 Ga0495659_0084499 3300046664 Bacteria 1210
669 Ga0495661_0360397 3300046665 Bacteria 714
670 Ga0495588_0018926 3300046674 Bacteria 3366
671 Ga0495588_0039983 3300046674 Bacteria 2390
672 Ga0495647_0085866 3300046681 Bacteria 1283
673 Ga0495647_0133047 3300046681 Bacteria 1055
674 Ga0495670_0155104 3300046691 Bacteria 1201
675 Ga0495671_0001282 3300046692 Bacteria 17146
676 Ga0495671_0020509 3300046692 Bacteria 3482
677 Ga0495636_0116299 3300047318 Bacteria 1180
678 Ga0495676_0007868 3300047321 Bacteria 9777
679 Ga0495677_0028439 3300047445 Bacteria 2030
680 Ga0495681_0002764 3300047470 Bacteria 12417
681 Ga0495684_0583206 3300047471 Bacteria 757
682 Ga0495686_0001297 3300047472 Bacteria 28173
683 Ga0495593_0005660 3300047673 Bacteria 7376
684 Ga0495593_0078652 3300047673 Bacteria 1708
685 Ga0495614_0003894 3300048089 Bacteria 6704
686 Ga0495615_0062668 3300048090 Bacteria 985
687 Ga0496101_0002803 3300048904 Bacteria 10698
688 Ga0496101_0009650 3300048904 Bacteria 6349
689 Ga0496101_0455762 3300048904 Bacteria 1009
690 Ga0496102_0003435 3300048905 Bacteria 13428
691 Ga0496102_0004534 3300048905 Bacteria 11740
692 Ga0496102_0030993 3300048905 Bacteria 4791
693 Ga0496103_0013210 3300048906 Bacteria 4896
694 Ga0496103_0236151 3300048906 Bacteria 1176
695 Ga0496104_0006268 3300048907 Bacteria 10455
696 Ga0496104_0045610 3300048907 Bacteria 4124
697 Ga0496104_0137938 3300048907 Bacteria 2343
698 Ga0496105_0002236 3300048908 Bacteria 14021
699 Ga0496105_0381014 3300048908 Bacteria 1122
700 Ga0496106_0011540 3300048909 Bacteria 6531
701 Ga0496106_0165973 3300048909 Bacteria 1748
702 Ga0496106_0340134 3300048909 Bacteria 1205
703 Ga0496108_0170429 3300048911 Bacteria 1883
704 Ga0496108_0201964 3300048911 Bacteria 1725
705 Ga0496108_0397048 3300048911 Bacteria 1204
706 Ga0496110_0038468 3300048913 Bacteria 4163
707 Ga0496110_0231827 3300048913 Bacteria 1679
708 Ga0496111_0236653 3300048914 Bacteria 1356
709 Ga0496112_0712570 3300048915 Bacteria 931
710 Ga0496113_0159675 3300048916 Bacteria 1782
711 Ga0496114_0102391 3300048917 Bacteria 2446
712 Ga0496114_0179880 3300048917 Bacteria 1846
713 Ga0496116_0022162 3300048919 Bacteria 4769
714 Ga0496116_0026734 3300048919 Bacteria 4210
715 Ga0496116_0035145 3300048919 Bacteria 3524
716 Ga0496116_0145520 3300048919 Bacteria 1325
717 Ga0496116_0192403 3300048919 Bacteria 1078
718 Ga0496117_0000030 3300048920 Bacteria 389141
719 Ga0496117_0002266 3300048920 Bacteria 24847
720 Ga0496117_0016902 3300048920 Bacteria 6120
721 Ga0496117_0086801 3300048920 Bacteria 2031
722 Ga0496117_0116370 3300048920 Bacteria 1652
723 Ga0496117_0173575 3300048920 Bacteria 1248
724 Ga0496118_0003433 3300048921 Bacteria 19953
725 Ga0496118_0003748 3300048921 Bacteria 18793
726 Ga0496118_0011117 3300048921 Bacteria 8829
727 Ga0496118_0079459 3300048921 Bacteria 2314
728 Ga0496118_0101001 3300048921 Bacteria 1949
729 Ga0496119_0006742 3300048922 Bacteria 10543
730 Ga0496119_0024993 3300048922 Bacteria 4182
731 Ga0496120_0000148 3300048923 Bacteria 116605
732 Ga0496120_0247637 3300048923 Bacteria 838
733 Ga0496121_0008570 3300048924 Bacteria 11979
734 Ga0496121_0045401 3300048924 Bacteria 3776
735 Ga0496121_0066020 3300048924 Bacteria 2940
736 Ga0496121_0123171 3300048924 Bacteria 1954
737 Ga0496121_0180394 3300048924 Bacteria 1524
738 Ga0496121_0248526 3300048924 Bacteria 1235
739 Ga0496121_0305559 3300048924 Bacteria 1077
740 Ga0496122_0000050 3300048925 Bacteria 267874
741 Ga0496122_0000565 3300048925 Bacteria 75875
742 Ga0496122_0001461 3300048925 Bacteria 38115
743 Ga0496122_0005040 3300048925 Bacteria 15971
744 Ga0496122_0055769 3300048925 Bacteria 2953
745 Ga0496122_0068837 3300048925 Bacteria 2539
746 Ga0496122_0093644 3300048925 Bacteria 2037
747 Ga0496122_0113078 3300048925 Bacteria 1775
748 Ga0496122_0172882 3300048925 Bacteria 1299
749 Ga0496123_0000023 3300048926 Bacteria 346894
750 Ga0496123_0000179 3300048926 Bacteria 127833
751 Ga0496123_0000247 3300048926 Bacteria 109186
752 Ga0496123_0001600 3300048926 Bacteria 30686
753 Ga0496123_0029502 3300048926 Bacteria 4036
754 Ga0496123_0041436 3300048926 Bacteria 3192
755 Ga0496123_0043777 3300048926 Bacteria 3070
756 Ga0496123_0152383 3300048926 Bacteria 1245
757 Ga0496123_0230881 3300048926 Bacteria 926
758 Ga0496124_0000004 3300048927 Bacteria 976131
759 Ga0496124_0001021 3300048927 Bacteria 44387
760 Ga0496124_0002705 3300048927 Bacteria 22653
761 Ga0496124_0016756 3300048927 Bacteria 6949
762 Ga0496124_0021012 3300048927 Bacteria 6020
763 Ga0496124_0144906 3300048927 Bacteria 1870
764 Ga0496124_0180198 3300048927 Bacteria 1627
765 Ga0496124_0230138 3300048927 Bacteria 1386
766 Ga0496125_0000161 3300048928 Bacteria 150707
767 Ga0496125_0000171 3300048928 Bacteria 145308
768 Ga0496125_0027820 3300048928 Bacteria 5116
769 Ga0496125_0035255 3300048928 Bacteria 4394
770 Ga0496125_0042236 3300048928 Bacteria 3886
771 Ga0496125_0094490 3300048928 Bacteria 2227
772 Ga0496125_0095746 3300048928 Bacteria 2207
773 Ga0496125_0116994 3300048928 Bacteria 1913
774 Ga0496125_0205763 3300048928 Bacteria 1283
775 Ga0496125_0226980 3300048928 Bacteria 1198
776 Ga0496125_0254557 3300048928 Bacteria 1105
777 Ga0496125_0292768 3300048928 Bacteria 1001
778 Ga0496126_0027931 3300048929 Bacteria 5381
779 Ga0501031_0013513 3300049568 Bacteria 5321
780 Ga0501032_0003246 3300049569 Bacteria 12503
781 Ga0501033_0000059 3300049570 Bacteria 105311
782 Ga0501033_0001825 3300049570 Bacteria 18567
783 Ga0501034_0078279 3300049571 Bacteria 3311
784 Ga0501034_0092587 3300049571 Bacteria 3019
785 Ga0501034_0345391 3300049571 Bacteria 1417
786 Ga0501036_0008122 3300049572 Bacteria 8600
787 Ga0501037_0002561 3300049573 Bacteria 13135
788 Ga0501037_0009063 3300049573 Bacteria 7293
789 Ga0501037_0114231 3300049573 Bacteria 1944
790 Ga0501037_0414562 3300049573 Bacteria 922
791 Ga0501037_0456101 3300049573 Bacteria 871
792 Ga0501038_0073454 3300049574 Bacteria 2896
793 Ga0501038_0605245 3300049574 Bacteria 829
794 Ga0501043_0000090 3300049579 Bacteria 81336
795 Ga0501043_0000828 3300049579 Bacteria 27461
796 Ga0501043_0134025 3300049579 Bacteria 1941
797 Ga0501043_0312175 3300049579 Bacteria 1200
798 Ga0501046_0000126 3300049580 Bacteria 81334
799 Ga0501046_0033515 3300049580 Bacteria 4148
800 Ga0501047_0000160 3300049581 Bacteria 81946
801 Ga0501047_0076941 3300049581 Bacteria 3211
802 Ga0501048_0000040 3300049582 Bacteria 63031
803 Ga0501249_009632 3300049679 Bacteria 2010
804 Ga0501252_019446 3300049682 Bacteria 877
805 Ga0501225_0007904 3300049705 Bacteria 3069
806 Ga0501262_000028 3300049759 Bacteria 19106
807 Ga0501262_000393 3300049759 Bacteria 5317
808 Ga0501266_030019 3300049763 Bacteria 773
809 Ga0501035_0000213 3300049822 Bacteria 69670
810 Ga0501035_0002403 3300049822 Bacteria 18351
811 Ga0501035_0169553 3300049822 Bacteria 1886
812 Ga0501035_0304843 3300049822 Bacteria 1341
813 Ga0501035_0395444 3300049822 Bacteria 1150
814 Ga0501044_0000045 3300049823 Bacteria 148353
815 Ga0501044_0009438 3300049823 Bacteria 10627
816 Ga0501044_0198289 3300049823 Bacteria 1966
817 Ga0501045_0035981 3300049824 Bacteria 3595
818 nmdc:mga03683_128261_c1 3300050489 Bacteria 1133
819 nmdc:mga03683_136111_c1 3300050489 Bacteria 1102
820 nmdc:mga03683_205984_c1 3300050489 Bacteria 904
821 nmdc:mga03683_26366_c1 3300050489 Bacteria 2292
822 nmdc:mga03683_34001_c1 3300050489 Bacteria 2061
823 nmdc:mga03683_41053_c1 3300050489 Bacteria 1900
824 nmdc:mga03683_78960_c1 3300050489 Bacteria 1418
825 nmdc:mga03n38_164100_c1 3300050490 Bacteria 1127
826 nmdc:mga03n38_21477_c1 3300050490 Bacteria 2598
827 nmdc:mga00v17_171779_c1 3300050491 Bacteria 1398
828 nmdc:mga00v17_213293_c1 3300050491 Bacteria 1249
829 nmdc:mga00v17_55892_c1 3300050491 Bacteria 2412
830 nmdc:mga00v17_5989_c1 3300050491 Bacteria 6433
831 nmdc:mga00v17_700_c1 3300050491 Bacteria 18378
832 nmdc:mga0yw44_185856_c1 3300050492 Bacteria 1369
833 nmdc:mga0yw44_4974_c1 3300050492 Bacteria 6201
834 nmdc:mga0yw44_76476_c1 3300050492 Bacteria 2090
835 nmdc:mga0k408_140873_c1 3300050493 Bacteria 1435
836 nmdc:mga0k408_264627_c1 3300050493 Bacteria 1027
837 nmdc:mga0k408_29093_c1 3300050493 Bacteria 3143
838 nmdc:mga0k408_78681_c1 3300050493 Bacteria 1929
839 nmdc:mga06z11_1446_c1 3300050494 Bacteria 8826
840 nmdc:mga07m45_1027_c1 3300050496 Bacteria 12374
841 nmdc:mga07m45_278739_c1 3300050496 Bacteria 973
842 nmdc:mga07m45_3652_c1 3300050496 Bacteria 7431
843 nmdc:mga07m45_59_c1 3300050496 Bacteria 45010
844 nmdc:mga07m45_8066_c1 3300050496 Bacteria 5399
845 nmdc:mga08x19_447026_c1 3300050514 Bacteria 909
846 nmdc:mga0sz30_13103_c1 3300050516 Bacteria 3240
847 nmdc:mga0sz30_29872_c1 3300050516 Bacteria 2249
848 nmdc:mga0sz30_5751_c1 3300050516 Bacteria 4565
849 Ga0500643_009198 3300053087 Bacteria 3796
850 Ga0500651_0000029 3300053093 Bacteria 113528
851 Ga0500651_0157988 3300053093 Bacteria 1357
852 Ga0500641_0099616 3300053096 Bacteria 1246
853 Ga0500556_0000102 3300053104 Bacteria 76549
854 Ga0500560_000085 3300053107 Bacteria 9184
855 Ga0500571_000896 3300053110 Bacteria 13015
856 Ga0500572_094070 3300053111 Bacteria 952
857 Ga0500592_025006 3300053116 Bacteria 963
858 Ga0500593_000625 3300053117 Bacteria 13599
859 Ga0500593_109834 3300053117 Bacteria 1135
860 Ga0500594_0003141 3300053118 Bacteria 3611
861 Ga0500594_0014303 3300053118 Bacteria 1898
862 Ga0500608_002231 3300053122 Bacteria 6993
863 Ga0500655_014612 3300053133 Bacteria 1437
864 Ga0500658_0000243 3300053134 Bacteria 25613
865 Ga0500658_0000358 3300053134 Bacteria 20187
866 Ga0500658_0004281 3300053134 Bacteria 5348
867 Ga0500559_0000021 3300053136 Bacteria 129980
868 Ga0500559_0070922 3300053136 Bacteria 1568
869 Ga0500559_0084981 3300053136 Bacteria 1443
870 Ga0500559_0134986 3300053136 Bacteria 1153
871 Ga0500561_0000067 3300053137 Bacteria 20534
872 Ga0500564_037142 3300053138 Bacteria 2246
873 Ga0500568_0004013 3300053139 Bacteria 7983
874 Ga0500573_0216890 3300053140 Bacteria 1006
875 Ga0500574_000803 3300053141 Bacteria 4234
876 Ga0500574_039051 3300053141 Bacteria 1316
877 Ga0500577_0025912 3300053142 Bacteria 1990
878 Ga0500616_0039096 3300053153 Bacteria 2559
879 Ga0500624_000351 3300053157 Bacteria 15016
880 Ga0500627_0000393 3300053158 Bacteria 11732
881 Ga0500627_0008574 3300053158 Bacteria 3640
882 Ga0500633_0078818 3300053160 Bacteria 1189
883 Ga0500634_0054964 3300053161 Bacteria 2132
884 Ga0500634_0117040 3300053161 Bacteria 1304
885 Ga0500634_0167315 3300053161 Bacteria 1006
886 Ga0500636_0000012 3300053177 Bacteria 132207
887 Ga0500645_030395 3300053730 Bacteria 1626
888 Ga0500645_043394 3300053730 Bacteria 1324
889 Ga0500596_009403 3300053735 Bacteria 1526
890 Ga0587090_000032 3300059510 Bacteria 7356
891 Ga0587091_001375 3300059511 Bacteria 2609
892 Ga0587067_000808 3300059640 Bacteria 3050
893 Ga0587072_000287 3300059643 Bacteria 4707
894 2512035855 2511231221 Bacteria 6846400
895 2512532045 2512047086 Bacteria 6850303
896 2513230249 2513020051 Bacteria 6053213
897 2513574137 2513237084 Bacteria 7231967
898 2513696050 2513237101 Bacteria 7952346
899 2514000133 2513237159 Bacteria 6810126
900 2537873135 2537561587 Bacteria 5425293
901 2554244482 2554235003 Bacteria 5877155
902 2559297673 2558860242 Bacteria 5568029
903 2566035776 2565956521 Bacteria 4468993
904 2599603738 2599185210 Bacteria 5624189
905 2599622683 2599185214 Bacteria 8209958
906 2599623988 2599185214 Bacteria 8209958
907 2599671162 2599185226 Bacteria 8233575
908 2599671999 2599185226 Bacteria 8233575
909 2599679801 2599185227 Bacteria 8246414
910 2599681919 2599185227 Bacteria 8246414
911 2599691817 2599185229 Bacteria 8216126
912 2599693932 2599185229 Bacteria 8216126
913 2601612467 2600255279 Bacteria 5605316
914 2601749008 2600255308 Bacteria 5611129
915 2643867529 2643221570 Bacteria 5103772
916 2643917498 2643221582 Bacteria 5804683
917 2643990452 2643221596 Bacteria 5006805
918 2644058590 2643221609 Bacteria 6756331
919 2644070794 2643221611 Bacteria 6820941
920 2644295029 2643221652 Bacteria 5140275
921 2644328753 2643221658 Bacteria 6064537
922 2644398078 2643221672 Bacteria 6322190
923 2644413864 2643221674 Bacteria 3919126
924 2644467422 2643221683 Bacteria 5749203
925 2644469216 2643221683 Bacteria 5749203
926 2644522672 2643221693 Bacteria 5513853
927 2671113082 2667528174 Bacteria 6435400
928 2719667018 2718217997 Bacteria 6740740
929 2720493438 2718218199 Bacteria 6740745
930 2723846283 2721755755 Bacteria 8322773
931 2738718584 2738541277 Bacteria 7458140
932 2738722098 2738541277 Bacteria 7458140
933 2738881186 2738541307 Bacteria 8606193
934 2738884710 2738541307 Bacteria 8606193
935 2739244113 2738543012 Bacteria 7115078
936 2739252449 2738543013 Bacteria 5618633
937 2739252603 2738543013 Bacteria 5618633
938 2739280602 2738543019 Bacteria 7459457
939 2739282462 2738543019 Bacteria 7459457
940 2739610908 2739367655 Bacteria 4051151
941 2793297141 2791355256 Bacteria 6798008
942 2793337333 2791355262 Bacteria 6774204
943 2793352243 2791355265 Bacteria 6539969
944 2805927572 2802429605 Bacteria 6875453
945 2805936046 2802429606 Bacteria 6346811
946 2806049026 2802429633 Bacteria 7341974
947 2806065806 2802429636 Bacteria 7597525
948 2806077302 2802429637 Bacteria 7067217
949 2808989184 2808606387 Bacteria 5697198
950 2816472439 2816332133 Bacteria 7249298
951 2819557720 2818991439 Bacteria 6907412
952 2819596435 2818991446 Bacteria 7757362
953 2819599976 2818991446 Bacteria 7757362
954 2828306055 2828305725 Bacteria 4916900
955 2831267148 2831265667 Bacteria 7184833
956 2831270230 2831265667 Bacteria 7184833
957 2838031603 2838029111 Bacteria 6603031
958 2838056233 2838054893 Bacteria 7451788
959 2838059963 2838054893 Bacteria 7451788
960 2838679893 2838675328 Bacteria 4909118
961 2838717690 2838714209 Bacteria 5525906
962 2838724464 2838719591 Bacteria 5523910
963 2838729594 2838724970 Bacteria 4908691
964 2841850033 2841846520 Bacteria 5345850
965 2841861182 2841859092 Bacteria 5436171
966 2841868056 2841864319 Bacteria 6742987
967 2842128505 2842124991 Bacteria 5346824
968 2842134575 2842130223 Bacteria 4909145
969 2842156593 2842152218 Bacteria 4908957
970 2842173935 2842170452 Bacteria 5525737
971 2842180214 2842175837 Bacteria 4908771
972 2842192213 2842187318 Bacteria 5524014
973 2842197067 2842192696 Bacteria 6147454
974 2842206467 2842205361 Bacteria 6340321
975 2842216507 2842211629 Bacteria 5523832
976 2842229249 2842224351 Bacteria 5524473
977 2842279924 2842278818 Bacteria 6340002
978 2842287553 2842285085 Bacteria 6011953
979 2842345126 2842341865 Bacteria 7003929
980 2842369965 2842363717 Bacteria 6844742
981 2842398401 2842395702 Bacteria 6780583
982 2842404918 2842402390 Bacteria 6681310
983 2842411500 2842409023 Bacteria 6687331
984 2842418049 2842415677 Bacteria 6596907
985 2842478335 2842475841 Bacteria 6603183
986 2842505719 2842502639 Bacteria 6604161
987 2842518551 2842515876 Bacteria 5436280
988 2842523679 2842521101 Bacteria 6569494
989 2842680442 2842677519 Bacteria 5615038
990 2842682401 2842677519 Bacteria 5615038
991 2842736041 2842733646 Bacteria 5716726
992 2842748272 2842747753 Bacteria 5578255
993 2857547402 2857542790 Bacteria 5326616
994 2857580357 2857576091 Bacteria 5465855
995 2869252205 2869249662 Bacteria 6868783
996 2869270921 2869264136 Bacteria 6880765
997 2871463899 2871459585 Bacteria 6866887
998 2874132027 2874131515 Bacteria 6820270
999 2874610752 2874604998 Bacteria 7834745
1000 2876811676 2876808645 Bacteria 8824342
1001 2879118834 2879110137 Bacteria 8907982
1002 2881929425 2881927736 Bacteria 3993927
1003 2885199570 2885198086 Bacteria 7212419
1004 2885204827 2885198086 Bacteria 7212419
1005 2885213157 2885211737 Bacteria 7212420
1006 2885218486 2885211737 Bacteria 7212420
1007 2887380275 2887375801 Bacteria 5334027
1008 2889039269 2889033259 Bacteria 9099371
1009 2891374330 2891373044 Bacteria 5202277
1010 2899793088 2899792073 Bacteria 4926588
1011 2899849710 2899845264 Bacteria 5672268
1012 2899926077 2899924645 Bacteria 7487985
1013 2899931145 2899924645 Bacteria 7487985
1014 2903752807 2903748898 Bacteria 9972761
1015 2904452285 2904449895 Bacteria 6927402
1016 2904454815 2904449895 Bacteria 6927402
1017 2904458569 2904456579 Bacteria 6819253
1018 2904462612 2904456579 Bacteria 6819253
1019 2904481386 2904479285 Bacteria 5073931
1020 2904546798 2904541872 Bacteria 8915136
1021 2904548652 2904541872 Bacteria 8915136
1022 2906368560 2906363423 Bacteria 6856682
1023 2906372527 2906370794 Bacteria 6881062
1024 2906396023 2906393657 Bacteria 6790866
1025 2917705653 2917699015 Bacteria 7043791
1026 2919117970 2919114240 Bacteria 5700270
1027 2919412869 2919408235 Bacteria 6149349
1028 2919464055 2919462493 Bacteria 5817112
1029 2919466338 2919462493 Bacteria 5817112
1030 2922362086 2922361189 Bacteria 7436256
1031 2923561822 2923556063 Bacteria 6793593
1032 2924717677 2924710171 Bacteria 6752351
1033 2926757739 2926754445 Bacteria 5964435
1034 2926764636 2926760298 Bacteria 5505990
1035 2928038077 2928037797 Bacteria 7273642
1036 2928041527 2928037797 Bacteria 7273642
1037 2928046317 2928044640 Bacteria 7271509
1038 2928049091 2928044640 Bacteria 7271509
1039 2928052299 2928051484 Bacteria 7773759
1040 2928054012 2928051484 Bacteria 7773759
1041 2928065030 2928064002 Bacteria 7419480
1042 2928065765 2928064002 Bacteria 7419480
1043 2928077433 2928070936 Bacteria 8062541
1044 2928077909 2928070936 Bacteria 8062541
1045 2928087369 2928084124 Bacteria 7159212
1046 2928088694 2928084124 Bacteria 7159212
1047 2928115455 2928115317 Bacteria 6477646
1048 2929164271 2929160207 Bacteria 9075316
1049 2929164682 2929160207 Bacteria 9075316
1050 2929522213 2929520902 Bacteria 6765052
1051 2929523851 2929520902 Bacteria 6765052
1052 2932422769 2932422444 Bacteria 4678430
1053 2933010354 2933006813 Bacteria 4912075
1054 2933014177 2933011516 Bacteria 5439334
1055 2933597223 2933594066 Bacteria 5594265
1056 2945910707 2945909444 Bacteria 7065066
1057 2945913031 2945909444 Bacteria 7065066
1058 2945946603 2945945610 Bacteria 5951079
1059 2945946867 2945945610 Bacteria 5951079
1060 2945976326 2945972063 Bacteria 6086495
1061 2945976582 2945972063 Bacteria 6086495
1062 2945984684 2945984333 Bacteria 7358892
1063 2945987120 2945984333 Bacteria 7358892
1064 2954768001 2954767861 Bacteria 5535784
1065 2954771619 2954767861 Bacteria 5535784
1066 2965043416 2965040258 Bacteria 6855979
1067 2965093081 2965089291 Bacteria 6866420
1068 2977954330 2977950692 Bacteria 6893264
1069 2979090253 2979089926 Bacteria 5670289
1070 2979095783 2979095461 Bacteria 5669583
1071 2979102760 2979100975 Bacteria 5423623
1072 2984509351 2984509177 Bacteria 5274802
1073 2984519949 2984518228 Bacteria 5277463
1074 2984537681 2984537506 Bacteria 5277481
1075 2984604429 2984601300 Bacteria 5455244
1076 3004200819 3004195979 Bacteria 6776956
1077 650844118 650716007 Bacteria 5573770
1078 8003573306 8003570095 Bacteria 5747666
1079 8004318478 8004312739 Bacteria 7444653
1080 8004363284 8004361976 Bacteria 6858373
1081 8005294753 8005289223 Bacteria 6634003
1082 8005486369 8005484373 Bacteria 6297373
1083 8005647488 8005645114 Bacteria 6950293
1084 8005700975 8005695170 Bacteria 6912330
1085 8006964664 8006964411 Bacteria 8966052
1086 8006991986 8006984368 Bacteria 9651211
1087 8006999919 8006994254 Bacteria 8309700
1088 8018178360 8018176218 Bacteria 6896178
1089 8024505167 8024501048 Bacteria 6427847
1090 8056387600 8056382006 Bacteria 6408074
1091 8056680335 8056673599 Bacteria 7871253
1092 Ga0496121_0024154
1093 JGI24739J22299_10017252
1094 JGI25156J39149_1000197
1095 JGI25162J39368_1000069
1096 JGI25154J39366_1001559
1097 JGI25158J39367_1002784
1098 JGI25157J39369_1000239
1099 JGI25152J39213_1013570
1100 JGI25152J39213_1020352
1101 JGI25150J39212_1012541
1102 JGI25159J45721_1030586
1103 JGI25151J46595_10000912
1104 JGI25151J46595_10001106
1105 JGI25151J46595_10002242
1106 JGI25151J46595_10017903
1107 JGI25151J46595_10056756
1108 JGI25151J46595_10076514
1109 JGI25165J46597_1000018
1110 JGI25153J46596_10016995
1111 JGI25153J46596_10033586
1112 rootH1_10031181
1113 Ga0006562J51391_1048428
1114 Ga0006562J51391_1089020
1115 JGI25404J52841_10033220
1116 Ga0055535_1000625
1117 Ga0055542_1000087
1118 Ga0055529_1000904
1119 Ga0055526_1004955
1120 Ga0055526_1037798
1121 Ga0055526_1041428
1122 Ga0055537_1000544
1123 Ga0055537_1001201
1124 Ga0055537_1001648
1125 Ga0055537_1007410
1126 Ga0055524_1000973
1127 Ga0055524_1010583
1128 Ga0055524_1017548
1129 Ga0055524_1042099
1130 Ga0055536_1002305
1131 Ga0055536_1012752
1132 Ga0055534_1000273
1133 Ga0055534_1000470
1134 Ga0055534_1000494
1135 Ga0055534_1003656
1136 Ga0055528_1003260
1137 Ga0055528_1005515
1138 Ga0055528_1005551
1139 Ga0055528_1017013
1140 Ga0055530_10000492
1141 Ga0055530_10010401
1142 Ga0055530_10044594
1143 Ga0055540_1001711
1144 Ga0055540_1002128
1145 Ga0055540_1006032
1146 Ga0055540_1014097
1147 Ga0055531_10000397
1148 Ga0055531_10000729
1149 Ga0055531_10001138
1150 Ga0055531_10001242
1151 Ga0055531_10001938
1152 Ga0058692_1005109
1153 Ga0055543_1011426
1154 Ga0065165_1001097
1155 Ga0065165_1002200
1156 Ga0065165_1004159
1157 Ga0065165_1039354
1158 Ga0065165_1054412
1159 Ga0065714_10006671
1160 Ga0065704_10018558
1161 Ga0070658_10017213
1162 Ga0070658_10302886
1163 Ga0070658_10816950
1164 Ga0070676_10197030
1165 Ga0070683_100001096
1166 Ga0070670_100060064
1167 Ga0070670_100439201
1168 Ga0068869_100134442
1169 Ga0070680_100077659
1170 Ga0070680_100485840
1171 Ga0068868_100048109
1172 Ga0070660_100006803
1173 Ga0070660_100193642
1174 Ga0070661_100001103
1175 Ga0070661_100119325
1176 Ga0070661_100439330
1177 Ga0070692_10297828
1178 Ga0070669_100126607
1179 Ga0070669_100493304
1180 Ga0070671_100001731
1181 Ga0070671_100007662
1182 Ga0070674_100322706
1183 Ga0070673_100002957
1184 Ga0070659_100007948
1185 Ga0070659_100017622
1186 Ga0070659_100217087
1187 Ga0070667_100025826
1188 Ga0070709_10391818
1189 Ga0070678_100331899
1190 Ga0070678_100579375
1191 Ga0070662_100019503
1192 Ga0070662_100400495
1193 Ga0070662_100741545
1194 Ga0068867_100302199
1195 Ga0070679_100026744
1196 Ga0070679_100054342
1197 Ga0070679_100352608
1198 Ga0070679_100731008
1199 Ga0070679_100949201
1200 Ga0070684_100004228
1201 Ga0068853_100005290
1202 Ga0068853_100025317
1203 Ga0068853_100043331
1204 Ga0068853_100091642
1205 Ga0068853_100177581
1206 Ga0070672_100011366
1207 Ga0070672_100300081
1208 Ga0070672_100463449
1209 Ga0070693_100005182
1210 Ga0070693_100037504
1211 Ga0070665_100034493
1212 Ga0070665_100494019
1213 Ga0068855_100008931
1214 Ga0068855_100023191
1215 Ga0068855_100232591
1216 Ga0070664_100003886
1217 Ga0070664_100008256
1218 Ga0070664_100035223
1219 Ga0068857_100150767
1220 Ga0068857_100650792
1221 Ga0068854_100002503
1222 Ga0068856_100011574
1223 Ga0068856_100073839
1224 Ga0068856_100189093
1225 Ga0068856_100580147
1226 Ga0068852_100002132
1227 Ga0068852_100008877
1228 Ga0068852_100785744
1229 Ga0068859_101566843
1230 Ga0068864_100041516
1231 Ga0068864_100098816
1232 Ga0068864_100563475
1233 Ga0068864_101135215
1234 Ga0068866_10428922
1235 Ga0068851_10001036
1236 Ga0068851_10013404
1237 Ga0068863_100387960
1238 Ga0068860_100498273
1239 Ga0081540_1000001
1240 Ga0081539_10011653
1241 Ga0075365_10119863
1242 Ga0075365_10514958
1243 Ga0075368_10007452
1244 Ga0075368_10009279
1245 Ga0075363_100149641
1246 Ga0075363_100194871
1247 Ga0075364_10043751
1248 Ga0075364_10121371
1249 Ga0075364_10132498
1250 Ga0075364_10245132
1251 Ga0075364_10454599
1252 Ga0075364_10566178
1253 Ga0075432_10011542
1254 Ga0075432_10097420
1255 Ga0075362_10008375
1256 Ga0075362_10015340
1257 Ga0075362_10068895
1258 Ga0075362_10125015
1259 Ga0075362_10131574
1260 Ga0075367_10020216
1261 Ga0075367_10228947
1262 Ga0075367_10378842
1263 Ga0075369_10010312
1264 Ga0075366_10031124
1265 Ga0075366_10148815
1266 Ga0097621_100146079
1267 Ga0097621_100445735
1268 Ga0097621_100697246
1269 Ga0075370_10001140
1270 Ga0075370_10001936
1271 Ga0075370_10014295
1272 Ga0075370_10031122
1273 Ga0075370_10035802
1274 Ga0068871_100230495
1275 Ga0068871_100596188
1276 Ga0079104_1005275
1277 Ga0099826_10000053
1278 Ga0099826_10000135
1279 Ga0099826_10000408
1280 Ga0099826_10009692
1281 Ga0099826_10063502
1282 Ga0105244_10061912
1283 Ga0105240_10010218
1284 Ga0105240_10027927
1285 Ga0105245_10421667
1286 Ga0105243_10004536
1287 Ga0105243_10006125
1288 Ga0105243_10728975
1289 Ga0105241_10197717
1290 Ga0105242_10116195
1291 Ga0105242_10182665
1292 Ga0105248_10022313
1293 Ga0105248_10405449
1294 Ga0105237_10197175
1295 Ga0105237_10214553
1296 Ga0105237_10582625
1297 Ga0105238_10010711
1298 Ga0105238_10051831
1299 Ga0105238_10083755
1300 Ga0105239_11155729
1301 Ga0105239_11158671
1302 Ga0105246_10437945
1303 Ga0157373_10003196
1304 Ga0157373_10037357
1305 Ga0157371_10000005
1306 Ga0157371_10269629
1307 Ga0157370_10000036
1308 Ga0157370_10006235
1309 Ga0157370_10012371
1310 Ga0157370_10079644
1311 Ga0157369_10008755
1312 Ga0157369_10148403
1313 Ga0157369_10371569
1314 Ga0157374_10106980
1315 Ga0163162_10165664
1316 Ga0163162_10240918
1317 Ga0163162_10537508
1318 Ga0163162_10831348
1319 Ga0157372_10034372
1320 Ga0157372_10149374
1321 Ga0157375_10228180
1322 Ga0157375_10342998
1323 Ga0157375_10441668
1324 Ga0157375_10986304
1325 Ga0163163_10274774
1326 Ga0182008_10001904
1327 Ga0182008_10004300
1328 Ga0182008_10004309
1329 Ga0182008_10018378
1330 Ga0182008_10026105
1331 Ga0182008_10033309
1332 Ga0157379_10196452
1333 Ga0157376_10100256
1334 Ga0157376_10385972
1335 Ga0182006_1038793
1336 Ga0182006_1055979
1337 Ga0182006_1098533
1338 Ga0182006_1113178
1339 Ga0182007_10000278
1340 Ga0182007_10006630
1341 Ga0182007_10007196
1342 Ga0182007_10163702
1343 Ga0182005_1029422
1344 Ga0182005_1057456
1345 Ga0183362_10001
1346 Ga0183362_10003
1347 Ga0163161_10000598
1348 Ga0163161_10002565
1349 Ga0163161_10008944
1350 Ga0163161_10010182
1351 Ga0163161_10082600
1352 Ga0163161_10088707
1353 Ga0163161_10131056
1354 Ga0163161_10219816
1355 Ga0163161_10263133
1356 Ga0213872_10000161
1357 Ga0213872_10001576
1358 Ga0209435_100089
1359 Ga0209436_104844
1360 Ga0209672_101712
1361 Ga0209672_103043
1362 Ga0209672_110906
1363 Ga0209147_100510
1364 Ga0209147_100652
1365 Ga0209437_100022
1366 Ga0209258_100009
1367 Ga0209258_100199
1368 Ga0209258_104563
1369 Ga0207425_1006727
1370 Ga0207425_1054598
1371 Ga0209646_1000293
1372 Ga0209026_1000364
1373 Ga0209148_1000007
1374 Ga0209148_1000179
1375 Ga0209759_1000508
1376 Ga0209129_1000071
1377 Ga0209129_1000249
1378 Ga0209129_1002464
1379 Ga0209129_1003880
1380 Ga0209129_1011174
1381 Ga0209233_1000031
1382 Ga0209565_1000083
1383 Ga0209565_1000138
1384 Ga0209565_1000225
1385 Ga0209565_1001961
1386 Ga0209565_1020057
1387 Ga0209455_1005323
1388 Ga0209673_1000064
1389 Ga0209673_1000178
1390 Ga0209673_1000329
1391 Ga0209673_1000534
1392 Ga0209673_1000546
1393 Ga0209673_1001554
1394 Ga0209673_1006108
1395 Ga0209673_1011314
1396 Ga0209673_1021401
1397 Ga0209673_1067931
1398 Ga0209130_1000489
1399 Ga0209130_1000773
1400 Ga0209130_1000889
1401 Ga0209130_1002267
1402 Ga0209130_1010307
1403 Ga0209675_1000036
1404 Ga0209675_1000081
1405 Ga0209675_1000458
1406 Ga0209675_1000573
1407 Ga0209675_1000726
1408 Ga0209675_1001085
1409 Ga0209675_1004179
1410 Ga0209675_1032892
1411 Ga0209676_1000004
1412 Ga0209676_1000005
1413 Ga0209676_1000162
1414 Ga0209676_1000757
1415 Ga0209676_1001007
1416 Ga0209676_1007094
1417 Ga0209676_1018153
1418 Ga0209676_1028115
1419 Ga0209676_1065877
1420 Ga0209025_1000121
1421 Ga0209025_1000168
1422 Ga0209025_1000220
1423 Ga0209025_1000544
1424 Ga0209025_1001108
1425 Ga0209025_1001466
1426 Ga0209025_1008041
1427 Ga0209025_1021707
1428 Ga0209025_1022779
1429 Ga0209025_1022812
1430 Ga0209025_1062080
1431 Ga0209025_1098582
1432 Ga0209564_1000239
1433 Ga0209564_1000287
1434 Ga0209564_1002099
1435 Ga0209564_1004174
1436 Ga0209564_1020032
1437 Ga0209758_1000027
1438 Ga0209758_1002782
1439 Ga0209758_1005551
1440 Ga0209758_1012650
1441 Ga0209758_1012867
1442 Ga0209050_1000002
1443 Ga0209050_1000007
1444 Ga0209050_1001089
1445 Ga0209050_1010883
1446 Ga0209050_1011437
1447 Ga0209050_1022072
1448 Ga0209050_1027972
1449 Ga0209256_1000081
1450 Ga0209256_1000470
1451 Ga0209256_1001206
1452 Ga0209256_1004326
1453 Ga0209256_1007583
1454 Ga0209256_1023119
1455 Ga0207426_1000027
1456 Ga0207426_1000095
1457 Ga0207426_1000176
1458 Ga0209051_1000002
1459 Ga0209051_1000009
1460 Ga0209051_1000113
1461 Ga0209051_1000274
1462 Ga0209051_1000347
1463 Ga0209051_1000367
1464 Ga0209051_1000373
1465 Ga0209051_1000375
1466 Ga0209051_1000553
1467 Ga0209051_1000583
1468 Ga0209051_1010791
1469 Ga0209257_1000002
1470 Ga0209257_1000011
1471 Ga0209257_1000012
1472 Ga0209257_1000286
1473 Ga0209257_1000449
1474 Ga0209257_1000866
1475 Ga0209257_1006354
1476 Ga0209257_1008169
1477 Ga0209257_1015259
1478 Ga0207656_10000704
1479 Ga0207656_10014809
1480 Ga0207656_10063725
1481 Ga0207655_1002072
1482 Ga0207682_10053981
1483 Ga0207688_10164791
1484 Ga0207680_10363756
1485 Ga0207645_10375932
1486 Ga0207643_10069814
1487 Ga0207705_10246089
1488 Ga0207705_10251493
1489 Ga0207707_10254859
1490 Ga0207695_10067576
1491 Ga0207695_10103057
1492 Ga0207695_10454631
1493 Ga0207671_10112041
1494 Ga0207671_10128694
1495 Ga0207671_10741066
1496 Ga0207657_10012553
1497 Ga0207657_10353658
1498 Ga0207649_10038780
1499 Ga0207649_10094843
1500 Ga0207652_10150007
1501 Ga0207652_10228451
1502 Ga0207652_10599279
1503 Ga0207694_10014406
1504 Ga0207694_10057945
1505 Ga0207650_10008936
1506 Ga0207650_10227158
1507 Ga0207659_10173289
1508 Ga0207687_10186622
1509 Ga0207687_10324063
1510 Ga0207687_10821508
1511 Ga0207644_10040844
1512 Ga0207706_10075641
1513 Ga0207706_10306336
1514 Ga0207686_10143107
1515 Ga0207709_10000205
1516 Ga0207709_10000775
1517 Ga0207709_10001443
1518 Ga0207709_10026435
1519 Ga0207670_10115274
1520 Ga0207669_10305795
1521 Ga0207669_10373259
1522 Ga0207704_10737480
1523 Ga0207691_10003117
1524 Ga0207691_10099686
1525 Ga0207691_10183259
1526 Ga0207691_10213107
1527 Ga0207689_10092172
1528 Ga0207661_10248391
1529 Ga0207679_10004885
1530 Ga0207679_10069827
1531 Ga0207667_10039072
1532 Ga0207667_10064795
1533 Ga0207667_10281405
1534 Ga0207651_10001658
1535 Ga0207651_10472957
1536 Ga0207668_10149909
1537 Ga0207668_10532612
1538 Ga0207640_10023587
1539 Ga0207640_10213151
1540 Ga0207640_10366858
1541 Ga0207658_10029339
1542 Ga0207677_10326456
1543 Ga0207703_10630473
1544 Ga0207639_10039065
1545 Ga0207639_10350688
1546 Ga0207639_10630024
1547 Ga0207678_10002002
1548 Ga0207702_10016299
1549 Ga0207702_10054569
1550 Ga0207702_10363759
1551 Ga0207702_10381692
1552 Ga0207641_10183018
1553 Ga0207641_10226137
1554 Ga0207648_10105730
1555 Ga0207676_10030082
1556 Ga0207676_10034484
1557 Ga0207676_10135625
1558 Ga0207674_10007917
1559 Ga0207674_10157222
1560 Ga0207674_10195272
1561 Ga0207698_10002093
1562 Ga0207698_10004842
1563 Ga0207698_10992278
1564 Ga0209281_1011677
1565 Ga0209371_1005256
1566 Ga0209282_1000521
1567 Ga0209282_1001174
1568 Ga0209282_1137457
1569 Ga0207428_10303229
1570 Ga0268266_10016386
1571 Ga0268266_10222780
1572 Ga0268265_10293161
1573 Ga0268264_10222893
1574 Ga0268264_11404748
1575 Ga0307515_10000152
1576 Ga0307515_10014281
1577 Ga0307512_10206815
1578 Ga0316177_1192376
1579 Ga0314311_1055507
1580 Ga0316179_1038668
1581 Ga0316178_1036717
1582 Ga0316180_1138007
1583 Ga0316183_1051137
1584 Ga0316181_1003089
1585 Ga0316182_1122964
1586 Ga0316182_1388324
1587 Ga0265328_10097000
1588 Ga0265325_10004238
1589 Ga0265331_10098030
1590 Ga0265327_10000028
1591 Ga0265327_10000777
1592 Ga0265327_10008172
1593 Ga0265327_10036761
1594 Ga0307513_10065904
1595 Ga0307513_10090119
1596 Ga0307408_100003858
1597 Ga0307408_100111775
1598 Ga0307408_100177221
1599 Ga0307408_100332892
1600 Ga0307408_100355467
1601 Ga0307408_100444291
1602 Ga0307408_100665219
1603 Ga0265313_10030042
1604 Ga0307514_10062787
1605 Ga0307514_10124915
1606 Ga0307405_10007105
1607 Ga0307405_10186499
1608 Ga0307410_11059536
1609 Ga0307406_10002407
1610 Ga0307406_10006868
1611 Ga0307406_10634622
1612 Ga0307407_10200361
1613 Ga0307412_10011637
1614 Ga0307412_10029890
1615 Ga0307412_10052063
1616 Ga0307412_10081391
1617 Ga0307412_10090438
1618 Ga0307412_10544762
1619 Ga0307412_11012476
1620 Ga0307409_100494442
1621 Ga0307416_100002355
1622 Ga0307416_100248852
1623 Ga0307416_100273917
1624 Ga0307416_100839362
1625 Ga0307414_10053714
1626 Ga0307414_10272027
1627 Ga0307414_10346528
1628 Ga0307414_10353223
1629 Ga0307414_10516729
1630 Ga0307411_10126489
1631 Ga0307411_10127142
1632 Ga0307411_10154694
1633 Ga0307411_10178818
1634 Ga0307411_10331449
1635 Ga0307411_10407642
1636 Ga0307411_10477974
1637 Ga0307415_100426498
1638 Ga0307510_10031385
1639 Ga0395899_0001942
1640 Ga0395899_0037564
1641 Ga0395900_0007000
1642 Ga0395900_0031551
1643 Ga0395900_0328009
1644 Ga0395900_0426841
1645 Ga0395898_0005430
1646 Ga0395898_0023388
1647 Ga0395898_0160759
1648 Ga0395898_0284077
1649 Ga0395905_0007138
1650 Ga0395905_0022261
1651 Ga0395905_0034921
1652 Ga0395905_0134156
1653 Ga0395905_0288704
1654 Ga0395901_0053458
1655 Ga0395901_0087292
1656 Ga0395901_0089104
1657 Ga0395901_0098619
1658 Ga0395901_0126807
1659 Ga0395901_0161306
1660 Ga0395901_0241940
1661 Ga0395901_0291445
1662 Ga0400483_082990
1663 Ga0436361_0042902
1664 Ga0436361_0481133
1665 Ga0439436_0040093
1666 Ga0439439_0125455
1667 Ga0439466_0047929
1668 Ga0439465_0011629
1669 Ga0439465_0050689
1670 Ga0451789_1335968
1671 Ga0451807_1518065
1672 Ga0451841_0497166
1673 Ga0451849_0678049
1674 Ga0451843_0558905
1675 Ga0451855_0724113
1676 Ga0451853_1561911
1677 Ga0439433_0045643
1678 Ga0439442_007281
1679 Ga0439445_0005785
1680 Ga0439445_0064595
1681 Ga0439432_018005
1682 Ga0439432_077720
1683 Ga0439449_0003797
1684 Ga0439449_0027720
1685 Ga0439449_0029793
1686 Ga0439449_0055546
1687 Ga0439449_0058086
1688 Ga0439452_007125
1689 Ga0439452_053252
1690 Ga0439457_039037
1691 Ga0439462_0072097
1692 Ga0450911_000935
1693 Ga0450921_001087
1694 Ga0450921_007383
1695 Ga0450923_001056
1696 Ga0450923_025537
1697 Ga0450890_003439
1698 Ga0450906_001534
1699 Ga0450906_011587
1700 Ga0450907_018413
1701 Ga0450908_007977
1702 Ga0450908_018068
1703 Ga0450908_030656
1704 Ga0450918_000934
1705 Ga0450918_021669
1706 Ga0451577_0066420
1707 Ga0466969_0152924
1708 Ga0466965_0182478
1709 Ga0453684_0516077
1710 Ga0453684_0546791
1711 Ga0466957_0189471
1712 Ga0451576_0585814
1713 Ga0466967_0443681
1714 Ga0495627_003930
1715 Ga0495627_013261
1716 Ga0495603_0165527
1717 Ga0495629_0352332
1718 Ga0495638_0007637
1719 Ga0495650_0015654
1720 Ga0495582_0153466
1721 Ga0495639_0003490
1722 Ga0495607_0000252
1723 Ga0495606_0173958
1724 Ga0495606_0196526
1725 Ga0495610_0080827
1726 Ga0495610_0080849
1727 Ga0495616_0000916
1728 Ga0495616_0023039
1729 Ga0495618_0286256
1730 Ga0495620_0008895
1731 Ga0495628_0380461
1732 Ga0495630_0222885
1733 Ga0495631_0000233
1734 Ga0495631_0095683
1735 Ga0495637_0008199
1736 Ga0495637_0010611
1737 Ga0495637_0140069
1738 Ga0495648_0137089
1739 Ga0495663_0064363
1740 Ga0495663_0095518
1741 Ga0495642_0100047
1742 Ga0495654_0090347
1743 Ga0495621_0016352
1744 Ga0495621_0020533
1745 Ga0495621_0042258
1746 Ga0495621_0114909
1747 Ga0495622_0014993
1748 Ga0495633_0003443
1749 Ga0495633_0060037
1750 Ga0495633_0150745
1751 Ga0495667_0235221
1752 Ga0495656_0000108
1753 Ga0495656_0003752
1754 Ga0495656_0034326
1755 Ga0495625_0000057
1756 Ga0495625_0000637
1757 Ga0495625_0098883
1758 Ga0495625_0108633
1759 Ga0495659_0084499
1760 Ga0495661_0360397
1761 Ga0495588_0018926
1762 Ga0495588_0039983
1763 Ga0495647_0085866
1764 Ga0495647_0133047
1765 Ga0495670_0155104
1766 Ga0495671_0001282
1767 Ga0495671_0020509
1768 Ga0495636_0116299
1769 Ga0495676_0007868
1770 Ga0495677_0028439
1771 Ga0495681_0002764
1772 Ga0495684_0583206
1773 Ga0495686_0001297
1774 Ga0495593_0005660
1775 Ga0495593_0078652
1776 Ga0495614_0003894
1777 Ga0495615_0062668
1778 Ga0496101_0002803
1779 Ga0496101_0009650
1780 Ga0496101_0455762
1781 Ga0496102_0003435
1782 Ga0496102_0004534
1783 Ga0496102_0030993
1784 Ga0496103_0013210
1785 Ga0496103_0236151
1786 Ga0496104_0006268
1787 Ga0496104_0045610
1788 Ga0496104_0137938
1789 Ga0496105_0002236
1790 Ga0496105_0381014
1791 Ga0496106_0011540
1792 Ga0496106_0165973
1793 Ga0496106_0340134
1794 Ga0496108_0170429
1795 Ga0496108_0201964
1796 Ga0496108_0397048
1797 Ga0496110_0038468
1798 Ga0496110_0231827
1799 Ga0496111_0236653
1800 Ga0496112_0712570
1801 Ga0496113_0159675
1802 Ga0496114_0102391
1803 Ga0496114_0179880
1804 Ga0496116_0022162
1805 Ga0496116_0026734
1806 Ga0496116_0035145
1807 Ga0496116_0145520
1808 Ga0496116_0192403
1809 Ga0496117_0000030
1810 Ga0496117_0002266
1811 Ga0496117_0016902
1812 Ga0496117_0086801
1813 Ga0496117_0116370
1814 Ga0496117_0173575
1815 Ga0496118_0003433
1816 Ga0496118_0003748
1817 Ga0496118_0011117
1818 Ga0496118_0079459
1819 Ga0496118_0101001
1820 Ga0496119_0006742
1821 Ga0496119_0024993
1822 Ga0496120_0000148
1823 Ga0496120_0247637
1824 Ga0496121_0008570
1825 Ga0496121_0045401
1826 Ga0496121_0066020
1827 Ga0496121_0123171
1828 Ga0496121_0180394
1829 Ga0496121_0248526
1830 Ga0496121_0305559
1831 Ga0496122_0000050
1832 Ga0496122_0000565
1833 Ga0496122_0001461
1834 Ga0496122_0005040
1835 Ga0496122_0055769
1836 Ga0496122_0068837
1837 Ga0496122_0093644
1838 Ga0496122_0113078
1839 Ga0496122_0172882
1840 Ga0496123_0000023
1841 Ga0496123_0000179
1842 Ga0496123_0000247
1843 Ga0496123_0001600
1844 Ga0496123_0029502
1845 Ga0496123_0041436
1846 Ga0496123_0043777
1847 Ga0496123_0152383
1848 Ga0496123_0230881
1849 Ga0496124_0000004
1850 Ga0496124_0001021
1851 Ga0496124_0002705
1852 Ga0496124_0016756
1853 Ga0496124_0021012
1854 Ga0496124_0144906
1855 Ga0496124_0180198
1856 Ga0496124_0230138
1857 Ga0496125_0000161
1858 Ga0496125_0000171
1859 Ga0496125_0027820
1860 Ga0496125_0035255
1861 Ga0496125_0042236
1862 Ga0496125_0094490
1863 Ga0496125_0095746
1864 Ga0496125_0116994
1865 Ga0496125_0205763
1866 Ga0496125_0226980
1867 Ga0496125_0254557
1868 Ga0496125_0292768
1869 Ga0496126_0027931
1870 Ga0501031_0013513
1871 Ga0501032_0003246
1872 Ga0501033_0000059
1873 Ga0501033_0001825
1874 Ga0501034_0078279
1875 Ga0501034_0092587
1876 Ga0501034_0345391
1877 Ga0501036_0008122
1878 Ga0501037_0002561
1879 Ga0501037_0009063
1880 Ga0501037_0114231
1881 Ga0501037_0414562
1882 Ga0501037_0456101
1883 Ga0501038_0073454
1884 Ga0501038_0605245
1885 Ga0501043_0000090
1886 Ga0501043_0000828
1887 Ga0501043_0134025
1888 Ga0501043_0312175
1889 Ga0501046_0000126
1890 Ga0501046_0033515
1891 Ga0501047_0000160
1892 Ga0501047_0076941
1893 Ga0501048_0000040
1894 Ga0501249_009632
1895 Ga0501252_019446
1896 Ga0501225_0007904
1897 Ga0501262_000028
1898 Ga0501262_000393
1899 Ga0501266_030019
1900 Ga0501035_0000213
1901 Ga0501035_0002403
1902 Ga0501035_0169553
1903 Ga0501035_0304843
1904 Ga0501035_0395444
1905 Ga0501044_0000045
1906 Ga0501044_0009438
1907 Ga0501044_0198289
1908 Ga0501045_0035981
1909 nmdc:mga03683_128261_c1
1910 nmdc:mga03683_136111_c1
1911 nmdc:mga03683_205984_c1
1912 nmdc:mga03683_26366_c1
1913 nmdc:mga03683_34001_c1
1914 nmdc:mga03683_41053_c1
1915 nmdc:mga03683_78960_c1
1916 nmdc:mga03n38_164100_c1
1917 nmdc:mga03n38_21477_c1
1918 nmdc:mga00v17_171779_c1
1919 nmdc:mga00v17_213293_c1
1920 nmdc:mga00v17_55892_c1
1921 nmdc:mga00v17_5989_c1
1922 nmdc:mga00v17_700_c1
1923 nmdc:mga0yw44_185856_c1
1924 nmdc:mga0yw44_4974_c1
1925 nmdc:mga0yw44_76476_c1
1926 nmdc:mga0k408_140873_c1
1927 nmdc:mga0k408_264627_c1
1928 nmdc:mga0k408_29093_c1
1929 nmdc:mga0k408_78681_c1
1930 nmdc:mga06z11_1446_c1
1931 nmdc:mga07m45_1027_c1
1932 nmdc:mga07m45_278739_c1
1933 nmdc:mga07m45_3652_c1
1934 nmdc:mga07m45_59_c1
1935 nmdc:mga07m45_8066_c1
1936 nmdc:mga08x19_447026_c1
1937 nmdc:mga0sz30_13103_c1
1938 nmdc:mga0sz30_29872_c1
1939 nmdc:mga0sz30_5751_c1
1940 Ga0500643_009198
1941 Ga0500651_0000029
1942 Ga0500651_0157988
1943 Ga0500641_0099616
1944 Ga0500556_0000102
1945 Ga0500560_000085
1946 Ga0500571_000896
1947 Ga0500572_094070
1948 Ga0500592_025006
1949 Ga0500593_000625
1950 Ga0500593_109834
1951 Ga0500594_0003141
1952 Ga0500594_0014303
1953 Ga0500608_002231
1954 Ga0500655_014612
1955 Ga0500658_0000243
1956 Ga0500658_0000358
1957 Ga0500658_0004281
1958 Ga0500559_0000021
1959 Ga0500559_0070922
1960 Ga0500559_0084981
1961 Ga0500559_0134986
1962 Ga0500561_0000067
1963 Ga0500564_037142
1964 Ga0500568_0004013
1965 Ga0500573_0216890
1966 Ga0500574_000803
1967 Ga0500574_039051
1968 Ga0500577_0025912
1969 Ga0500616_0039096
1970 Ga0500624_000351
1971 Ga0500627_0000393
1972 Ga0500627_0008574
1973 Ga0500633_0078818
1974 Ga0500634_0054964
1975 Ga0500634_0117040
1976 Ga0500634_0167315
1977 Ga0500636_0000012
1978 Ga0500645_030395
1979 Ga0500645_043394
1980 Ga0500596_009403
1981 Ga0587090_000032
1982 Ga0587091_001375
1983 Ga0587067_000808
1984 Ga0587072_000287
1985 2512035855
1986 2512532045
1987 2513230249
1988 2513574137
1989 2513696050
1990 2514000133
1991 2537873135
1992 2554244482
1993 2559297673
1994 2566035776
1995 2599603738
1996 2599622683
1997 2599623988
1998 2599671162
1999 2599671999
2000 2599679801
2001 2599681919
2002 2599691817
2003 2599693932
2004 2601612467
2005 2601749008
2006 2643867529
2007 2643917498
2008 2643990452
2009 2644058590
2010 2644070794
2011 2644295029
2012 2644328753
2013 2644398078
2014 2644413864
2015 2644467422
2016 2644469216
2017 2644522672
2018 2671113082
2019 2719667018
2020 2720493438
2021 2723846283
2022 2738718584
2023 2738722098
2024 2738881186
2025 2738884710
2026 2739244113
2027 2739252449
2028 2739252603
2029 2739280602
2030 2739282462
2031 2739610908
2032 2793297141
2033 2793337333
2034 2793352243
2035 2805927572
2036 2805936046
2037 2806049026
2038 2806065806
2039 2806077302
2040 2808989184
2041 2816472439
2042 2819557720
2043 2819596435
2044 2819599976
2045 2828306055
2046 2831267148
2047 2831270230
2048 2838031603
2049 2838056233
2050 2838059963
2051 2838679893
2052 2838717690
2053 2838724464
2054 2838729594
2055 2841850033
2056 2841861182
2057 2841868056
2058 2842128505
2059 2842134575
2060 2842156593
2061 2842173935
2062 2842180214
2063 2842192213
2064 2842197067
2065 2842206467
2066 2842216507
2067 2842229249
2068 2842279924
2069 2842287553
2070 2842345126
2071 2842369965
2072 2842398401
2073 2842404918
2074 2842411500
2075 2842418049
2076 2842478335
2077 2842505719
2078 2842518551
2079 2842523679
2080 2842680442
2081 2842682401
2082 2842736041
2083 2842748272
2084 2857547402
2085 2857580357
2086 2869252205
2087 2869270921
2088 2871463899
2089 2874132027
2090 2874610752
2091 2876811676
2092 2879118834
2093 2881929425
2094 2885199570
2095 2885204827
2096 2885213157
2097 2885218486
2098 2887380275
2099 2889039269
2100 2891374330
2101 2899793088
2102 2899849710
2103 2899926077
2104 2899931145
2105 2903752807
2106 2904452285
2107 2904454815
2108 2904458569
2109 2904462612
2110 2904481386
2111 2904546798
2112 2904548652
2113 2906368560
2114 2906372527
2115 2906396023
2116 2917705653
2117 2919117970
2118 2919412869
2119 2919464055
2120 2919466338
2121 2922362086
2122 2923561822
2123 2924717677
2124 2926757739
2125 2926764636
2126 2928038077
2127 2928041527
2128 2928046317
2129 2928049091
2130 2928052299
2131 2928054012
2132 2928065030
2133 2928065765
2134 2928077433
2135 2928077909
2136 2928087369
2137 2928088694
2138 2928115455
2139 2929164271
2140 2929164682
2141 2929522213
2142 2929523851
2143 2932422769
2144 2933010354
2145 2933014177
2146 2933597223
2147 2945910707
2148 2945913031
2149 2945946603
2150 2945946867
2151 2945976326
2152 2945976582
2153 2945984684
2154 2945987120
2155 2954768001
2156 2954771619
2157 2965043416
2158 2965093081
2159 2977954330
2160 2979090253
2161 2979095783
2162 2979102760
2163 2984509351
2164 2984519949
2165 2984537681
2166 2984604429
2167 3004200819
2168 650844118
2169 8003573306
2170 8004318478
2171 8004363284
2172 8005294753
2173 8005486369
2174 8005647488
2175 8005700975
2176 8006964664
2177 8006991986
2178 8006999919
2179 8018178360
2180 8024505167
2181 8056387600
2182 8056680335

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

30

214

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8451 1 210
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8268 1 210
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7514 10 153
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7321 18 203
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7234 11 204
ID Description Score Start End Superfamily
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8663 17 210 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8656 8 216 1.10.3720.10
af_Q2FX86_270_484_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8509 11 213 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8478 1 210 1.10.3720.10
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.842 1 210 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2R7R261-F1-model_v4 deleted 0.9311 13 138
AF-A0A2E0RD90-F1-model_v4 deleted 0.9227 13 158
AF-A0A0H3GTQ0-F1-model_v4 Amino acid ABC superfamily ATP binding cassette transporter 0.9213 1 214 GO:0006865
GO:0022857
GO:0043190
AF-A0A2V8FXA6-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9189 5 145 GO:0006865
GO:0022857
GO:0043190
AF-A0A6P1V534-F1-model_v4 Amino acid ABC transporter permease 0.9186 1 214 GO:0006865
GO:0022857
GO:0043190

Map