F489893

General Info

Members Datasets Scaffolds Average Seq Length
1091 398 1059 238

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0086164|Ga0501031_0086164_859_1671
Length 270
Sequence MASIRDRPSSPTPTAAPNGVGLRPTFNIFGVNSPDRLYFRQMLSGRDIARSDPLARQMVNFAYLIGDRETGEALVVDAAYDIRGILDVAAADGMKVTGALVTHYHQDHVGGNMMGYQISGVRELLTLNPVPVHVQADEAVGVQRVTGAGEGDLVRHDSGDVVDVGAIGVELIHTPGHTPGSQCFLVDGRYLVSGDTLFLEGCGRTDLPGGDAAQLYDSLTHKLAKVPDDTVLFPGHLYSAEPSATMGETRRWNFVFKPRSEAEWLAMFGG

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2576861822 Frankia sp. CeD Isolate Nodule
3 2582580736 Prauserella sp. Am3 Isolate Unclassified
4 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
5 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
6 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
7 2671180195 Frankia sp. CcI49 Isolate Nodule
8 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
9 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
10 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
11 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
12 2773857922 Frankia sp. CcI49 Isolate Nodule
13 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
14 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
15 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
16 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
17 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
18 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
19 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
20 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
21 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
22 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
23 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
24 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
25 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
26 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
27 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
28 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
29 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
30 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
208 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
222 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
239 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
244 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
245 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
250 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
251 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
252 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
253 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
254 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
257 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
258 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
383 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
387 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
393 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
394 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
395 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
396 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
397 8054920844 Frankia tisae Agncl-8 Isolate Nodule
398 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.45
Nodule 0.73
Rhizoplane 7.97
Rhizosphere 71.86
Stem 0
Stem Tuber 0.09
Unclassified 8.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1002320 3300002073 Bacteria 1934
2 JGI24748J21848_1007147 3300002074 Bacteria 1307
3 JGI24744J21845_10001349 3300002077 Bacteria 4856
4 JGI24744J21845_10011490 3300002077 Bacteria 1810
5 rootH2_10039752 3300003320 Bacteria 4700
6 rootH1_10169282 3300003323 Bacteria 2191
7 Ga0055540_1000118 3300003792 Bacteria 83025
8 Ga0055540_1000243 3300003792 Bacteria 49933
9 Ga0055540_1003862 3300003792 Bacteria 7032
10 Ga0055540_1014158 3300003792 Bacteria 2393
11 Ga0070676_10009545 3300005328 Bacteria 5241
12 Ga0070683_100139575 3300005329 Bacteria 2296
13 Ga0070670_100107856 3300005331 Bacteria 2400
14 Ga0070677_10024226 3300005333 Bacteria 2255
15 Ga0068869_100020924 3300005334 Bacteria 4494
16 Ga0068869_100057787 3300005334 Bacteria 2834
17 Ga0070682_100082895 3300005337 Bacteria 2079
18 Ga0070682_100429136 3300005337 Bacteria 1007
19 Ga0068868_100014673 3300005338 Bacteria 5779
20 Ga0068868_100200257 3300005338 Bacteria 1664
21 Ga0070689_100012121 3300005340 Bacteria 6200
22 Ga0070691_10018762 3300005341 Bacteria 3189
23 Ga0070661_100116760 3300005344 Bacteria 1996
24 Ga0070692_10225373 3300005345 Bacteria 1110
25 Ga0070668_100000242 3300005347 Bacteria 35872
26 Ga0070668_100009256 3300005347 Bacteria 7304
27 Ga0070668_100665440 3300005347 Bacteria 916
28 Ga0070669_100005081 3300005353 Bacteria 9513
29 Ga0070669_100030328 3300005353 Bacteria 3902
30 Ga0070669_100393500 3300005353 Bacteria 1133
31 Ga0070675_100115777 3300005354 Bacteria 2273
32 Ga0070671_100002818 3300005355 Bacteria 13514
33 Ga0070674_100004607 3300005356 Bacteria 7878
34 Ga0070674_100067195 3300005356 Bacteria 2521
35 Ga0070674_100234972 3300005356 Bacteria 1432
36 Ga0070673_100182460 3300005364 Bacteria 1797
37 Ga0070673_100427071 3300005364 Bacteria 1189
38 Ga0070688_100006748 3300005365 Bacteria 6155
39 Ga0070659_100004755 3300005366 Bacteria 9703
40 Ga0070667_100000420 3300005367 Bacteria 45173
41 Ga0070667_100000544 3300005367 Bacteria 37580
42 Ga0070667_100010100 3300005367 Bacteria 7810
43 Ga0070667_100027586 3300005367 Bacteria 4725
44 Ga0070703_10074144 3300005406 Bacteria 1143
45 Ga0070709_10104574 3300005434 Bacteria 1892
46 Ga0070714_100314014 3300005435 Bacteria 1464
47 Ga0070714_100429440 3300005435 Bacteria 1252
48 Ga0070714_100811920 3300005435 Bacteria 906
49 Ga0070710_10003235 3300005437 Bacteria 7716
50 Ga0070710_10003876 3300005437 Bacteria 7080
51 Ga0070710_10096464 3300005437 Bacteria 1753
52 Ga0070701_10024593 3300005438 Bacteria 2914
53 Ga0070711_100000663 3300005439 Bacteria 17961
54 Ga0070705_100029772 3300005440 Bacteria 3008
55 Ga0070694_100044443 3300005444 Bacteria 2973
56 Ga0070694_100248455 3300005444 Bacteria 1345
57 Ga0070708_100013579 3300005445 Bacteria 6675
58 Ga0070708_100045457 3300005445 Bacteria 3867
59 Ga0070708_100352634 3300005445 Bacteria 1387
60 Ga0070708_100459079 3300005445 Bacteria 1202
61 Ga0070663_100000795 3300005455 Bacteria 17139
62 Ga0070663_100010657 3300005455 Bacteria 5735
63 Ga0070663_100194434 3300005455 Bacteria 1580
64 Ga0070678_100000459 3300005456 Bacteria 19456
65 Ga0070678_100110382 3300005456 Bacteria 2151
66 Ga0070678_100676952 3300005456 Bacteria 927
67 Ga0070662_100004396 3300005457 Bacteria 8910
68 Ga0070662_100289588 3300005457 Bacteria 1327
69 Ga0070681_10028887 3300005458 Bacteria 5572
70 Ga0070681_10109599 3300005458 Bacteria 2701
71 Ga0068867_100007547 3300005459 Bacteria 7694
72 Ga0068867_100399728 3300005459 Bacteria 1158
73 Ga0070685_10027454 3300005466 Bacteria 3146
74 Ga0070685_10410993 3300005466 Bacteria 939
75 Ga0070706_100005155 3300005467 Bacteria 12471
76 Ga0070699_100301033 3300005518 Bacteria 1439
77 Ga0070679_100143533 3300005530 Bacteria 2366
78 Ga0068853_100006833 3300005539 Bacteria 9098
79 Ga0068853_100195840 3300005539 Bacteria 1838
80 Ga0070672_100129753 3300005543 Bacteria 2071
81 Ga0070695_100055433 3300005545 Bacteria 2555
82 Ga0070696_100007179 3300005546 Bacteria 7440
83 Ga0070696_100017803 3300005546 Bacteria 4797
84 Ga0070693_100008532 3300005547 Bacteria 5059
85 Ga0070665_100007100 3300005548 Bacteria 11381
86 Ga0070665_100012650 3300005548 Bacteria 8499
87 Ga0070665_100017385 3300005548 Bacteria 7217
88 Ga0070665_100030781 3300005548 Bacteria 5401
89 Ga0070665_100349835 3300005548 Bacteria 1483
90 Ga0070665_100359237 3300005548 Bacteria 1462
91 Ga0070665_100393789 3300005548 Bacteria 1393
92 Ga0070704_100010478 3300005549 Bacteria 5642
93 Ga0070704_100228884 3300005549 Bacteria 1515
94 Ga0068855_100110559 3300005563 Bacteria 3155
95 Ga0068855_100410772 3300005563 Bacteria 1482
96 Ga0068855_100461077 3300005563 Bacteria 1386
97 Ga0068854_100000608 3300005578 Bacteria 21244
98 Ga0068854_100124372 3300005578 Bacteria 1962
99 Ga0068856_100609976 3300005614 Bacteria 1112
100 Ga0068856_101060738 3300005614 Bacteria 828
101 Ga0070702_100070855 3300005615 Bacteria 2059
102 Ga0070702_100160319 3300005615 Bacteria 1453
103 Ga0068852_100436113 3300005616 Bacteria 1294
104 Ga0068859_100007479 3300005617 Bacteria 11091
105 Ga0068859_100030153 3300005617 Bacteria 5442
106 Ga0068866_10004533 3300005718 Bacteria 5698
107 Ga0068866_10120733 3300005718 Bacteria 1476
108 Ga0068861_100004705 3300005719 Bacteria 9173
109 Ga0068861_100118447 3300005719 Bacteria 2133
110 Ga0068861_100207767 3300005719 Bacteria 1647
111 Ga0068861_100503038 3300005719 Bacteria 1096
112 Ga0068863_100000818 3300005841 Bacteria 31194
113 Ga0068863_100105276 3300005841 Bacteria 2684
114 Ga0068863_100108056 3300005841 Bacteria 2648
115 Ga0068858_100001820 3300005842 Bacteria 21703
116 Ga0068858_100011821 3300005842 Bacteria 8230
117 Ga0068858_100023732 3300005842 Bacteria 5713
118 Ga0068858_100394941 3300005842 Bacteria 1328
119 Ga0068860_100000048 3300005843 Bacteria 209375
120 Ga0068860_100012097 3300005843 Bacteria 8500
121 Ga0068860_100100455 3300005843 Bacteria 2760
122 Ga0068860_100577302 3300005843 Bacteria 1128
123 Ga0068860_100721246 3300005843 Bacteria 1007
124 Ga0068862_100000053 3300005844 Bacteria 143631
125 Ga0068862_100015980 3300005844 Bacteria 6239
126 Ga0068862_100187054 3300005844 Bacteria 1862
127 Ga0081455_10002841 3300005937 Bacteria 20392
128 Ga0081455_10011754 3300005937 Bacteria 8768
129 Ga0081455_10031829 3300005937 Bacteria 4765
130 Ga0081455_10053243 3300005937 Bacteria 3458
131 Ga0081455_10132807 3300005937 Bacteria 1944
132 Ga0081455_10133779 3300005937 Bacteria 1935
133 Ga0081455_10243227 3300005937 Bacteria 1321
134 Ga0081538_10049765 3300005981 Bacteria 2539
135 Ga0075365_10002834 3300006038 Bacteria 8694
136 Ga0075365_10038635 3300006038 Bacteria 3104
137 Ga0075365_10040437 3300006038 Bacteria 3040
138 Ga0075365_10048365 3300006038 Bacteria 2799
139 Ga0075365_10161480 3300006038 Bacteria 1561
140 Ga0075365_10169232 3300006038 Bacteria 1525
141 Ga0075365_10215619 3300006038 Bacteria 1346
142 Ga0075368_10041498 3300006042 Bacteria 1808
143 Ga0075363_100002416 3300006048 Bacteria 7624
144 Ga0075363_100002790 3300006048 Bacteria 7252
145 Ga0075363_100021877 3300006048 Bacteria 3228
146 Ga0075363_100022307 3300006048 Bacteria 3199
147 Ga0075363_100041344 3300006048 Bacteria 2431
148 Ga0075363_100058980 3300006048 Bacteria 2062
149 Ga0075363_100096794 3300006048 Bacteria 1630
150 Ga0075363_100158657 3300006048 Bacteria 1280
151 Ga0075363_100226049 3300006048 Bacteria 1073
152 Ga0075363_100236523 3300006048 Bacteria 1049
153 Ga0075364_10001709 3300006051 Bacteria 12070
154 Ga0075364_10002529 3300006051 Bacteria 10245
155 Ga0075364_10004937 3300006051 Bacteria 7727
156 Ga0075364_10008520 3300006051 Bacteria 6134
157 Ga0075364_10014187 3300006051 Bacteria 4918
158 Ga0075364_10104427 3300006051 Bacteria 1887
159 Ga0075364_10109496 3300006051 Bacteria 1842
160 Ga0075364_10187426 3300006051 Bacteria 1401
161 Ga0075364_10316909 3300006051 Bacteria 1062
162 Ga0070715_10072627 3300006163 Bacteria 1541
163 Ga0070712_100001159 3300006175 Bacteria 15943
164 Ga0070712_100022461 3300006175 Bacteria 4157
165 Ga0070712_100504505 3300006175 Bacteria 1014
166 Ga0075362_10018711 3300006177 Bacteria 2870
167 Ga0075362_10084062 3300006177 Bacteria 1470
168 Ga0075362_10098756 3300006177 Bacteria 1363
169 Ga0075362_10225848 3300006177 Bacteria 916
170 Ga0075367_10043148 3300006178 Bacteria 2642
171 Ga0075367_10112226 3300006178 Bacteria 1674
172 Ga0075367_10205360 3300006178 Bacteria 1231
173 Ga0075369_10001719 3300006186 Bacteria 7575
174 Ga0075369_10003008 3300006186 Bacteria 6099
175 Ga0075369_10012059 3300006186 Bacteria 3409
176 Ga0075369_10028394 3300006186 Bacteria 2345
177 Ga0075369_10034831 3300006186 Bacteria 2138
178 Ga0075369_10059482 3300006186 Bacteria 1665
179 Ga0075369_10115180 3300006186 Bacteria 1214
180 Ga0075369_10121975 3300006186 Bacteria 1180
181 Ga0097621_100046178 3300006237 Bacteria 3523
182 Ga0075370_10031081 3300006353 Bacteria 2980
183 Ga0075370_10115673 3300006353 Bacteria 1559
184 Ga0075370_10167716 3300006353 Bacteria 1290
185 Ga0075370_10231062 3300006353 Bacteria 1094
186 Ga0075370_10241140 3300006353 Bacteria 1070
187 Ga0075370_10274747 3300006353 Bacteria 1000
188 Ga0068871_100449400 3300006358 Bacteria 1155
189 Ga0075428_100004799 3300006844 Bacteria 14992
190 Ga0075428_100013494 3300006844 Bacteria 9093
191 Ga0075428_100044817 3300006844 Bacteria 4860
192 Ga0075428_100063605 3300006844 Bacteria 4040
193 Ga0075428_100064989 3300006844 Bacteria 3995
194 Ga0075430_100024958 3300006846 Bacteria 5085
195 Ga0075430_100064811 3300006846 Bacteria 3070
196 Ga0075430_100080372 3300006846 Bacteria 2731
197 Ga0075430_100179845 3300006846 Bacteria 1759
198 Ga0075430_100247053 3300006846 Bacteria 1479
199 Ga0075431_100002922 3300006847 Bacteria 16543
200 Ga0075431_100043370 3300006847 Bacteria 4642
201 Ga0075431_100241443 3300006847 Bacteria 1838
202 Ga0075431_100491627 3300006847 Bacteria 1219
203 Ga0075434_100394812 3300006871 Bacteria 1404
204 Ga0075429_100011604 3300006880 Bacteria 7642
205 Ga0075429_100050085 3300006880 Bacteria 3634
206 Ga0075429_100083434 3300006880 Bacteria 2786
207 Ga0075429_100123804 3300006880 Bacteria 2260
208 Ga0075429_100129666 3300006880 Bacteria 2206
209 Ga0068865_100004581 3300006881 Bacteria 8343
210 Ga0097620_100007479 3300006931 Bacteria 11091
211 Ga0097620_100030152 3300006931 Bacteria 5442
212 Ga0099795_10074357 3300007788 Bacteria 1288
213 Ga0105251_10018513 3300009011 Bacteria 3701
214 Ga0105250_10139551 3300009092 Bacteria 1004
215 Ga0111539_10003516 3300009094 Bacteria 20665
216 Ga0111539_10007896 3300009094 Bacteria 13579
217 Ga0111539_10008660 3300009094 Bacteria 12914
218 Ga0111539_10146768 3300009094 Bacteria 2762
219 Ga0111539_10382934 3300009094 Bacteria 1638
220 Ga0111539_10643535 3300009094 Bacteria 1234
221 Ga0105245_10001283 3300009098 Bacteria 22648
222 Ga0105245_10007676 3300009098 Bacteria 9448
223 Ga0105245_10058042 3300009098 Bacteria 3483
224 Ga0105247_10000118 3300009101 Bacteria 77424
225 Ga0105247_10000195 3300009101 Bacteria 59840
226 Ga0105247_10000413 3300009101 Bacteria 36208
227 Ga0105247_10001525 3300009101 Bacteria 16561
228 Ga0105247_10055705 3300009101 Bacteria 2440
229 Ga0105247_10092793 3300009101 Bacteria 1918
230 Ga0105247_10185289 3300009101 Bacteria 1391
231 Ga0114129_10001629 3300009147 Bacteria 30482
232 Ga0114129_10003146 3300009147 Bacteria 23167
233 Ga0114129_10006791 3300009147 Bacteria 16247
234 Ga0114129_10033012 3300009147 Bacteria 7315
235 Ga0114129_10201392 3300009147 Bacteria 2696
236 Ga0105243_10000773 3300009148 Bacteria 30624
237 Ga0105243_10185687 3300009148 Bacteria 1812
238 Ga0105243_10371859 3300009148 Bacteria 1319
239 Ga0105243_10696557 3300009148 Bacteria 990
240 Ga0105241_10012270 3300009174 Bacteria 6287
241 Ga0105242_10011770 3300009176 Bacteria 6732
242 Ga0105242_10092028 3300009176 Bacteria 2554
243 Ga0105242_10583699 3300009176 Bacteria 1077
244 Ga0105248_10000151 3300009177 Bacteria 81027
245 Ga0105248_10007012 3300009177 Bacteria 12339
246 Ga0105248_10013545 3300009177 Bacteria 8977
247 Ga0105248_10250908 3300009177 Bacteria 1992
248 Ga0105237_10013445 3300009545 Bacteria 8583
249 Ga0105237_10036627 3300009545 Bacteria 4965
250 Ga0105237_10077118 3300009545 Bacteria 3323
251 Ga0105249_10000022 3300009553 Bacteria 258377
252 Ga0105249_10004515 3300009553 Bacteria 12030
253 Ga0105249_10155145 3300009553 Bacteria 2207
254 Ga0105249_10610163 3300009553 Bacteria 1146
255 Ga0105249_10666839 3300009553 Bacteria 1098
256 Ga0099796_10057134 3300010159 Bacteria 1372
257 Ga0105239_10043734 3300010375 Bacteria 4911
258 Ga0105239_10095488 3300010375 Bacteria 3284
259 Ga0105239_10580723 3300010375 Bacteria 1278
260 Ga0105239_10684577 3300010375 Bacteria 1172
261 Ga0105239_10821585 3300010375 Bacteria 1065
262 Ga0105239_11037786 3300010375 Bacteria 943
263 Ga0105246_10116320 3300011119 Bacteria 1974
264 Ga0105246_10339824 3300011119 Bacteria 1227
265 Ga0105246_10374712 3300011119 Bacteria 1174
266 Ga0157369_10069869 3300013105 Bacteria 3773
267 Ga0157369_10199327 3300013105 Bacteria 2101
268 Ga0157378_10002823 3300013297 Bacteria 15493
269 Ga0157378_10319649 3300013297 Bacteria 1507
270 Ga0157378_10381281 3300013297 Unclassified 1385
271 Ga0163162_10002292 3300013306 Bacteria 17964
272 Ga0163162_10089288 3300013306 Bacteria 3162
273 Ga0163162_10130397 3300013306 Bacteria 2622
274 Ga0163162_10221827 3300013306 Bacteria 2020
275 Ga0163162_10940275 3300013306 Bacteria 976
276 Ga0163162_11289078 3300013306 Bacteria 830
277 Ga0157372_10030734 3300013307 Bacteria 5877
278 Ga0157372_10097249 3300013307 Bacteria 3357
279 Ga0157375_10028525 3300013308 Bacteria 5233
280 Ga0157375_10082487 3300013308 Bacteria 3257
281 Ga0157375_10262588 3300013308 Bacteria 1888
282 Ga0157375_10388900 3300013308 Bacteria 1561
283 Ga0157375_11053991 3300013308 Bacteria 951
284 Ga0163163_10003313 3300014325 Bacteria 13660
285 Ga0163163_11110220 3300014325 Bacteria 854
286 Ga0157380_10006763 3300014326 Bacteria 8104
287 Ga0157380_10052902 3300014326 Bacteria 3217
288 Ga0157380_10095069 3300014326 Bacteria 2468
289 Ga0157380_10212413 3300014326 Bacteria 1725
290 Ga0157380_10779192 3300014326 Bacteria 971
291 Ga0157380_11036224 3300014326 Bacteria 856
292 Ga0182008_10113655 3300014497 Bacteria 1342
293 Ga0157377_10160789 3300014745 Bacteria 1396
294 Ga0157377_10277956 3300014745 Bacteria 1096
295 Ga0157379_10001742 3300014968 Bacteria 17990
296 Ga0157379_10048775 3300014968 Bacteria 3780
297 Ga0157379_10067726 3300014968 Bacteria 3191
298 Ga0157379_10106220 3300014968 Bacteria 2520
299 Ga0157379_10265772 3300014968 Bacteria 1559
300 Ga0157376_10106149 3300014969 Bacteria 2464
301 Ga0163161_10000939 3300017792 Bacteria 22414
302 Ga0163161_10010290 3300017792 Bacteria 6478
303 Ga0163161_10095548 3300017792 Bacteria 2205
304 Ga0213876_10005702 3300021384 Bacteria 6828
305 Ga0213876_10006963 3300021384 Bacteria 6163
306 Ga0213875_10097570 3300021388 Bacteria 1371
307 Ga0213875_10178359 3300021388 Bacteria 998
308 Ga0224572_1021500 3300024225 Bacteria 1238
309 Ga0209051_1000051 3300025303 Bacteria 283620
310 Ga0209051_1001489 3300025303 Bacteria 19606
311 Ga0209051_1001900 3300025303 Bacteria 16287
312 Ga0209051_1066991 3300025303 Bacteria 1100
313 Ga0207696_1055064 3300025711 Bacteria 1129
314 Ga0207692_10006326 3300025898 Bacteria 4798
315 Ga0207692_10074385 3300025898 Bacteria 1800
316 Ga0207642_10000995 3300025899 Bacteria 8857
317 Ga0207710_10000029 3300025900 Bacteria 289155
318 Ga0207710_10000076 3300025900 Bacteria 145523
319 Ga0207710_10000091 3300025900 Bacteria 121330
320 Ga0207710_10003297 3300025900 Bacteria 7215
321 Ga0207688_10001765 3300025901 Bacteria 11487
322 Ga0207688_10002070 3300025901 Bacteria 10777
323 Ga0207688_10262257 3300025901 Bacteria 1049
324 Ga0207680_10075538 3300025903 Bacteria 2102
325 Ga0207680_10082562 3300025903 Bacteria 2023
326 Ga0207647_10124217 3300025904 Bacteria 1520
327 Ga0207647_10274870 3300025904 Bacteria 962
328 Ga0207685_10047646 3300025905 Bacteria 1637
329 Ga0207699_10144692 3300025906 Bacteria 1566
330 Ga0207645_10043029 3300025907 Bacteria 2889
331 Ga0207684_10015458 3300025910 Bacteria 6567
332 Ga0207654_10054565 3300025911 Bacteria 2310
333 Ga0207707_10031389 3300025912 Bacteria 4649
334 Ga0207671_10010972 3300025914 Bacteria 7422
335 Ga0207671_10056830 3300025914 Bacteria 2900
336 Ga0207671_10063268 3300025914 Bacteria 2749
337 Ga0207671_10186716 3300025914 Bacteria 1615
338 Ga0207693_10000513 3300025915 Bacteria 34994
339 Ga0207693_10021564 3300025915 Bacteria 5119
340 Ga0207663_10002243 3300025916 Bacteria 9247
341 Ga0207663_10007211 3300025916 Bacteria 5752
342 Ga0207663_10242952 3300025916 Bacteria 1321
343 Ga0207660_10272551 3300025917 Bacteria 1341
344 Ga0207662_10044720 3300025918 Bacteria 2615
345 Ga0207657_10229717 3300025919 Bacteria 1484
346 Ga0207681_10001228 3300025923 Bacteria 16511
347 Ga0207681_10024065 3300025923 Bacteria 3904
348 Ga0207681_10773482 3300025923 Bacteria 801
349 Ga0207659_10409214 3300025926 Bacteria 1136
350 Ga0207687_10006399 3300025927 Bacteria 7779
351 Ga0207687_10012713 3300025927 Bacteria 5501
352 Ga0207700_10083531 3300025928 Bacteria 2500
353 Ga0207664_10240262 3300025929 Bacteria 1577
354 Ga0207664_10679061 3300025929 Bacteria 926
355 Ga0207644_10045936 3300025931 Bacteria 3109
356 Ga0207644_10063626 3300025931 Bacteria 2679
357 Ga0207690_10083671 3300025932 Bacteria 2235
358 Ga0207706_10005762 3300025933 Bacteria 11528
359 Ga0207706_10159703 3300025933 Bacteria 1981
360 Ga0207706_10718761 3300025933 Bacteria 852
361 Ga0207709_10178107 3300025935 Bacteria 1499
362 Ga0207709_10354787 3300025935 Bacteria 1108
363 Ga0207709_10422149 3300025935 Bacteria 1024
364 Ga0207670_10006353 3300025936 Bacteria 6550
365 Ga0207670_10012662 3300025936 Bacteria 4943
366 Ga0207669_10001354 3300025937 Bacteria 10425
367 Ga0207669_10057021 3300025937 Bacteria 2376
368 Ga0207669_10437204 3300025937 Bacteria 1034
369 Ga0207669_10511703 3300025937 Bacteria 962
370 Ga0207704_10009059 3300025938 Bacteria 4785
371 Ga0207704_10212038 3300025938 Bacteria 1426
372 Ga0207665_10000852 3300025939 Bacteria 20607
373 Ga0207691_10168095 3300025940 Bacteria 1921
374 Ga0207711_10000172 3300025941 Bacteria 69349
375 Ga0207711_10037703 3300025941 Bacteria 4108
376 Ga0207711_10038570 3300025941 Bacteria 4063
377 Ga0207711_10072739 3300025941 Bacteria 2987
378 Ga0207689_10026221 3300025942 Bacteria 4881
379 Ga0207667_10353098 3300025949 Bacteria 1499
380 Ga0207667_10393814 3300025949 Bacteria 1410
381 Ga0207651_10120996 3300025960 Bacteria 1985
382 Ga0207651_10306129 3300025960 Bacteria 1323
383 Ga0207712_10000005 3300025961 Bacteria 608697
384 Ga0207712_10019806 3300025961 Bacteria 4398
385 Ga0207712_10077385 3300025961 Bacteria 2411
386 Ga0207712_10116233 3300025961 Bacteria 2015
387 Ga0207712_10310735 3300025961 Bacteria 1297
388 Ga0207668_10008387 3300025972 Bacteria 6156
389 Ga0207668_10029503 3300025972 Bacteria 3596
390 Ga0207668_10089894 3300025972 Bacteria 2252
391 Ga0207640_10008326 3300025981 Bacteria 5759
392 Ga0207658_10000356 3300025986 Bacteria 45186
393 Ga0207658_10003633 3300025986 Bacteria 10897
394 Ga0207658_10104456 3300025986 Bacteria 2226
395 Ga0207658_10182743 3300025986 Bacteria 1737
396 Ga0207677_10015714 3300026023 Bacteria 4463
397 Ga0207677_10122968 3300026023 Bacteria 1956
398 Ga0207703_10000392 3300026035 Bacteria 47040
399 Ga0207703_10009257 3300026035 Bacteria 7746
400 Ga0207703_10034176 3300026035 Bacteria 4034
401 Ga0207639_10022607 3300026041 Bacteria 4531
402 Ga0207639_10168686 3300026041 Bacteria 1851
403 Ga0207678_10000312 3300026067 Bacteria 43816
404 Ga0207678_10008726 3300026067 Bacteria 8925
405 Ga0207678_10126186 3300026067 Bacteria 2183
406 Ga0207708_10049662 3300026075 Bacteria 3195
407 Ga0207702_10532442 3300026078 Bacteria 1148
408 Ga0207702_10836713 3300026078 Bacteria 911
409 Ga0207641_10002348 3300026088 Bacteria 17500
410 Ga0207641_10023303 3300026088 Bacteria 5102
411 Ga0207641_10090704 3300026088 Bacteria 2673
412 Ga0207641_10200930 3300026088 Bacteria 1838
413 Ga0207641_10679484 3300026088 Bacteria 1013
414 Ga0207648_10001669 3300026089 Bacteria 24324
415 Ga0207648_10156982 3300026089 Bacteria 2008
416 Ga0207648_10168992 3300026089 Bacteria 1933
417 Ga0207676_10261578 3300026095 Bacteria 1563
418 Ga0207676_10509274 3300026095 Bacteria 1144
419 Ga0207676_10848985 3300026095 Bacteria 893
420 Ga0207676_11227877 3300026095 Bacteria 743
421 Ga0207674_10614471 3300026116 Bacteria 1050
422 Ga0207675_100004512 3300026118 Bacteria 13447
423 Ga0207675_100314079 3300026118 Bacteria 1529
424 Ga0207675_100468746 3300026118 Bacteria 1250
425 Ga0207675_100592497 3300026118 Bacteria 1111
426 Ga0207683_10001309 3300026121 Bacteria 22501
427 Ga0207683_10017976 3300026121 Bacteria 6029
428 Ga0207683_10075414 3300026121 Bacteria 2985
429 Ga0207683_10155034 3300026121 Bacteria 2068
430 Ga0207683_10749877 3300026121 Bacteria 906
431 Ga0207428_10041400 3300027907 Bacteria 3730
432 Ga0207428_10128299 3300027907 Bacteria 1942
433 Ga0207428_10403756 3300027907 Bacteria 1000
434 Ga0268266_10007915 3300028379 Bacteria 9518
435 Ga0268266_10021881 3300028379 Bacteria 5448
436 Ga0268266_10055544 3300028379 Bacteria 3404
437 Ga0268266_10069556 3300028379 Bacteria 3050
438 Ga0268266_10074167 3300028379 Bacteria 2954
439 Ga0268265_10000005 3300028380 Bacteria 535350
440 Ga0268265_10047339 3300028380 Bacteria 3222
441 Ga0268265_10137513 3300028380 Bacteria 2040
442 Ga0268264_10000005 3300028381 Bacteria 934972
443 Ga0268264_10005001 3300028381 Bacteria 11218
444 Ga0268264_10010103 3300028381 Bacteria 7811
445 Ga0268264_10257260 3300028381 Bacteria 1625
446 Ga0268264_10425878 3300028381 Bacteria 1281
447 Ga0265336_10023226 3300028666 Bacteria 1969
448 Ga0307515_10049214 3300028794 Bacteria 6350
449 Ga0265327_10003360 3300031251 Bacteria 15417
450 Ga0265327_10007674 3300031251 Bacteria 8261
451 Ga0307513_10026057 3300031456 Bacteria 6752
452 Ga0307513_10051706 3300031456 Bacteria 4430
453 Ga0307513_10328386 3300031456 Bacteria 1285
454 Ga0307408_100071279 3300031548 Bacteria 2569
455 Ga0316576_10014864 3300031727 Bacteria 5208
456 Ga0316576_10026583 3300031727 Bacteria 4062
457 Ga0316576_10038890 3300031727 Bacteria 3413
458 Ga0316576_10044572 3300031727 Bacteria 3204
459 Ga0316576_10050442 3300031727 Bacteria 3027
460 Ga0316576_10089315 3300031727 Bacteria 2295
461 Ga0316576_10114759 3300031727 Bacteria 2020
462 Ga0316578_10000199 3300031728 Bacteria 17042
463 Ga0316578_10004340 3300031728 Bacteria 6676
464 Ga0316578_10005773 3300031728 Bacteria 6042
465 Ga0316578_10310667 3300031728 Bacteria 942
466 Ga0316577_10077528 3300031733 Bacteria 1856
467 Ga0316577_10270660 3300031733 Bacteria 961
468 Ga0307413_10284024 3300031824 Bacteria 1246
469 Ga0307518_10004976 3300031838 Bacteria 9506
470 Ga0307406_10604970 3300031901 Bacteria 904
471 Ga0307407_10278727 3300031903 Bacteria 1157
472 Ga0307412_10193861 3300031911 Bacteria 1538
473 Ga0307412_10340767 3300031911 Bacteria 1200
474 Ga0307409_100122099 3300031995 Bacteria 2208
475 Ga0307409_100215620 3300031995 Bacteria 1729
476 Ga0307416_100076770 3300032002 Bacteria 2802
477 Ga0307416_100324519 3300032002 Bacteria 1544
478 Ga0307416_100364835 3300032002 Bacteria 1468
479 Ga0307414_10163103 3300032004 Bacteria 1773
480 Ga0307411_10645651 3300032005 Bacteria 916
481 Ga0307415_100123955 3300032126 Bacteria 1943
482 Ga0307507_10059312 3300033179 Bacteria 3583
483 Ga0307510_10062879 3300033180 Bacteria 3787
484 Ga0373948_0015998 3300034817 Bacteria 1382
485 Ga0373928_0008232 3300035084 Bacteria 2022
486 Ga0373929_0002852 3300035085 Bacteria 3158
487 Ga0373929_0039886 3300035085 Bacteria 1039
488 Ga0373932_0000149 3300035112 Bacteria 19976
489 Ga0373953_0064474 3300035117 Bacteria 1503
490 Ga0373961_0074403 3300035241 Bacteria 1057
491 Ga0316574_0011965 3300035398 Bacteria 4949
492 Ga0316574_0034545 3300035398 Bacteria 3084
493 Ga0316574_0044055 3300035398 Bacteria 2760
494 Ga0316574_0047718 3300035398 Bacteria 2659
495 Ga0316574_0059585 3300035398 Bacteria 2395
496 Ga0316574_0068231 3300035398 Bacteria 2242
497 Ga0316574_0100826 3300035398 Bacteria 1848
498 Ga0316574_0129518 3300035398 Bacteria 1623
499 Ga0316574_0369974 3300035398 Bacteria 905
500 Ga0316574_0414827 3300035398 Bacteria 847
501 Ga0373931_0000005 3300035691 Bacteria 480485
502 Ga0373931_0000070 3300035691 Bacteria 49819
503 Ga0373931_0009617 3300035691 Bacteria 4629
504 Ga0373931_0084331 3300035691 Bacteria 1759
505 Ga0373931_0254889 3300035691 Bacteria 1068
506 Ga0373933_0190829 3300035724 Bacteria 1309
507 Ga0373947_0157853 3300035725 Bacteria 1465
508 Ga0373937_0022133 3300036401 Bacteria 5711
509 Ga0316582_0028824 3300036647 Bacteria 3367
510 Ga0316582_0221947 3300036647 Bacteria 1292
511 Ga0316584_0009292 3300036712 Bacteria 6818
512 Ga0316584_0014998 3300036712 Bacteria 5534
513 Ga0316584_0020525 3300036712 Bacteria 4791
514 Ga0316584_0202556 3300036712 Bacteria 1464
515 Ga0373925_0337512 3300037068 Bacteria 1222
516 Ga0395905_0134481 3300037471 Bacteria 2326
517 Ga0436364_0247820 3300037853 Bacteria 988
518 Ga0436364_0376382 3300037853 Bacteria 1913
519 Ga0436364_0627822 3300037853 Bacteria 7432
520 Ga0436364_0812123 3300037853 Bacteria 1875
521 Ga0436364_0859478 3300037853 Bacteria 14849
522 Ga0436364_1330762 3300037853 Bacteria 1040
523 Ga0395901_0829400 3300038443 Bacteria 912
524 Ga0400485_08781 3300038735 Bacteria 4917
525 Ga0400483_027616 3300039062 Bacteria 1071
526 Ga0400483_058092 3300039062 Bacteria 1235
527 Ga0400483_128414 3300039062 Bacteria 7994
528 Ga0436365_0530475 3300039437 Bacteria 1512
529 Ga0436365_0712680 3300039437 Bacteria 47182
530 Ga0436365_0983079 3300039437 Bacteria 6284
531 Ga0436365_1888780 3300039437 Bacteria 23476
532 Ga0436361_0376062 3300039447 Bacteria 833
533 Ga0436363_0223575 3300039450 Bacteria 1264
534 Ga0436363_0709713 3300039450 Bacteria 1144
535 Ga0436363_0836064 3300039450 Bacteria 1304
536 Ga0439436_0045543 3300041404 Bacteria 1248
537 Ga0439439_0004099 3300041406 Bacteria 3258
538 Ga0439461_0024936 3300041410 Bacteria 1212
539 Ga0439466_0020218 3300041411 Bacteria 2375
540 Ga0439465_0002227 3300041413 Bacteria 6360
541 Ga0439465_0002339 3300041413 Bacteria 6218
542 Ga0439465_0040516 3300041413 Bacteria 1506
543 Ga0439465_0070137 3300041413 Bacteria 1173
544 Ga0451807_2366488 3300041486 Bacteria 889
545 Ga0439442_037188 3300042002 Bacteria 1020
546 Ga0439445_0003083 3300042004 Bacteria 3733
547 Ga0439445_0093555 3300042004 Bacteria 848
548 Ga0439448_0087574 3300042005 Bacteria 1050
549 Ga0439452_032504 3300042010 Bacteria 1273
550 Ga0439452_058374 3300042010 Bacteria 869
551 Ga0450902_017562 3300042137 Bacteria 1170
552 Ga0439458_0089914 3300042157 Bacteria 790
553 Ga0439434_0074525 3300042435 Bacteria 1071
554 Ga0439444_0027144 3300042437 Bacteria 1052
555 Ga0439464_0001811 3300042439 Bacteria 5160
556 Ga0439460_0012259 3300042461 Bacteria 2221
557 Ga0451577_0000984 3300042876 Bacteria 41467
558 Ga0466969_0117815 3300044656 Bacteria 1238
559 Ga0466972_0002130 3300044658 Bacteria 9720
560 Ga0466972_0015250 3300044658 Bacteria 3842
561 Ga0466972_0018390 3300044658 Bacteria 3493
562 Ga0466972_0024503 3300044658 Bacteria 2994
563 Ga0466972_0045367 3300044658 Bacteria 2131
564 Ga0466972_0092925 3300044658 Bacteria 1430
565 Ga0466972_0097287 3300044658 Bacteria 1394
566 Ga0466965_0003626 3300044683 Bacteria 6802
567 Ga0466965_0008281 3300044683 Bacteria 4806
568 Ga0466965_0020332 3300044683 Bacteria 3190
569 Ga0466965_0029783 3300044683 Bacteria 2657
570 Ga0466961_0033971 3300044693 Bacteria 3276
571 Ga0466961_0109723 3300044693 Bacteria 1737
572 Ga0466961_0109927 3300044693 Bacteria 1735
573 Ga0466961_0400133 3300044693 Bacteria 833
574 Ga0466963_0033417 3300044694 Bacteria 3339
575 Ga0466963_0065377 3300044694 Bacteria 2438
576 Ga0466963_0101673 3300044694 Bacteria 1968
577 Ga0466963_0330718 3300044694 Bacteria 1073
578 Ga0466963_0362285 3300044694 Bacteria 1021
579 Ga0466964_0014296 3300044706 Bacteria 3018
580 Ga0453684_0010613 3300044712 Bacteria 15709
581 Ga0466971_0087645 3300044719 Bacteria 1423
582 Ga0466971_0097761 3300044719 Bacteria 1347
583 Ga0466971_0216303 3300044719 Bacteria 907
584 Ga0466968_0018033 3300044735 Bacteria 2828
585 Ga0466968_0127631 3300044735 Bacteria 1155
586 Ga0466968_0223036 3300044735 Bacteria 888
587 Ga0466970_0003910 3300044765 Bacteria 7297
588 Ga0466970_0088771 3300044765 Bacteria 1676
589 Ga0466970_0218293 3300044765 Bacteria 1064
590 Ga0466957_0004259 3300044842 Bacteria 7931
591 Ga0466957_0122562 3300044842 Bacteria 1658
592 Ga0466957_0216742 3300044842 Bacteria 1262
593 Ga0466960_0000482 3300044901 Bacteria 13577
594 Ga0466960_0000689 3300044901 Bacteria 11770
595 Ga0466960_0002286 3300044901 Bacteria 7173
596 Ga0466960_0007001 3300044901 Bacteria 4554
597 Ga0466960_0021941 3300044901 Bacteria 2849
598 Ga0466960_0127999 3300044901 Bacteria 1337
599 Ga0466960_0128351 3300044901 Bacteria 1335
600 Ga0466960_0167517 3300044901 Bacteria 1184
601 Ga0466959_0004691 3300045049 Bacteria 9203
602 Ga0466959_0091764 3300045049 Bacteria 2180
603 Ga0451576_0758626 3300045051 Bacteria 1019
604 Ga0466958_0005121 3300045836 Bacteria 7007
605 Ga0466958_0008266 3300045836 Bacteria 5763
606 Ga0466958_0071272 3300045836 Bacteria 2128
607 Ga0466958_0089696 3300045836 Bacteria 1901
608 Ga0466958_0130648 3300045836 Bacteria 1577
609 Ga0466958_0198345 3300045836 Bacteria 1277
610 Ga0466967_0012840 3300045976 Bacteria 6437
611 Ga0466967_0021263 3300045976 Bacteria 5264
612 Ga0466967_0069194 3300045976 Bacteria 3154
613 Ga0466967_0089291 3300045976 Bacteria 2798
614 Ga0466967_0106514 3300045976 Bacteria 2570
615 Ga0466967_0592523 3300045976 Bacteria 1094
616 Ga0466967_0650624 3300045976 Bacteria 1042
617 Ga0466967_0739844 3300045976 Bacteria 975
618 Ga0466967_1124399 3300045976 Bacteria 783
619 Ga0495592_0118747 3300046454 Bacteria 1863
620 Ga0495629_0004180 3300046459 Bacteria 10839
621 Ga0495629_0429982 3300046459 Bacteria 895
622 Ga0495641_0017750 3300046461 Bacteria 3696
623 Ga0495641_0107633 3300046461 Bacteria 1244
624 Ga0495651_0142745 3300046462 Bacteria 1734
625 Ga0495653_0227596 3300046463 Bacteria 1250
626 Ga0495582_0135980 3300046473 Bacteria 1391
627 Ga0495582_0154983 3300046473 Bacteria 1301
628 Ga0495662_0062556 3300046476 Bacteria 1798
629 Ga0495583_0016279 3300046506 Bacteria 4007
630 Ga0495608_0008848 3300046511 Bacteria 7045
631 Ga0495608_0296135 3300046511 Bacteria 1002
632 Ga0495630_0027145 3300046517 Bacteria 4245
633 Ga0495648_0013467 3300046524 Bacteria 6044
634 Ga0495654_0045262 3300046530 Bacteria 2172
635 Ga0495587_0022409 3300046536 Bacteria 3890
636 Ga0495667_0066207 3300046559 Bacteria 2362
637 Ga0495634_0023847 3300046642 Bacteria 4298
638 Ga0495634_0236175 3300046642 Unclassified 1123
639 Ga0495657_0020356 3300046675 Bacteria 4770
640 Ga0495599_0174777 3300046678 Bacteria 1325
641 Ga0495647_0037974 3300046681 Bacteria 1820
642 Ga0495647_0057534 3300046681 Bacteria 1527
643 Ga0495647_0154614 3300046681 Unclassified 985
644 Ga0495658_0003996 3300046683 Bacteria 7266
645 Ga0495658_0039219 3300046683 Bacteria 2627
646 Ga0495613_0007630 3300046689 Bacteria 8046
647 Ga0495613_0161006 3300046689 Bacteria 1597
648 Ga0495624_0112641 3300046690 Bacteria 1673
649 Ga0495649_0231830 3300046694 Bacteria 953
650 Ga0495604_0269251 3300047317 Bacteria 1155
651 Ga0495674_0299903 3300047319 Bacteria 1313
652 Ga0495674_0414921 3300047319 Bacteria 1085
653 Ga0495672_0002606 3300047320 Bacteria 16350
654 Ga0495672_0011184 3300047320 Bacteria 6343
655 Ga0495672_0230903 3300047320 Bacteria 908
656 Ga0495676_0453829 3300047321 Bacteria 845
657 Ga0495680_0076453 3300047322 Bacteria 2538
658 Ga0495680_0180509 3300047322 Bacteria 1524
659 Ga0495673_0003826 3300047469 Bacteria 9720
660 Ga0495684_0213628 3300047471 Bacteria 1417
661 Ga0495686_0001711 3300047472 Bacteria 22657
662 Ga0495593_0082906 3300047673 Bacteria 1657
663 Ga0495626_0069970 3300048091 Bacteria 1580
664 Ga0495626_0072913 3300048091 Bacteria 1539
665 Ga0496100_0001291 3300048903 Bacteria 12229
666 Ga0496100_0002422 3300048903 Bacteria 9454
667 Ga0496100_0003502 3300048903 Bacteria 8196
668 Ga0496100_0006840 3300048903 Bacteria 6249
669 Ga0496100_0065969 3300048903 Bacteria 2400
670 Ga0496100_0067913 3300048903 Bacteria 2369
671 Ga0496100_0123595 3300048903 Bacteria 1814
672 Ga0496101_0000020 3300048904 Bacteria 218859
673 Ga0496101_0000047 3300048904 Bacteria 152715
674 Ga0496101_0001621 3300048904 Bacteria 13519
675 Ga0496101_0003730 3300048904 Bacteria 9504
676 Ga0496101_0025795 3300048904 Bacteria 4080
677 Ga0496101_0100058 3300048904 Bacteria 2168
678 Ga0496101_0239562 3300048904 Bacteria 1412
679 Ga0496102_0000003 3300048905 Bacteria 592263
680 Ga0496102_0000050 3300048905 Bacteria 179469
681 Ga0496102_0000157 3300048905 Bacteria 92353
682 Ga0496102_0004407 3300048905 Bacteria 11898
683 Ga0496102_0041387 3300048905 Bacteria 4172
684 Ga0496102_0050426 3300048905 Bacteria 3789
685 Ga0496102_0131035 3300048905 Bacteria 2347
686 Ga0496102_0523255 3300048905 Bacteria 1108
687 Ga0496103_0000012 3300048906 Bacteria 301778
688 Ga0496103_0000106 3300048906 Bacteria 92315
689 Ga0496103_0000831 3300048906 Bacteria 22700
690 Ga0496103_0001090 3300048906 Bacteria 18900
691 Ga0496103_0002661 3300048906 Bacteria 11186
692 Ga0496103_0150176 3300048906 Bacteria 1492
693 Ga0496104_0040374 3300048907 Bacteria 4373
694 Ga0496104_0117772 3300048907 Bacteria 2549
695 Ga0496104_0419929 3300048907 Bacteria 1249
696 Ga0496104_0572024 3300048907 Bacteria 1040
697 Ga0496105_0019525 3300048908 Bacteria 5468
698 Ga0496105_0046558 3300048908 Bacteria 3580
699 Ga0496105_0499753 3300048908 Bacteria 955
700 Ga0496106_0001356 3300048909 Bacteria 18326
701 Ga0496106_0006678 3300048909 Bacteria 8542
702 Ga0496106_0012798 3300048909 Bacteria 6194
703 Ga0496106_0022520 3300048909 Bacteria 4682
704 Ga0496106_0509002 3300048909 Bacteria 967
705 Ga0496107_0004101 3300048910 Bacteria 9812
706 Ga0496107_0017352 3300048910 Bacteria 5062
707 Ga0496107_0065029 3300048910 Bacteria 2644
708 Ga0496107_0086106 3300048910 Bacteria 2293
709 Ga0496107_0149666 3300048910 Bacteria 1726
710 Ga0496107_0172107 3300048910 Bacteria 1607
711 Ga0496107_0323756 3300048910 Bacteria 1147
712 Ga0496108_0001423 3300048911 Bacteria 18868
713 Ga0496108_0013592 3300048911 Bacteria 6644
714 Ga0496108_0033164 3300048911 Bacteria 4290
715 Ga0496108_0054383 3300048911 Bacteria 3359
716 Ga0496108_0279149 3300048911 Bacteria 1454
717 Ga0496108_0457907 3300048911 Bacteria 1114
718 Ga0496108_0849063 3300048911 Bacteria 786
719 Ga0496109_0000104 3300048912 Bacteria 87994
720 Ga0496109_0015166 3300048912 Bacteria 6708
721 Ga0496109_0109989 3300048912 Bacteria 2562
722 Ga0496109_0134769 3300048912 Bacteria 2307
723 Ga0496109_0153597 3300048912 Bacteria 2156
724 Ga0496109_0505214 3300048912 Bacteria 1141
725 Ga0496109_0908953 3300048912 Bacteria 818
726 Ga0496110_0016323 3300048913 Bacteria 6199
727 Ga0496110_0029430 3300048913 Bacteria 4726
728 Ga0496110_0075396 3300048913 Bacteria 2997
729 Ga0496110_0248476 3300048913 Bacteria 1619
730 Ga0496110_0491377 3300048913 Bacteria 1118
731 Ga0496110_0845403 3300048913 Bacteria 820
732 Ga0496110_0919481 3300048913 Bacteria 781
733 Ga0496111_0023404 3300048914 Bacteria 4336
734 Ga0496111_0243824 3300048914 Bacteria 1334
735 Ga0496112_0045499 3300048915 Bacteria 4302
736 Ga0496112_0172160 3300048915 Bacteria 2130
737 Ga0496112_0331140 3300048915 Bacteria 1466
738 Ga0496112_0385441 3300048915 Bacteria 1342
739 Ga0496113_0003726 3300048916 Bacteria 9191
740 Ga0496113_0174560 3300048916 Bacteria 1703
741 Ga0496113_0260399 3300048916 Bacteria 1386
742 Ga0496113_0464450 3300048916 Bacteria 1017
743 Ga0496113_0521654 3300048916 Bacteria 954
744 Ga0496114_0000793 3300048917 Bacteria 23635
745 Ga0496114_0006229 3300048917 Bacteria 9391
746 Ga0496114_0125026 3300048917 Bacteria 2216
747 Ga0496114_0259054 3300048917 Bacteria 1531
748 Ga0496114_0410902 3300048917 Bacteria 1199
749 Ga0496115_0013217 3300048918 Bacteria 6237
750 Ga0496115_0340559 3300048918 Bacteria 1224
751 Ga0496116_0000040 3300048919 Bacteria 346900
752 Ga0496116_0000724 3300048919 Bacteria 42184
753 Ga0496116_0002883 3300048919 Bacteria 17604
754 Ga0496116_0065784 3300048919 Bacteria 2323
755 Ga0496117_0000003 3300048920 Bacteria 1881097
756 Ga0496117_0000364 3300048920 Bacteria 78857
757 Ga0496117_0000459 3300048920 Bacteria 68055
758 Ga0496117_0063979 3300048920 Bacteria 2511
759 Ga0496117_0202713 3300048920 Bacteria 1119
760 Ga0496118_0000001 3300048921 Bacteria 1881100
761 Ga0496118_0000069 3300048921 Bacteria 203439
762 Ga0496118_0000452 3300048921 Bacteria 67982
763 Ga0496118_0003972 3300048921 Bacteria 18042
764 Ga0496118_0005190 3300048921 Bacteria 14907
765 Ga0496119_0000142 3300048922 Bacteria 100419
766 Ga0496119_0000357 3300048922 Bacteria 64157
767 Ga0496119_0000777 3300048922 Bacteria 42677
768 Ga0496119_0004835 3300048922 Bacteria 13197
769 Ga0496119_0013089 3300048922 Bacteria 6651
770 Ga0496119_0013866 3300048922 Bacteria 6364
771 Ga0496119_0022264 3300048922 Bacteria 4546
772 Ga0496119_0157093 3300048922 Bacteria 1213
773 Ga0496120_0000149 3300048923 Bacteria 116137
774 Ga0496120_0000230 3300048923 Bacteria 96223
775 Ga0496120_0027186 3300048923 Bacteria 3524
776 Ga0496120_0031048 3300048923 Bacteria 3241
777 Ga0496120_0051991 3300048923 Bacteria 2336
778 Ga0496120_0092260 3300048923 Bacteria 1616
779 Ga0496121_0000002 3300048924 Bacteria 1494588
780 Ga0496121_0000019 3300048924 Bacteria 499976
781 Ga0496121_0006622 3300048924 Bacteria 14271
782 Ga0496121_0038561 3300048924 Bacteria 4227
783 Ga0496122_0000078 3300048925 Bacteria 214068
784 Ga0496122_0009230 3300048925 Bacteria 10437
785 Ga0496123_0009351 3300048926 Bacteria 8840
786 Ga0496123_0021371 3300048926 Bacteria 5032
787 Ga0496124_0000002 3300048927 Bacteria 1494588
788 Ga0496124_0048825 3300048927 Bacteria 3613
789 Ga0496124_0303981 3300048927 Bacteria 1150
790 Ga0496125_0000002 3300048928 Bacteria 1480920
791 Ga0496125_0322150 3300048928 Bacteria 936
792 Ga0496126_0000009 3300048929 Bacteria 750350
793 Ga0496126_0000372 3300048929 Bacteria 92561
794 Ga0496126_0000785 3300048929 Bacteria 57203
795 Ga0496126_0007337 3300048929 Bacteria 12109
796 Ga0496126_0022746 3300048929 Bacteria 6089
797 Ga0496126_0033616 3300048929 Bacteria 4823
798 Ga0501031_0021390 3300049568 Bacteria 4217
799 Ga0501031_0086164 3300049568 Bacteria 2048
800 Ga0501031_0230615 3300049568 Bacteria 1205
801 Ga0501032_0009961 3300049569 Bacteria 6862
802 Ga0501032_0010428 3300049569 Bacteria 6701
803 Ga0501032_0084855 3300049569 Bacteria 2105
804 Ga0501033_0003270 3300049570 Bacteria 13411
805 Ga0501033_0023185 3300049570 Bacteria 4681
806 Ga0501033_0150043 3300049570 Bacteria 1682
807 Ga0501033_0369983 3300049570 Bacteria 1002
808 Ga0501034_0003015 3300049571 Bacteria 19477
809 Ga0501034_0004248 3300049571 Bacteria 15979
810 Ga0501034_0008438 3300049571 Bacteria 10883
811 Ga0501034_0012702 3300049571 Bacteria 8689
812 Ga0501034_0047165 3300049571 Bacteria 4352
813 Ga0501034_0065836 3300049571 Bacteria 3637
814 Ga0501034_0112825 3300049571 Bacteria 2708
815 Ga0501034_0122475 3300049571 Bacteria 2587
816 Ga0501034_0245073 3300049571 Bacteria 1737
817 Ga0501034_0319159 3300049571 Bacteria 1487
818 Ga0501034_0499811 3300049571 Bacteria 1130
819 Ga0501036_0014271 3300049572 Bacteria 6609
820 Ga0501036_0034841 3300049572 Bacteria 4259
821 Ga0501036_0051502 3300049572 Bacteria 3486
822 Ga0501036_0084828 3300049572 Bacteria 2678
823 Ga0501036_0087476 3300049572 Bacteria 2634
824 Ga0501036_0157668 3300049572 Bacteria 1914
825 Ga0501036_0264303 3300049572 Bacteria 1441
826 Ga0501036_0657786 3300049572 Bacteria 867
827 Ga0501037_0003227 3300049573 Bacteria 11815
828 Ga0501037_0015365 3300049573 Bacteria 5633
829 Ga0501037_0022637 3300049573 Bacteria 4647
830 Ga0501037_0026732 3300049573 Bacteria 4264
831 Ga0501037_0047676 3300049573 Bacteria 3139
832 Ga0501037_0200147 3300049573 Bacteria 1412
833 Ga0501037_0348440 3300049573 Bacteria 1022
834 Ga0501038_0001047 3300049574 Bacteria 24924
835 Ga0501038_0004575 3300049574 Bacteria 12874
836 Ga0501038_0025858 3300049574 Bacteria 5229
837 Ga0501038_0100483 3300049574 Bacteria 2410
838 Ga0501038_0184883 3300049574 Bacteria 1680
839 Ga0501039_0002201 3300049575 Bacteria 14424
840 Ga0501039_0013791 3300049575 Bacteria 6183
841 Ga0501039_0018503 3300049575 Bacteria 5348
842 Ga0501039_0022559 3300049575 Bacteria 4832
843 Ga0501039_0104330 3300049575 Bacteria 2213
844 Ga0501040_0001028 3300049576 Bacteria 17701
845 Ga0501040_0010664 3300049576 Bacteria 6011
846 Ga0501040_0044056 3300049576 Bacteria 3042
847 Ga0501040_0235571 3300049576 Bacteria 1304
848 Ga0501040_0275533 3300049576 Bacteria 1201
849 Ga0501041_0014439 3300049577 Bacteria 4689
850 Ga0501041_0053843 3300049577 Bacteria 2454
851 Ga0501041_0064393 3300049577 Bacteria 2245
852 Ga0501042_0001091 3300049578 Bacteria 15579
853 Ga0501042_0008175 3300049578 Bacteria 6892
854 Ga0501042_0059318 3300049578 Bacteria 2732
855 Ga0501042_0360269 3300049578 Bacteria 1052
856 Ga0501042_0408711 3300049578 Bacteria 984
857 Ga0501043_0001283 3300049579 Bacteria 22062
858 Ga0501043_0085797 3300049579 Bacteria 2474
859 Ga0501043_0305473 3300049579 Bacteria 1215
860 Ga0501046_0011417 3300049580 Bacteria 7594
861 Ga0501046_0013929 3300049580 Bacteria 6791
862 Ga0501046_0037849 3300049580 Bacteria 3875
863 Ga0501046_0120515 3300049580 Bacteria 1996
864 Ga0501046_0203052 3300049580 Bacteria 1474
865 Ga0501047_0003181 3300049581 Bacteria 15564
866 Ga0501047_0018956 3300049581 Bacteria 6599
867 Ga0501047_0026162 3300049581 Bacteria 5613
868 Ga0501048_0007016 3300049582 Bacteria 8559
869 Ga0501048_0016487 3300049582 Bacteria 5447
870 Ga0501048_0052459 3300049582 Bacteria 2902
871 Ga0501048_0091267 3300049582 Bacteria 2149
872 Ga0501048_0119456 3300049582 Bacteria 1862
873 Ga0501067_0035400 3300049583 Bacteria 2773
874 Ga0501068_0000013 3300049584 Bacteria 62800
875 Ga0501068_0005418 3300049584 Bacteria 6982
876 Ga0501068_0047961 3300049584 Bacteria 2578
877 Ga0501068_0113270 3300049584 Bacteria 1688
878 Ga0501068_0259259 3300049584 Bacteria 1109
879 Ga0501068_0422822 3300049584 Bacteria 860
880 Ga0501069_0004972 3300049585 Bacteria 6896
881 Ga0501069_0013269 3300049585 Bacteria 4390
882 Ga0501070_0003730 3300049586 Bacteria 13150
883 Ga0501070_0006326 3300049586 Bacteria 10077
884 Ga0501070_0011228 3300049586 Bacteria 7563
885 Ga0501070_0032913 3300049586 Bacteria 4336
886 Ga0501070_0041793 3300049586 Bacteria 3818
887 Ga0501070_0099905 3300049586 Bacteria 2401
888 Ga0501070_0109387 3300049586 Bacteria 2284
889 Ga0501070_0114448 3300049586 Bacteria 2228
890 Ga0501070_0703086 3300049586 Bacteria 799
891 Ga0501071_0002096 3300049587 Bacteria 11965
892 Ga0501071_0021003 3300049587 Bacteria 4544
893 Ga0501071_0040463 3300049587 Bacteria 3335
894 Ga0501071_0082547 3300049587 Bacteria 2353
895 Ga0501071_0365927 3300049587 Bacteria 1098
896 Ga0501072_0003265 3300049588 Bacteria 12189
897 Ga0501072_0008699 3300049588 Bacteria 7707
898 Ga0501072_0009253 3300049588 Bacteria 7488
899 Ga0501072_0124912 3300049588 Bacteria 2050
900 Ga0501072_0159627 3300049588 Bacteria 1798
901 Ga0501072_0202909 3300049588 Bacteria 1581
902 Ga0501072_0276087 3300049588 Bacteria 1337
903 Ga0501073_0001051 3300049589 Bacteria 19911
904 Ga0501073_0001202 3300049589 Bacteria 18874
905 Ga0501073_0107172 3300049589 Bacteria 1939
906 Ga0501073_0174778 3300049589 Bacteria 1486
907 Ga0501073_0392660 3300049589 Bacteria 959
908 Ga0501074_0006859 3300049590 Bacteria 8224
909 Ga0501074_0034972 3300049590 Bacteria 3641
910 Ga0501074_0039729 3300049590 Bacteria 3408
911 Ga0501075_0004110 3300049591 Bacteria 9830
912 Ga0501075_0012579 3300049591 Bacteria 6019
913 Ga0501075_0015241 3300049591 Bacteria 5513
914 Ga0501075_0064908 3300049591 Bacteria 2754
915 Ga0501076_0021127 3300049592 Bacteria 4988
916 Ga0501077_0000891 3300049593 Bacteria 17957
917 Ga0501077_0021822 3300049593 Bacteria 4054
918 Ga0501079_0002112 3300049741 Bacteria 14285
919 Ga0501079_0006243 3300049741 Bacteria 8946
920 Ga0501079_0032459 3300049741 Bacteria 4014
921 Ga0501079_0033822 3300049741 Bacteria 3933
922 Ga0501079_0365003 3300049741 Bacteria 1132
923 Ga0501080_0003683 3300049742 Bacteria 13518
924 Ga0501080_0011291 3300049742 Bacteria 8175
925 Ga0501080_0027388 3300049742 Bacteria 5299
926 Ga0501080_0333814 3300049742 Bacteria 1371
927 Ga0501081_0003048 3300049743 Bacteria 10638
928 Ga0501081_0191167 3300049743 Bacteria 1482
929 Ga0501081_0211415 3300049743 Bacteria 1409
930 Ga0501083_0004203 3300049744 Bacteria 10138
931 Ga0501083_0014677 3300049744 Bacteria 5477
932 Ga0501083_0019555 3300049744 Bacteria 4717
933 Ga0501083_0100365 3300049744 Bacteria 1909
934 Ga0501035_0001201 3300049822 Bacteria 26999
935 Ga0501035_0004777 3300049822 Bacteria 12865
936 Ga0501035_0042300 3300049822 Bacteria 4110
937 Ga0501035_0215134 3300049822 Bacteria 1643
938 Ga0501044_0002283 3300049823 Bacteria 21835
939 Ga0501044_0005129 3300049823 Bacteria 14608
940 Ga0501044_0014776 3300049823 Bacteria 8417
941 Ga0501044_0022781 3300049823 Bacteria 6671
942 Ga0501044_0602994 3300049823 Bacteria 991
943 Ga0501045_0001848 3300049824 Bacteria 14314
944 Ga0501045_0010139 3300049824 Bacteria 6593
945 Ga0501045_0025670 3300049824 Bacteria 4237
946 Ga0501045_0049608 3300049824 Bacteria 3061
947 Ga0501045_0444886 3300049824 Bacteria 963
948 Ga0501045_0599149 3300049824 Bacteria 816
949 nmdc:mga03683_207115_c1 3300050489 Bacteria 901
950 nmdc:mga03683_86628_c1 3300050489 Bacteria 1360
951 nmdc:mga03n38_118809_c1 3300050490 Bacteria 1297
952 nmdc:mga03n38_150622_c1 3300050490 Bacteria 1170
953 nmdc:mga03n38_19183_c1 3300050490 Bacteria 2713
954 nmdc:mga03n38_210370_c1 3300050490 Bacteria 1011
955 nmdc:mga03n38_325_c1 3300050490 Bacteria 11543
956 nmdc:mga03n38_36014_c1 3300050490 Bacteria 2125
957 nmdc:mga03n38_42755_c1 3300050490 Bacteria 1982
958 nmdc:mga03n38_72887_c1 3300050490 Bacteria 1593
959 nmdc:mga03n38_7960_c1 3300050490 Bacteria 3776
960 nmdc:mga03n38_83167_c1 3300050490 Bacteria 1509
961 nmdc:mga00v17_139468_c1 3300050491 Bacteria 1554
962 nmdc:mga00v17_158309_c1 3300050491 Bacteria 1457
963 nmdc:mga00v17_165945_c1 3300050491 Bacteria 1423
964 nmdc:mga00v17_177789_c1 3300050491 Bacteria 1373
965 nmdc:mga00v17_248675_c1 3300050491 Bacteria 1153
966 nmdc:mga00v17_2691_c1 3300050491 Bacteria 9117
967 nmdc:mga00v17_335633_c1 3300050491 Bacteria 982
968 nmdc:mga00v17_34630_c1 3300050491 Bacteria 3001
969 nmdc:mga00v17_352591_c1 3300050491 Bacteria 957
970 nmdc:mga00v17_3888_c1 3300050491 Bacteria 7698
971 nmdc:mga00v17_422191_c1 3300050491 Bacteria 866
972 nmdc:mga00v17_55294_c1 3300050491 Bacteria 2424
973 nmdc:mga00v17_65643_c1 3300050491 Bacteria 2240
974 nmdc:mga00v17_74838_c1 3300050491 Bacteria 2105
975 nmdc:mga00v17_8065_c1 3300050491 Bacteria 5654
976 nmdc:mga00v17_88356_c1 3300050491 Bacteria 1943
977 nmdc:mga0yw44_107028_c2 3300050492 Bacteria 954
978 nmdc:mga0yw44_138246_c1 3300050492 Bacteria 1582
979 nmdc:mga0yw44_1794_c1 3300050492 Bacteria 8760
980 nmdc:mga0yw44_24071_c1 3300050492 Bacteria 3440
981 nmdc:mga0yw44_24549_c1 3300050492 Bacteria 3413
982 nmdc:mga0yw44_32973_c1 3300050492 Bacteria 3022
983 nmdc:mga0yw44_385743_c1 3300050492 Bacteria 946
984 nmdc:mga0yw44_418992_c1 3300050492 Bacteria 906
985 nmdc:mga06z11_163148_c1 3300050494 Bacteria 1275
986 nmdc:mga06z11_193207_c1 3300050494 Bacteria 1179
987 nmdc:mga06z11_341926_c1 3300050494 Bacteria 895
988 nmdc:mga06z11_500455_c1 3300050494 Bacteria 736
989 nmdc:mga04h51_96980_c1 3300050495 Bacteria 1069
990 nmdc:mga07m45_189458_c1 3300050496 Bacteria 1196
991 nmdc:mga07m45_218123_c1 3300050496 Bacteria 1110
992 nmdc:mga07m45_238021_c1 3300050496 Bacteria 1059
993 nmdc:mga07m45_52756_c1 3300050496 Bacteria 2296
994 nmdc:mga07m45_9664_c1 3300050496 Bacteria 5012
995 nmdc:mga05p37_10145_c1 3300050507 Bacteria 11180
996 nmdc:mga05p37_14137_c1 3300050507 Bacteria 9579
997 nmdc:mga05p37_624731_c1 3300050507 Bacteria 1212
998 nmdc:mga05p37_99626_c1 3300050507 Bacteria 3579
999 nmdc:mga09592_151398_c1 3300050508 Bacteria 2001
1000 nmdc:mga09592_178633_c1 3300050508 Bacteria 1836
1001 nmdc:mga09592_57199_c1 3300050508 Bacteria 3296
1002 nmdc:mga0qj67_10130_c1 3300050509 Bacteria 7035
1003 nmdc:mga0qj67_250671_c1 3300050509 Bacteria 1437
1004 nmdc:mga0qj67_298076_c1 3300050509 Bacteria 1306
1005 nmdc:mga0qj67_33851_c1 3300050509 Bacteria 3988
1006 nmdc:mga0qj67_59404_c1 3300050509 Bacteria 3032
1007 nmdc:mga0qj67_82039_c1 3300050509 Bacteria 2586
1008 nmdc:mga06r32_24409_c1 3300050510 Bacteria 5612
1009 nmdc:mga06r32_452881_c1 3300050510 Bacteria 1263
1010 nmdc:mga06r32_489869_c1 3300050510 Bacteria 1207
1011 nmdc:mga06r32_5459_c1 3300050510 Bacteria 11449
1012 nmdc:mga06r32_74568_c1 3300050510 Bacteria 3290
1013 nmdc:mga06r32_869417_c1 3300050510 Bacteria 859
1014 nmdc:mga06r32_99237_c1 3300050510 Bacteria 2856
1015 nmdc:mga08y16_134535_c1 3300050511 Bacteria 2569
1016 nmdc:mga08y16_149844_c1 3300050511 Bacteria 2425
1017 nmdc:mga08y16_284935_c1 3300050511 Bacteria 1704
1018 nmdc:mga08y16_284953_c1 3300050511 Bacteria 1704
1019 nmdc:mga08y16_51066_c1 3300050511 Bacteria 4326
1020 nmdc:mga08y16_672453_c1 3300050511 Bacteria 1037
1021 nmdc:mga0n895_368504_c1 3300050512 Bacteria 1454
1022 nmdc:mga0sz30_16094_c2 3300050516 Bacteria 2103
1023 nmdc:mga0sz30_2056_c1 3300050516 Bacteria 7194
1024 nmdc:mga0sz30_20615_c2 3300050516 Bacteria 2235
1025 nmdc:mga0sz30_28900_c1 3300050516 Bacteria 2283
1026 nmdc:mga0sz30_776_c1 3300050516 Bacteria 11640
1027 Ga0495612_0129504 3300053078 Bacteria 1090
1028 Ga0495612_0198064 3300053078 Bacteria 886
1029 Ga0500635_0003906 3300053080 Bacteria 3793
1030 Ga0495595_0001572 3300053084 Bacteria 8919
1031 Ga0495595_0024247 3300053084 Bacteria 2679
1032 Ga0495619_0007407 3300053085 Bacteria 6956
1033 Ga0495619_0030618 3300053085 Bacteria 3483
1034 Ga0500642_0154738 3300053130 Bacteria 1076
1035 Ga0500652_000964 3300053131 Bacteria 9516
1036 Ga0500568_0000189 3300053139 Bacteria 53789
1037 Ga0500616_0029359 3300053153 Bacteria 3026
1038 Ga0500616_0037029 3300053153 Bacteria 2643
1039 Ga0500616_0059240 3300053153 Bacteria 1989
1040 Ga0501084_0000230 3300054114 Bacteria 42013
1041 Ga0501084_0001967 3300054114 Bacteria 16416
1042 Ga0501084_0009101 3300054114 Bacteria 8217
1043 Ga0501084_0018562 3300054114 Bacteria 5789
1044 Ga0501084_0072851 3300054114 Bacteria 2877
1045 Ga0501084_0124642 3300054114 Bacteria 2167
1046 Ga0501084_0540733 3300054114 Bacteria 984
1047 Ga0501082_0008758 3300060353 Bacteria 8722
1048 Ga0501082_0035405 3300060353 Bacteria 4303
1049 Ga0501082_0224402 3300060353 Bacteria 1635
1050 Ga0501082_0450888 3300060353 Bacteria 1124
1051 Ga0466962_0007543 3300061719 Bacteria 5220
1052 Ga0466962_0055138 3300061719 Bacteria 1899
1053 Ga0466962_0134781 3300061719 Bacteria 1195
1054 Ga0530510_0001967 3300061734 Bacteria 14070
1055 Ga0530510_0026019 3300061734 Bacteria 4185
1056 Ga0530510_0048339 3300061734 Bacteria 3075
1057 Ga0530510_0068608 3300061734 Bacteria 2572
1058 Ga0530510_0228622 3300061734 Bacteria 1383
1059 Ga0530510_0504623 3300061734 Bacteria 917

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0247820 Ga0436364_0247820_211_795 194
2 3300049570 Ga0501033_0150043 Ga0501033_0150043_1056_1649 195
3 3300031733 Ga0316577_10270660 Ga0316577_102706601 203
4 3300035398 Ga0316574_0414827 Ga0316574_0414827_20_631 203
5 3300005347 Ga0070668_100665440 Ga0070668_1006654402 209
6 3300005445 Ga0070708_100013579 Ga0070708_1000135793 211
7 3300006178 Ga0075367_10043148 Ga0075367_100431482 211
8 3300045976 Ga0466967_0021263 Ga0466967_0021263_4616_5251 211
9 3300046473 Ga0495582_0154983 Ga0495582_0154983_82_726 211
10 3300049579 Ga0501043_0305473 Ga0501043_0305473_533_1171 211
11 3300005367 Ga0070667_100000420 Ga0070667_10000042018 216
12 3300005841 Ga0068863_100000818 Ga0068863_10000081830 216
13 3300026088 Ga0207641_10002348 Ga0207641_1000234818 216
14 3300026095 Ga0207676_11227877 Ga0207676_112278771 216
15 3300026118 Ga0207675_100468746 Ga0207675_1004687461 216
16 3300044658 Ga0466972_0045367 Ga0466972_0045367_1457_2107 216
17 3300044658 Ga0466972_0092925 Ga0466972_0092925_26_676 216
18 3300045976 Ga0466967_0650624 Ga0466967_0650624_377_1027 216
19 3300048903 Ga0496100_0065969 Ga0496100_0065969_70_720 216
20 3300048927 Ga0496124_0303981 Ga0496124_0303981_71_721 216
21 3300049824 Ga0501045_0599149 Ga0501045_0599149_154_804 216
22 3300035398 Ga0316574_0059585 Ga0316574_0059585_354_1031 222
23 3300005333 Ga0070677_10024226 Ga0070677_100242263 223
24 3300005356 Ga0070674_100067195 Ga0070674_1000671952 223
25 3300005615 Ga0070702_100070855 Ga0070702_1000708552 223
26 3300005719 Ga0068861_100207767 Ga0068861_1002077672 223
27 3300009148 Ga0105243_10696557 Ga0105243_106965572 223
28 3300009177 Ga0105248_10250908 Ga0105248_102509082 223
29 3300009553 Ga0105249_10610163 Ga0105249_106101632 223
30 3300013308 Ga0157375_11053991 Ga0157375_110539911 223
31 3300014326 Ga0157380_10052902 Ga0157380_100529024 223
32 3300017792 Ga0163161_10010290 Ga0163161_100102903 223
33 3300025937 Ga0207669_10057021 Ga0207669_100570213 223
34 3300025941 Ga0207711_10072739 Ga0207711_100727392 223
35 3300025961 Ga0207712_10310735 Ga0207712_103107352 223
36 3300026089 Ga0207648_10168992 Ga0207648_101689922 223
37 3300031727 Ga0316576_10026583 Ga0316576_100265832 223
38 3300031727 Ga0316576_10044572 Ga0316576_100445723 223
39 3300031727 Ga0316576_10114759 Ga0316576_101147592 223
40 3300031728 Ga0316578_10000199 Ga0316578_100001993 223
41 3300031728 Ga0316578_10005773 Ga0316578_100057733 223
42 3300031733 Ga0316577_10077528 Ga0316577_100775282 223
43 3300035398 Ga0316574_0011965 Ga0316574_0011965_3189_3863 223
44 3300035398 Ga0316574_0044055 Ga0316574_0044055_538_1212 223
45 3300035398 Ga0316574_0047718 Ga0316574_0047718_1110_1784 223
46 3300035398 Ga0316574_0100826 Ga0316574_0100826_699_1373 223
47 3300036647 Ga0316582_0221947 Ga0316582_0221947_261_935 223
48 3300036712 Ga0316584_0009292 Ga0316584_0009292_1546_2220 223
49 3300006051 Ga0075364_10109496 Ga0075364_101094962 224
50 3300041413 Ga0439465_0040516 Ga0439465_0040516_406_1110 225
51 3300046681 Ga0495647_0037974 Ga0495647_0037974_552_1244 225
52 3300049572 Ga0501036_0084828 Ga0501036_0084828_200_895 225
53 3300049576 Ga0501040_0044056 Ga0501040_0044056_46_741 225
54 3300049587 Ga0501071_0365927 Ga0501071_0365927_386_1081 225
55 3300049588 Ga0501072_0202909 Ga0501072_0202909_631_1326 225
56 3300049824 Ga0501045_0444886 Ga0501045_0444886_138_833 225
57 3300060353 Ga0501082_0450888 Ga0501082_0450888_292_987 225
58 3300061734 Ga0530510_0048339 Ga0530510_0048339_1817_2512 225
59 3300031727 Ga0316576_10014864 Ga0316576_100148643 227
60 3300035398 Ga0316574_0369974 Ga0316574_0369974_177_875 227
61 3300048910 Ga0496107_0323756 Ga0496107_0323756_441_1124 227
62 iso_pu_bacteria 2558860112 2558908353 227
63 3300035398 Ga0316574_0034545 Ga0316574_0034545_1282_2007 228
64 3300035398 Ga0316574_0129518 Ga0316574_0129518_387_1088 228
65 3300005445 Ga0070708_100352634 Ga0070708_1003526341 230
66 3300005548 Ga0070665_100349835 Ga0070665_1003498352 231
67 3300025923 Ga0207681_10773482 Ga0207681_107734821 231
68 3300025986 Ga0207658_10182743 Ga0207658_101827432 231
69 3300031456 Ga0307513_10026057 Ga0307513_100260574 231
70 3300037471 Ga0395905_0134481 Ga0395905_0134481_700_1401 231
71 iso_pu_bacteria 2870782633 2870785241 231
72 iso_pu_bacteria 2899370129 2899372242 231
73 iso_pu_bacteria 2915358134 2915359679 231
74 3300005844 Ga0068862_100187054 Ga0068862_1001870542 232
75 3300049570 Ga0501033_0369983 Ga0501033_0369983_184_882 232
76 3300049571 Ga0501034_0245073 Ga0501034_0245073_682_1380 232
77 3300049573 Ga0501037_0200147 Ga0501037_0200147_30_728 232
78 3300049580 Ga0501046_0203052 Ga0501046_0203052_585_1283 232
79 3300049581 Ga0501047_0026162 Ga0501047_0026162_4606_5304 232
80 3300049822 Ga0501035_0004777 Ga0501035_0004777_6898_7596 232
81 3300049823 Ga0501044_0014776 Ga0501044_0014776_3108_3806 232
82 3300053130 Ga0500642_0154738 Ga0500642_0154738_352_1050 232
83 iso_pu_bacteria 2576861822 2579748889 232
84 iso_pu_bacteria 2582580736 2583149795 232
85 iso_pu_bacteria 2585427649 2586061465 232
86 iso_pu_bacteria 2671180195 2671838011 232
87 iso_pu_bacteria 2684623035 2686536452 232
88 iso_pu_bacteria 2687453743 2689989930 232
89 iso_pu_bacteria 2773857922 2774856167 232
90 iso_pu_bacteria 2808606522 2809589440 232
91 iso_pu_bacteria 2866612099 2866617563 232
92 iso_pu_bacteria 2895880812 2895883528 232
93 iso_pu_bacteria 2899359706 2899361900 232
94 iso_pu_bacteria 2915768154 2915772608 232
95 iso_pu_bacteria 2917736166 2917736461 232
96 iso_pu_bacteria 8003314358 8003323450 232
97 iso_pu_bacteria 8054472261 8054474675 232
98 iso_pu_bacteria 8054913762 8054919803 232
99 iso_pu_bacteria 8054920844 8054926344 232
100 iso_pu_bacteria 8055157932 8055163266 232
101 3300005548 Ga0070665_100007100 Ga0070665_1000071009 233
102 3300005614 Ga0068856_101060738 Ga0068856_1010607381 233
103 3300005841 Ga0068863_100105276 Ga0068863_1001052763 233
104 3300005841 Ga0068863_100108056 Ga0068863_1001080563 233
105 3300005843 Ga0068860_100100455 Ga0068860_1001004552 233
106 3300009101 Ga0105247_10185289 Ga0105247_101852892 233
107 3300014968 Ga0157379_10067726 Ga0157379_100677262 233
108 3300025936 Ga0207670_10006353 Ga0207670_100063536 233
109 3300025972 Ga0207668_10029503 Ga0207668_100295033 233
110 3300026078 Ga0207702_10836713 Ga0207702_108367132 233
111 3300026088 Ga0207641_10023303 Ga0207641_100233036 233
112 3300026088 Ga0207641_10090704 Ga0207641_100907043 233
113 3300028379 Ga0268266_10074167 Ga0268266_100741673 233
114 3300028381 Ga0268264_10010103 Ga0268264_100101036 233
115 3300035724 Ga0373933_0190829 Ga0373933_0190829_539_1258 233
116 3300039437 Ga0436365_0712680 Ga0436365_0712680_46146_46853 233
117 3300044694 Ga0466963_0065377 Ga0466963_0065377_346_1047 233
118 3300044706 Ga0466964_0014296 Ga0466964_0014296_931_1632 233
119 3300045976 Ga0466967_0106514 Ga0466967_0106514_88_789 233
120 3300046461 Ga0495641_0107633 Ga0495641_0107633_83_793 233
121 3300046462 Ga0495651_0142745 Ga0495651_0142745_147_866 233
122 3300046511 Ga0495608_0008848 Ga0495608_0008848_5026_5745 233
123 3300046536 Ga0495587_0022409 Ga0495587_0022409_108_827 233
124 3300046675 Ga0495657_0020356 Ga0495657_0020356_1895_2614 233
125 3300046678 Ga0495599_0174777 Ga0495599_0174777_79_798 233
126 3300047319 Ga0495674_0299903 Ga0495674_0299903_328_1047 233
127 3300047322 Ga0495680_0076453 Ga0495680_0076453_417_1136 233
128 3300047471 Ga0495684_0213628 Ga0495684_0213628_398_1117 233
129 3300048903 Ga0496100_0001291 Ga0496100_0001291_9338_10039 233
130 3300048904 Ga0496101_0001621 Ga0496101_0001621_4597_5298 233
131 3300048905 Ga0496102_0000157 Ga0496102_0000157_63073_63774 233
132 3300048906 Ga0496103_0000106 Ga0496103_0000106_28591_29292 233
133 3300048907 Ga0496104_0117772 Ga0496104_0117772_1678_2379 233
134 3300048908 Ga0496105_0046558 Ga0496105_0046558_1193_1894 233
135 3300048910 Ga0496107_0065029 Ga0496107_0065029_1098_1799 233
136 3300048912 Ga0496109_0109989 Ga0496109_0109989_410_1111 233
137 3300048919 Ga0496116_0000724 Ga0496116_0000724_28620_29321 233
138 3300048920 Ga0496117_0000364 Ga0496117_0000364_49576_50277 233
139 3300048921 Ga0496118_0000069 Ga0496118_0000069_173954_174655 233
140 3300048922 Ga0496119_0000777 Ga0496119_0000777_2766_3467 233
141 3300048923 Ga0496120_0031048 Ga0496120_0031048_527_1228 233
142 3300048924 Ga0496121_0006622 Ga0496121_0006622_12014_12715 233
143 3300048927 Ga0496124_0048825 Ga0496124_0048825_1057_1758 233
144 3300048928 Ga0496125_0322150 Ga0496125_0322150_15_716 233
145 3300048929 Ga0496126_0000372 Ga0496126_0000372_63076_63777 233
146 3300049571 Ga0501034_0012702 Ga0501034_0012702_6709_7419 233
147 3300053084 Ga0495595_0001572 Ga0495595_0001572_1606_2325 233
148 3300053085 Ga0495619_0030618 Ga0495619_0030618_2088_2807 233
149 3300061719 Ga0466962_0134781 Ga0466962_0134781_379_1080 233
150 iso_pu_bacteria 2643221687 2644486976 233
151 iso_pu_bacteria 2643221715 2644635128 233
152 iso_pu_bacteria 2738541264 2738664162 233
153 iso_pu_bacteria 2738541356 2739143297 233
154 iso_pu_bacteria 2842134933 2842136665 233
155 iso_pu_bacteria 2902792274 2902792858 233
156 iso_pu_bacteria 2902810491 2902813846 233
157 iso_pu_bacteria 2902837492 2902841881 233
158 iso_pu_bacteria 2929212328 2929213669 233
159 3300005440 Ga0070705_100029772 Ga0070705_1000297723 234
160 3300005444 Ga0070694_100248455 Ga0070694_1002484552 234
161 3300005458 Ga0070681_10028887 Ga0070681_100288873 234
162 3300005458 Ga0070681_10109599 Ga0070681_101095992 234
163 3300005545 Ga0070695_100055433 Ga0070695_1000554332 234
164 3300005546 Ga0070696_100017803 Ga0070696_1000178032 234
165 3300005563 Ga0068855_100410772 Ga0068855_1004107722 234
166 3300005937 Ga0081455_10053243 Ga0081455_100532435 234
167 3300006844 Ga0075428_100063605 Ga0075428_1000636053 234
168 3300006846 Ga0075430_100179845 Ga0075430_1001798452 234
169 3300006847 Ga0075431_100241443 Ga0075431_1002414433 234
170 3300006871 Ga0075434_100394812 Ga0075434_1003948122 234
171 3300006880 Ga0075429_100050085 Ga0075429_1000500852 234
172 3300006880 Ga0075429_100123804 Ga0075429_1001238042 234
173 3300009094 Ga0111539_10007896 Ga0111539_1000789610 234
174 3300009094 Ga0111539_10008660 Ga0111539_100086605 234
175 3300009147 Ga0114129_10033012 Ga0114129_100330125 234
176 3300009148 Ga0105243_10371859 Ga0105243_103718592 234
177 3300025912 Ga0207707_10031389 Ga0207707_100313892 234
178 3300025935 Ga0207709_10354787 Ga0207709_103547872 234
179 3300027907 Ga0207428_10128299 Ga0207428_101282993 234
180 3300031548 Ga0307408_100071279 Ga0307408_1000712792 234
181 3300041404 Ga0439436_0045543 Ga0439436_0045543_42_752 234
182 3300041406 Ga0439439_0004099 Ga0439439_0004099_452_1162 234
183 3300042010 Ga0439452_032504 Ga0439452_032504_76_816 234
184 3300042137 Ga0450902_017562 Ga0450902_017562_232_1014 234
185 3300042435 Ga0439434_0074525 Ga0439434_0074525_10_750 234
186 3300044693 Ga0466961_0109723 Ga0466961_0109723_587_1294 234
187 3300044735 Ga0466968_0127631 Ga0466968_0127631_111_821 234
188 3300045976 Ga0466967_1124399 Ga0466967_1124399_28_741 234
189 3300048907 Ga0496104_0419929 Ga0496104_0419929_22_741 234
190 3300049578 Ga0501042_0408711 Ga0501042_0408711_167_886 234
191 3300049585 Ga0501069_0004972 Ga0501069_0004972_5076_5789 234
192 3300049586 Ga0501070_0003730 Ga0501070_0003730_1355_2068 234
193 3300049587 Ga0501071_0002096 Ga0501071_0002096_6446_7159 234
194 3300049589 Ga0501073_0001051 Ga0501073_0001051_8057_8770 234
195 3300049590 Ga0501074_0034972 Ga0501074_0034972_1975_2688 234
196 3300049741 Ga0501079_0002112 Ga0501079_0002112_7686_8399 234
197 3300049742 Ga0501080_0003683 Ga0501080_0003683_12717_13430 234
198 3300049744 Ga0501083_0004203 Ga0501083_0004203_7286_7999 234
199 3300050490 nmdc:mga03n38_150622_c1 nmdc:mga03n38_150622_c1_182_904 234
200 3300050492 nmdc:mga0yw44_32973_c1 nmdc:mga0yw44_32973_c1_2181_2891 234
201 3300050507 nmdc:mga05p37_10145_c1 nmdc:mga05p37_10145_c1_2242_2964 234
202 3300050507 nmdc:mga05p37_624731_c1 nmdc:mga05p37_624731_c1_351_1073 234
203 3300050509 nmdc:mga0qj67_82039_c1 nmdc:mga0qj67_82039_c1_1196_1918 234
204 3300050510 nmdc:mga06r32_489869_c1 nmdc:mga06r32_489869_c1_146_868 234
205 3300050510 nmdc:mga06r32_5459_c1 nmdc:mga06r32_5459_c1_5103_5825 234
206 3300050511 nmdc:mga08y16_284935_c1 nmdc:mga08y16_284935_c1_563_1285 234
207 3300050511 nmdc:mga08y16_284953_c1 nmdc:mga08y16_284953_c1_669_1391 234
208 3300050511 nmdc:mga08y16_672453_c1 nmdc:mga08y16_672453_c1_177_887 234
209 3300050512 nmdc:mga0n895_368504_c1 nmdc:mga0n895_368504_c1_542_1252 234
210 3300054114 Ga0501084_0009101 Ga0501084_0009101_1661_2374 234
211 3300061734 Ga0530510_0504623 Ga0530510_0504623_139_858 234
212 3300005328 Ga0070676_10009545 Ga0070676_100095454 235
213 3300005329 Ga0070683_100139575 Ga0070683_1001395753 235
214 3300005344 Ga0070661_100116760 Ga0070661_1001167602 235
215 3300005345 Ga0070692_10225373 Ga0070692_102253731 235
216 3300005354 Ga0070675_100115777 Ga0070675_1001157771 235
217 3300005364 Ga0070673_100427071 Ga0070673_1004270711 235
218 3300005435 Ga0070714_100429440 Ga0070714_1004294402 235
219 3300005445 Ga0070708_100045457 Ga0070708_1000454572 235
220 3300005456 Ga0070678_100110382 Ga0070678_1001103822 235
221 3300005466 Ga0070685_10410993 Ga0070685_104109931 235
222 3300005467 Ga0070706_100005155 Ga0070706_10000515513 235
223 3300005518 Ga0070699_100301033 Ga0070699_1003010332 235
224 3300005530 Ga0070679_100143533 Ga0070679_1001435332 235
225 3300005614 Ga0068856_100609976 Ga0068856_1006099762 235
226 3300005719 Ga0068861_100503038 Ga0068861_1005030382 235
227 3300005937 Ga0081455_10011754 Ga0081455_100117543 235
228 3300005937 Ga0081455_10243227 Ga0081455_102432272 235
229 3300006038 Ga0075365_10048365 Ga0075365_100483653 235
230 3300006038 Ga0075365_10161480 Ga0075365_101614802 235
231 3300006038 Ga0075365_10215619 Ga0075365_102156192 235
232 3300006844 Ga0075428_100013494 Ga0075428_1000134944 235
233 3300006844 Ga0075428_100044817 Ga0075428_1000448173 235
234 3300006844 Ga0075428_100064989 Ga0075428_1000649891 235
235 3300006846 Ga0075430_100024958 Ga0075430_1000249584 235
236 3300006846 Ga0075430_100247053 Ga0075430_1002470531 235
237 3300006847 Ga0075431_100002922 Ga0075431_10000292213 235
238 3300006847 Ga0075431_100043370 Ga0075431_1000433705 235
239 3300006880 Ga0075429_100083434 Ga0075429_1000834343 235
240 3300006880 Ga0075429_100129666 Ga0075429_1001296663 235
241 3300009094 Ga0111539_10146768 Ga0111539_101467683 235
242 3300009098 Ga0105245_10007676 Ga0105245_1000767610 235
243 3300009147 Ga0114129_10201392 Ga0114129_102013924 235
244 3300010375 Ga0105239_10821585 Ga0105239_108215852 235
245 3300010375 Ga0105239_11037786 Ga0105239_110377861 235
246 3300011119 Ga0105246_10339824 Ga0105246_103398242 235
247 3300013105 Ga0157369_10199327 Ga0157369_101993273 235
248 3300013297 Ga0157378_10381281 Ga0157378_103812812 235
249 3300013306 Ga0163162_10221827 Ga0163162_102218272 235
250 3300014326 Ga0157380_10095069 Ga0157380_100950692 235
251 3300021384 Ga0213876_10006963 Ga0213876_100069637 235
252 3300021388 Ga0213875_10097570 Ga0213875_100975704 235
253 3300025907 Ga0207645_10043029 Ga0207645_100430292 235
254 3300025910 Ga0207684_10015458 Ga0207684_100154586 235
255 3300025917 Ga0207660_10272551 Ga0207660_102725511 235
256 3300025927 Ga0207687_10012713 Ga0207687_100127137 235
257 3300025937 Ga0207669_10437204 Ga0207669_104372041 235
258 3300026078 Ga0207702_10532442 Ga0207702_105324422 235
259 3300026095 Ga0207676_10848985 Ga0207676_108489851 235
260 3300026118 Ga0207675_100314079 Ga0207675_1003140792 235
261 3300026121 Ga0207683_10075414 Ga0207683_100754143 235
262 3300026121 Ga0207683_10155034 Ga0207683_101550343 235
263 3300027907 Ga0207428_10403756 Ga0207428_104037561 235
264 3300031456 Ga0307513_10051706 Ga0307513_100517063 235
265 3300031911 Ga0307412_10193861 Ga0307412_101938613 235
266 3300031911 Ga0307412_10340767 Ga0307412_103407672 235
267 3300032002 Ga0307416_100324519 Ga0307416_1003245192 235
268 3300034817 Ga0373948_0015998 Ga0373948_0015998_276_986 235
269 3300035117 Ga0373953_0064474 Ga0373953_0064474_122_835 235
270 3300035691 Ga0373931_0000070 Ga0373931_0000070_10706_11416 235
271 3300037853 Ga0436364_0859478 Ga0436364_0859478_672_1385 235
272 3300038735 Ga0400485_08781 Ga0400485_08781_3727_4440 235
273 3300039062 Ga0400483_027616 Ga0400483_027616_195_908 235
274 3300039062 Ga0400483_058092 Ga0400483_058092_225_938 235
275 3300039062 Ga0400483_128414 Ga0400483_128414_4021_4734 235
276 3300039437 Ga0436365_0983079 Ga0436365_0983079_3388_4101 235
277 3300039450 Ga0436363_0836064 Ga0436363_0836064_492_1205 235
278 3300042010 Ga0439452_058374 Ga0439452_058374_25_741 235
279 3300042437 Ga0439444_0027144 Ga0439444_0027144_107_829 235
280 3300042439 Ga0439464_0001811 Ga0439464_0001811_968_1690 235
281 3300042461 Ga0439460_0012259 Ga0439460_0012259_608_1330 235
282 3300044658 Ga0466972_0018390 Ga0466972_0018390_1245_1955 235
283 3300044683 Ga0466965_0003626 Ga0466965_0003626_1776_2486 235
284 3300044693 Ga0466961_0033971 Ga0466961_0033971_364_1077 235
285 3300044694 Ga0466963_0033417 Ga0466963_0033417_532_1245 235
286 3300044694 Ga0466963_0101673 Ga0466963_0101673_107_820 235
287 3300044694 Ga0466963_0330718 Ga0466963_0330718_253_966 235
288 3300044719 Ga0466971_0097761 Ga0466971_0097761_10_723 235
289 3300044719 Ga0466971_0216303 Ga0466971_0216303_56_769 235
290 3300044765 Ga0466970_0003910 Ga0466970_0003910_4602_5312 235
291 3300044901 Ga0466960_0002286 Ga0466960_0002286_1510_2220 235
292 3300044901 Ga0466960_0007001 Ga0466960_0007001_3169_3882 235
293 3300045836 Ga0466958_0071272 Ga0466958_0071272_269_982 235
294 3300045836 Ga0466958_0089696 Ga0466958_0089696_643_1356 235
295 3300045976 Ga0466967_0012840 Ga0466967_0012840_3091_3804 235
296 3300045976 Ga0466967_0089291 Ga0466967_0089291_321_1031 235
297 3300046454 Ga0495592_0118747 Ga0495592_0118747_707_1420 235
298 3300046459 Ga0495629_0429982 Ga0495629_0429982_132_845 235
299 3300046473 Ga0495582_0135980 Ga0495582_0135980_483_1199 235
300 3300046476 Ga0495662_0062556 Ga0495662_0062556_345_1061 235
301 3300046506 Ga0495583_0016279 Ga0495583_0016279_867_1655 235
302 3300046511 Ga0495608_0296135 Ga0495608_0296135_276_989 235
303 3300046517 Ga0495630_0027145 Ga0495630_0027145_3077_3796 235
304 3300046559 Ga0495667_0066207 Ga0495667_0066207_1387_2100 235
305 3300046642 Ga0495634_0023847 Ga0495634_0023847_1327_2043 235
306 3300046642 Ga0495634_0236175 Ga0495634_0236175_81_794 235
307 3300046681 Ga0495647_0057534 Ga0495647_0057534_395_1111 235
308 3300046681 Ga0495647_0154614 Ga0495647_0154614_254_967 235
309 3300046683 Ga0495658_0039219 Ga0495658_0039219_69_782 235
310 3300046689 Ga0495613_0007630 Ga0495613_0007630_6677_7393 235
311 3300046689 Ga0495613_0161006 Ga0495613_0161006_106_819 235
312 3300047317 Ga0495604_0269251 Ga0495604_0269251_146_859 235
313 3300048091 Ga0495626_0072913 Ga0495626_0072913_280_990 235
314 3300048911 Ga0496108_0457907 Ga0496108_0457907_194_907 235
315 3300048912 Ga0496109_0908953 Ga0496109_0908953_25_738 235
316 3300048913 Ga0496110_0075396 Ga0496110_0075396_1577_2290 235
317 3300048917 Ga0496114_0410902 Ga0496114_0410902_11_724 235
318 3300048920 Ga0496117_0063979 Ga0496117_0063979_969_1682 235
319 3300048921 Ga0496118_0000452 Ga0496118_0000452_49241_49954 235
320 3300049569 Ga0501032_0010428 Ga0501032_0010428_4120_4833 235
321 3300049570 Ga0501033_0023185 Ga0501033_0023185_706_1419 235
322 3300049571 Ga0501034_0003015 Ga0501034_0003015_6740_7456 235
323 3300049571 Ga0501034_0004248 Ga0501034_0004248_7290_8006 235
324 3300049571 Ga0501034_0047165 Ga0501034_0047165_2882_3592 235
325 3300049571 Ga0501034_0065836 Ga0501034_0065836_858_1571 235
326 3300049572 Ga0501036_0051502 Ga0501036_0051502_60_773 235
327 3300049573 Ga0501037_0026732 Ga0501037_0026732_3150_3863 235
328 3300049573 Ga0501037_0047676 Ga0501037_0047676_2001_2717 235
329 3300049578 Ga0501042_0360269 Ga0501042_0360269_268_990 235
330 3300049580 Ga0501046_0013929 Ga0501046_0013929_4351_5064 235
331 3300049581 Ga0501047_0003181 Ga0501047_0003181_540_1253 235
332 3300049582 Ga0501048_0052459 Ga0501048_0052459_415_1128 235
333 3300049583 Ga0501067_0035400 Ga0501067_0035400_890_1603 235
334 3300049584 Ga0501068_0000013 Ga0501068_0000013_48145_48861 235
335 3300049586 Ga0501070_0006326 Ga0501070_0006326_4264_4980 235
336 3300049586 Ga0501070_0011228 Ga0501070_0011228_2559_3272 235
337 3300049588 Ga0501072_0009253 Ga0501072_0009253_3204_3920 235
338 3300049589 Ga0501073_0001202 Ga0501073_0001202_12903_13619 235
339 3300049589 Ga0501073_0174778 Ga0501073_0174778_407_1120 235
340 3300049590 Ga0501074_0006859 Ga0501074_0006859_2663_3379 235
341 3300049742 Ga0501080_0011291 Ga0501080_0011291_3614_4330 235
342 3300049742 Ga0501080_0333814 Ga0501080_0333814_455_1183 235
343 3300049744 Ga0501083_0014677 Ga0501083_0014677_3435_4151 235
344 3300049744 Ga0501083_0019555 Ga0501083_0019555_3141_3857 235
345 3300049744 Ga0501083_0100365 Ga0501083_0100365_993_1709 235
346 3300049822 Ga0501035_0001201 Ga0501035_0001201_24559_25272 235
347 3300049823 Ga0501044_0002283 Ga0501044_0002283_19245_19958 235
348 3300049823 Ga0501044_0602994 Ga0501044_0602994_12_722 235
349 3300050490 nmdc:mga03n38_7960_c1 nmdc:mga03n38_7960_c1_193_918 235
350 3300050491 nmdc:mga00v17_74838_c1 nmdc:mga00v17_74838_c1_1208_1924 235
351 3300050492 nmdc:mga0yw44_138246_c1 nmdc:mga0yw44_138246_c1_182_898 235
352 3300050508 nmdc:mga09592_151398_c1 nmdc:mga09592_151398_c1_80_802 235
353 3300050509 nmdc:mga0qj67_298076_c1 nmdc:mga0qj67_298076_c1_289_1011 235
354 3300050509 nmdc:mga0qj67_33851_c1 nmdc:mga0qj67_33851_c1_1300_2100 235
355 3300050510 nmdc:mga06r32_74568_c1 nmdc:mga06r32_74568_c1_1276_1998 235
356 3300050510 nmdc:mga06r32_869417_c1 nmdc:mga06r32_869417_c1_27_749 235
357 3300050511 nmdc:mga08y16_134535_c1 nmdc:mga08y16_134535_c1_1558_2280 235
358 3300053078 Ga0495612_0129504 Ga0495612_0129504_269_1006 235
359 3300053078 Ga0495612_0198064 Ga0495612_0198064_141_860 235
360 3300053084 Ga0495595_0024247 Ga0495595_0024247_1459_2172 235
361 3300053085 Ga0495619_0007407 Ga0495619_0007407_2266_2979 235
362 3300053139 Ga0500568_0000189 Ga0500568_0000189_28032_28775 235
363 3300053153 Ga0500616_0037029 Ga0500616_0037029_1867_2589 235
364 3300053153 Ga0500616_0059240 Ga0500616_0059240_627_1340 235
365 3300054114 Ga0501084_0000230 Ga0501084_0000230_16551_17273 235
366 3300054114 Ga0501084_0540733 Ga0501084_0540733_166_888 235
367 3300061719 Ga0466962_0055138 Ga0466962_0055138_891_1604 235
368 3300061734 Ga0530510_0228622 Ga0530510_0228622_84_806 235
369 3300002073 JGI24745J21846_1002320 JGI24745J21846_10023202 236
370 3300002074 JGI24748J21848_1007147 JGI24748J21848_10071472 236
371 3300002077 JGI24744J21845_10001349 JGI24744J21845_100013491 236
372 3300002077 JGI24744J21845_10011490 JGI24744J21845_100114901 236
373 3300003320 rootH2_10039752 rootH2_100397525 236
374 3300003323 rootH1_10169282 rootH1_101692823 236
375 3300003792 Ga0055540_1000118 Ga0055540_100011845 236
376 3300003792 Ga0055540_1000243 Ga0055540_100024346 236
377 3300003792 Ga0055540_1003862 Ga0055540_10038625 236
378 3300003792 Ga0055540_1014158 Ga0055540_10141582 236
379 3300005331 Ga0070670_100107856 Ga0070670_1001078562 236
380 3300005334 Ga0068869_100020924 Ga0068869_1000209247 236
381 3300005334 Ga0068869_100057787 Ga0068869_1000577871 236
382 3300005337 Ga0070682_100082895 Ga0070682_1000828951 236
383 3300005337 Ga0070682_100429136 Ga0070682_1004291361 236
384 3300005338 Ga0068868_100014673 Ga0068868_1000146732 236
385 3300005338 Ga0068868_100200257 Ga0068868_1002002572 236
386 3300005340 Ga0070689_100012121 Ga0070689_1000121212 236
387 3300005341 Ga0070691_10018762 Ga0070691_100187622 236
388 3300005347 Ga0070668_100000242 Ga0070668_10000024210 236
389 3300005347 Ga0070668_100009256 Ga0070668_1000092568 236
390 3300005353 Ga0070669_100005081 Ga0070669_1000050815 236
391 3300005353 Ga0070669_100030328 Ga0070669_1000303283 236
392 3300005353 Ga0070669_100393500 Ga0070669_1003935001 236
393 3300005355 Ga0070671_100002818 Ga0070671_10000281814 236
394 3300005356 Ga0070674_100004607 Ga0070674_1000046075 236
395 3300005356 Ga0070674_100234972 Ga0070674_1002349722 236
396 3300005364 Ga0070673_100182460 Ga0070673_1001824602 236
397 3300005365 Ga0070688_100006748 Ga0070688_1000067484 236
398 3300005366 Ga0070659_100004755 Ga0070659_10000475510 236
399 3300005367 Ga0070667_100000544 Ga0070667_10000054413 236
400 3300005367 Ga0070667_100010100 Ga0070667_1000101008 236
401 3300005367 Ga0070667_100027586 Ga0070667_1000275861 236
402 3300005406 Ga0070703_10074144 Ga0070703_100741441 236
403 3300005434 Ga0070709_10104574 Ga0070709_101045742 236
404 3300005435 Ga0070714_100314014 Ga0070714_1003140142 236
405 3300005435 Ga0070714_100811920 Ga0070714_1008119202 236
406 3300005437 Ga0070710_10003235 Ga0070710_100032354 236
407 3300005437 Ga0070710_10003876 Ga0070710_100038764 236
408 3300005437 Ga0070710_10096464 Ga0070710_100964642 236
409 3300005438 Ga0070701_10024593 Ga0070701_100245933 236
410 3300005439 Ga0070711_100000663 Ga0070711_10000066314 236
411 3300005444 Ga0070694_100044443 Ga0070694_1000444436 236
412 3300005445 Ga0070708_100459079 Ga0070708_1004590792 236
413 3300005455 Ga0070663_100000795 Ga0070663_1000007952 236
414 3300005455 Ga0070663_100010657 Ga0070663_1000106574 236
415 3300005455 Ga0070663_100194434 Ga0070663_1001944341 236
416 3300005456 Ga0070678_100000459 Ga0070678_10000045917 236
417 3300005456 Ga0070678_100676952 Ga0070678_1006769521 236
418 3300005457 Ga0070662_100004396 Ga0070662_10000439610 236
419 3300005457 Ga0070662_100289588 Ga0070662_1002895882 236
420 3300005459 Ga0068867_100007547 Ga0068867_10000754710 236
421 3300005459 Ga0068867_100399728 Ga0068867_1003997281 236
422 3300005466 Ga0070685_10027454 Ga0070685_100274543 236
423 3300005539 Ga0068853_100006833 Ga0068853_10000683310 236
424 3300005539 Ga0068853_100195840 Ga0068853_1001958402 236
425 3300005543 Ga0070672_100129753 Ga0070672_1001297532 236
426 3300005546 Ga0070696_100007179 Ga0070696_1000071799 236
427 3300005547 Ga0070693_100008532 Ga0070693_1000085329 236
428 3300005548 Ga0070665_100012650 Ga0070665_1000126502 236
429 3300005548 Ga0070665_100017385 Ga0070665_1000173858 236
430 3300005548 Ga0070665_100030781 Ga0070665_1000307812 236
431 3300005548 Ga0070665_100359237 Ga0070665_1003592371 236
432 3300005548 Ga0070665_100393789 Ga0070665_1003937892 236
433 3300005549 Ga0070704_100010478 Ga0070704_1000104784 236
434 3300005549 Ga0070704_100228884 Ga0070704_1002288842 236
435 3300005563 Ga0068855_100110559 Ga0068855_1001105593 236
436 3300005563 Ga0068855_100461077 Ga0068855_1004610772 236
437 3300005578 Ga0068854_100000608 Ga0068854_1000006083 236
438 3300005578 Ga0068854_100124372 Ga0068854_1001243722 236
439 3300005615 Ga0070702_100160319 Ga0070702_1001603192 236
440 3300005616 Ga0068852_100436113 Ga0068852_1004361132 236
441 3300005617 Ga0068859_100007479 Ga0068859_1000074798 236
442 3300005617 Ga0068859_100030153 Ga0068859_10003015310 236
443 3300005718 Ga0068866_10004533 Ga0068866_100045332 236
444 3300005718 Ga0068866_10120733 Ga0068866_101207332 236
445 3300005719 Ga0068861_100004705 Ga0068861_1000047059 236
446 3300005719 Ga0068861_100118447 Ga0068861_1001184472 236
447 3300005842 Ga0068858_100001820 Ga0068858_1000018203 236
448 3300005842 Ga0068858_100011821 Ga0068858_1000118215 236
449 3300005842 Ga0068858_100023732 Ga0068858_10002373212 236
450 3300005842 Ga0068858_100394941 Ga0068858_1003949412 236
451 3300005843 Ga0068860_100000048 Ga0068860_100000048167 236
452 3300005843 Ga0068860_100012097 Ga0068860_1000120979 236
453 3300005843 Ga0068860_100577302 Ga0068860_1005773021 236
454 3300005843 Ga0068860_100721246 Ga0068860_1007212461 236
455 3300005844 Ga0068862_100000053 Ga0068862_100000053104 236
456 3300005844 Ga0068862_100015980 Ga0068862_1000159803 236
457 3300005937 Ga0081455_10002841 Ga0081455_100028417 236
458 3300005937 Ga0081455_10031829 Ga0081455_100318294 236
459 3300005937 Ga0081455_10132807 Ga0081455_101328072 236
460 3300005937 Ga0081455_10133779 Ga0081455_101337792 236
461 3300005981 Ga0081538_10049765 Ga0081538_100497652 236
462 3300006038 Ga0075365_10002834 Ga0075365_100028346 236
463 3300006038 Ga0075365_10038635 Ga0075365_100386352 236
464 3300006038 Ga0075365_10040437 Ga0075365_100404372 236
465 3300006038 Ga0075365_10169232 Ga0075365_101692322 236
466 3300006042 Ga0075368_10041498 Ga0075368_100414982 236
467 3300006048 Ga0075363_100002416 Ga0075363_1000024168 236
468 3300006048 Ga0075363_100002790 Ga0075363_1000027905 236
469 3300006048 Ga0075363_100021877 Ga0075363_1000218774 236
470 3300006048 Ga0075363_100022307 Ga0075363_1000223075 236
471 3300006048 Ga0075363_100041344 Ga0075363_1000413442 236
472 3300006048 Ga0075363_100058980 Ga0075363_1000589802 236
473 3300006048 Ga0075363_100096794 Ga0075363_1000967941 236
474 3300006048 Ga0075363_100158657 Ga0075363_1001586572 236
475 3300006048 Ga0075363_100226049 Ga0075363_1002260492 236
476 3300006048 Ga0075363_100236523 Ga0075363_1002365231 236
477 3300006051 Ga0075364_10001709 Ga0075364_100017096 236
478 3300006051 Ga0075364_10002529 Ga0075364_100025294 236
479 3300006051 Ga0075364_10004937 Ga0075364_1000493716 236
480 3300006051 Ga0075364_10008520 Ga0075364_100085207 236
481 3300006051 Ga0075364_10014187 Ga0075364_100141876 236
482 3300006051 Ga0075364_10104427 Ga0075364_101044272 236
483 3300006051 Ga0075364_10187426 Ga0075364_101874262 236
484 3300006051 Ga0075364_10316909 Ga0075364_103169092 236
485 3300006163 Ga0070715_10072627 Ga0070715_100726272 236
486 3300006175 Ga0070712_100001159 Ga0070712_10000115913 236
487 3300006175 Ga0070712_100022461 Ga0070712_1000224613 236
488 3300006175 Ga0070712_100504505 Ga0070712_1005045051 236
489 3300006177 Ga0075362_10018711 Ga0075362_100187112 236
490 3300006177 Ga0075362_10084062 Ga0075362_100840621 236
491 3300006177 Ga0075362_10098756 Ga0075362_100987562 236
492 3300006177 Ga0075362_10225848 Ga0075362_102258482 236
493 3300006178 Ga0075367_10112226 Ga0075367_101122262 236
494 3300006178 Ga0075367_10205360 Ga0075367_102053602 236
495 3300006186 Ga0075369_10001719 Ga0075369_100017196 236
496 3300006186 Ga0075369_10003008 Ga0075369_100030084 236
497 3300006186 Ga0075369_10012059 Ga0075369_100120593 236
498 3300006186 Ga0075369_10028394 Ga0075369_100283944 236
499 3300006186 Ga0075369_10034831 Ga0075369_100348312 236
500 3300006186 Ga0075369_10059482 Ga0075369_100594822 236
501 3300006186 Ga0075369_10115180 Ga0075369_101151802 236
502 3300006186 Ga0075369_10121975 Ga0075369_101219752 236
503 3300006237 Ga0097621_100046178 Ga0097621_1000461782 236
504 3300006353 Ga0075370_10031081 Ga0075370_100310817 236
505 3300006353 Ga0075370_10115673 Ga0075370_101156732 236
506 3300006353 Ga0075370_10167716 Ga0075370_101677162 236
507 3300006353 Ga0075370_10231062 Ga0075370_102310622 236
508 3300006353 Ga0075370_10241140 Ga0075370_102411401 236
509 3300006353 Ga0075370_10274747 Ga0075370_102747471 236
510 3300006358 Ga0068871_100449400 Ga0068871_1004494002 236
511 3300006844 Ga0075428_100004799 Ga0075428_10000479916 236
512 3300006846 Ga0075430_100064811 Ga0075430_1000648111 236
513 3300006846 Ga0075430_100080372 Ga0075430_1000803723 236
514 3300006847 Ga0075431_100491627 Ga0075431_1004916272 236
515 3300006880 Ga0075429_100011604 Ga0075429_1000116042 236
516 3300006881 Ga0068865_100004581 Ga0068865_1000045816 236
517 3300006931 Ga0097620_100007479 Ga0097620_1000074798 236
518 3300006931 Ga0097620_100030152 Ga0097620_10003015210 236
519 3300007788 Ga0099795_10074357 Ga0099795_100743572 236
520 3300009011 Ga0105251_10018513 Ga0105251_100185135 236
521 3300009092 Ga0105250_10139551 Ga0105250_101395512 236
522 3300009094 Ga0111539_10003516 Ga0111539_1000351611 236
523 3300009094 Ga0111539_10382934 Ga0111539_103829342 236
524 3300009094 Ga0111539_10643535 Ga0111539_106435352 236
525 3300009098 Ga0105245_10001283 Ga0105245_1000128320 236
526 3300009098 Ga0105245_10058042 Ga0105245_100580422 236
527 3300009101 Ga0105247_10000118 Ga0105247_1000011826 236
528 3300009101 Ga0105247_10000195 Ga0105247_1000019543 236
529 3300009101 Ga0105247_10000413 Ga0105247_1000041330 236
530 3300009101 Ga0105247_10001525 Ga0105247_1000152515 236
531 3300009101 Ga0105247_10055705 Ga0105247_100557053 236
532 3300009101 Ga0105247_10092793 Ga0105247_100927932 236
533 3300009147 Ga0114129_10001629 Ga0114129_1000162912 236
534 3300009147 Ga0114129_10003146 Ga0114129_1000314615 236
535 3300009147 Ga0114129_10006791 Ga0114129_1000679111 236
536 3300009148 Ga0105243_10000773 Ga0105243_1000077325 236
537 3300009148 Ga0105243_10185687 Ga0105243_101856871 236
538 3300009174 Ga0105241_10012270 Ga0105241_100122703 236
539 3300009176 Ga0105242_10011770 Ga0105242_100117704 236
540 3300009176 Ga0105242_10092028 Ga0105242_100920283 236
541 3300009176 Ga0105242_10583699 Ga0105242_105836991 236
542 3300009177 Ga0105248_10000151 Ga0105248_1000015133 236
543 3300009177 Ga0105248_10007012 Ga0105248_100070122 236
544 3300009177 Ga0105248_10013545 Ga0105248_1001354510 236
545 3300009545 Ga0105237_10013445 Ga0105237_100134454 236
546 3300009545 Ga0105237_10036627 Ga0105237_100366279 236
547 3300009545 Ga0105237_10077118 Ga0105237_100771184 236
548 3300009553 Ga0105249_10000022 Ga0105249_10000022159 236
549 3300009553 Ga0105249_10004515 Ga0105249_1000451510 236
550 3300009553 Ga0105249_10155145 Ga0105249_101551452 236
551 3300009553 Ga0105249_10666839 Ga0105249_106668392 236
552 3300010159 Ga0099796_10057134 Ga0099796_100571342 236
553 3300010375 Ga0105239_10043734 Ga0105239_100437344 236
554 3300010375 Ga0105239_10095488 Ga0105239_100954885 236
555 3300010375 Ga0105239_10580723 Ga0105239_105807231 236
556 3300010375 Ga0105239_10684577 Ga0105239_106845772 236
557 3300011119 Ga0105246_10116320 Ga0105246_101163203 236
558 3300011119 Ga0105246_10374712 Ga0105246_103747121 236
559 3300013105 Ga0157369_10069869 Ga0157369_100698692 236
560 3300013297 Ga0157378_10002823 Ga0157378_1000282316 236
561 3300013297 Ga0157378_10319649 Ga0157378_103196492 236
562 3300013306 Ga0163162_10002292 Ga0163162_1000229214 236
563 3300013306 Ga0163162_10089288 Ga0163162_100892882 236
564 3300013306 Ga0163162_10130397 Ga0163162_101303972 236
565 3300013306 Ga0163162_10940275 Ga0163162_109402751 236
566 3300013306 Ga0163162_11289078 Ga0163162_112890781 236
567 3300013307 Ga0157372_10030734 Ga0157372_1003073410 236
568 3300013307 Ga0157372_10097249 Ga0157372_100972493 236
569 3300013308 Ga0157375_10028525 Ga0157375_100285255 236
570 3300013308 Ga0157375_10082487 Ga0157375_100824874 236
571 3300013308 Ga0157375_10262588 Ga0157375_102625882 236
572 3300013308 Ga0157375_10388900 Ga0157375_103889001 236
573 3300014325 Ga0163163_10003313 Ga0163163_100033134 236
574 3300014325 Ga0163163_11110220 Ga0163163_111102201 236
575 3300014326 Ga0157380_10006763 Ga0157380_100067635 236
576 3300014326 Ga0157380_10212413 Ga0157380_102124132 236
577 3300014326 Ga0157380_10779192 Ga0157380_107791922 236
578 3300014326 Ga0157380_11036224 Ga0157380_110362241 236
579 3300014497 Ga0182008_10113655 Ga0182008_101136551 236
580 3300014745 Ga0157377_10160789 Ga0157377_101607892 236
581 3300014745 Ga0157377_10277956 Ga0157377_102779562 236
582 3300014968 Ga0157379_10001742 Ga0157379_100017427 236
583 3300014968 Ga0157379_10048775 Ga0157379_100487753 236
584 3300014968 Ga0157379_10106220 Ga0157379_101062203 236
585 3300014968 Ga0157379_10265772 Ga0157379_102657722 236
586 3300014969 Ga0157376_10106149 Ga0157376_101061493 236
587 3300017792 Ga0163161_10000939 Ga0163161_1000093922 236
588 3300017792 Ga0163161_10095548 Ga0163161_100955482 236
589 3300021384 Ga0213876_10005702 Ga0213876_100057026 236
590 3300021388 Ga0213875_10178359 Ga0213875_101783591 236
591 3300024225 Ga0224572_1021500 Ga0224572_10215002 236
592 3300025303 Ga0209051_1000051 Ga0209051_1000051237 236
593 3300025303 Ga0209051_1001489 Ga0209051_100148912 236
594 3300025303 Ga0209051_1001900 Ga0209051_100190011 236
595 3300025303 Ga0209051_1066991 Ga0209051_10669912 236
596 3300025711 Ga0207696_1055064 Ga0207696_10550642 236
597 3300025898 Ga0207692_10006326 Ga0207692_100063263 236
598 3300025898 Ga0207692_10074385 Ga0207692_100743852 236
599 3300025899 Ga0207642_10000995 Ga0207642_100009955 236
600 3300025900 Ga0207710_10000029 Ga0207710_10000029159 236
601 3300025900 Ga0207710_10000076 Ga0207710_1000007652 236
602 3300025900 Ga0207710_10000091 Ga0207710_1000009196 236
603 3300025900 Ga0207710_10003297 Ga0207710_100032974 236
604 3300025901 Ga0207688_10001765 Ga0207688_1000176512 236
605 3300025901 Ga0207688_10002070 Ga0207688_1000207010 236
606 3300025901 Ga0207688_10262257 Ga0207688_102622572 236
607 3300025903 Ga0207680_10075538 Ga0207680_100755382 236
608 3300025903 Ga0207680_10082562 Ga0207680_100825621 236
609 3300025904 Ga0207647_10124217 Ga0207647_101242172 236
610 3300025904 Ga0207647_10274870 Ga0207647_102748701 236
611 3300025905 Ga0207685_10047646 Ga0207685_100476462 236
612 3300025906 Ga0207699_10144692 Ga0207699_101446922 236
613 3300025911 Ga0207654_10054565 Ga0207654_100545653 236
614 3300025914 Ga0207671_10010972 Ga0207671_100109722 236
615 3300025914 Ga0207671_10056830 Ga0207671_100568302 236
616 3300025914 Ga0207671_10063268 Ga0207671_100632681 236
617 3300025914 Ga0207671_10186716 Ga0207671_101867162 236
618 3300025915 Ga0207693_10000513 Ga0207693_1000051329 236
619 3300025915 Ga0207693_10021564 Ga0207693_100215646 236
620 3300025916 Ga0207663_10002243 Ga0207663_100022435 236
621 3300025916 Ga0207663_10007211 Ga0207663_100072113 236
622 3300025916 Ga0207663_10242952 Ga0207663_102429522 236
623 3300025918 Ga0207662_10044720 Ga0207662_100447203 236
624 3300025919 Ga0207657_10229717 Ga0207657_102297171 236
625 3300025923 Ga0207681_10001228 Ga0207681_100012286 236
626 3300025923 Ga0207681_10024065 Ga0207681_100240653 236
627 3300025926 Ga0207659_10409214 Ga0207659_104092142 236
628 3300025927 Ga0207687_10006399 Ga0207687_1000639912 236
629 3300025928 Ga0207700_10083531 Ga0207700_100835317 236
630 3300025929 Ga0207664_10240262 Ga0207664_102402622 236
631 3300025929 Ga0207664_10679061 Ga0207664_106790612 236
632 3300025931 Ga0207644_10045936 Ga0207644_100459363 236
633 3300025931 Ga0207644_10063626 Ga0207644_100636262 236
634 3300025932 Ga0207690_10083671 Ga0207690_100836711 236
635 3300025933 Ga0207706_10005762 Ga0207706_1000576210 236
636 3300025933 Ga0207706_10159703 Ga0207706_101597032 236
637 3300025933 Ga0207706_10718761 Ga0207706_107187611 236
638 3300025935 Ga0207709_10178107 Ga0207709_101781072 236
639 3300025935 Ga0207709_10422149 Ga0207709_104221491 236
640 3300025936 Ga0207670_10012662 Ga0207670_1001266211 236
641 3300025937 Ga0207669_10001354 Ga0207669_1000135415 236
642 3300025937 Ga0207669_10511703 Ga0207669_105117031 236
643 3300025938 Ga0207704_10009059 Ga0207704_100090593 236
644 3300025938 Ga0207704_10212038 Ga0207704_102120382 236
645 3300025939 Ga0207665_10000852 Ga0207665_100008523 236
646 3300025940 Ga0207691_10168095 Ga0207691_101680952 236
647 3300025941 Ga0207711_10000172 Ga0207711_1000017244 236
648 3300025941 Ga0207711_10037703 Ga0207711_100377034 236
649 3300025941 Ga0207711_10038570 Ga0207711_100385705 236
650 3300025942 Ga0207689_10026221 Ga0207689_100262214 236
651 3300025949 Ga0207667_10353098 Ga0207667_103530982 236
652 3300025949 Ga0207667_10393814 Ga0207667_103938142 236
653 3300025960 Ga0207651_10120996 Ga0207651_101209961 236
654 3300025960 Ga0207651_10306129 Ga0207651_103061292 236
655 3300025961 Ga0207712_10000005 Ga0207712_10000005160 236
656 3300025961 Ga0207712_10019806 Ga0207712_100198064 236
657 3300025961 Ga0207712_10077385 Ga0207712_100773851 236
658 3300025961 Ga0207712_10116233 Ga0207712_101162332 236
659 3300025972 Ga0207668_10008387 Ga0207668_1000838712 236
660 3300025972 Ga0207668_10089894 Ga0207668_100898942 236
661 3300025981 Ga0207640_10008326 Ga0207640_100083265 236
662 3300025986 Ga0207658_10000356 Ga0207658_1000035619 236
663 3300025986 Ga0207658_10003633 Ga0207658_100036334 236
664 3300025986 Ga0207658_10104456 Ga0207658_101044563 236
665 3300026023 Ga0207677_10015714 Ga0207677_100157143 236
666 3300026023 Ga0207677_10122968 Ga0207677_101229682 236
667 3300026035 Ga0207703_10000392 Ga0207703_1000039218 236
668 3300026035 Ga0207703_10009257 Ga0207703_1000925711 236
669 3300026035 Ga0207703_10034176 Ga0207703_100341762 236
670 3300026041 Ga0207639_10022607 Ga0207639_1002260710 236
671 3300026041 Ga0207639_10168686 Ga0207639_101686861 236
672 3300026067 Ga0207678_10000312 Ga0207678_1000031214 236
673 3300026067 Ga0207678_10008726 Ga0207678_100087265 236
674 3300026067 Ga0207678_10126186 Ga0207678_101261863 236
675 3300026075 Ga0207708_10049662 Ga0207708_100496622 236
676 3300026088 Ga0207641_10200930 Ga0207641_102009302 236
677 3300026088 Ga0207641_10679484 Ga0207641_106794841 236
678 3300026089 Ga0207648_10001669 Ga0207648_1000166910 236
679 3300026089 Ga0207648_10156982 Ga0207648_101569821 236
680 3300026095 Ga0207676_10261578 Ga0207676_102615782 236
681 3300026095 Ga0207676_10509274 Ga0207676_105092742 236
682 3300026116 Ga0207674_10614471 Ga0207674_106144711 236
683 3300026118 Ga0207675_100004512 Ga0207675_1000045129 236
684 3300026118 Ga0207675_100592497 Ga0207675_1005924972 236
685 3300026121 Ga0207683_10001309 Ga0207683_1000130910 236
686 3300026121 Ga0207683_10017976 Ga0207683_100179764 236
687 3300026121 Ga0207683_10749877 Ga0207683_107498772 236
688 3300027907 Ga0207428_10041400 Ga0207428_100414002 236
689 3300028379 Ga0268266_10007915 Ga0268266_100079155 236
690 3300028379 Ga0268266_10021881 Ga0268266_100218812 236
691 3300028379 Ga0268266_10055544 Ga0268266_100555442 236
692 3300028379 Ga0268266_10069556 Ga0268266_100695562 236
693 3300028380 Ga0268265_10000005 Ga0268265_10000005452 236
694 3300028380 Ga0268265_10047339 Ga0268265_100473393 236
695 3300028380 Ga0268265_10137513 Ga0268265_101375132 236
696 3300028381 Ga0268264_10000005 Ga0268264_10000005160 236
697 3300028381 Ga0268264_10005001 Ga0268264_100050018 236
698 3300028381 Ga0268264_10257260 Ga0268264_102572601 236
699 3300028381 Ga0268264_10425878 Ga0268264_104258782 236
700 3300028666 Ga0265336_10023226 Ga0265336_100232262 236
701 3300028794 Ga0307515_10049214 Ga0307515_100492142 236
702 3300031251 Ga0265327_10003360 Ga0265327_100033604 236
703 3300031251 Ga0265327_10007674 Ga0265327_100076743 236
704 3300031456 Ga0307513_10328386 Ga0307513_103283861 236
705 3300031727 Ga0316576_10038890 Ga0316576_100388903 236
706 3300031727 Ga0316576_10050442 Ga0316576_100504424 236
707 3300031727 Ga0316576_10089315 Ga0316576_100893151 236
708 3300031728 Ga0316578_10004340 Ga0316578_100043402 236
709 3300031728 Ga0316578_10310667 Ga0316578_103106671 236
710 3300031824 Ga0307413_10284024 Ga0307413_102840242 236
711 3300031838 Ga0307518_10004976 Ga0307518_100049768 236
712 3300031901 Ga0307406_10604970 Ga0307406_106049701 236
713 3300031903 Ga0307407_10278727 Ga0307407_102787272 236
714 3300031995 Ga0307409_100122099 Ga0307409_1001220992 236
715 3300031995 Ga0307409_100215620 Ga0307409_1002156202 236
716 3300032002 Ga0307416_100076770 Ga0307416_1000767702 236
717 3300032002 Ga0307416_100364835 Ga0307416_1003648353 236
718 3300032004 Ga0307414_10163103 Ga0307414_101631032 236
719 3300032005 Ga0307411_10645651 Ga0307411_106456512 236
720 3300032126 Ga0307415_100123955 Ga0307415_1001239552 236
721 3300033179 Ga0307507_10059312 Ga0307507_100593123 236
722 3300033180 Ga0307510_10062879 Ga0307510_100628794 236
723 3300035084 Ga0373928_0008232 Ga0373928_0008232_337_1047 236
724 3300035085 Ga0373929_0002852 Ga0373929_0002852_2350_3069 236
725 3300035085 Ga0373929_0039886 Ga0373929_0039886_268_978 236
726 3300035112 Ga0373932_0000149 Ga0373932_0000149_12384_13103 236
727 3300035241 Ga0373961_0074403 Ga0373961_0074403_33_743 236
728 3300035398 Ga0316574_0068231 Ga0316574_0068231_258_989 236
729 3300035691 Ga0373931_0000005 Ga0373931_0000005_429191_429910 236
730 3300035691 Ga0373931_0009617 Ga0373931_0009617_2873_3583 236
731 3300035691 Ga0373931_0084331 Ga0373931_0084331_907_1617 236
732 3300035691 Ga0373931_0254889 Ga0373931_0254889_294_1004 236
733 3300035725 Ga0373947_0157853 Ga0373947_0157853_122_832 236
734 3300036401 Ga0373937_0022133 Ga0373937_0022133_3224_3964 236
735 3300036647 Ga0316582_0028824 Ga0316582_0028824_1342_2073 236
736 3300036712 Ga0316584_0014998 Ga0316584_0014998_203_919 236
737 3300036712 Ga0316584_0020525 Ga0316584_0020525_3131_3862 236
738 3300036712 Ga0316584_0202556 Ga0316584_0202556_698_1429 236
739 3300037068 Ga0373925_0337512 Ga0373925_0337512_242_952 236
740 3300037853 Ga0436364_0376382 Ga0436364_0376382_846_1592 236
741 3300037853 Ga0436364_0627822 Ga0436364_0627822_4871_5587 236
742 3300037853 Ga0436364_0812123 Ga0436364_0812123_228_944 236
743 3300037853 Ga0436364_1330762 Ga0436364_1330762_134_850 236
744 3300038443 Ga0395901_0829400 Ga0395901_0829400_30_740 236
745 3300039437 Ga0436365_0530475 Ga0436365_0530475_154_870 236
746 3300039437 Ga0436365_1888780 Ga0436365_1888780_13800_14516 236
747 3300039447 Ga0436361_0376062 Ga0436361_0376062_97_816 236
748 3300039450 Ga0436363_0223575 Ga0436363_0223575_538_1254 236
749 3300039450 Ga0436363_0709713 Ga0436363_0709713_410_1126 236
750 3300041410 Ga0439461_0024936 Ga0439461_0024936_264_977 236
751 3300041411 Ga0439466_0020218 Ga0439466_0020218_1105_1818 236
752 3300041413 Ga0439465_0002227 Ga0439465_0002227_1072_1785 236
753 3300041413 Ga0439465_0002339 Ga0439465_0002339_193_912 236
754 3300041413 Ga0439465_0070137 Ga0439465_0070137_381_1091 236
755 3300041486 Ga0451807_2366488 Ga0451807_2366488_27_749 236
756 3300042002 Ga0439442_037188 Ga0439442_037188_19_729 236
757 3300042004 Ga0439445_0003083 Ga0439445_0003083_2842_3555 236
758 3300042004 Ga0439445_0093555 Ga0439445_0093555_25_735 236
759 3300042005 Ga0439448_0087574 Ga0439448_0087574_198_911 236
760 3300042157 Ga0439458_0089914 Ga0439458_0089914_39_749 236
761 3300042876 Ga0451577_0000984 Ga0451577_0000984_38614_39330 236
762 3300044656 Ga0466969_0117815 Ga0466969_0117815_412_1122 236
763 3300044658 Ga0466972_0002130 Ga0466972_0002130_942_1655 236
764 3300044658 Ga0466972_0015250 Ga0466972_0015250_415_1152 236
765 3300044658 Ga0466972_0024503 Ga0466972_0024503_465_1175 236
766 3300044658 Ga0466972_0097287 Ga0466972_0097287_442_1152 236
767 3300044683 Ga0466965_0008281 Ga0466965_0008281_147_884 236
768 3300044683 Ga0466965_0020332 Ga0466965_0020332_2354_3064 236
769 3300044683 Ga0466965_0029783 Ga0466965_0029783_1120_1833 236
770 3300044693 Ga0466961_0109927 Ga0466961_0109927_461_1177 236
771 3300044693 Ga0466961_0400133 Ga0466961_0400133_85_795 236
772 3300044694 Ga0466963_0362285 Ga0466963_0362285_198_908 236
773 3300044712 Ga0453684_0010613 Ga0453684_0010613_7675_8391 236
774 3300044719 Ga0466971_0087645 Ga0466971_0087645_492_1202 236
775 3300044735 Ga0466968_0018033 Ga0466968_0018033_799_1512 236
776 3300044735 Ga0466968_0223036 Ga0466968_0223036_58_768 236
777 3300044765 Ga0466970_0088771 Ga0466970_0088771_934_1647 236
778 3300044765 Ga0466970_0218293 Ga0466970_0218293_131_847 236
779 3300044842 Ga0466957_0004259 Ga0466957_0004259_658_1371 236
780 3300044842 Ga0466957_0122562 Ga0466957_0122562_598_1314 236
781 3300044842 Ga0466957_0216742 Ga0466957_0216742_501_1211 236
782 3300044901 Ga0466960_0000482 Ga0466960_0000482_4490_5227 236
783 3300044901 Ga0466960_0000689 Ga0466960_0000689_2103_2816 236
784 3300044901 Ga0466960_0021941 Ga0466960_0021941_1616_2326 236
785 3300044901 Ga0466960_0127999 Ga0466960_0127999_88_798 236
786 3300044901 Ga0466960_0128351 Ga0466960_0128351_470_1180 236
787 3300044901 Ga0466960_0167517 Ga0466960_0167517_356_1072 236
788 3300045049 Ga0466959_0004691 Ga0466959_0004691_8414_9124 236
789 3300045049 Ga0466959_0091764 Ga0466959_0091764_798_1511 236
790 3300045051 Ga0451576_0758626 Ga0451576_0758626_161_877 236
791 3300045836 Ga0466958_0005121 Ga0466958_0005121_5221_5931 236
792 3300045836 Ga0466958_0008266 Ga0466958_0008266_4750_5466 236
793 3300045836 Ga0466958_0130648 Ga0466958_0130648_89_805 236
794 3300045836 Ga0466958_0198345 Ga0466958_0198345_470_1186 236
795 3300045976 Ga0466967_0069194 Ga0466967_0069194_1893_2621 236
796 3300045976 Ga0466967_0592523 Ga0466967_0592523_50_760 236
797 3300045976 Ga0466967_0739844 Ga0466967_0739844_198_920 236
798 3300046459 Ga0495629_0004180 Ga0495629_0004180_9928_10638 236
799 3300046461 Ga0495641_0017750 Ga0495641_0017750_1858_2568 236
800 3300046463 Ga0495653_0227596 Ga0495653_0227596_118_843 236
801 3300046524 Ga0495648_0013467 Ga0495648_0013467_80_805 236
802 3300046530 Ga0495654_0045262 Ga0495654_0045262_514_1239 236
803 3300046683 Ga0495658_0003996 Ga0495658_0003996_2470_3180 236
804 3300046690 Ga0495624_0112641 Ga0495624_0112641_118_828 236
805 3300046694 Ga0495649_0231830 Ga0495649_0231830_69_779 236
806 3300047319 Ga0495674_0414921 Ga0495674_0414921_211_921 236
807 3300047320 Ga0495672_0002606 Ga0495672_0002606_6739_7455 236
808 3300047320 Ga0495672_0011184 Ga0495672_0011184_529_1254 236
809 3300047320 Ga0495672_0230903 Ga0495672_0230903_84_800 236
810 3300047321 Ga0495676_0453829 Ga0495676_0453829_17_727 236
811 3300047322 Ga0495680_0180509 Ga0495680_0180509_625_1365 236
812 3300047469 Ga0495673_0003826 Ga0495673_0003826_1677_2402 236
813 3300047472 Ga0495686_0001711 Ga0495686_0001711_4244_4969 236
814 3300047673 Ga0495593_0082906 Ga0495593_0082906_332_1042 236
815 3300048091 Ga0495626_0069970 Ga0495626_0069970_739_1455 236
816 3300048903 Ga0496100_0002422 Ga0496100_0002422_2171_2884 236
817 3300048903 Ga0496100_0003502 Ga0496100_0003502_3863_4573 236
818 3300048903 Ga0496100_0006840 Ga0496100_0006840_4229_4954 236
819 3300048903 Ga0496100_0067913 Ga0496100_0067913_199_912 236
820 3300048903 Ga0496100_0123595 Ga0496100_0123595_158_883 236
821 3300048904 Ga0496101_0000020 Ga0496101_0000020_32604_33317 236
822 3300048904 Ga0496101_0000047 Ga0496101_0000047_56214_56939 236
823 3300048904 Ga0496101_0003730 Ga0496101_0003730_4245_4955 236
824 3300048904 Ga0496101_0025795 Ga0496101_0025795_1870_2595 236
825 3300048904 Ga0496101_0100058 Ga0496101_0100058_336_1049 236
826 3300048904 Ga0496101_0239562 Ga0496101_0239562_660_1370 236
827 3300048905 Ga0496102_0000003 Ga0496102_0000003_393347_394072 236
828 3300048905 Ga0496102_0000050 Ga0496102_0000050_95667_96392 236
829 3300048905 Ga0496102_0004407 Ga0496102_0004407_8145_8858 236
830 3300048905 Ga0496102_0041387 Ga0496102_0041387_515_1225 236
831 3300048905 Ga0496102_0050426 Ga0496102_0050426_2051_2761 236
832 3300048905 Ga0496102_0131035 Ga0496102_0131035_1121_1843 236
833 3300048905 Ga0496102_0523255 Ga0496102_0523255_32_742 236
834 3300048906 Ga0496103_0000012 Ga0496103_0000012_102859_103584 236
835 3300048906 Ga0496103_0000831 Ga0496103_0000831_3570_4295 236
836 3300048906 Ga0496103_0001090 Ga0496103_0001090_8775_9488 236
837 3300048906 Ga0496103_0002661 Ga0496103_0002661_3601_4311 236
838 3300048906 Ga0496103_0150176 Ga0496103_0150176_619_1329 236
839 3300048907 Ga0496104_0040374 Ga0496104_0040374_1069_1779 236
840 3300048907 Ga0496104_0572024 Ga0496104_0572024_98_823 236
841 3300048908 Ga0496105_0019525 Ga0496105_0019525_4694_5404 236
842 3300048908 Ga0496105_0499753 Ga0496105_0499753_50_760 236
843 3300048909 Ga0496106_0001356 Ga0496106_0001356_1302_2015 236
844 3300048909 Ga0496106_0006678 Ga0496106_0006678_4762_5472 236
845 3300048909 Ga0496106_0012798 Ga0496106_0012798_32_757 236
846 3300048909 Ga0496106_0022520 Ga0496106_0022520_622_1332 236
847 3300048909 Ga0496106_0509002 Ga0496106_0509002_100_813 236
848 3300048910 Ga0496107_0004101 Ga0496107_0004101_4648_5358 236
849 3300048910 Ga0496107_0017352 Ga0496107_0017352_1366_2079 236
850 3300048910 Ga0496107_0086106 Ga0496107_0086106_1433_2143 236
851 3300048910 Ga0496107_0149666 Ga0496107_0149666_708_1433 236
852 3300048910 Ga0496107_0172107 Ga0496107_0172107_253_978 236
853 3300048911 Ga0496108_0001423 Ga0496108_0001423_14142_14852 236
854 3300048911 Ga0496108_0013592 Ga0496108_0013592_4588_5298 236
855 3300048911 Ga0496108_0033164 Ga0496108_0033164_1943_2659 236
856 3300048911 Ga0496108_0054383 Ga0496108_0054383_1751_2464 236
857 3300048911 Ga0496108_0279149 Ga0496108_0279149_300_1025 236
858 3300048911 Ga0496108_0849063 Ga0496108_0849063_38_748 236
859 3300048912 Ga0496109_0000104 Ga0496109_0000104_76740_77453 236
860 3300048912 Ga0496109_0015166 Ga0496109_0015166_3600_4310 236
861 3300048912 Ga0496109_0134769 Ga0496109_0134769_556_1266 236
862 3300048912 Ga0496109_0153597 Ga0496109_0153597_989_1699 236
863 3300048912 Ga0496109_0505214 Ga0496109_0505214_392_1102 236
864 3300048913 Ga0496110_0016323 Ga0496110_0016323_1042_1752 236
865 3300048913 Ga0496110_0029430 Ga0496110_0029430_3441_4154 236
866 3300048913 Ga0496110_0248476 Ga0496110_0248476_106_828 236
867 3300048913 Ga0496110_0491377 Ga0496110_0491377_266_982 236
868 3300048913 Ga0496110_0845403 Ga0496110_0845403_69_779 236
869 3300048913 Ga0496110_0919481 Ga0496110_0919481_26_736 236
870 3300048914 Ga0496111_0023404 Ga0496111_0023404_542_1255 236
871 3300048914 Ga0496111_0243824 Ga0496111_0243824_444_1154 236
872 3300048915 Ga0496112_0045499 Ga0496112_0045499_1380_2093 236
873 3300048915 Ga0496112_0172160 Ga0496112_0172160_670_1380 236
874 3300048915 Ga0496112_0331140 Ga0496112_0331140_543_1253 236
875 3300048915 Ga0496112_0385441 Ga0496112_0385441_457_1167 236
876 3300048916 Ga0496113_0003726 Ga0496113_0003726_6575_7288 236
877 3300048916 Ga0496113_0174560 Ga0496113_0174560_409_1119 236
878 3300048916 Ga0496113_0260399 Ga0496113_0260399_543_1253 236
879 3300048916 Ga0496113_0464450 Ga0496113_0464450_145_855 236
880 3300048916 Ga0496113_0521654 Ga0496113_0521654_209_922 236
881 3300048917 Ga0496114_0000793 Ga0496114_0000793_19322_20035 236
882 3300048917 Ga0496114_0006229 Ga0496114_0006229_3815_4525 236
883 3300048917 Ga0496114_0125026 Ga0496114_0125026_1361_2071 236
884 3300048917 Ga0496114_0259054 Ga0496114_0259054_658_1380 236
885 3300048918 Ga0496115_0013217 Ga0496115_0013217_1603_2313 236
886 3300048918 Ga0496115_0340559 Ga0496115_0340559_121_831 236
887 3300048919 Ga0496116_0000040 Ga0496116_0000040_147987_148712 236
888 3300048919 Ga0496116_0002883 Ga0496116_0002883_12567_13280 236
889 3300048919 Ga0496116_0065784 Ga0496116_0065784_854_1579 236
890 3300048920 Ga0496117_0000003 Ga0496117_0000003_198192_198917 236
891 3300048920 Ga0496117_0000459 Ga0496117_0000459_3015_3740 236
892 3300048920 Ga0496117_0202713 Ga0496117_0202713_210_923 236
893 3300048921 Ga0496118_0000001 Ga0496118_0000001_198195_198920 236
894 3300048921 Ga0496118_0003972 Ga0496118_0003972_11462_12187 236
895 3300048921 Ga0496118_0005190 Ga0496118_0005190_1065_1778 236
896 3300048922 Ga0496119_0000142 Ga0496119_0000142_55329_56054 236
897 3300048922 Ga0496119_0000357 Ga0496119_0000357_21096_21809 236
898 3300048922 Ga0496119_0004835 Ga0496119_0004835_1367_2080 236
899 3300048922 Ga0496119_0013089 Ga0496119_0013089_3741_4466 236
900 3300048922 Ga0496119_0013866 Ga0496119_0013866_3085_3810 236
901 3300048922 Ga0496119_0022264 Ga0496119_0022264_351_1076 236
902 3300048922 Ga0496119_0157093 Ga0496119_0157093_74_787 236
903 3300048923 Ga0496120_0000149 Ga0496120_0000149_12906_13631 236
904 3300048923 Ga0496120_0000230 Ga0496120_0000230_80302_81015 236
905 3300048923 Ga0496120_0027186 Ga0496120_0027186_1395_2120 236
906 3300048923 Ga0496120_0051991 Ga0496120_0051991_1543_2256 236
907 3300048923 Ga0496120_0092260 Ga0496120_0092260_119_838 236
908 3300048924 Ga0496121_0000002 Ga0496121_0000002_739128_739841 236
909 3300048924 Ga0496121_0000019 Ga0496121_0000019_402746_403471 236
910 3300048924 Ga0496121_0038561 Ga0496121_0038561_3005_3730 236
911 3300048925 Ga0496122_0000078 Ga0496122_0000078_78544_79257 236
912 3300048925 Ga0496122_0009230 Ga0496122_0009230_8239_8952 236
913 3300048926 Ga0496123_0009351 Ga0496123_0009351_6982_7695 236
914 3300048926 Ga0496123_0021371 Ga0496123_0021371_1028_1741 236
915 3300048927 Ga0496124_0000002 Ga0496124_0000002_754748_755461 236
916 3300048928 Ga0496125_0000002 Ga0496125_0000002_739128_739841 236
917 3300048929 Ga0496126_0000009 Ga0496126_0000009_10510_11223 236
918 3300048929 Ga0496126_0000785 Ga0496126_0000785_39818_40543 236
919 3300048929 Ga0496126_0007337 Ga0496126_0007337_6431_7156 236
920 3300048929 Ga0496126_0022746 Ga0496126_0022746_2521_3243 236
921 3300048929 Ga0496126_0033616 Ga0496126_0033616_2708_3421 236
922 3300049568 Ga0501031_0021390 Ga0501031_0021390_2683_3402 236
923 3300049568 Ga0501031_0086164 Ga0501031_0086164_859_1671 236
924 3300049568 Ga0501031_0230615 Ga0501031_0230615_364_1092 236
925 3300049569 Ga0501032_0009961 Ga0501032_0009961_5874_6602 236
926 3300049569 Ga0501032_0084855 Ga0501032_0084855_716_1429 236
927 3300049570 Ga0501033_0003270 Ga0501033_0003270_6479_7291 236
928 3300049571 Ga0501034_0008438 Ga0501034_0008438_9333_10046 236
929 3300049571 Ga0501034_0112825 Ga0501034_0112825_1739_2455 236
930 3300049571 Ga0501034_0122475 Ga0501034_0122475_743_1453 236
931 3300049571 Ga0501034_0319159 Ga0501034_0319159_719_1429 236
932 3300049571 Ga0501034_0499811 Ga0501034_0499811_56_796 236
933 3300049572 Ga0501036_0014271 Ga0501036_0014271_704_1423 236
934 3300049572 Ga0501036_0034841 Ga0501036_0034841_2048_2860 236
935 3300049572 Ga0501036_0087476 Ga0501036_0087476_521_1234 236
936 3300049572 Ga0501036_0157668 Ga0501036_0157668_1003_1731 236
937 3300049572 Ga0501036_0264303 Ga0501036_0264303_252_992 236
938 3300049572 Ga0501036_0657786 Ga0501036_0657786_18_737 236
939 3300049573 Ga0501037_0003227 Ga0501037_0003227_6088_6801 236
940 3300049573 Ga0501037_0015365 Ga0501037_0015365_294_1022 236
941 3300049573 Ga0501037_0022637 Ga0501037_0022637_2980_3792 236
942 3300049573 Ga0501037_0348440 Ga0501037_0348440_211_930 236
943 3300049574 Ga0501038_0001047 Ga0501038_0001047_23624_24337 236
944 3300049574 Ga0501038_0004575 Ga0501038_0004575_8217_9029 236
945 3300049574 Ga0501038_0025858 Ga0501038_0025858_174_902 236
946 3300049574 Ga0501038_0100483 Ga0501038_0100483_1008_1748 236
947 3300049574 Ga0501038_0184883 Ga0501038_0184883_238_957 236
948 3300049575 Ga0501039_0002201 Ga0501039_0002201_6897_7709 236
949 3300049575 Ga0501039_0013791 Ga0501039_0013791_2568_3281 236
950 3300049575 Ga0501039_0018503 Ga0501039_0018503_514_1233 236
951 3300049575 Ga0501039_0022559 Ga0501039_0022559_1552_2292 236
952 3300049575 Ga0501039_0104330 Ga0501039_0104330_546_1265 236
953 3300049576 Ga0501040_0001028 Ga0501040_0001028_10204_11016 236
954 3300049576 Ga0501040_0010664 Ga0501040_0010664_2993_3712 236
955 3300049576 Ga0501040_0235571 Ga0501040_0235571_72_791 236
956 3300049576 Ga0501040_0275533 Ga0501040_0275533_99_839 236
957 3300049577 Ga0501041_0014439 Ga0501041_0014439_143_955 236
958 3300049577 Ga0501041_0053843 Ga0501041_0053843_988_1728 236
959 3300049577 Ga0501041_0064393 Ga0501041_0064393_611_1330 236
960 3300049578 Ga0501042_0001091 Ga0501042_0001091_12170_12910 236
961 3300049578 Ga0501042_0008175 Ga0501042_0008175_4827_5546 236
962 3300049578 Ga0501042_0059318 Ga0501042_0059318_1143_1955 236
963 3300049579 Ga0501043_0001283 Ga0501043_0001283_11674_12387 236
964 3300049579 Ga0501043_0085797 Ga0501043_0085797_1148_1888 236
965 3300049580 Ga0501046_0011417 Ga0501046_0011417_892_1704 236
966 3300049580 Ga0501046_0037849 Ga0501046_0037849_731_1471 236
967 3300049580 Ga0501046_0120515 Ga0501046_0120515_67_786 236
968 3300049581 Ga0501047_0018956 Ga0501047_0018956_475_1200 236
969 3300049582 Ga0501048_0007016 Ga0501048_0007016_6391_7203 236
970 3300049582 Ga0501048_0016487 Ga0501048_0016487_1157_1876 236
971 3300049582 Ga0501048_0091267 Ga0501048_0091267_803_1522 236
972 3300049582 Ga0501048_0119456 Ga0501048_0119456_92_832 236
973 3300049584 Ga0501068_0005418 Ga0501068_0005418_3830_4546 236
974 3300049584 Ga0501068_0047961 Ga0501068_0047961_1730_2443 236
975 3300049584 Ga0501068_0113270 Ga0501068_0113270_639_1451 236
976 3300049584 Ga0501068_0259259 Ga0501068_0259259_370_1089 236
977 3300049584 Ga0501068_0422822 Ga0501068_0422822_43_783 236
978 3300049585 Ga0501069_0013269 Ga0501069_0013269_48_773 236
979 3300049586 Ga0501070_0032913 Ga0501070_0032913_409_1137 236
980 3300049586 Ga0501070_0041793 Ga0501070_0041793_1858_2598 236
981 3300049586 Ga0501070_0099905 Ga0501070_0099905_1195_1917 236
982 3300049586 Ga0501070_0109387 Ga0501070_0109387_705_1415 236
983 3300049586 Ga0501070_0114448 Ga0501070_0114448_1293_2006 236
984 3300049586 Ga0501070_0703086 Ga0501070_0703086_62_787 236
985 3300049587 Ga0501071_0021003 Ga0501071_0021003_1574_2314 236
986 3300049587 Ga0501071_0040463 Ga0501071_0040463_39_851 236
987 3300049587 Ga0501071_0082547 Ga0501071_0082547_1093_1812 236
988 3300049588 Ga0501072_0003265 Ga0501072_0003265_2186_2998 236
989 3300049588 Ga0501072_0008699 Ga0501072_0008699_1825_2544 236
990 3300049588 Ga0501072_0124912 Ga0501072_0124912_842_1561 236
991 3300049588 Ga0501072_0159627 Ga0501072_0159627_202_942 236
992 3300049588 Ga0501072_0276087 Ga0501072_0276087_132_851 236
993 3300049589 Ga0501073_0107172 Ga0501073_0107172_83_895 236
994 3300049589 Ga0501073_0392660 Ga0501073_0392660_143_859 236
995 3300049590 Ga0501074_0039729 Ga0501074_0039729_1485_2225 236
996 3300049591 Ga0501075_0004110 Ga0501075_0004110_6218_6937 236
997 3300049591 Ga0501075_0012579 Ga0501075_0012579_54_866 236
998 3300049591 Ga0501075_0015241 Ga0501075_0015241_2884_3624 236
999 3300049591 Ga0501075_0064908 Ga0501075_0064908_383_1102 236
1000 3300049592 Ga0501076_0021127 Ga0501076_0021127_891_1703 236
1001 3300049593 Ga0501077_0000891 Ga0501077_0000891_8979_9791 236
1002 3300049593 Ga0501077_0021822 Ga0501077_0021822_3080_3820 236
1003 3300049741 Ga0501079_0006243 Ga0501079_0006243_5738_6550 236
1004 3300049741 Ga0501079_0032459 Ga0501079_0032459_2017_2736 236
1005 3300049741 Ga0501079_0033822 Ga0501079_0033822_2505_3245 236
1006 3300049741 Ga0501079_0365003 Ga0501079_0365003_375_1094 236
1007 3300049742 Ga0501080_0027388 Ga0501080_0027388_4238_4966 236
1008 3300049743 Ga0501081_0003048 Ga0501081_0003048_2231_3043 236
1009 3300049743 Ga0501081_0191167 Ga0501081_0191167_390_1130 236
1010 3300049743 Ga0501081_0211415 Ga0501081_0211415_638_1354 236
1011 3300049822 Ga0501035_0042300 Ga0501035_0042300_787_1599 236
1012 3300049822 Ga0501035_0215134 Ga0501035_0215134_547_1275 236
1013 3300049823 Ga0501044_0005129 Ga0501044_0005129_327_1055 236
1014 3300049823 Ga0501044_0022781 Ga0501044_0022781_5634_6347 236
1015 3300049824 Ga0501045_0001848 Ga0501045_0001848_6671_7483 236
1016 3300049824 Ga0501045_0010139 Ga0501045_0010139_1055_1795 236
1017 3300049824 Ga0501045_0025670 Ga0501045_0025670_950_1669 236
1018 3300049824 Ga0501045_0049608 Ga0501045_0049608_1878_2597 236
1019 3300050489 nmdc:mga03683_207115_c1 nmdc:mga03683_207115_c1_92_802 236
1020 3300050489 nmdc:mga03683_86628_c1 nmdc:mga03683_86628_c1_34_744 236
1021 3300050490 nmdc:mga03n38_118809_c1 nmdc:mga03n38_118809_c1_467_1204 236
1022 3300050490 nmdc:mga03n38_19183_c1 nmdc:mga03n38_19183_c1_790_1500 236
1023 3300050490 nmdc:mga03n38_210370_c1 nmdc:mga03n38_210370_c1_204_914 236
1024 3300050490 nmdc:mga03n38_325_c1 nmdc:mga03n38_325_c1_3532_4248 236
1025 3300050490 nmdc:mga03n38_36014_c1 nmdc:mga03n38_36014_c1_291_1001 236
1026 3300050490 nmdc:mga03n38_42755_c1 nmdc:mga03n38_42755_c1_1240_1959 236
1027 3300050490 nmdc:mga03n38_72887_c1 nmdc:mga03n38_72887_c1_809_1519 236
1028 3300050490 nmdc:mga03n38_83167_c1 nmdc:mga03n38_83167_c1_330_1040 236
1029 3300050491 nmdc:mga00v17_139468_c1 nmdc:mga00v17_139468_c1_524_1243 236
1030 3300050491 nmdc:mga00v17_158309_c1 nmdc:mga00v17_158309_c1_198_908 236
1031 3300050491 nmdc:mga00v17_165945_c1 nmdc:mga00v17_165945_c1_330_1049 236
1032 3300050491 nmdc:mga00v17_177789_c1 nmdc:mga00v17_177789_c1_283_993 236
1033 3300050491 nmdc:mga00v17_248675_c1 nmdc:mga00v17_248675_c1_428_1138 236
1034 3300050491 nmdc:mga00v17_2691_c1 nmdc:mga00v17_2691_c1_7487_8203 236
1035 3300050491 nmdc:mga00v17_335633_c1 nmdc:mga00v17_335633_c1_180_893 236
1036 3300050491 nmdc:mga00v17_34630_c1 nmdc:mga00v17_34630_c1_334_1071 236
1037 3300050491 nmdc:mga00v17_352591_c1 nmdc:mga00v17_352591_c1_179_898 236
1038 3300050491 nmdc:mga00v17_3888_c1 nmdc:mga00v17_3888_c1_6091_6831 236
1039 3300050491 nmdc:mga00v17_422191_c1 nmdc:mga00v17_422191_c1_146_856 236
1040 3300050491 nmdc:mga00v17_55294_c1 nmdc:mga00v17_55294_c1_17_727 236
1041 3300050491 nmdc:mga00v17_65643_c1 nmdc:mga00v17_65643_c1_407_1123 236
1042 3300050491 nmdc:mga00v17_8065_c1 nmdc:mga00v17_8065_c1_344_1054 236
1043 3300050491 nmdc:mga00v17_88356_c1 nmdc:mga00v17_88356_c1_689_1405 236
1044 3300050492 nmdc:mga0yw44_107028_c2 nmdc:mga0yw44_107028_c2_208_918 236
1045 3300050492 nmdc:mga0yw44_1794_c1 nmdc:mga0yw44_1794_c1_547_1266 236
1046 3300050492 nmdc:mga0yw44_24071_c1 nmdc:mga0yw44_24071_c1_145_891 236
1047 3300050492 nmdc:mga0yw44_24549_c1 nmdc:mga0yw44_24549_c1_2550_3266 236
1048 3300050492 nmdc:mga0yw44_385743_c1 nmdc:mga0yw44_385743_c1_206_916 236
1049 3300050492 nmdc:mga0yw44_418992_c1 nmdc:mga0yw44_418992_c1_14_733 236
1050 3300050494 nmdc:mga06z11_163148_c1 nmdc:mga06z11_163148_c1_99_809 236
1051 3300050494 nmdc:mga06z11_193207_c1 nmdc:mga06z11_193207_c1_11_721 236
1052 3300050494 nmdc:mga06z11_341926_c1 nmdc:mga06z11_341926_c1_22_738 236
1053 3300050494 nmdc:mga06z11_500455_c1 nmdc:mga06z11_500455_c1_16_726 236
1054 3300050495 nmdc:mga04h51_96980_c1 nmdc:mga04h51_96980_c1_221_958 236
1055 3300050496 nmdc:mga07m45_189458_c1 nmdc:mga07m45_189458_c1_77_817 236
1056 3300050496 nmdc:mga07m45_218123_c1 nmdc:mga07m45_218123_c1_215_925 236
1057 3300050496 nmdc:mga07m45_238021_c1 nmdc:mga07m45_238021_c1_21_917 236
1058 3300050496 nmdc:mga07m45_52756_c1 nmdc:mga07m45_52756_c1_1327_2064 236
1059 3300050496 nmdc:mga07m45_9664_c1 nmdc:mga07m45_9664_c1_121_837 236
1060 3300050507 nmdc:mga05p37_14137_c1 nmdc:mga05p37_14137_c1_4828_5538 236
1061 3300050507 nmdc:mga05p37_99626_c1 nmdc:mga05p37_99626_c1_569_1300 236
1062 3300050508 nmdc:mga09592_178633_c1 nmdc:mga09592_178633_c1_671_1468 236
1063 3300050508 nmdc:mga09592_57199_c1 nmdc:mga09592_57199_c1_1824_2555 236
1064 3300050509 nmdc:mga0qj67_10130_c1 nmdc:mga0qj67_10130_c1_5171_5881 236
1065 3300050509 nmdc:mga0qj67_250671_c1 nmdc:mga0qj67_250671_c1_558_1289 236
1066 3300050509 nmdc:mga0qj67_59404_c1 nmdc:mga0qj67_59404_c1_1023_1820 236
1067 3300050510 nmdc:mga06r32_24409_c1 nmdc:mga06r32_24409_c1_3966_4763 236
1068 3300050510 nmdc:mga06r32_452881_c1 nmdc:mga06r32_452881_c1_153_863 236
1069 3300050510 nmdc:mga06r32_99237_c1 nmdc:mga06r32_99237_c1_21_752 236
1070 3300050511 nmdc:mga08y16_149844_c1 nmdc:mga08y16_149844_c1_94_813 236
1071 3300050511 nmdc:mga08y16_51066_c1 nmdc:mga08y16_51066_c1_763_1503 236
1072 3300050516 nmdc:mga0sz30_16094_c2 nmdc:mga0sz30_16094_c2_228_947 236
1073 3300050516 nmdc:mga0sz30_2056_c1 nmdc:mga0sz30_2056_c1_3414_4130 236
1074 3300050516 nmdc:mga0sz30_20615_c2 nmdc:mga0sz30_20615_c2_1383_2093 236
1075 3300050516 nmdc:mga0sz30_28900_c1 nmdc:mga0sz30_28900_c1_912_1622 236
1076 3300050516 nmdc:mga0sz30_776_c1 nmdc:mga0sz30_776_c1_6130_6840 236
1077 3300053080 Ga0500635_0003906 Ga0500635_0003906_1631_2356 236
1078 3300053131 Ga0500652_000964 Ga0500652_000964_2442_3167 236
1079 3300053153 Ga0500616_0029359 Ga0500616_0029359_1171_1896 236
1080 3300054114 Ga0501084_0001967 Ga0501084_0001967_6299_7111 236
1081 3300054114 Ga0501084_0018562 Ga0501084_0018562_1089_1808 236
1082 3300054114 Ga0501084_0072851 Ga0501084_0072851_468_1187 236
1083 3300054114 Ga0501084_0124642 Ga0501084_0124642_779_1519 236
1084 3300060353 Ga0501082_0008758 Ga0501082_0008758_1078_1890 236
1085 3300060353 Ga0501082_0035405 Ga0501082_0035405_400_1119 236
1086 3300060353 Ga0501082_0224402 Ga0501082_0224402_604_1323 236
1087 3300061719 Ga0466962_0007543 Ga0466962_0007543_3578_4288 236
1088 3300061734 Ga0530510_0001967 Ga0530510_0001967_1421_2233 236
1089 3300061734 Ga0530510_0026019 Ga0530510_0026019_3156_3896 236
1090 3300061734 Ga0530510_0068608 Ga0530510_0068608_1086_1805 236
1091 iso_pu_bacteria 2939582691 2939586763 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

56

236

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ysb-assembly1.cif.gz_B crystal structure of ethe1 from myxococcus xanthus 0.9108 5 234
5ve4-assembly1.cif.gz_A crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans 0.8635 5 234
8ewo-assembly2.cif.gz_B crystal structure of putative glyoxylase ii from pseudomonas aeruginosa 0.8628 27 203
2gcu-assembly2.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at1g53580 0.8609 3 234
5ve3-assembly2.cif.gz_A crystal structure of wild-type persulfide dioxygenase-rhodanese fusion protein from burkholderia phytofirmans 0.8562 4 234
ID Description Score Start End Superfamily
af_I6Y4A5_15_234_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9999 13 231 3.60.15.10
af_I6Y4A5_15_234_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9909 13 231 3.60.15.10
af_Q86PD3_43_273_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9086 1 234 3.60.15.10
af_O53534_19_208_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8769 25 213 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8735 27 203 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A1A1XH31-F1-model_v4 deleted 1.001 3 235
AF-A0A7I7MTX2-F1-model_v4 Glyoxalase II 1.001 2 235 GO:0016787
AF-A0A1A3PDE8-F1-model_v4 MBL fold metallo-hydrolase 1.001 2 202 GO:0016787
AF-A0A4Q7QFP2-F1-model_v4 deleted 0.9986 1 235
AF-X8FGR9-F1-model_v4 deleted 0.9984 69 235

Feature Viewer

pLDDT pTM Quality
96.54 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map