F489893
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1091 | 398 | 1059 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0086164|Ga0501031_0086164_859_1671 |
| Length | 270 |
| Sequence | MASIRDRPSSPTPTAAPNGVGLRPTFNIFGVNSPDRLYFRQMLSGRDIARSDPLARQMVNFAYLIGDRETGEALVVDAAYDIRGILDVAAADGMKVTGALVTHYHQDHVGGNMMGYQISGVRELLTLNPVPVHVQADEAVGVQRVTGAGEGDLVRHDSGDVVDVGAIGVELIHTPGHTPGSQCFLVDGRYLVSGDTLFLEGCGRTDLPGGDAAQLYDSLTHKLAKVPDDTVLFPGHLYSAEPSATMGETRRWNFVFKPRSEAEWLAMFGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 2 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 3 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 4 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 5 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 6 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 7 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 8 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 9 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 10 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 11 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 12 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 13 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 14 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 15 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 16 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 17 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 18 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 19 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 20 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 21 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 22 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 23 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 24 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 25 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 26 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 27 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 28 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 29 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 30 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 31 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 32 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 33 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 207 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 208 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 220 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 221 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 233 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 239 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 244 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 245 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 246 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 247 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 248 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 249 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 250 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 251 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 252 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 253 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 254 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 257 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 258 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 261 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 262 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 325 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 326 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 327 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 328 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 331 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 387 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 393 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 394 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 395 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 396 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 397 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 398 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.07 |
| Metatranscriptomes | 0 |
| Isolates | 2.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.45 |
| Nodule | 0.73 |
| Rhizoplane | 7.97 |
| Rhizosphere | 71.86 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 8.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1002320 | 3300002073 | Bacteria | 1934 |
| 2 | JGI24748J21848_1007147 | 3300002074 | Bacteria | 1307 |
| 3 | JGI24744J21845_10001349 | 3300002077 | Bacteria | 4856 |
| 4 | JGI24744J21845_10011490 | 3300002077 | Bacteria | 1810 |
| 5 | rootH2_10039752 | 3300003320 | Bacteria | 4700 |
| 6 | rootH1_10169282 | 3300003323 | Bacteria | 2191 |
| 7 | Ga0055540_1000118 | 3300003792 | Bacteria | 83025 |
| 8 | Ga0055540_1000243 | 3300003792 | Bacteria | 49933 |
| 9 | Ga0055540_1003862 | 3300003792 | Bacteria | 7032 |
| 10 | Ga0055540_1014158 | 3300003792 | Bacteria | 2393 |
| 11 | Ga0070676_10009545 | 3300005328 | Bacteria | 5241 |
| 12 | Ga0070683_100139575 | 3300005329 | Bacteria | 2296 |
| 13 | Ga0070670_100107856 | 3300005331 | Bacteria | 2400 |
| 14 | Ga0070677_10024226 | 3300005333 | Bacteria | 2255 |
| 15 | Ga0068869_100020924 | 3300005334 | Bacteria | 4494 |
| 16 | Ga0068869_100057787 | 3300005334 | Bacteria | 2834 |
| 17 | Ga0070682_100082895 | 3300005337 | Bacteria | 2079 |
| 18 | Ga0070682_100429136 | 3300005337 | Bacteria | 1007 |
| 19 | Ga0068868_100014673 | 3300005338 | Bacteria | 5779 |
| 20 | Ga0068868_100200257 | 3300005338 | Bacteria | 1664 |
| 21 | Ga0070689_100012121 | 3300005340 | Bacteria | 6200 |
| 22 | Ga0070691_10018762 | 3300005341 | Bacteria | 3189 |
| 23 | Ga0070661_100116760 | 3300005344 | Bacteria | 1996 |
| 24 | Ga0070692_10225373 | 3300005345 | Bacteria | 1110 |
| 25 | Ga0070668_100000242 | 3300005347 | Bacteria | 35872 |
| 26 | Ga0070668_100009256 | 3300005347 | Bacteria | 7304 |
| 27 | Ga0070668_100665440 | 3300005347 | Bacteria | 916 |
| 28 | Ga0070669_100005081 | 3300005353 | Bacteria | 9513 |
| 29 | Ga0070669_100030328 | 3300005353 | Bacteria | 3902 |
| 30 | Ga0070669_100393500 | 3300005353 | Bacteria | 1133 |
| 31 | Ga0070675_100115777 | 3300005354 | Bacteria | 2273 |
| 32 | Ga0070671_100002818 | 3300005355 | Bacteria | 13514 |
| 33 | Ga0070674_100004607 | 3300005356 | Bacteria | 7878 |
| 34 | Ga0070674_100067195 | 3300005356 | Bacteria | 2521 |
| 35 | Ga0070674_100234972 | 3300005356 | Bacteria | 1432 |
| 36 | Ga0070673_100182460 | 3300005364 | Bacteria | 1797 |
| 37 | Ga0070673_100427071 | 3300005364 | Bacteria | 1189 |
| 38 | Ga0070688_100006748 | 3300005365 | Bacteria | 6155 |
| 39 | Ga0070659_100004755 | 3300005366 | Bacteria | 9703 |
| 40 | Ga0070667_100000420 | 3300005367 | Bacteria | 45173 |
| 41 | Ga0070667_100000544 | 3300005367 | Bacteria | 37580 |
| 42 | Ga0070667_100010100 | 3300005367 | Bacteria | 7810 |
| 43 | Ga0070667_100027586 | 3300005367 | Bacteria | 4725 |
| 44 | Ga0070703_10074144 | 3300005406 | Bacteria | 1143 |
| 45 | Ga0070709_10104574 | 3300005434 | Bacteria | 1892 |
| 46 | Ga0070714_100314014 | 3300005435 | Bacteria | 1464 |
| 47 | Ga0070714_100429440 | 3300005435 | Bacteria | 1252 |
| 48 | Ga0070714_100811920 | 3300005435 | Bacteria | 906 |
| 49 | Ga0070710_10003235 | 3300005437 | Bacteria | 7716 |
| 50 | Ga0070710_10003876 | 3300005437 | Bacteria | 7080 |
| 51 | Ga0070710_10096464 | 3300005437 | Bacteria | 1753 |
| 52 | Ga0070701_10024593 | 3300005438 | Bacteria | 2914 |
| 53 | Ga0070711_100000663 | 3300005439 | Bacteria | 17961 |
| 54 | Ga0070705_100029772 | 3300005440 | Bacteria | 3008 |
| 55 | Ga0070694_100044443 | 3300005444 | Bacteria | 2973 |
| 56 | Ga0070694_100248455 | 3300005444 | Bacteria | 1345 |
| 57 | Ga0070708_100013579 | 3300005445 | Bacteria | 6675 |
| 58 | Ga0070708_100045457 | 3300005445 | Bacteria | 3867 |
| 59 | Ga0070708_100352634 | 3300005445 | Bacteria | 1387 |
| 60 | Ga0070708_100459079 | 3300005445 | Bacteria | 1202 |
| 61 | Ga0070663_100000795 | 3300005455 | Bacteria | 17139 |
| 62 | Ga0070663_100010657 | 3300005455 | Bacteria | 5735 |
| 63 | Ga0070663_100194434 | 3300005455 | Bacteria | 1580 |
| 64 | Ga0070678_100000459 | 3300005456 | Bacteria | 19456 |
| 65 | Ga0070678_100110382 | 3300005456 | Bacteria | 2151 |
| 66 | Ga0070678_100676952 | 3300005456 | Bacteria | 927 |
| 67 | Ga0070662_100004396 | 3300005457 | Bacteria | 8910 |
| 68 | Ga0070662_100289588 | 3300005457 | Bacteria | 1327 |
| 69 | Ga0070681_10028887 | 3300005458 | Bacteria | 5572 |
| 70 | Ga0070681_10109599 | 3300005458 | Bacteria | 2701 |
| 71 | Ga0068867_100007547 | 3300005459 | Bacteria | 7694 |
| 72 | Ga0068867_100399728 | 3300005459 | Bacteria | 1158 |
| 73 | Ga0070685_10027454 | 3300005466 | Bacteria | 3146 |
| 74 | Ga0070685_10410993 | 3300005466 | Bacteria | 939 |
| 75 | Ga0070706_100005155 | 3300005467 | Bacteria | 12471 |
| 76 | Ga0070699_100301033 | 3300005518 | Bacteria | 1439 |
| 77 | Ga0070679_100143533 | 3300005530 | Bacteria | 2366 |
| 78 | Ga0068853_100006833 | 3300005539 | Bacteria | 9098 |
| 79 | Ga0068853_100195840 | 3300005539 | Bacteria | 1838 |
| 80 | Ga0070672_100129753 | 3300005543 | Bacteria | 2071 |
| 81 | Ga0070695_100055433 | 3300005545 | Bacteria | 2555 |
| 82 | Ga0070696_100007179 | 3300005546 | Bacteria | 7440 |
| 83 | Ga0070696_100017803 | 3300005546 | Bacteria | 4797 |
| 84 | Ga0070693_100008532 | 3300005547 | Bacteria | 5059 |
| 85 | Ga0070665_100007100 | 3300005548 | Bacteria | 11381 |
| 86 | Ga0070665_100012650 | 3300005548 | Bacteria | 8499 |
| 87 | Ga0070665_100017385 | 3300005548 | Bacteria | 7217 |
| 88 | Ga0070665_100030781 | 3300005548 | Bacteria | 5401 |
| 89 | Ga0070665_100349835 | 3300005548 | Bacteria | 1483 |
| 90 | Ga0070665_100359237 | 3300005548 | Bacteria | 1462 |
| 91 | Ga0070665_100393789 | 3300005548 | Bacteria | 1393 |
| 92 | Ga0070704_100010478 | 3300005549 | Bacteria | 5642 |
| 93 | Ga0070704_100228884 | 3300005549 | Bacteria | 1515 |
| 94 | Ga0068855_100110559 | 3300005563 | Bacteria | 3155 |
| 95 | Ga0068855_100410772 | 3300005563 | Bacteria | 1482 |
| 96 | Ga0068855_100461077 | 3300005563 | Bacteria | 1386 |
| 97 | Ga0068854_100000608 | 3300005578 | Bacteria | 21244 |
| 98 | Ga0068854_100124372 | 3300005578 | Bacteria | 1962 |
| 99 | Ga0068856_100609976 | 3300005614 | Bacteria | 1112 |
| 100 | Ga0068856_101060738 | 3300005614 | Bacteria | 828 |
| 101 | Ga0070702_100070855 | 3300005615 | Bacteria | 2059 |
| 102 | Ga0070702_100160319 | 3300005615 | Bacteria | 1453 |
| 103 | Ga0068852_100436113 | 3300005616 | Bacteria | 1294 |
| 104 | Ga0068859_100007479 | 3300005617 | Bacteria | 11091 |
| 105 | Ga0068859_100030153 | 3300005617 | Bacteria | 5442 |
| 106 | Ga0068866_10004533 | 3300005718 | Bacteria | 5698 |
| 107 | Ga0068866_10120733 | 3300005718 | Bacteria | 1476 |
| 108 | Ga0068861_100004705 | 3300005719 | Bacteria | 9173 |
| 109 | Ga0068861_100118447 | 3300005719 | Bacteria | 2133 |
| 110 | Ga0068861_100207767 | 3300005719 | Bacteria | 1647 |
| 111 | Ga0068861_100503038 | 3300005719 | Bacteria | 1096 |
| 112 | Ga0068863_100000818 | 3300005841 | Bacteria | 31194 |
| 113 | Ga0068863_100105276 | 3300005841 | Bacteria | 2684 |
| 114 | Ga0068863_100108056 | 3300005841 | Bacteria | 2648 |
| 115 | Ga0068858_100001820 | 3300005842 | Bacteria | 21703 |
| 116 | Ga0068858_100011821 | 3300005842 | Bacteria | 8230 |
| 117 | Ga0068858_100023732 | 3300005842 | Bacteria | 5713 |
| 118 | Ga0068858_100394941 | 3300005842 | Bacteria | 1328 |
| 119 | Ga0068860_100000048 | 3300005843 | Bacteria | 209375 |
| 120 | Ga0068860_100012097 | 3300005843 | Bacteria | 8500 |
| 121 | Ga0068860_100100455 | 3300005843 | Bacteria | 2760 |
| 122 | Ga0068860_100577302 | 3300005843 | Bacteria | 1128 |
| 123 | Ga0068860_100721246 | 3300005843 | Bacteria | 1007 |
| 124 | Ga0068862_100000053 | 3300005844 | Bacteria | 143631 |
| 125 | Ga0068862_100015980 | 3300005844 | Bacteria | 6239 |
| 126 | Ga0068862_100187054 | 3300005844 | Bacteria | 1862 |
| 127 | Ga0081455_10002841 | 3300005937 | Bacteria | 20392 |
| 128 | Ga0081455_10011754 | 3300005937 | Bacteria | 8768 |
| 129 | Ga0081455_10031829 | 3300005937 | Bacteria | 4765 |
| 130 | Ga0081455_10053243 | 3300005937 | Bacteria | 3458 |
| 131 | Ga0081455_10132807 | 3300005937 | Bacteria | 1944 |
| 132 | Ga0081455_10133779 | 3300005937 | Bacteria | 1935 |
| 133 | Ga0081455_10243227 | 3300005937 | Bacteria | 1321 |
| 134 | Ga0081538_10049765 | 3300005981 | Bacteria | 2539 |
| 135 | Ga0075365_10002834 | 3300006038 | Bacteria | 8694 |
| 136 | Ga0075365_10038635 | 3300006038 | Bacteria | 3104 |
| 137 | Ga0075365_10040437 | 3300006038 | Bacteria | 3040 |
| 138 | Ga0075365_10048365 | 3300006038 | Bacteria | 2799 |
| 139 | Ga0075365_10161480 | 3300006038 | Bacteria | 1561 |
| 140 | Ga0075365_10169232 | 3300006038 | Bacteria | 1525 |
| 141 | Ga0075365_10215619 | 3300006038 | Bacteria | 1346 |
| 142 | Ga0075368_10041498 | 3300006042 | Bacteria | 1808 |
| 143 | Ga0075363_100002416 | 3300006048 | Bacteria | 7624 |
| 144 | Ga0075363_100002790 | 3300006048 | Bacteria | 7252 |
| 145 | Ga0075363_100021877 | 3300006048 | Bacteria | 3228 |
| 146 | Ga0075363_100022307 | 3300006048 | Bacteria | 3199 |
| 147 | Ga0075363_100041344 | 3300006048 | Bacteria | 2431 |
| 148 | Ga0075363_100058980 | 3300006048 | Bacteria | 2062 |
| 149 | Ga0075363_100096794 | 3300006048 | Bacteria | 1630 |
| 150 | Ga0075363_100158657 | 3300006048 | Bacteria | 1280 |
| 151 | Ga0075363_100226049 | 3300006048 | Bacteria | 1073 |
| 152 | Ga0075363_100236523 | 3300006048 | Bacteria | 1049 |
| 153 | Ga0075364_10001709 | 3300006051 | Bacteria | 12070 |
| 154 | Ga0075364_10002529 | 3300006051 | Bacteria | 10245 |
| 155 | Ga0075364_10004937 | 3300006051 | Bacteria | 7727 |
| 156 | Ga0075364_10008520 | 3300006051 | Bacteria | 6134 |
| 157 | Ga0075364_10014187 | 3300006051 | Bacteria | 4918 |
| 158 | Ga0075364_10104427 | 3300006051 | Bacteria | 1887 |
| 159 | Ga0075364_10109496 | 3300006051 | Bacteria | 1842 |
| 160 | Ga0075364_10187426 | 3300006051 | Bacteria | 1401 |
| 161 | Ga0075364_10316909 | 3300006051 | Bacteria | 1062 |
| 162 | Ga0070715_10072627 | 3300006163 | Bacteria | 1541 |
| 163 | Ga0070712_100001159 | 3300006175 | Bacteria | 15943 |
| 164 | Ga0070712_100022461 | 3300006175 | Bacteria | 4157 |
| 165 | Ga0070712_100504505 | 3300006175 | Bacteria | 1014 |
| 166 | Ga0075362_10018711 | 3300006177 | Bacteria | 2870 |
| 167 | Ga0075362_10084062 | 3300006177 | Bacteria | 1470 |
| 168 | Ga0075362_10098756 | 3300006177 | Bacteria | 1363 |
| 169 | Ga0075362_10225848 | 3300006177 | Bacteria | 916 |
| 170 | Ga0075367_10043148 | 3300006178 | Bacteria | 2642 |
| 171 | Ga0075367_10112226 | 3300006178 | Bacteria | 1674 |
| 172 | Ga0075367_10205360 | 3300006178 | Bacteria | 1231 |
| 173 | Ga0075369_10001719 | 3300006186 | Bacteria | 7575 |
| 174 | Ga0075369_10003008 | 3300006186 | Bacteria | 6099 |
| 175 | Ga0075369_10012059 | 3300006186 | Bacteria | 3409 |
| 176 | Ga0075369_10028394 | 3300006186 | Bacteria | 2345 |
| 177 | Ga0075369_10034831 | 3300006186 | Bacteria | 2138 |
| 178 | Ga0075369_10059482 | 3300006186 | Bacteria | 1665 |
| 179 | Ga0075369_10115180 | 3300006186 | Bacteria | 1214 |
| 180 | Ga0075369_10121975 | 3300006186 | Bacteria | 1180 |
| 181 | Ga0097621_100046178 | 3300006237 | Bacteria | 3523 |
| 182 | Ga0075370_10031081 | 3300006353 | Bacteria | 2980 |
| 183 | Ga0075370_10115673 | 3300006353 | Bacteria | 1559 |
| 184 | Ga0075370_10167716 | 3300006353 | Bacteria | 1290 |
| 185 | Ga0075370_10231062 | 3300006353 | Bacteria | 1094 |
| 186 | Ga0075370_10241140 | 3300006353 | Bacteria | 1070 |
| 187 | Ga0075370_10274747 | 3300006353 | Bacteria | 1000 |
| 188 | Ga0068871_100449400 | 3300006358 | Bacteria | 1155 |
| 189 | Ga0075428_100004799 | 3300006844 | Bacteria | 14992 |
| 190 | Ga0075428_100013494 | 3300006844 | Bacteria | 9093 |
| 191 | Ga0075428_100044817 | 3300006844 | Bacteria | 4860 |
| 192 | Ga0075428_100063605 | 3300006844 | Bacteria | 4040 |
| 193 | Ga0075428_100064989 | 3300006844 | Bacteria | 3995 |
| 194 | Ga0075430_100024958 | 3300006846 | Bacteria | 5085 |
| 195 | Ga0075430_100064811 | 3300006846 | Bacteria | 3070 |
| 196 | Ga0075430_100080372 | 3300006846 | Bacteria | 2731 |
| 197 | Ga0075430_100179845 | 3300006846 | Bacteria | 1759 |
| 198 | Ga0075430_100247053 | 3300006846 | Bacteria | 1479 |
| 199 | Ga0075431_100002922 | 3300006847 | Bacteria | 16543 |
| 200 | Ga0075431_100043370 | 3300006847 | Bacteria | 4642 |
| 201 | Ga0075431_100241443 | 3300006847 | Bacteria | 1838 |
| 202 | Ga0075431_100491627 | 3300006847 | Bacteria | 1219 |
| 203 | Ga0075434_100394812 | 3300006871 | Bacteria | 1404 |
| 204 | Ga0075429_100011604 | 3300006880 | Bacteria | 7642 |
| 205 | Ga0075429_100050085 | 3300006880 | Bacteria | 3634 |
| 206 | Ga0075429_100083434 | 3300006880 | Bacteria | 2786 |
| 207 | Ga0075429_100123804 | 3300006880 | Bacteria | 2260 |
| 208 | Ga0075429_100129666 | 3300006880 | Bacteria | 2206 |
| 209 | Ga0068865_100004581 | 3300006881 | Bacteria | 8343 |
| 210 | Ga0097620_100007479 | 3300006931 | Bacteria | 11091 |
| 211 | Ga0097620_100030152 | 3300006931 | Bacteria | 5442 |
| 212 | Ga0099795_10074357 | 3300007788 | Bacteria | 1288 |
| 213 | Ga0105251_10018513 | 3300009011 | Bacteria | 3701 |
| 214 | Ga0105250_10139551 | 3300009092 | Bacteria | 1004 |
| 215 | Ga0111539_10003516 | 3300009094 | Bacteria | 20665 |
| 216 | Ga0111539_10007896 | 3300009094 | Bacteria | 13579 |
| 217 | Ga0111539_10008660 | 3300009094 | Bacteria | 12914 |
| 218 | Ga0111539_10146768 | 3300009094 | Bacteria | 2762 |
| 219 | Ga0111539_10382934 | 3300009094 | Bacteria | 1638 |
| 220 | Ga0111539_10643535 | 3300009094 | Bacteria | 1234 |
| 221 | Ga0105245_10001283 | 3300009098 | Bacteria | 22648 |
| 222 | Ga0105245_10007676 | 3300009098 | Bacteria | 9448 |
| 223 | Ga0105245_10058042 | 3300009098 | Bacteria | 3483 |
| 224 | Ga0105247_10000118 | 3300009101 | Bacteria | 77424 |
| 225 | Ga0105247_10000195 | 3300009101 | Bacteria | 59840 |
| 226 | Ga0105247_10000413 | 3300009101 | Bacteria | 36208 |
| 227 | Ga0105247_10001525 | 3300009101 | Bacteria | 16561 |
| 228 | Ga0105247_10055705 | 3300009101 | Bacteria | 2440 |
| 229 | Ga0105247_10092793 | 3300009101 | Bacteria | 1918 |
| 230 | Ga0105247_10185289 | 3300009101 | Bacteria | 1391 |
| 231 | Ga0114129_10001629 | 3300009147 | Bacteria | 30482 |
| 232 | Ga0114129_10003146 | 3300009147 | Bacteria | 23167 |
| 233 | Ga0114129_10006791 | 3300009147 | Bacteria | 16247 |
| 234 | Ga0114129_10033012 | 3300009147 | Bacteria | 7315 |
| 235 | Ga0114129_10201392 | 3300009147 | Bacteria | 2696 |
| 236 | Ga0105243_10000773 | 3300009148 | Bacteria | 30624 |
| 237 | Ga0105243_10185687 | 3300009148 | Bacteria | 1812 |
| 238 | Ga0105243_10371859 | 3300009148 | Bacteria | 1319 |
| 239 | Ga0105243_10696557 | 3300009148 | Bacteria | 990 |
| 240 | Ga0105241_10012270 | 3300009174 | Bacteria | 6287 |
| 241 | Ga0105242_10011770 | 3300009176 | Bacteria | 6732 |
| 242 | Ga0105242_10092028 | 3300009176 | Bacteria | 2554 |
| 243 | Ga0105242_10583699 | 3300009176 | Bacteria | 1077 |
| 244 | Ga0105248_10000151 | 3300009177 | Bacteria | 81027 |
| 245 | Ga0105248_10007012 | 3300009177 | Bacteria | 12339 |
| 246 | Ga0105248_10013545 | 3300009177 | Bacteria | 8977 |
| 247 | Ga0105248_10250908 | 3300009177 | Bacteria | 1992 |
| 248 | Ga0105237_10013445 | 3300009545 | Bacteria | 8583 |
| 249 | Ga0105237_10036627 | 3300009545 | Bacteria | 4965 |
| 250 | Ga0105237_10077118 | 3300009545 | Bacteria | 3323 |
| 251 | Ga0105249_10000022 | 3300009553 | Bacteria | 258377 |
| 252 | Ga0105249_10004515 | 3300009553 | Bacteria | 12030 |
| 253 | Ga0105249_10155145 | 3300009553 | Bacteria | 2207 |
| 254 | Ga0105249_10610163 | 3300009553 | Bacteria | 1146 |
| 255 | Ga0105249_10666839 | 3300009553 | Bacteria | 1098 |
| 256 | Ga0099796_10057134 | 3300010159 | Bacteria | 1372 |
| 257 | Ga0105239_10043734 | 3300010375 | Bacteria | 4911 |
| 258 | Ga0105239_10095488 | 3300010375 | Bacteria | 3284 |
| 259 | Ga0105239_10580723 | 3300010375 | Bacteria | 1278 |
| 260 | Ga0105239_10684577 | 3300010375 | Bacteria | 1172 |
| 261 | Ga0105239_10821585 | 3300010375 | Bacteria | 1065 |
| 262 | Ga0105239_11037786 | 3300010375 | Bacteria | 943 |
| 263 | Ga0105246_10116320 | 3300011119 | Bacteria | 1974 |
| 264 | Ga0105246_10339824 | 3300011119 | Bacteria | 1227 |
| 265 | Ga0105246_10374712 | 3300011119 | Bacteria | 1174 |
| 266 | Ga0157369_10069869 | 3300013105 | Bacteria | 3773 |
| 267 | Ga0157369_10199327 | 3300013105 | Bacteria | 2101 |
| 268 | Ga0157378_10002823 | 3300013297 | Bacteria | 15493 |
| 269 | Ga0157378_10319649 | 3300013297 | Bacteria | 1507 |
| 270 | Ga0157378_10381281 | 3300013297 | Unclassified | 1385 |
| 271 | Ga0163162_10002292 | 3300013306 | Bacteria | 17964 |
| 272 | Ga0163162_10089288 | 3300013306 | Bacteria | 3162 |
| 273 | Ga0163162_10130397 | 3300013306 | Bacteria | 2622 |
| 274 | Ga0163162_10221827 | 3300013306 | Bacteria | 2020 |
| 275 | Ga0163162_10940275 | 3300013306 | Bacteria | 976 |
| 276 | Ga0163162_11289078 | 3300013306 | Bacteria | 830 |
| 277 | Ga0157372_10030734 | 3300013307 | Bacteria | 5877 |
| 278 | Ga0157372_10097249 | 3300013307 | Bacteria | 3357 |
| 279 | Ga0157375_10028525 | 3300013308 | Bacteria | 5233 |
| 280 | Ga0157375_10082487 | 3300013308 | Bacteria | 3257 |
| 281 | Ga0157375_10262588 | 3300013308 | Bacteria | 1888 |
| 282 | Ga0157375_10388900 | 3300013308 | Bacteria | 1561 |
| 283 | Ga0157375_11053991 | 3300013308 | Bacteria | 951 |
| 284 | Ga0163163_10003313 | 3300014325 | Bacteria | 13660 |
| 285 | Ga0163163_11110220 | 3300014325 | Bacteria | 854 |
| 286 | Ga0157380_10006763 | 3300014326 | Bacteria | 8104 |
| 287 | Ga0157380_10052902 | 3300014326 | Bacteria | 3217 |
| 288 | Ga0157380_10095069 | 3300014326 | Bacteria | 2468 |
| 289 | Ga0157380_10212413 | 3300014326 | Bacteria | 1725 |
| 290 | Ga0157380_10779192 | 3300014326 | Bacteria | 971 |
| 291 | Ga0157380_11036224 | 3300014326 | Bacteria | 856 |
| 292 | Ga0182008_10113655 | 3300014497 | Bacteria | 1342 |
| 293 | Ga0157377_10160789 | 3300014745 | Bacteria | 1396 |
| 294 | Ga0157377_10277956 | 3300014745 | Bacteria | 1096 |
| 295 | Ga0157379_10001742 | 3300014968 | Bacteria | 17990 |
| 296 | Ga0157379_10048775 | 3300014968 | Bacteria | 3780 |
| 297 | Ga0157379_10067726 | 3300014968 | Bacteria | 3191 |
| 298 | Ga0157379_10106220 | 3300014968 | Bacteria | 2520 |
| 299 | Ga0157379_10265772 | 3300014968 | Bacteria | 1559 |
| 300 | Ga0157376_10106149 | 3300014969 | Bacteria | 2464 |
| 301 | Ga0163161_10000939 | 3300017792 | Bacteria | 22414 |
| 302 | Ga0163161_10010290 | 3300017792 | Bacteria | 6478 |
| 303 | Ga0163161_10095548 | 3300017792 | Bacteria | 2205 |
| 304 | Ga0213876_10005702 | 3300021384 | Bacteria | 6828 |
| 305 | Ga0213876_10006963 | 3300021384 | Bacteria | 6163 |
| 306 | Ga0213875_10097570 | 3300021388 | Bacteria | 1371 |
| 307 | Ga0213875_10178359 | 3300021388 | Bacteria | 998 |
| 308 | Ga0224572_1021500 | 3300024225 | Bacteria | 1238 |
| 309 | Ga0209051_1000051 | 3300025303 | Bacteria | 283620 |
| 310 | Ga0209051_1001489 | 3300025303 | Bacteria | 19606 |
| 311 | Ga0209051_1001900 | 3300025303 | Bacteria | 16287 |
| 312 | Ga0209051_1066991 | 3300025303 | Bacteria | 1100 |
| 313 | Ga0207696_1055064 | 3300025711 | Bacteria | 1129 |
| 314 | Ga0207692_10006326 | 3300025898 | Bacteria | 4798 |
| 315 | Ga0207692_10074385 | 3300025898 | Bacteria | 1800 |
| 316 | Ga0207642_10000995 | 3300025899 | Bacteria | 8857 |
| 317 | Ga0207710_10000029 | 3300025900 | Bacteria | 289155 |
| 318 | Ga0207710_10000076 | 3300025900 | Bacteria | 145523 |
| 319 | Ga0207710_10000091 | 3300025900 | Bacteria | 121330 |
| 320 | Ga0207710_10003297 | 3300025900 | Bacteria | 7215 |
| 321 | Ga0207688_10001765 | 3300025901 | Bacteria | 11487 |
| 322 | Ga0207688_10002070 | 3300025901 | Bacteria | 10777 |
| 323 | Ga0207688_10262257 | 3300025901 | Bacteria | 1049 |
| 324 | Ga0207680_10075538 | 3300025903 | Bacteria | 2102 |
| 325 | Ga0207680_10082562 | 3300025903 | Bacteria | 2023 |
| 326 | Ga0207647_10124217 | 3300025904 | Bacteria | 1520 |
| 327 | Ga0207647_10274870 | 3300025904 | Bacteria | 962 |
| 328 | Ga0207685_10047646 | 3300025905 | Bacteria | 1637 |
| 329 | Ga0207699_10144692 | 3300025906 | Bacteria | 1566 |
| 330 | Ga0207645_10043029 | 3300025907 | Bacteria | 2889 |
| 331 | Ga0207684_10015458 | 3300025910 | Bacteria | 6567 |
| 332 | Ga0207654_10054565 | 3300025911 | Bacteria | 2310 |
| 333 | Ga0207707_10031389 | 3300025912 | Bacteria | 4649 |
| 334 | Ga0207671_10010972 | 3300025914 | Bacteria | 7422 |
| 335 | Ga0207671_10056830 | 3300025914 | Bacteria | 2900 |
| 336 | Ga0207671_10063268 | 3300025914 | Bacteria | 2749 |
| 337 | Ga0207671_10186716 | 3300025914 | Bacteria | 1615 |
| 338 | Ga0207693_10000513 | 3300025915 | Bacteria | 34994 |
| 339 | Ga0207693_10021564 | 3300025915 | Bacteria | 5119 |
| 340 | Ga0207663_10002243 | 3300025916 | Bacteria | 9247 |
| 341 | Ga0207663_10007211 | 3300025916 | Bacteria | 5752 |
| 342 | Ga0207663_10242952 | 3300025916 | Bacteria | 1321 |
| 343 | Ga0207660_10272551 | 3300025917 | Bacteria | 1341 |
| 344 | Ga0207662_10044720 | 3300025918 | Bacteria | 2615 |
| 345 | Ga0207657_10229717 | 3300025919 | Bacteria | 1484 |
| 346 | Ga0207681_10001228 | 3300025923 | Bacteria | 16511 |
| 347 | Ga0207681_10024065 | 3300025923 | Bacteria | 3904 |
| 348 | Ga0207681_10773482 | 3300025923 | Bacteria | 801 |
| 349 | Ga0207659_10409214 | 3300025926 | Bacteria | 1136 |
| 350 | Ga0207687_10006399 | 3300025927 | Bacteria | 7779 |
| 351 | Ga0207687_10012713 | 3300025927 | Bacteria | 5501 |
| 352 | Ga0207700_10083531 | 3300025928 | Bacteria | 2500 |
| 353 | Ga0207664_10240262 | 3300025929 | Bacteria | 1577 |
| 354 | Ga0207664_10679061 | 3300025929 | Bacteria | 926 |
| 355 | Ga0207644_10045936 | 3300025931 | Bacteria | 3109 |
| 356 | Ga0207644_10063626 | 3300025931 | Bacteria | 2679 |
| 357 | Ga0207690_10083671 | 3300025932 | Bacteria | 2235 |
| 358 | Ga0207706_10005762 | 3300025933 | Bacteria | 11528 |
| 359 | Ga0207706_10159703 | 3300025933 | Bacteria | 1981 |
| 360 | Ga0207706_10718761 | 3300025933 | Bacteria | 852 |
| 361 | Ga0207709_10178107 | 3300025935 | Bacteria | 1499 |
| 362 | Ga0207709_10354787 | 3300025935 | Bacteria | 1108 |
| 363 | Ga0207709_10422149 | 3300025935 | Bacteria | 1024 |
| 364 | Ga0207670_10006353 | 3300025936 | Bacteria | 6550 |
| 365 | Ga0207670_10012662 | 3300025936 | Bacteria | 4943 |
| 366 | Ga0207669_10001354 | 3300025937 | Bacteria | 10425 |
| 367 | Ga0207669_10057021 | 3300025937 | Bacteria | 2376 |
| 368 | Ga0207669_10437204 | 3300025937 | Bacteria | 1034 |
| 369 | Ga0207669_10511703 | 3300025937 | Bacteria | 962 |
| 370 | Ga0207704_10009059 | 3300025938 | Bacteria | 4785 |
| 371 | Ga0207704_10212038 | 3300025938 | Bacteria | 1426 |
| 372 | Ga0207665_10000852 | 3300025939 | Bacteria | 20607 |
| 373 | Ga0207691_10168095 | 3300025940 | Bacteria | 1921 |
| 374 | Ga0207711_10000172 | 3300025941 | Bacteria | 69349 |
| 375 | Ga0207711_10037703 | 3300025941 | Bacteria | 4108 |
| 376 | Ga0207711_10038570 | 3300025941 | Bacteria | 4063 |
| 377 | Ga0207711_10072739 | 3300025941 | Bacteria | 2987 |
| 378 | Ga0207689_10026221 | 3300025942 | Bacteria | 4881 |
| 379 | Ga0207667_10353098 | 3300025949 | Bacteria | 1499 |
| 380 | Ga0207667_10393814 | 3300025949 | Bacteria | 1410 |
| 381 | Ga0207651_10120996 | 3300025960 | Bacteria | 1985 |
| 382 | Ga0207651_10306129 | 3300025960 | Bacteria | 1323 |
| 383 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 384 | Ga0207712_10019806 | 3300025961 | Bacteria | 4398 |
| 385 | Ga0207712_10077385 | 3300025961 | Bacteria | 2411 |
| 386 | Ga0207712_10116233 | 3300025961 | Bacteria | 2015 |
| 387 | Ga0207712_10310735 | 3300025961 | Bacteria | 1297 |
| 388 | Ga0207668_10008387 | 3300025972 | Bacteria | 6156 |
| 389 | Ga0207668_10029503 | 3300025972 | Bacteria | 3596 |
| 390 | Ga0207668_10089894 | 3300025972 | Bacteria | 2252 |
| 391 | Ga0207640_10008326 | 3300025981 | Bacteria | 5759 |
| 392 | Ga0207658_10000356 | 3300025986 | Bacteria | 45186 |
| 393 | Ga0207658_10003633 | 3300025986 | Bacteria | 10897 |
| 394 | Ga0207658_10104456 | 3300025986 | Bacteria | 2226 |
| 395 | Ga0207658_10182743 | 3300025986 | Bacteria | 1737 |
| 396 | Ga0207677_10015714 | 3300026023 | Bacteria | 4463 |
| 397 | Ga0207677_10122968 | 3300026023 | Bacteria | 1956 |
| 398 | Ga0207703_10000392 | 3300026035 | Bacteria | 47040 |
| 399 | Ga0207703_10009257 | 3300026035 | Bacteria | 7746 |
| 400 | Ga0207703_10034176 | 3300026035 | Bacteria | 4034 |
| 401 | Ga0207639_10022607 | 3300026041 | Bacteria | 4531 |
| 402 | Ga0207639_10168686 | 3300026041 | Bacteria | 1851 |
| 403 | Ga0207678_10000312 | 3300026067 | Bacteria | 43816 |
| 404 | Ga0207678_10008726 | 3300026067 | Bacteria | 8925 |
| 405 | Ga0207678_10126186 | 3300026067 | Bacteria | 2183 |
| 406 | Ga0207708_10049662 | 3300026075 | Bacteria | 3195 |
| 407 | Ga0207702_10532442 | 3300026078 | Bacteria | 1148 |
| 408 | Ga0207702_10836713 | 3300026078 | Bacteria | 911 |
| 409 | Ga0207641_10002348 | 3300026088 | Bacteria | 17500 |
| 410 | Ga0207641_10023303 | 3300026088 | Bacteria | 5102 |
| 411 | Ga0207641_10090704 | 3300026088 | Bacteria | 2673 |
| 412 | Ga0207641_10200930 | 3300026088 | Bacteria | 1838 |
| 413 | Ga0207641_10679484 | 3300026088 | Bacteria | 1013 |
| 414 | Ga0207648_10001669 | 3300026089 | Bacteria | 24324 |
| 415 | Ga0207648_10156982 | 3300026089 | Bacteria | 2008 |
| 416 | Ga0207648_10168992 | 3300026089 | Bacteria | 1933 |
| 417 | Ga0207676_10261578 | 3300026095 | Bacteria | 1563 |
| 418 | Ga0207676_10509274 | 3300026095 | Bacteria | 1144 |
| 419 | Ga0207676_10848985 | 3300026095 | Bacteria | 893 |
| 420 | Ga0207676_11227877 | 3300026095 | Bacteria | 743 |
| 421 | Ga0207674_10614471 | 3300026116 | Bacteria | 1050 |
| 422 | Ga0207675_100004512 | 3300026118 | Bacteria | 13447 |
| 423 | Ga0207675_100314079 | 3300026118 | Bacteria | 1529 |
| 424 | Ga0207675_100468746 | 3300026118 | Bacteria | 1250 |
| 425 | Ga0207675_100592497 | 3300026118 | Bacteria | 1111 |
| 426 | Ga0207683_10001309 | 3300026121 | Bacteria | 22501 |
| 427 | Ga0207683_10017976 | 3300026121 | Bacteria | 6029 |
| 428 | Ga0207683_10075414 | 3300026121 | Bacteria | 2985 |
| 429 | Ga0207683_10155034 | 3300026121 | Bacteria | 2068 |
| 430 | Ga0207683_10749877 | 3300026121 | Bacteria | 906 |
| 431 | Ga0207428_10041400 | 3300027907 | Bacteria | 3730 |
| 432 | Ga0207428_10128299 | 3300027907 | Bacteria | 1942 |
| 433 | Ga0207428_10403756 | 3300027907 | Bacteria | 1000 |
| 434 | Ga0268266_10007915 | 3300028379 | Bacteria | 9518 |
| 435 | Ga0268266_10021881 | 3300028379 | Bacteria | 5448 |
| 436 | Ga0268266_10055544 | 3300028379 | Bacteria | 3404 |
| 437 | Ga0268266_10069556 | 3300028379 | Bacteria | 3050 |
| 438 | Ga0268266_10074167 | 3300028379 | Bacteria | 2954 |
| 439 | Ga0268265_10000005 | 3300028380 | Bacteria | 535350 |
| 440 | Ga0268265_10047339 | 3300028380 | Bacteria | 3222 |
| 441 | Ga0268265_10137513 | 3300028380 | Bacteria | 2040 |
| 442 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 443 | Ga0268264_10005001 | 3300028381 | Bacteria | 11218 |
| 444 | Ga0268264_10010103 | 3300028381 | Bacteria | 7811 |
| 445 | Ga0268264_10257260 | 3300028381 | Bacteria | 1625 |
| 446 | Ga0268264_10425878 | 3300028381 | Bacteria | 1281 |
| 447 | Ga0265336_10023226 | 3300028666 | Bacteria | 1969 |
| 448 | Ga0307515_10049214 | 3300028794 | Bacteria | 6350 |
| 449 | Ga0265327_10003360 | 3300031251 | Bacteria | 15417 |
| 450 | Ga0265327_10007674 | 3300031251 | Bacteria | 8261 |
| 451 | Ga0307513_10026057 | 3300031456 | Bacteria | 6752 |
| 452 | Ga0307513_10051706 | 3300031456 | Bacteria | 4430 |
| 453 | Ga0307513_10328386 | 3300031456 | Bacteria | 1285 |
| 454 | Ga0307408_100071279 | 3300031548 | Bacteria | 2569 |
| 455 | Ga0316576_10014864 | 3300031727 | Bacteria | 5208 |
| 456 | Ga0316576_10026583 | 3300031727 | Bacteria | 4062 |
| 457 | Ga0316576_10038890 | 3300031727 | Bacteria | 3413 |
| 458 | Ga0316576_10044572 | 3300031727 | Bacteria | 3204 |
| 459 | Ga0316576_10050442 | 3300031727 | Bacteria | 3027 |
| 460 | Ga0316576_10089315 | 3300031727 | Bacteria | 2295 |
| 461 | Ga0316576_10114759 | 3300031727 | Bacteria | 2020 |
| 462 | Ga0316578_10000199 | 3300031728 | Bacteria | 17042 |
| 463 | Ga0316578_10004340 | 3300031728 | Bacteria | 6676 |
| 464 | Ga0316578_10005773 | 3300031728 | Bacteria | 6042 |
| 465 | Ga0316578_10310667 | 3300031728 | Bacteria | 942 |
| 466 | Ga0316577_10077528 | 3300031733 | Bacteria | 1856 |
| 467 | Ga0316577_10270660 | 3300031733 | Bacteria | 961 |
| 468 | Ga0307413_10284024 | 3300031824 | Bacteria | 1246 |
| 469 | Ga0307518_10004976 | 3300031838 | Bacteria | 9506 |
| 470 | Ga0307406_10604970 | 3300031901 | Bacteria | 904 |
| 471 | Ga0307407_10278727 | 3300031903 | Bacteria | 1157 |
| 472 | Ga0307412_10193861 | 3300031911 | Bacteria | 1538 |
| 473 | Ga0307412_10340767 | 3300031911 | Bacteria | 1200 |
| 474 | Ga0307409_100122099 | 3300031995 | Bacteria | 2208 |
| 475 | Ga0307409_100215620 | 3300031995 | Bacteria | 1729 |
| 476 | Ga0307416_100076770 | 3300032002 | Bacteria | 2802 |
| 477 | Ga0307416_100324519 | 3300032002 | Bacteria | 1544 |
| 478 | Ga0307416_100364835 | 3300032002 | Bacteria | 1468 |
| 479 | Ga0307414_10163103 | 3300032004 | Bacteria | 1773 |
| 480 | Ga0307411_10645651 | 3300032005 | Bacteria | 916 |
| 481 | Ga0307415_100123955 | 3300032126 | Bacteria | 1943 |
| 482 | Ga0307507_10059312 | 3300033179 | Bacteria | 3583 |
| 483 | Ga0307510_10062879 | 3300033180 | Bacteria | 3787 |
| 484 | Ga0373948_0015998 | 3300034817 | Bacteria | 1382 |
| 485 | Ga0373928_0008232 | 3300035084 | Bacteria | 2022 |
| 486 | Ga0373929_0002852 | 3300035085 | Bacteria | 3158 |
| 487 | Ga0373929_0039886 | 3300035085 | Bacteria | 1039 |
| 488 | Ga0373932_0000149 | 3300035112 | Bacteria | 19976 |
| 489 | Ga0373953_0064474 | 3300035117 | Bacteria | 1503 |
| 490 | Ga0373961_0074403 | 3300035241 | Bacteria | 1057 |
| 491 | Ga0316574_0011965 | 3300035398 | Bacteria | 4949 |
| 492 | Ga0316574_0034545 | 3300035398 | Bacteria | 3084 |
| 493 | Ga0316574_0044055 | 3300035398 | Bacteria | 2760 |
| 494 | Ga0316574_0047718 | 3300035398 | Bacteria | 2659 |
| 495 | Ga0316574_0059585 | 3300035398 | Bacteria | 2395 |
| 496 | Ga0316574_0068231 | 3300035398 | Bacteria | 2242 |
| 497 | Ga0316574_0100826 | 3300035398 | Bacteria | 1848 |
| 498 | Ga0316574_0129518 | 3300035398 | Bacteria | 1623 |
| 499 | Ga0316574_0369974 | 3300035398 | Bacteria | 905 |
| 500 | Ga0316574_0414827 | 3300035398 | Bacteria | 847 |
| 501 | Ga0373931_0000005 | 3300035691 | Bacteria | 480485 |
| 502 | Ga0373931_0000070 | 3300035691 | Bacteria | 49819 |
| 503 | Ga0373931_0009617 | 3300035691 | Bacteria | 4629 |
| 504 | Ga0373931_0084331 | 3300035691 | Bacteria | 1759 |
| 505 | Ga0373931_0254889 | 3300035691 | Bacteria | 1068 |
| 506 | Ga0373933_0190829 | 3300035724 | Bacteria | 1309 |
| 507 | Ga0373947_0157853 | 3300035725 | Bacteria | 1465 |
| 508 | Ga0373937_0022133 | 3300036401 | Bacteria | 5711 |
| 509 | Ga0316582_0028824 | 3300036647 | Bacteria | 3367 |
| 510 | Ga0316582_0221947 | 3300036647 | Bacteria | 1292 |
| 511 | Ga0316584_0009292 | 3300036712 | Bacteria | 6818 |
| 512 | Ga0316584_0014998 | 3300036712 | Bacteria | 5534 |
| 513 | Ga0316584_0020525 | 3300036712 | Bacteria | 4791 |
| 514 | Ga0316584_0202556 | 3300036712 | Bacteria | 1464 |
| 515 | Ga0373925_0337512 | 3300037068 | Bacteria | 1222 |
| 516 | Ga0395905_0134481 | 3300037471 | Bacteria | 2326 |
| 517 | Ga0436364_0247820 | 3300037853 | Bacteria | 988 |
| 518 | Ga0436364_0376382 | 3300037853 | Bacteria | 1913 |
| 519 | Ga0436364_0627822 | 3300037853 | Bacteria | 7432 |
| 520 | Ga0436364_0812123 | 3300037853 | Bacteria | 1875 |
| 521 | Ga0436364_0859478 | 3300037853 | Bacteria | 14849 |
| 522 | Ga0436364_1330762 | 3300037853 | Bacteria | 1040 |
| 523 | Ga0395901_0829400 | 3300038443 | Bacteria | 912 |
| 524 | Ga0400485_08781 | 3300038735 | Bacteria | 4917 |
| 525 | Ga0400483_027616 | 3300039062 | Bacteria | 1071 |
| 526 | Ga0400483_058092 | 3300039062 | Bacteria | 1235 |
| 527 | Ga0400483_128414 | 3300039062 | Bacteria | 7994 |
| 528 | Ga0436365_0530475 | 3300039437 | Bacteria | 1512 |
| 529 | Ga0436365_0712680 | 3300039437 | Bacteria | 47182 |
| 530 | Ga0436365_0983079 | 3300039437 | Bacteria | 6284 |
| 531 | Ga0436365_1888780 | 3300039437 | Bacteria | 23476 |
| 532 | Ga0436361_0376062 | 3300039447 | Bacteria | 833 |
| 533 | Ga0436363_0223575 | 3300039450 | Bacteria | 1264 |
| 534 | Ga0436363_0709713 | 3300039450 | Bacteria | 1144 |
| 535 | Ga0436363_0836064 | 3300039450 | Bacteria | 1304 |
| 536 | Ga0439436_0045543 | 3300041404 | Bacteria | 1248 |
| 537 | Ga0439439_0004099 | 3300041406 | Bacteria | 3258 |
| 538 | Ga0439461_0024936 | 3300041410 | Bacteria | 1212 |
| 539 | Ga0439466_0020218 | 3300041411 | Bacteria | 2375 |
| 540 | Ga0439465_0002227 | 3300041413 | Bacteria | 6360 |
| 541 | Ga0439465_0002339 | 3300041413 | Bacteria | 6218 |
| 542 | Ga0439465_0040516 | 3300041413 | Bacteria | 1506 |
| 543 | Ga0439465_0070137 | 3300041413 | Bacteria | 1173 |
| 544 | Ga0451807_2366488 | 3300041486 | Bacteria | 889 |
| 545 | Ga0439442_037188 | 3300042002 | Bacteria | 1020 |
| 546 | Ga0439445_0003083 | 3300042004 | Bacteria | 3733 |
| 547 | Ga0439445_0093555 | 3300042004 | Bacteria | 848 |
| 548 | Ga0439448_0087574 | 3300042005 | Bacteria | 1050 |
| 549 | Ga0439452_032504 | 3300042010 | Bacteria | 1273 |
| 550 | Ga0439452_058374 | 3300042010 | Bacteria | 869 |
| 551 | Ga0450902_017562 | 3300042137 | Bacteria | 1170 |
| 552 | Ga0439458_0089914 | 3300042157 | Bacteria | 790 |
| 553 | Ga0439434_0074525 | 3300042435 | Bacteria | 1071 |
| 554 | Ga0439444_0027144 | 3300042437 | Bacteria | 1052 |
| 555 | Ga0439464_0001811 | 3300042439 | Bacteria | 5160 |
| 556 | Ga0439460_0012259 | 3300042461 | Bacteria | 2221 |
| 557 | Ga0451577_0000984 | 3300042876 | Bacteria | 41467 |
| 558 | Ga0466969_0117815 | 3300044656 | Bacteria | 1238 |
| 559 | Ga0466972_0002130 | 3300044658 | Bacteria | 9720 |
| 560 | Ga0466972_0015250 | 3300044658 | Bacteria | 3842 |
| 561 | Ga0466972_0018390 | 3300044658 | Bacteria | 3493 |
| 562 | Ga0466972_0024503 | 3300044658 | Bacteria | 2994 |
| 563 | Ga0466972_0045367 | 3300044658 | Bacteria | 2131 |
| 564 | Ga0466972_0092925 | 3300044658 | Bacteria | 1430 |
| 565 | Ga0466972_0097287 | 3300044658 | Bacteria | 1394 |
| 566 | Ga0466965_0003626 | 3300044683 | Bacteria | 6802 |
| 567 | Ga0466965_0008281 | 3300044683 | Bacteria | 4806 |
| 568 | Ga0466965_0020332 | 3300044683 | Bacteria | 3190 |
| 569 | Ga0466965_0029783 | 3300044683 | Bacteria | 2657 |
| 570 | Ga0466961_0033971 | 3300044693 | Bacteria | 3276 |
| 571 | Ga0466961_0109723 | 3300044693 | Bacteria | 1737 |
| 572 | Ga0466961_0109927 | 3300044693 | Bacteria | 1735 |
| 573 | Ga0466961_0400133 | 3300044693 | Bacteria | 833 |
| 574 | Ga0466963_0033417 | 3300044694 | Bacteria | 3339 |
| 575 | Ga0466963_0065377 | 3300044694 | Bacteria | 2438 |
| 576 | Ga0466963_0101673 | 3300044694 | Bacteria | 1968 |
| 577 | Ga0466963_0330718 | 3300044694 | Bacteria | 1073 |
| 578 | Ga0466963_0362285 | 3300044694 | Bacteria | 1021 |
| 579 | Ga0466964_0014296 | 3300044706 | Bacteria | 3018 |
| 580 | Ga0453684_0010613 | 3300044712 | Bacteria | 15709 |
| 581 | Ga0466971_0087645 | 3300044719 | Bacteria | 1423 |
| 582 | Ga0466971_0097761 | 3300044719 | Bacteria | 1347 |
| 583 | Ga0466971_0216303 | 3300044719 | Bacteria | 907 |
| 584 | Ga0466968_0018033 | 3300044735 | Bacteria | 2828 |
| 585 | Ga0466968_0127631 | 3300044735 | Bacteria | 1155 |
| 586 | Ga0466968_0223036 | 3300044735 | Bacteria | 888 |
| 587 | Ga0466970_0003910 | 3300044765 | Bacteria | 7297 |
| 588 | Ga0466970_0088771 | 3300044765 | Bacteria | 1676 |
| 589 | Ga0466970_0218293 | 3300044765 | Bacteria | 1064 |
| 590 | Ga0466957_0004259 | 3300044842 | Bacteria | 7931 |
| 591 | Ga0466957_0122562 | 3300044842 | Bacteria | 1658 |
| 592 | Ga0466957_0216742 | 3300044842 | Bacteria | 1262 |
| 593 | Ga0466960_0000482 | 3300044901 | Bacteria | 13577 |
| 594 | Ga0466960_0000689 | 3300044901 | Bacteria | 11770 |
| 595 | Ga0466960_0002286 | 3300044901 | Bacteria | 7173 |
| 596 | Ga0466960_0007001 | 3300044901 | Bacteria | 4554 |
| 597 | Ga0466960_0021941 | 3300044901 | Bacteria | 2849 |
| 598 | Ga0466960_0127999 | 3300044901 | Bacteria | 1337 |
| 599 | Ga0466960_0128351 | 3300044901 | Bacteria | 1335 |
| 600 | Ga0466960_0167517 | 3300044901 | Bacteria | 1184 |
| 601 | Ga0466959_0004691 | 3300045049 | Bacteria | 9203 |
| 602 | Ga0466959_0091764 | 3300045049 | Bacteria | 2180 |
| 603 | Ga0451576_0758626 | 3300045051 | Bacteria | 1019 |
| 604 | Ga0466958_0005121 | 3300045836 | Bacteria | 7007 |
| 605 | Ga0466958_0008266 | 3300045836 | Bacteria | 5763 |
| 606 | Ga0466958_0071272 | 3300045836 | Bacteria | 2128 |
| 607 | Ga0466958_0089696 | 3300045836 | Bacteria | 1901 |
| 608 | Ga0466958_0130648 | 3300045836 | Bacteria | 1577 |
| 609 | Ga0466958_0198345 | 3300045836 | Bacteria | 1277 |
| 610 | Ga0466967_0012840 | 3300045976 | Bacteria | 6437 |
| 611 | Ga0466967_0021263 | 3300045976 | Bacteria | 5264 |
| 612 | Ga0466967_0069194 | 3300045976 | Bacteria | 3154 |
| 613 | Ga0466967_0089291 | 3300045976 | Bacteria | 2798 |
| 614 | Ga0466967_0106514 | 3300045976 | Bacteria | 2570 |
| 615 | Ga0466967_0592523 | 3300045976 | Bacteria | 1094 |
| 616 | Ga0466967_0650624 | 3300045976 | Bacteria | 1042 |
| 617 | Ga0466967_0739844 | 3300045976 | Bacteria | 975 |
| 618 | Ga0466967_1124399 | 3300045976 | Bacteria | 783 |
| 619 | Ga0495592_0118747 | 3300046454 | Bacteria | 1863 |
| 620 | Ga0495629_0004180 | 3300046459 | Bacteria | 10839 |
| 621 | Ga0495629_0429982 | 3300046459 | Bacteria | 895 |
| 622 | Ga0495641_0017750 | 3300046461 | Bacteria | 3696 |
| 623 | Ga0495641_0107633 | 3300046461 | Bacteria | 1244 |
| 624 | Ga0495651_0142745 | 3300046462 | Bacteria | 1734 |
| 625 | Ga0495653_0227596 | 3300046463 | Bacteria | 1250 |
| 626 | Ga0495582_0135980 | 3300046473 | Bacteria | 1391 |
| 627 | Ga0495582_0154983 | 3300046473 | Bacteria | 1301 |
| 628 | Ga0495662_0062556 | 3300046476 | Bacteria | 1798 |
| 629 | Ga0495583_0016279 | 3300046506 | Bacteria | 4007 |
| 630 | Ga0495608_0008848 | 3300046511 | Bacteria | 7045 |
| 631 | Ga0495608_0296135 | 3300046511 | Bacteria | 1002 |
| 632 | Ga0495630_0027145 | 3300046517 | Bacteria | 4245 |
| 633 | Ga0495648_0013467 | 3300046524 | Bacteria | 6044 |
| 634 | Ga0495654_0045262 | 3300046530 | Bacteria | 2172 |
| 635 | Ga0495587_0022409 | 3300046536 | Bacteria | 3890 |
| 636 | Ga0495667_0066207 | 3300046559 | Bacteria | 2362 |
| 637 | Ga0495634_0023847 | 3300046642 | Bacteria | 4298 |
| 638 | Ga0495634_0236175 | 3300046642 | Unclassified | 1123 |
| 639 | Ga0495657_0020356 | 3300046675 | Bacteria | 4770 |
| 640 | Ga0495599_0174777 | 3300046678 | Bacteria | 1325 |
| 641 | Ga0495647_0037974 | 3300046681 | Bacteria | 1820 |
| 642 | Ga0495647_0057534 | 3300046681 | Bacteria | 1527 |
| 643 | Ga0495647_0154614 | 3300046681 | Unclassified | 985 |
| 644 | Ga0495658_0003996 | 3300046683 | Bacteria | 7266 |
| 645 | Ga0495658_0039219 | 3300046683 | Bacteria | 2627 |
| 646 | Ga0495613_0007630 | 3300046689 | Bacteria | 8046 |
| 647 | Ga0495613_0161006 | 3300046689 | Bacteria | 1597 |
| 648 | Ga0495624_0112641 | 3300046690 | Bacteria | 1673 |
| 649 | Ga0495649_0231830 | 3300046694 | Bacteria | 953 |
| 650 | Ga0495604_0269251 | 3300047317 | Bacteria | 1155 |
| 651 | Ga0495674_0299903 | 3300047319 | Bacteria | 1313 |
| 652 | Ga0495674_0414921 | 3300047319 | Bacteria | 1085 |
| 653 | Ga0495672_0002606 | 3300047320 | Bacteria | 16350 |
| 654 | Ga0495672_0011184 | 3300047320 | Bacteria | 6343 |
| 655 | Ga0495672_0230903 | 3300047320 | Bacteria | 908 |
| 656 | Ga0495676_0453829 | 3300047321 | Bacteria | 845 |
| 657 | Ga0495680_0076453 | 3300047322 | Bacteria | 2538 |
| 658 | Ga0495680_0180509 | 3300047322 | Bacteria | 1524 |
| 659 | Ga0495673_0003826 | 3300047469 | Bacteria | 9720 |
| 660 | Ga0495684_0213628 | 3300047471 | Bacteria | 1417 |
| 661 | Ga0495686_0001711 | 3300047472 | Bacteria | 22657 |
| 662 | Ga0495593_0082906 | 3300047673 | Bacteria | 1657 |
| 663 | Ga0495626_0069970 | 3300048091 | Bacteria | 1580 |
| 664 | Ga0495626_0072913 | 3300048091 | Bacteria | 1539 |
| 665 | Ga0496100_0001291 | 3300048903 | Bacteria | 12229 |
| 666 | Ga0496100_0002422 | 3300048903 | Bacteria | 9454 |
| 667 | Ga0496100_0003502 | 3300048903 | Bacteria | 8196 |
| 668 | Ga0496100_0006840 | 3300048903 | Bacteria | 6249 |
| 669 | Ga0496100_0065969 | 3300048903 | Bacteria | 2400 |
| 670 | Ga0496100_0067913 | 3300048903 | Bacteria | 2369 |
| 671 | Ga0496100_0123595 | 3300048903 | Bacteria | 1814 |
| 672 | Ga0496101_0000020 | 3300048904 | Bacteria | 218859 |
| 673 | Ga0496101_0000047 | 3300048904 | Bacteria | 152715 |
| 674 | Ga0496101_0001621 | 3300048904 | Bacteria | 13519 |
| 675 | Ga0496101_0003730 | 3300048904 | Bacteria | 9504 |
| 676 | Ga0496101_0025795 | 3300048904 | Bacteria | 4080 |
| 677 | Ga0496101_0100058 | 3300048904 | Bacteria | 2168 |
| 678 | Ga0496101_0239562 | 3300048904 | Bacteria | 1412 |
| 679 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 680 | Ga0496102_0000050 | 3300048905 | Bacteria | 179469 |
| 681 | Ga0496102_0000157 | 3300048905 | Bacteria | 92353 |
| 682 | Ga0496102_0004407 | 3300048905 | Bacteria | 11898 |
| 683 | Ga0496102_0041387 | 3300048905 | Bacteria | 4172 |
| 684 | Ga0496102_0050426 | 3300048905 | Bacteria | 3789 |
| 685 | Ga0496102_0131035 | 3300048905 | Bacteria | 2347 |
| 686 | Ga0496102_0523255 | 3300048905 | Bacteria | 1108 |
| 687 | Ga0496103_0000012 | 3300048906 | Bacteria | 301778 |
| 688 | Ga0496103_0000106 | 3300048906 | Bacteria | 92315 |
| 689 | Ga0496103_0000831 | 3300048906 | Bacteria | 22700 |
| 690 | Ga0496103_0001090 | 3300048906 | Bacteria | 18900 |
| 691 | Ga0496103_0002661 | 3300048906 | Bacteria | 11186 |
| 692 | Ga0496103_0150176 | 3300048906 | Bacteria | 1492 |
| 693 | Ga0496104_0040374 | 3300048907 | Bacteria | 4373 |
| 694 | Ga0496104_0117772 | 3300048907 | Bacteria | 2549 |
| 695 | Ga0496104_0419929 | 3300048907 | Bacteria | 1249 |
| 696 | Ga0496104_0572024 | 3300048907 | Bacteria | 1040 |
| 697 | Ga0496105_0019525 | 3300048908 | Bacteria | 5468 |
| 698 | Ga0496105_0046558 | 3300048908 | Bacteria | 3580 |
| 699 | Ga0496105_0499753 | 3300048908 | Bacteria | 955 |
| 700 | Ga0496106_0001356 | 3300048909 | Bacteria | 18326 |
| 701 | Ga0496106_0006678 | 3300048909 | Bacteria | 8542 |
| 702 | Ga0496106_0012798 | 3300048909 | Bacteria | 6194 |
| 703 | Ga0496106_0022520 | 3300048909 | Bacteria | 4682 |
| 704 | Ga0496106_0509002 | 3300048909 | Bacteria | 967 |
| 705 | Ga0496107_0004101 | 3300048910 | Bacteria | 9812 |
| 706 | Ga0496107_0017352 | 3300048910 | Bacteria | 5062 |
| 707 | Ga0496107_0065029 | 3300048910 | Bacteria | 2644 |
| 708 | Ga0496107_0086106 | 3300048910 | Bacteria | 2293 |
| 709 | Ga0496107_0149666 | 3300048910 | Bacteria | 1726 |
| 710 | Ga0496107_0172107 | 3300048910 | Bacteria | 1607 |
| 711 | Ga0496107_0323756 | 3300048910 | Bacteria | 1147 |
| 712 | Ga0496108_0001423 | 3300048911 | Bacteria | 18868 |
| 713 | Ga0496108_0013592 | 3300048911 | Bacteria | 6644 |
| 714 | Ga0496108_0033164 | 3300048911 | Bacteria | 4290 |
| 715 | Ga0496108_0054383 | 3300048911 | Bacteria | 3359 |
| 716 | Ga0496108_0279149 | 3300048911 | Bacteria | 1454 |
| 717 | Ga0496108_0457907 | 3300048911 | Bacteria | 1114 |
| 718 | Ga0496108_0849063 | 3300048911 | Bacteria | 786 |
| 719 | Ga0496109_0000104 | 3300048912 | Bacteria | 87994 |
| 720 | Ga0496109_0015166 | 3300048912 | Bacteria | 6708 |
| 721 | Ga0496109_0109989 | 3300048912 | Bacteria | 2562 |
| 722 | Ga0496109_0134769 | 3300048912 | Bacteria | 2307 |
| 723 | Ga0496109_0153597 | 3300048912 | Bacteria | 2156 |
| 724 | Ga0496109_0505214 | 3300048912 | Bacteria | 1141 |
| 725 | Ga0496109_0908953 | 3300048912 | Bacteria | 818 |
| 726 | Ga0496110_0016323 | 3300048913 | Bacteria | 6199 |
| 727 | Ga0496110_0029430 | 3300048913 | Bacteria | 4726 |
| 728 | Ga0496110_0075396 | 3300048913 | Bacteria | 2997 |
| 729 | Ga0496110_0248476 | 3300048913 | Bacteria | 1619 |
| 730 | Ga0496110_0491377 | 3300048913 | Bacteria | 1118 |
| 731 | Ga0496110_0845403 | 3300048913 | Bacteria | 820 |
| 732 | Ga0496110_0919481 | 3300048913 | Bacteria | 781 |
| 733 | Ga0496111_0023404 | 3300048914 | Bacteria | 4336 |
| 734 | Ga0496111_0243824 | 3300048914 | Bacteria | 1334 |
| 735 | Ga0496112_0045499 | 3300048915 | Bacteria | 4302 |
| 736 | Ga0496112_0172160 | 3300048915 | Bacteria | 2130 |
| 737 | Ga0496112_0331140 | 3300048915 | Bacteria | 1466 |
| 738 | Ga0496112_0385441 | 3300048915 | Bacteria | 1342 |
| 739 | Ga0496113_0003726 | 3300048916 | Bacteria | 9191 |
| 740 | Ga0496113_0174560 | 3300048916 | Bacteria | 1703 |
| 741 | Ga0496113_0260399 | 3300048916 | Bacteria | 1386 |
| 742 | Ga0496113_0464450 | 3300048916 | Bacteria | 1017 |
| 743 | Ga0496113_0521654 | 3300048916 | Bacteria | 954 |
| 744 | Ga0496114_0000793 | 3300048917 | Bacteria | 23635 |
| 745 | Ga0496114_0006229 | 3300048917 | Bacteria | 9391 |
| 746 | Ga0496114_0125026 | 3300048917 | Bacteria | 2216 |
| 747 | Ga0496114_0259054 | 3300048917 | Bacteria | 1531 |
| 748 | Ga0496114_0410902 | 3300048917 | Bacteria | 1199 |
| 749 | Ga0496115_0013217 | 3300048918 | Bacteria | 6237 |
| 750 | Ga0496115_0340559 | 3300048918 | Bacteria | 1224 |
| 751 | Ga0496116_0000040 | 3300048919 | Bacteria | 346900 |
| 752 | Ga0496116_0000724 | 3300048919 | Bacteria | 42184 |
| 753 | Ga0496116_0002883 | 3300048919 | Bacteria | 17604 |
| 754 | Ga0496116_0065784 | 3300048919 | Bacteria | 2323 |
| 755 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 756 | Ga0496117_0000364 | 3300048920 | Bacteria | 78857 |
| 757 | Ga0496117_0000459 | 3300048920 | Bacteria | 68055 |
| 758 | Ga0496117_0063979 | 3300048920 | Bacteria | 2511 |
| 759 | Ga0496117_0202713 | 3300048920 | Bacteria | 1119 |
| 760 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 761 | Ga0496118_0000069 | 3300048921 | Bacteria | 203439 |
| 762 | Ga0496118_0000452 | 3300048921 | Bacteria | 67982 |
| 763 | Ga0496118_0003972 | 3300048921 | Bacteria | 18042 |
| 764 | Ga0496118_0005190 | 3300048921 | Bacteria | 14907 |
| 765 | Ga0496119_0000142 | 3300048922 | Bacteria | 100419 |
| 766 | Ga0496119_0000357 | 3300048922 | Bacteria | 64157 |
| 767 | Ga0496119_0000777 | 3300048922 | Bacteria | 42677 |
| 768 | Ga0496119_0004835 | 3300048922 | Bacteria | 13197 |
| 769 | Ga0496119_0013089 | 3300048922 | Bacteria | 6651 |
| 770 | Ga0496119_0013866 | 3300048922 | Bacteria | 6364 |
| 771 | Ga0496119_0022264 | 3300048922 | Bacteria | 4546 |
| 772 | Ga0496119_0157093 | 3300048922 | Bacteria | 1213 |
| 773 | Ga0496120_0000149 | 3300048923 | Bacteria | 116137 |
| 774 | Ga0496120_0000230 | 3300048923 | Bacteria | 96223 |
| 775 | Ga0496120_0027186 | 3300048923 | Bacteria | 3524 |
| 776 | Ga0496120_0031048 | 3300048923 | Bacteria | 3241 |
| 777 | Ga0496120_0051991 | 3300048923 | Bacteria | 2336 |
| 778 | Ga0496120_0092260 | 3300048923 | Bacteria | 1616 |
| 779 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 780 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 781 | Ga0496121_0006622 | 3300048924 | Bacteria | 14271 |
| 782 | Ga0496121_0038561 | 3300048924 | Bacteria | 4227 |
| 783 | Ga0496122_0000078 | 3300048925 | Bacteria | 214068 |
| 784 | Ga0496122_0009230 | 3300048925 | Bacteria | 10437 |
| 785 | Ga0496123_0009351 | 3300048926 | Bacteria | 8840 |
| 786 | Ga0496123_0021371 | 3300048926 | Bacteria | 5032 |
| 787 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 788 | Ga0496124_0048825 | 3300048927 | Bacteria | 3613 |
| 789 | Ga0496124_0303981 | 3300048927 | Bacteria | 1150 |
| 790 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 791 | Ga0496125_0322150 | 3300048928 | Bacteria | 936 |
| 792 | Ga0496126_0000009 | 3300048929 | Bacteria | 750350 |
| 793 | Ga0496126_0000372 | 3300048929 | Bacteria | 92561 |
| 794 | Ga0496126_0000785 | 3300048929 | Bacteria | 57203 |
| 795 | Ga0496126_0007337 | 3300048929 | Bacteria | 12109 |
| 796 | Ga0496126_0022746 | 3300048929 | Bacteria | 6089 |
| 797 | Ga0496126_0033616 | 3300048929 | Bacteria | 4823 |
| 798 | Ga0501031_0021390 | 3300049568 | Bacteria | 4217 |
| 799 | Ga0501031_0086164 | 3300049568 | Bacteria | 2048 |
| 800 | Ga0501031_0230615 | 3300049568 | Bacteria | 1205 |
| 801 | Ga0501032_0009961 | 3300049569 | Bacteria | 6862 |
| 802 | Ga0501032_0010428 | 3300049569 | Bacteria | 6701 |
| 803 | Ga0501032_0084855 | 3300049569 | Bacteria | 2105 |
| 804 | Ga0501033_0003270 | 3300049570 | Bacteria | 13411 |
| 805 | Ga0501033_0023185 | 3300049570 | Bacteria | 4681 |
| 806 | Ga0501033_0150043 | 3300049570 | Bacteria | 1682 |
| 807 | Ga0501033_0369983 | 3300049570 | Bacteria | 1002 |
| 808 | Ga0501034_0003015 | 3300049571 | Bacteria | 19477 |
| 809 | Ga0501034_0004248 | 3300049571 | Bacteria | 15979 |
| 810 | Ga0501034_0008438 | 3300049571 | Bacteria | 10883 |
| 811 | Ga0501034_0012702 | 3300049571 | Bacteria | 8689 |
| 812 | Ga0501034_0047165 | 3300049571 | Bacteria | 4352 |
| 813 | Ga0501034_0065836 | 3300049571 | Bacteria | 3637 |
| 814 | Ga0501034_0112825 | 3300049571 | Bacteria | 2708 |
| 815 | Ga0501034_0122475 | 3300049571 | Bacteria | 2587 |
| 816 | Ga0501034_0245073 | 3300049571 | Bacteria | 1737 |
| 817 | Ga0501034_0319159 | 3300049571 | Bacteria | 1487 |
| 818 | Ga0501034_0499811 | 3300049571 | Bacteria | 1130 |
| 819 | Ga0501036_0014271 | 3300049572 | Bacteria | 6609 |
| 820 | Ga0501036_0034841 | 3300049572 | Bacteria | 4259 |
| 821 | Ga0501036_0051502 | 3300049572 | Bacteria | 3486 |
| 822 | Ga0501036_0084828 | 3300049572 | Bacteria | 2678 |
| 823 | Ga0501036_0087476 | 3300049572 | Bacteria | 2634 |
| 824 | Ga0501036_0157668 | 3300049572 | Bacteria | 1914 |
| 825 | Ga0501036_0264303 | 3300049572 | Bacteria | 1441 |
| 826 | Ga0501036_0657786 | 3300049572 | Bacteria | 867 |
| 827 | Ga0501037_0003227 | 3300049573 | Bacteria | 11815 |
| 828 | Ga0501037_0015365 | 3300049573 | Bacteria | 5633 |
| 829 | Ga0501037_0022637 | 3300049573 | Bacteria | 4647 |
| 830 | Ga0501037_0026732 | 3300049573 | Bacteria | 4264 |
| 831 | Ga0501037_0047676 | 3300049573 | Bacteria | 3139 |
| 832 | Ga0501037_0200147 | 3300049573 | Bacteria | 1412 |
| 833 | Ga0501037_0348440 | 3300049573 | Bacteria | 1022 |
| 834 | Ga0501038_0001047 | 3300049574 | Bacteria | 24924 |
| 835 | Ga0501038_0004575 | 3300049574 | Bacteria | 12874 |
| 836 | Ga0501038_0025858 | 3300049574 | Bacteria | 5229 |
| 837 | Ga0501038_0100483 | 3300049574 | Bacteria | 2410 |
| 838 | Ga0501038_0184883 | 3300049574 | Bacteria | 1680 |
| 839 | Ga0501039_0002201 | 3300049575 | Bacteria | 14424 |
| 840 | Ga0501039_0013791 | 3300049575 | Bacteria | 6183 |
| 841 | Ga0501039_0018503 | 3300049575 | Bacteria | 5348 |
| 842 | Ga0501039_0022559 | 3300049575 | Bacteria | 4832 |
| 843 | Ga0501039_0104330 | 3300049575 | Bacteria | 2213 |
| 844 | Ga0501040_0001028 | 3300049576 | Bacteria | 17701 |
| 845 | Ga0501040_0010664 | 3300049576 | Bacteria | 6011 |
| 846 | Ga0501040_0044056 | 3300049576 | Bacteria | 3042 |
| 847 | Ga0501040_0235571 | 3300049576 | Bacteria | 1304 |
| 848 | Ga0501040_0275533 | 3300049576 | Bacteria | 1201 |
| 849 | Ga0501041_0014439 | 3300049577 | Bacteria | 4689 |
| 850 | Ga0501041_0053843 | 3300049577 | Bacteria | 2454 |
| 851 | Ga0501041_0064393 | 3300049577 | Bacteria | 2245 |
| 852 | Ga0501042_0001091 | 3300049578 | Bacteria | 15579 |
| 853 | Ga0501042_0008175 | 3300049578 | Bacteria | 6892 |
| 854 | Ga0501042_0059318 | 3300049578 | Bacteria | 2732 |
| 855 | Ga0501042_0360269 | 3300049578 | Bacteria | 1052 |
| 856 | Ga0501042_0408711 | 3300049578 | Bacteria | 984 |
| 857 | Ga0501043_0001283 | 3300049579 | Bacteria | 22062 |
| 858 | Ga0501043_0085797 | 3300049579 | Bacteria | 2474 |
| 859 | Ga0501043_0305473 | 3300049579 | Bacteria | 1215 |
| 860 | Ga0501046_0011417 | 3300049580 | Bacteria | 7594 |
| 861 | Ga0501046_0013929 | 3300049580 | Bacteria | 6791 |
| 862 | Ga0501046_0037849 | 3300049580 | Bacteria | 3875 |
| 863 | Ga0501046_0120515 | 3300049580 | Bacteria | 1996 |
| 864 | Ga0501046_0203052 | 3300049580 | Bacteria | 1474 |
| 865 | Ga0501047_0003181 | 3300049581 | Bacteria | 15564 |
| 866 | Ga0501047_0018956 | 3300049581 | Bacteria | 6599 |
| 867 | Ga0501047_0026162 | 3300049581 | Bacteria | 5613 |
| 868 | Ga0501048_0007016 | 3300049582 | Bacteria | 8559 |
| 869 | Ga0501048_0016487 | 3300049582 | Bacteria | 5447 |
| 870 | Ga0501048_0052459 | 3300049582 | Bacteria | 2902 |
| 871 | Ga0501048_0091267 | 3300049582 | Bacteria | 2149 |
| 872 | Ga0501048_0119456 | 3300049582 | Bacteria | 1862 |
| 873 | Ga0501067_0035400 | 3300049583 | Bacteria | 2773 |
| 874 | Ga0501068_0000013 | 3300049584 | Bacteria | 62800 |
| 875 | Ga0501068_0005418 | 3300049584 | Bacteria | 6982 |
| 876 | Ga0501068_0047961 | 3300049584 | Bacteria | 2578 |
| 877 | Ga0501068_0113270 | 3300049584 | Bacteria | 1688 |
| 878 | Ga0501068_0259259 | 3300049584 | Bacteria | 1109 |
| 879 | Ga0501068_0422822 | 3300049584 | Bacteria | 860 |
| 880 | Ga0501069_0004972 | 3300049585 | Bacteria | 6896 |
| 881 | Ga0501069_0013269 | 3300049585 | Bacteria | 4390 |
| 882 | Ga0501070_0003730 | 3300049586 | Bacteria | 13150 |
| 883 | Ga0501070_0006326 | 3300049586 | Bacteria | 10077 |
| 884 | Ga0501070_0011228 | 3300049586 | Bacteria | 7563 |
| 885 | Ga0501070_0032913 | 3300049586 | Bacteria | 4336 |
| 886 | Ga0501070_0041793 | 3300049586 | Bacteria | 3818 |
| 887 | Ga0501070_0099905 | 3300049586 | Bacteria | 2401 |
| 888 | Ga0501070_0109387 | 3300049586 | Bacteria | 2284 |
| 889 | Ga0501070_0114448 | 3300049586 | Bacteria | 2228 |
| 890 | Ga0501070_0703086 | 3300049586 | Bacteria | 799 |
| 891 | Ga0501071_0002096 | 3300049587 | Bacteria | 11965 |
| 892 | Ga0501071_0021003 | 3300049587 | Bacteria | 4544 |
| 893 | Ga0501071_0040463 | 3300049587 | Bacteria | 3335 |
| 894 | Ga0501071_0082547 | 3300049587 | Bacteria | 2353 |
| 895 | Ga0501071_0365927 | 3300049587 | Bacteria | 1098 |
| 896 | Ga0501072_0003265 | 3300049588 | Bacteria | 12189 |
| 897 | Ga0501072_0008699 | 3300049588 | Bacteria | 7707 |
| 898 | Ga0501072_0009253 | 3300049588 | Bacteria | 7488 |
| 899 | Ga0501072_0124912 | 3300049588 | Bacteria | 2050 |
| 900 | Ga0501072_0159627 | 3300049588 | Bacteria | 1798 |
| 901 | Ga0501072_0202909 | 3300049588 | Bacteria | 1581 |
| 902 | Ga0501072_0276087 | 3300049588 | Bacteria | 1337 |
| 903 | Ga0501073_0001051 | 3300049589 | Bacteria | 19911 |
| 904 | Ga0501073_0001202 | 3300049589 | Bacteria | 18874 |
| 905 | Ga0501073_0107172 | 3300049589 | Bacteria | 1939 |
| 906 | Ga0501073_0174778 | 3300049589 | Bacteria | 1486 |
| 907 | Ga0501073_0392660 | 3300049589 | Bacteria | 959 |
| 908 | Ga0501074_0006859 | 3300049590 | Bacteria | 8224 |
| 909 | Ga0501074_0034972 | 3300049590 | Bacteria | 3641 |
| 910 | Ga0501074_0039729 | 3300049590 | Bacteria | 3408 |
| 911 | Ga0501075_0004110 | 3300049591 | Bacteria | 9830 |
| 912 | Ga0501075_0012579 | 3300049591 | Bacteria | 6019 |
| 913 | Ga0501075_0015241 | 3300049591 | Bacteria | 5513 |
| 914 | Ga0501075_0064908 | 3300049591 | Bacteria | 2754 |
| 915 | Ga0501076_0021127 | 3300049592 | Bacteria | 4988 |
| 916 | Ga0501077_0000891 | 3300049593 | Bacteria | 17957 |
| 917 | Ga0501077_0021822 | 3300049593 | Bacteria | 4054 |
| 918 | Ga0501079_0002112 | 3300049741 | Bacteria | 14285 |
| 919 | Ga0501079_0006243 | 3300049741 | Bacteria | 8946 |
| 920 | Ga0501079_0032459 | 3300049741 | Bacteria | 4014 |
| 921 | Ga0501079_0033822 | 3300049741 | Bacteria | 3933 |
| 922 | Ga0501079_0365003 | 3300049741 | Bacteria | 1132 |
| 923 | Ga0501080_0003683 | 3300049742 | Bacteria | 13518 |
| 924 | Ga0501080_0011291 | 3300049742 | Bacteria | 8175 |
| 925 | Ga0501080_0027388 | 3300049742 | Bacteria | 5299 |
| 926 | Ga0501080_0333814 | 3300049742 | Bacteria | 1371 |
| 927 | Ga0501081_0003048 | 3300049743 | Bacteria | 10638 |
| 928 | Ga0501081_0191167 | 3300049743 | Bacteria | 1482 |
| 929 | Ga0501081_0211415 | 3300049743 | Bacteria | 1409 |
| 930 | Ga0501083_0004203 | 3300049744 | Bacteria | 10138 |
| 931 | Ga0501083_0014677 | 3300049744 | Bacteria | 5477 |
| 932 | Ga0501083_0019555 | 3300049744 | Bacteria | 4717 |
| 933 | Ga0501083_0100365 | 3300049744 | Bacteria | 1909 |
| 934 | Ga0501035_0001201 | 3300049822 | Bacteria | 26999 |
| 935 | Ga0501035_0004777 | 3300049822 | Bacteria | 12865 |
| 936 | Ga0501035_0042300 | 3300049822 | Bacteria | 4110 |
| 937 | Ga0501035_0215134 | 3300049822 | Bacteria | 1643 |
| 938 | Ga0501044_0002283 | 3300049823 | Bacteria | 21835 |
| 939 | Ga0501044_0005129 | 3300049823 | Bacteria | 14608 |
| 940 | Ga0501044_0014776 | 3300049823 | Bacteria | 8417 |
| 941 | Ga0501044_0022781 | 3300049823 | Bacteria | 6671 |
| 942 | Ga0501044_0602994 | 3300049823 | Bacteria | 991 |
| 943 | Ga0501045_0001848 | 3300049824 | Bacteria | 14314 |
| 944 | Ga0501045_0010139 | 3300049824 | Bacteria | 6593 |
| 945 | Ga0501045_0025670 | 3300049824 | Bacteria | 4237 |
| 946 | Ga0501045_0049608 | 3300049824 | Bacteria | 3061 |
| 947 | Ga0501045_0444886 | 3300049824 | Bacteria | 963 |
| 948 | Ga0501045_0599149 | 3300049824 | Bacteria | 816 |
| 949 | nmdc:mga03683_207115_c1 | 3300050489 | Bacteria | 901 |
| 950 | nmdc:mga03683_86628_c1 | 3300050489 | Bacteria | 1360 |
| 951 | nmdc:mga03n38_118809_c1 | 3300050490 | Bacteria | 1297 |
| 952 | nmdc:mga03n38_150622_c1 | 3300050490 | Bacteria | 1170 |
| 953 | nmdc:mga03n38_19183_c1 | 3300050490 | Bacteria | 2713 |
| 954 | nmdc:mga03n38_210370_c1 | 3300050490 | Bacteria | 1011 |
| 955 | nmdc:mga03n38_325_c1 | 3300050490 | Bacteria | 11543 |
| 956 | nmdc:mga03n38_36014_c1 | 3300050490 | Bacteria | 2125 |
| 957 | nmdc:mga03n38_42755_c1 | 3300050490 | Bacteria | 1982 |
| 958 | nmdc:mga03n38_72887_c1 | 3300050490 | Bacteria | 1593 |
| 959 | nmdc:mga03n38_7960_c1 | 3300050490 | Bacteria | 3776 |
| 960 | nmdc:mga03n38_83167_c1 | 3300050490 | Bacteria | 1509 |
| 961 | nmdc:mga00v17_139468_c1 | 3300050491 | Bacteria | 1554 |
| 962 | nmdc:mga00v17_158309_c1 | 3300050491 | Bacteria | 1457 |
| 963 | nmdc:mga00v17_165945_c1 | 3300050491 | Bacteria | 1423 |
| 964 | nmdc:mga00v17_177789_c1 | 3300050491 | Bacteria | 1373 |
| 965 | nmdc:mga00v17_248675_c1 | 3300050491 | Bacteria | 1153 |
| 966 | nmdc:mga00v17_2691_c1 | 3300050491 | Bacteria | 9117 |
| 967 | nmdc:mga00v17_335633_c1 | 3300050491 | Bacteria | 982 |
| 968 | nmdc:mga00v17_34630_c1 | 3300050491 | Bacteria | 3001 |
| 969 | nmdc:mga00v17_352591_c1 | 3300050491 | Bacteria | 957 |
| 970 | nmdc:mga00v17_3888_c1 | 3300050491 | Bacteria | 7698 |
| 971 | nmdc:mga00v17_422191_c1 | 3300050491 | Bacteria | 866 |
| 972 | nmdc:mga00v17_55294_c1 | 3300050491 | Bacteria | 2424 |
| 973 | nmdc:mga00v17_65643_c1 | 3300050491 | Bacteria | 2240 |
| 974 | nmdc:mga00v17_74838_c1 | 3300050491 | Bacteria | 2105 |
| 975 | nmdc:mga00v17_8065_c1 | 3300050491 | Bacteria | 5654 |
| 976 | nmdc:mga00v17_88356_c1 | 3300050491 | Bacteria | 1943 |
| 977 | nmdc:mga0yw44_107028_c2 | 3300050492 | Bacteria | 954 |
| 978 | nmdc:mga0yw44_138246_c1 | 3300050492 | Bacteria | 1582 |
| 979 | nmdc:mga0yw44_1794_c1 | 3300050492 | Bacteria | 8760 |
| 980 | nmdc:mga0yw44_24071_c1 | 3300050492 | Bacteria | 3440 |
| 981 | nmdc:mga0yw44_24549_c1 | 3300050492 | Bacteria | 3413 |
| 982 | nmdc:mga0yw44_32973_c1 | 3300050492 | Bacteria | 3022 |
| 983 | nmdc:mga0yw44_385743_c1 | 3300050492 | Bacteria | 946 |
| 984 | nmdc:mga0yw44_418992_c1 | 3300050492 | Bacteria | 906 |
| 985 | nmdc:mga06z11_163148_c1 | 3300050494 | Bacteria | 1275 |
| 986 | nmdc:mga06z11_193207_c1 | 3300050494 | Bacteria | 1179 |
| 987 | nmdc:mga06z11_341926_c1 | 3300050494 | Bacteria | 895 |
| 988 | nmdc:mga06z11_500455_c1 | 3300050494 | Bacteria | 736 |
| 989 | nmdc:mga04h51_96980_c1 | 3300050495 | Bacteria | 1069 |
| 990 | nmdc:mga07m45_189458_c1 | 3300050496 | Bacteria | 1196 |
| 991 | nmdc:mga07m45_218123_c1 | 3300050496 | Bacteria | 1110 |
| 992 | nmdc:mga07m45_238021_c1 | 3300050496 | Bacteria | 1059 |
| 993 | nmdc:mga07m45_52756_c1 | 3300050496 | Bacteria | 2296 |
| 994 | nmdc:mga07m45_9664_c1 | 3300050496 | Bacteria | 5012 |
| 995 | nmdc:mga05p37_10145_c1 | 3300050507 | Bacteria | 11180 |
| 996 | nmdc:mga05p37_14137_c1 | 3300050507 | Bacteria | 9579 |
| 997 | nmdc:mga05p37_624731_c1 | 3300050507 | Bacteria | 1212 |
| 998 | nmdc:mga05p37_99626_c1 | 3300050507 | Bacteria | 3579 |
| 999 | nmdc:mga09592_151398_c1 | 3300050508 | Bacteria | 2001 |
| 1000 | nmdc:mga09592_178633_c1 | 3300050508 | Bacteria | 1836 |
| 1001 | nmdc:mga09592_57199_c1 | 3300050508 | Bacteria | 3296 |
| 1002 | nmdc:mga0qj67_10130_c1 | 3300050509 | Bacteria | 7035 |
| 1003 | nmdc:mga0qj67_250671_c1 | 3300050509 | Bacteria | 1437 |
| 1004 | nmdc:mga0qj67_298076_c1 | 3300050509 | Bacteria | 1306 |
| 1005 | nmdc:mga0qj67_33851_c1 | 3300050509 | Bacteria | 3988 |
| 1006 | nmdc:mga0qj67_59404_c1 | 3300050509 | Bacteria | 3032 |
| 1007 | nmdc:mga0qj67_82039_c1 | 3300050509 | Bacteria | 2586 |
| 1008 | nmdc:mga06r32_24409_c1 | 3300050510 | Bacteria | 5612 |
| 1009 | nmdc:mga06r32_452881_c1 | 3300050510 | Bacteria | 1263 |
| 1010 | nmdc:mga06r32_489869_c1 | 3300050510 | Bacteria | 1207 |
| 1011 | nmdc:mga06r32_5459_c1 | 3300050510 | Bacteria | 11449 |
| 1012 | nmdc:mga06r32_74568_c1 | 3300050510 | Bacteria | 3290 |
| 1013 | nmdc:mga06r32_869417_c1 | 3300050510 | Bacteria | 859 |
| 1014 | nmdc:mga06r32_99237_c1 | 3300050510 | Bacteria | 2856 |
| 1015 | nmdc:mga08y16_134535_c1 | 3300050511 | Bacteria | 2569 |
| 1016 | nmdc:mga08y16_149844_c1 | 3300050511 | Bacteria | 2425 |
| 1017 | nmdc:mga08y16_284935_c1 | 3300050511 | Bacteria | 1704 |
| 1018 | nmdc:mga08y16_284953_c1 | 3300050511 | Bacteria | 1704 |
| 1019 | nmdc:mga08y16_51066_c1 | 3300050511 | Bacteria | 4326 |
| 1020 | nmdc:mga08y16_672453_c1 | 3300050511 | Bacteria | 1037 |
| 1021 | nmdc:mga0n895_368504_c1 | 3300050512 | Bacteria | 1454 |
| 1022 | nmdc:mga0sz30_16094_c2 | 3300050516 | Bacteria | 2103 |
| 1023 | nmdc:mga0sz30_2056_c1 | 3300050516 | Bacteria | 7194 |
| 1024 | nmdc:mga0sz30_20615_c2 | 3300050516 | Bacteria | 2235 |
| 1025 | nmdc:mga0sz30_28900_c1 | 3300050516 | Bacteria | 2283 |
| 1026 | nmdc:mga0sz30_776_c1 | 3300050516 | Bacteria | 11640 |
| 1027 | Ga0495612_0129504 | 3300053078 | Bacteria | 1090 |
| 1028 | Ga0495612_0198064 | 3300053078 | Bacteria | 886 |
| 1029 | Ga0500635_0003906 | 3300053080 | Bacteria | 3793 |
| 1030 | Ga0495595_0001572 | 3300053084 | Bacteria | 8919 |
| 1031 | Ga0495595_0024247 | 3300053084 | Bacteria | 2679 |
| 1032 | Ga0495619_0007407 | 3300053085 | Bacteria | 6956 |
| 1033 | Ga0495619_0030618 | 3300053085 | Bacteria | 3483 |
| 1034 | Ga0500642_0154738 | 3300053130 | Bacteria | 1076 |
| 1035 | Ga0500652_000964 | 3300053131 | Bacteria | 9516 |
| 1036 | Ga0500568_0000189 | 3300053139 | Bacteria | 53789 |
| 1037 | Ga0500616_0029359 | 3300053153 | Bacteria | 3026 |
| 1038 | Ga0500616_0037029 | 3300053153 | Bacteria | 2643 |
| 1039 | Ga0500616_0059240 | 3300053153 | Bacteria | 1989 |
| 1040 | Ga0501084_0000230 | 3300054114 | Bacteria | 42013 |
| 1041 | Ga0501084_0001967 | 3300054114 | Bacteria | 16416 |
| 1042 | Ga0501084_0009101 | 3300054114 | Bacteria | 8217 |
| 1043 | Ga0501084_0018562 | 3300054114 | Bacteria | 5789 |
| 1044 | Ga0501084_0072851 | 3300054114 | Bacteria | 2877 |
| 1045 | Ga0501084_0124642 | 3300054114 | Bacteria | 2167 |
| 1046 | Ga0501084_0540733 | 3300054114 | Bacteria | 984 |
| 1047 | Ga0501082_0008758 | 3300060353 | Bacteria | 8722 |
| 1048 | Ga0501082_0035405 | 3300060353 | Bacteria | 4303 |
| 1049 | Ga0501082_0224402 | 3300060353 | Bacteria | 1635 |
| 1050 | Ga0501082_0450888 | 3300060353 | Bacteria | 1124 |
| 1051 | Ga0466962_0007543 | 3300061719 | Bacteria | 5220 |
| 1052 | Ga0466962_0055138 | 3300061719 | Bacteria | 1899 |
| 1053 | Ga0466962_0134781 | 3300061719 | Bacteria | 1195 |
| 1054 | Ga0530510_0001967 | 3300061734 | Bacteria | 14070 |
| 1055 | Ga0530510_0026019 | 3300061734 | Bacteria | 4185 |
| 1056 | Ga0530510_0048339 | 3300061734 | Bacteria | 3075 |
| 1057 | Ga0530510_0068608 | 3300061734 | Bacteria | 2572 |
| 1058 | Ga0530510_0228622 | 3300061734 | Bacteria | 1383 |
| 1059 | Ga0530510_0504623 | 3300061734 | Bacteria | 917 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_0247820 | Ga0436364_0247820_211_795 | 194 |
| 2 | 3300049570 | Ga0501033_0150043 | Ga0501033_0150043_1056_1649 | 195 |
| 3 | 3300031733 | Ga0316577_10270660 | Ga0316577_102706601 | 203 |
| 4 | 3300035398 | Ga0316574_0414827 | Ga0316574_0414827_20_631 | 203 |
| 5 | 3300005347 | Ga0070668_100665440 | Ga0070668_1006654402 | 209 |
| 6 | 3300005445 | Ga0070708_100013579 | Ga0070708_1000135793 | 211 |
| 7 | 3300006178 | Ga0075367_10043148 | Ga0075367_100431482 | 211 |
| 8 | 3300045976 | Ga0466967_0021263 | Ga0466967_0021263_4616_5251 | 211 |
| 9 | 3300046473 | Ga0495582_0154983 | Ga0495582_0154983_82_726 | 211 |
| 10 | 3300049579 | Ga0501043_0305473 | Ga0501043_0305473_533_1171 | 211 |
| 11 | 3300005367 | Ga0070667_100000420 | Ga0070667_10000042018 | 216 |
| 12 | 3300005841 | Ga0068863_100000818 | Ga0068863_10000081830 | 216 |
| 13 | 3300026088 | Ga0207641_10002348 | Ga0207641_1000234818 | 216 |
| 14 | 3300026095 | Ga0207676_11227877 | Ga0207676_112278771 | 216 |
| 15 | 3300026118 | Ga0207675_100468746 | Ga0207675_1004687461 | 216 |
| 16 | 3300044658 | Ga0466972_0045367 | Ga0466972_0045367_1457_2107 | 216 |
| 17 | 3300044658 | Ga0466972_0092925 | Ga0466972_0092925_26_676 | 216 |
| 18 | 3300045976 | Ga0466967_0650624 | Ga0466967_0650624_377_1027 | 216 |
| 19 | 3300048903 | Ga0496100_0065969 | Ga0496100_0065969_70_720 | 216 |
| 20 | 3300048927 | Ga0496124_0303981 | Ga0496124_0303981_71_721 | 216 |
| 21 | 3300049824 | Ga0501045_0599149 | Ga0501045_0599149_154_804 | 216 |
| 22 | 3300035398 | Ga0316574_0059585 | Ga0316574_0059585_354_1031 | 222 |
| 23 | 3300005333 | Ga0070677_10024226 | Ga0070677_100242263 | 223 |
| 24 | 3300005356 | Ga0070674_100067195 | Ga0070674_1000671952 | 223 |
| 25 | 3300005615 | Ga0070702_100070855 | Ga0070702_1000708552 | 223 |
| 26 | 3300005719 | Ga0068861_100207767 | Ga0068861_1002077672 | 223 |
| 27 | 3300009148 | Ga0105243_10696557 | Ga0105243_106965572 | 223 |
| 28 | 3300009177 | Ga0105248_10250908 | Ga0105248_102509082 | 223 |
| 29 | 3300009553 | Ga0105249_10610163 | Ga0105249_106101632 | 223 |
| 30 | 3300013308 | Ga0157375_11053991 | Ga0157375_110539911 | 223 |
| 31 | 3300014326 | Ga0157380_10052902 | Ga0157380_100529024 | 223 |
| 32 | 3300017792 | Ga0163161_10010290 | Ga0163161_100102903 | 223 |
| 33 | 3300025937 | Ga0207669_10057021 | Ga0207669_100570213 | 223 |
| 34 | 3300025941 | Ga0207711_10072739 | Ga0207711_100727392 | 223 |
| 35 | 3300025961 | Ga0207712_10310735 | Ga0207712_103107352 | 223 |
| 36 | 3300026089 | Ga0207648_10168992 | Ga0207648_101689922 | 223 |
| 37 | 3300031727 | Ga0316576_10026583 | Ga0316576_100265832 | 223 |
| 38 | 3300031727 | Ga0316576_10044572 | Ga0316576_100445723 | 223 |
| 39 | 3300031727 | Ga0316576_10114759 | Ga0316576_101147592 | 223 |
| 40 | 3300031728 | Ga0316578_10000199 | Ga0316578_100001993 | 223 |
| 41 | 3300031728 | Ga0316578_10005773 | Ga0316578_100057733 | 223 |
| 42 | 3300031733 | Ga0316577_10077528 | Ga0316577_100775282 | 223 |
| 43 | 3300035398 | Ga0316574_0011965 | Ga0316574_0011965_3189_3863 | 223 |
| 44 | 3300035398 | Ga0316574_0044055 | Ga0316574_0044055_538_1212 | 223 |
| 45 | 3300035398 | Ga0316574_0047718 | Ga0316574_0047718_1110_1784 | 223 |
| 46 | 3300035398 | Ga0316574_0100826 | Ga0316574_0100826_699_1373 | 223 |
| 47 | 3300036647 | Ga0316582_0221947 | Ga0316582_0221947_261_935 | 223 |
| 48 | 3300036712 | Ga0316584_0009292 | Ga0316584_0009292_1546_2220 | 223 |
| 49 | 3300006051 | Ga0075364_10109496 | Ga0075364_101094962 | 224 |
| 50 | 3300041413 | Ga0439465_0040516 | Ga0439465_0040516_406_1110 | 225 |
| 51 | 3300046681 | Ga0495647_0037974 | Ga0495647_0037974_552_1244 | 225 |
| 52 | 3300049572 | Ga0501036_0084828 | Ga0501036_0084828_200_895 | 225 |
| 53 | 3300049576 | Ga0501040_0044056 | Ga0501040_0044056_46_741 | 225 |
| 54 | 3300049587 | Ga0501071_0365927 | Ga0501071_0365927_386_1081 | 225 |
| 55 | 3300049588 | Ga0501072_0202909 | Ga0501072_0202909_631_1326 | 225 |
| 56 | 3300049824 | Ga0501045_0444886 | Ga0501045_0444886_138_833 | 225 |
| 57 | 3300060353 | Ga0501082_0450888 | Ga0501082_0450888_292_987 | 225 |
| 58 | 3300061734 | Ga0530510_0048339 | Ga0530510_0048339_1817_2512 | 225 |
| 59 | 3300031727 | Ga0316576_10014864 | Ga0316576_100148643 | 227 |
| 60 | 3300035398 | Ga0316574_0369974 | Ga0316574_0369974_177_875 | 227 |
| 61 | 3300048910 | Ga0496107_0323756 | Ga0496107_0323756_441_1124 | 227 |
| 62 | iso_pu_bacteria | 2558860112 | 2558908353 | 227 |
| 63 | 3300035398 | Ga0316574_0034545 | Ga0316574_0034545_1282_2007 | 228 |
| 64 | 3300035398 | Ga0316574_0129518 | Ga0316574_0129518_387_1088 | 228 |
| 65 | 3300005445 | Ga0070708_100352634 | Ga0070708_1003526341 | 230 |
| 66 | 3300005548 | Ga0070665_100349835 | Ga0070665_1003498352 | 231 |
| 67 | 3300025923 | Ga0207681_10773482 | Ga0207681_107734821 | 231 |
| 68 | 3300025986 | Ga0207658_10182743 | Ga0207658_101827432 | 231 |
| 69 | 3300031456 | Ga0307513_10026057 | Ga0307513_100260574 | 231 |
| 70 | 3300037471 | Ga0395905_0134481 | Ga0395905_0134481_700_1401 | 231 |
| 71 | iso_pu_bacteria | 2870782633 | 2870785241 | 231 |
| 72 | iso_pu_bacteria | 2899370129 | 2899372242 | 231 |
| 73 | iso_pu_bacteria | 2915358134 | 2915359679 | 231 |
| 74 | 3300005844 | Ga0068862_100187054 | Ga0068862_1001870542 | 232 |
| 75 | 3300049570 | Ga0501033_0369983 | Ga0501033_0369983_184_882 | 232 |
| 76 | 3300049571 | Ga0501034_0245073 | Ga0501034_0245073_682_1380 | 232 |
| 77 | 3300049573 | Ga0501037_0200147 | Ga0501037_0200147_30_728 | 232 |
| 78 | 3300049580 | Ga0501046_0203052 | Ga0501046_0203052_585_1283 | 232 |
| 79 | 3300049581 | Ga0501047_0026162 | Ga0501047_0026162_4606_5304 | 232 |
| 80 | 3300049822 | Ga0501035_0004777 | Ga0501035_0004777_6898_7596 | 232 |
| 81 | 3300049823 | Ga0501044_0014776 | Ga0501044_0014776_3108_3806 | 232 |
| 82 | 3300053130 | Ga0500642_0154738 | Ga0500642_0154738_352_1050 | 232 |
| 83 | iso_pu_bacteria | 2576861822 | 2579748889 | 232 |
| 84 | iso_pu_bacteria | 2582580736 | 2583149795 | 232 |
| 85 | iso_pu_bacteria | 2585427649 | 2586061465 | 232 |
| 86 | iso_pu_bacteria | 2671180195 | 2671838011 | 232 |
| 87 | iso_pu_bacteria | 2684623035 | 2686536452 | 232 |
| 88 | iso_pu_bacteria | 2687453743 | 2689989930 | 232 |
| 89 | iso_pu_bacteria | 2773857922 | 2774856167 | 232 |
| 90 | iso_pu_bacteria | 2808606522 | 2809589440 | 232 |
| 91 | iso_pu_bacteria | 2866612099 | 2866617563 | 232 |
| 92 | iso_pu_bacteria | 2895880812 | 2895883528 | 232 |
| 93 | iso_pu_bacteria | 2899359706 | 2899361900 | 232 |
| 94 | iso_pu_bacteria | 2915768154 | 2915772608 | 232 |
| 95 | iso_pu_bacteria | 2917736166 | 2917736461 | 232 |
| 96 | iso_pu_bacteria | 8003314358 | 8003323450 | 232 |
| 97 | iso_pu_bacteria | 8054472261 | 8054474675 | 232 |
| 98 | iso_pu_bacteria | 8054913762 | 8054919803 | 232 |
| 99 | iso_pu_bacteria | 8054920844 | 8054926344 | 232 |
| 100 | iso_pu_bacteria | 8055157932 | 8055163266 | 232 |
| 101 | 3300005548 | Ga0070665_100007100 | Ga0070665_1000071009 | 233 |
| 102 | 3300005614 | Ga0068856_101060738 | Ga0068856_1010607381 | 233 |
| 103 | 3300005841 | Ga0068863_100105276 | Ga0068863_1001052763 | 233 |
| 104 | 3300005841 | Ga0068863_100108056 | Ga0068863_1001080563 | 233 |
| 105 | 3300005843 | Ga0068860_100100455 | Ga0068860_1001004552 | 233 |
| 106 | 3300009101 | Ga0105247_10185289 | Ga0105247_101852892 | 233 |
| 107 | 3300014968 | Ga0157379_10067726 | Ga0157379_100677262 | 233 |
| 108 | 3300025936 | Ga0207670_10006353 | Ga0207670_100063536 | 233 |
| 109 | 3300025972 | Ga0207668_10029503 | Ga0207668_100295033 | 233 |
| 110 | 3300026078 | Ga0207702_10836713 | Ga0207702_108367132 | 233 |
| 111 | 3300026088 | Ga0207641_10023303 | Ga0207641_100233036 | 233 |
| 112 | 3300026088 | Ga0207641_10090704 | Ga0207641_100907043 | 233 |
| 113 | 3300028379 | Ga0268266_10074167 | Ga0268266_100741673 | 233 |
| 114 | 3300028381 | Ga0268264_10010103 | Ga0268264_100101036 | 233 |
| 115 | 3300035724 | Ga0373933_0190829 | Ga0373933_0190829_539_1258 | 233 |
| 116 | 3300039437 | Ga0436365_0712680 | Ga0436365_0712680_46146_46853 | 233 |
| 117 | 3300044694 | Ga0466963_0065377 | Ga0466963_0065377_346_1047 | 233 |
| 118 | 3300044706 | Ga0466964_0014296 | Ga0466964_0014296_931_1632 | 233 |
| 119 | 3300045976 | Ga0466967_0106514 | Ga0466967_0106514_88_789 | 233 |
| 120 | 3300046461 | Ga0495641_0107633 | Ga0495641_0107633_83_793 | 233 |
| 121 | 3300046462 | Ga0495651_0142745 | Ga0495651_0142745_147_866 | 233 |
| 122 | 3300046511 | Ga0495608_0008848 | Ga0495608_0008848_5026_5745 | 233 |
| 123 | 3300046536 | Ga0495587_0022409 | Ga0495587_0022409_108_827 | 233 |
| 124 | 3300046675 | Ga0495657_0020356 | Ga0495657_0020356_1895_2614 | 233 |
| 125 | 3300046678 | Ga0495599_0174777 | Ga0495599_0174777_79_798 | 233 |
| 126 | 3300047319 | Ga0495674_0299903 | Ga0495674_0299903_328_1047 | 233 |
| 127 | 3300047322 | Ga0495680_0076453 | Ga0495680_0076453_417_1136 | 233 |
| 128 | 3300047471 | Ga0495684_0213628 | Ga0495684_0213628_398_1117 | 233 |
| 129 | 3300048903 | Ga0496100_0001291 | Ga0496100_0001291_9338_10039 | 233 |
| 130 | 3300048904 | Ga0496101_0001621 | Ga0496101_0001621_4597_5298 | 233 |
| 131 | 3300048905 | Ga0496102_0000157 | Ga0496102_0000157_63073_63774 | 233 |
| 132 | 3300048906 | Ga0496103_0000106 | Ga0496103_0000106_28591_29292 | 233 |
| 133 | 3300048907 | Ga0496104_0117772 | Ga0496104_0117772_1678_2379 | 233 |
| 134 | 3300048908 | Ga0496105_0046558 | Ga0496105_0046558_1193_1894 | 233 |
| 135 | 3300048910 | Ga0496107_0065029 | Ga0496107_0065029_1098_1799 | 233 |
| 136 | 3300048912 | Ga0496109_0109989 | Ga0496109_0109989_410_1111 | 233 |
| 137 | 3300048919 | Ga0496116_0000724 | Ga0496116_0000724_28620_29321 | 233 |
| 138 | 3300048920 | Ga0496117_0000364 | Ga0496117_0000364_49576_50277 | 233 |
| 139 | 3300048921 | Ga0496118_0000069 | Ga0496118_0000069_173954_174655 | 233 |
| 140 | 3300048922 | Ga0496119_0000777 | Ga0496119_0000777_2766_3467 | 233 |
| 141 | 3300048923 | Ga0496120_0031048 | Ga0496120_0031048_527_1228 | 233 |
| 142 | 3300048924 | Ga0496121_0006622 | Ga0496121_0006622_12014_12715 | 233 |
| 143 | 3300048927 | Ga0496124_0048825 | Ga0496124_0048825_1057_1758 | 233 |
| 144 | 3300048928 | Ga0496125_0322150 | Ga0496125_0322150_15_716 | 233 |
| 145 | 3300048929 | Ga0496126_0000372 | Ga0496126_0000372_63076_63777 | 233 |
| 146 | 3300049571 | Ga0501034_0012702 | Ga0501034_0012702_6709_7419 | 233 |
| 147 | 3300053084 | Ga0495595_0001572 | Ga0495595_0001572_1606_2325 | 233 |
| 148 | 3300053085 | Ga0495619_0030618 | Ga0495619_0030618_2088_2807 | 233 |
| 149 | 3300061719 | Ga0466962_0134781 | Ga0466962_0134781_379_1080 | 233 |
| 150 | iso_pu_bacteria | 2643221687 | 2644486976 | 233 |
| 151 | iso_pu_bacteria | 2643221715 | 2644635128 | 233 |
| 152 | iso_pu_bacteria | 2738541264 | 2738664162 | 233 |
| 153 | iso_pu_bacteria | 2738541356 | 2739143297 | 233 |
| 154 | iso_pu_bacteria | 2842134933 | 2842136665 | 233 |
| 155 | iso_pu_bacteria | 2902792274 | 2902792858 | 233 |
| 156 | iso_pu_bacteria | 2902810491 | 2902813846 | 233 |
| 157 | iso_pu_bacteria | 2902837492 | 2902841881 | 233 |
| 158 | iso_pu_bacteria | 2929212328 | 2929213669 | 233 |
| 159 | 3300005440 | Ga0070705_100029772 | Ga0070705_1000297723 | 234 |
| 160 | 3300005444 | Ga0070694_100248455 | Ga0070694_1002484552 | 234 |
| 161 | 3300005458 | Ga0070681_10028887 | Ga0070681_100288873 | 234 |
| 162 | 3300005458 | Ga0070681_10109599 | Ga0070681_101095992 | 234 |
| 163 | 3300005545 | Ga0070695_100055433 | Ga0070695_1000554332 | 234 |
| 164 | 3300005546 | Ga0070696_100017803 | Ga0070696_1000178032 | 234 |
| 165 | 3300005563 | Ga0068855_100410772 | Ga0068855_1004107722 | 234 |
| 166 | 3300005937 | Ga0081455_10053243 | Ga0081455_100532435 | 234 |
| 167 | 3300006844 | Ga0075428_100063605 | Ga0075428_1000636053 | 234 |
| 168 | 3300006846 | Ga0075430_100179845 | Ga0075430_1001798452 | 234 |
| 169 | 3300006847 | Ga0075431_100241443 | Ga0075431_1002414433 | 234 |
| 170 | 3300006871 | Ga0075434_100394812 | Ga0075434_1003948122 | 234 |
| 171 | 3300006880 | Ga0075429_100050085 | Ga0075429_1000500852 | 234 |
| 172 | 3300006880 | Ga0075429_100123804 | Ga0075429_1001238042 | 234 |
| 173 | 3300009094 | Ga0111539_10007896 | Ga0111539_1000789610 | 234 |
| 174 | 3300009094 | Ga0111539_10008660 | Ga0111539_100086605 | 234 |
| 175 | 3300009147 | Ga0114129_10033012 | Ga0114129_100330125 | 234 |
| 176 | 3300009148 | Ga0105243_10371859 | Ga0105243_103718592 | 234 |
| 177 | 3300025912 | Ga0207707_10031389 | Ga0207707_100313892 | 234 |
| 178 | 3300025935 | Ga0207709_10354787 | Ga0207709_103547872 | 234 |
| 179 | 3300027907 | Ga0207428_10128299 | Ga0207428_101282993 | 234 |
| 180 | 3300031548 | Ga0307408_100071279 | Ga0307408_1000712792 | 234 |
| 181 | 3300041404 | Ga0439436_0045543 | Ga0439436_0045543_42_752 | 234 |
| 182 | 3300041406 | Ga0439439_0004099 | Ga0439439_0004099_452_1162 | 234 |
| 183 | 3300042010 | Ga0439452_032504 | Ga0439452_032504_76_816 | 234 |
| 184 | 3300042137 | Ga0450902_017562 | Ga0450902_017562_232_1014 | 234 |
| 185 | 3300042435 | Ga0439434_0074525 | Ga0439434_0074525_10_750 | 234 |
| 186 | 3300044693 | Ga0466961_0109723 | Ga0466961_0109723_587_1294 | 234 |
| 187 | 3300044735 | Ga0466968_0127631 | Ga0466968_0127631_111_821 | 234 |
| 188 | 3300045976 | Ga0466967_1124399 | Ga0466967_1124399_28_741 | 234 |
| 189 | 3300048907 | Ga0496104_0419929 | Ga0496104_0419929_22_741 | 234 |
| 190 | 3300049578 | Ga0501042_0408711 | Ga0501042_0408711_167_886 | 234 |
| 191 | 3300049585 | Ga0501069_0004972 | Ga0501069_0004972_5076_5789 | 234 |
| 192 | 3300049586 | Ga0501070_0003730 | Ga0501070_0003730_1355_2068 | 234 |
| 193 | 3300049587 | Ga0501071_0002096 | Ga0501071_0002096_6446_7159 | 234 |
| 194 | 3300049589 | Ga0501073_0001051 | Ga0501073_0001051_8057_8770 | 234 |
| 195 | 3300049590 | Ga0501074_0034972 | Ga0501074_0034972_1975_2688 | 234 |
| 196 | 3300049741 | Ga0501079_0002112 | Ga0501079_0002112_7686_8399 | 234 |
| 197 | 3300049742 | Ga0501080_0003683 | Ga0501080_0003683_12717_13430 | 234 |
| 198 | 3300049744 | Ga0501083_0004203 | Ga0501083_0004203_7286_7999 | 234 |
| 199 | 3300050490 | nmdc:mga03n38_150622_c1 | nmdc:mga03n38_150622_c1_182_904 | 234 |
| 200 | 3300050492 | nmdc:mga0yw44_32973_c1 | nmdc:mga0yw44_32973_c1_2181_2891 | 234 |
| 201 | 3300050507 | nmdc:mga05p37_10145_c1 | nmdc:mga05p37_10145_c1_2242_2964 | 234 |
| 202 | 3300050507 | nmdc:mga05p37_624731_c1 | nmdc:mga05p37_624731_c1_351_1073 | 234 |
| 203 | 3300050509 | nmdc:mga0qj67_82039_c1 | nmdc:mga0qj67_82039_c1_1196_1918 | 234 |
| 204 | 3300050510 | nmdc:mga06r32_489869_c1 | nmdc:mga06r32_489869_c1_146_868 | 234 |
| 205 | 3300050510 | nmdc:mga06r32_5459_c1 | nmdc:mga06r32_5459_c1_5103_5825 | 234 |
| 206 | 3300050511 | nmdc:mga08y16_284935_c1 | nmdc:mga08y16_284935_c1_563_1285 | 234 |
| 207 | 3300050511 | nmdc:mga08y16_284953_c1 | nmdc:mga08y16_284953_c1_669_1391 | 234 |
| 208 | 3300050511 | nmdc:mga08y16_672453_c1 | nmdc:mga08y16_672453_c1_177_887 | 234 |
| 209 | 3300050512 | nmdc:mga0n895_368504_c1 | nmdc:mga0n895_368504_c1_542_1252 | 234 |
| 210 | 3300054114 | Ga0501084_0009101 | Ga0501084_0009101_1661_2374 | 234 |
| 211 | 3300061734 | Ga0530510_0504623 | Ga0530510_0504623_139_858 | 234 |
| 212 | 3300005328 | Ga0070676_10009545 | Ga0070676_100095454 | 235 |
| 213 | 3300005329 | Ga0070683_100139575 | Ga0070683_1001395753 | 235 |
| 214 | 3300005344 | Ga0070661_100116760 | Ga0070661_1001167602 | 235 |
| 215 | 3300005345 | Ga0070692_10225373 | Ga0070692_102253731 | 235 |
| 216 | 3300005354 | Ga0070675_100115777 | Ga0070675_1001157771 | 235 |
| 217 | 3300005364 | Ga0070673_100427071 | Ga0070673_1004270711 | 235 |
| 218 | 3300005435 | Ga0070714_100429440 | Ga0070714_1004294402 | 235 |
| 219 | 3300005445 | Ga0070708_100045457 | Ga0070708_1000454572 | 235 |
| 220 | 3300005456 | Ga0070678_100110382 | Ga0070678_1001103822 | 235 |
| 221 | 3300005466 | Ga0070685_10410993 | Ga0070685_104109931 | 235 |
| 222 | 3300005467 | Ga0070706_100005155 | Ga0070706_10000515513 | 235 |
| 223 | 3300005518 | Ga0070699_100301033 | Ga0070699_1003010332 | 235 |
| 224 | 3300005530 | Ga0070679_100143533 | Ga0070679_1001435332 | 235 |
| 225 | 3300005614 | Ga0068856_100609976 | Ga0068856_1006099762 | 235 |
| 226 | 3300005719 | Ga0068861_100503038 | Ga0068861_1005030382 | 235 |
| 227 | 3300005937 | Ga0081455_10011754 | Ga0081455_100117543 | 235 |
| 228 | 3300005937 | Ga0081455_10243227 | Ga0081455_102432272 | 235 |
| 229 | 3300006038 | Ga0075365_10048365 | Ga0075365_100483653 | 235 |
| 230 | 3300006038 | Ga0075365_10161480 | Ga0075365_101614802 | 235 |
| 231 | 3300006038 | Ga0075365_10215619 | Ga0075365_102156192 | 235 |
| 232 | 3300006844 | Ga0075428_100013494 | Ga0075428_1000134944 | 235 |
| 233 | 3300006844 | Ga0075428_100044817 | Ga0075428_1000448173 | 235 |
| 234 | 3300006844 | Ga0075428_100064989 | Ga0075428_1000649891 | 235 |
| 235 | 3300006846 | Ga0075430_100024958 | Ga0075430_1000249584 | 235 |
| 236 | 3300006846 | Ga0075430_100247053 | Ga0075430_1002470531 | 235 |
| 237 | 3300006847 | Ga0075431_100002922 | Ga0075431_10000292213 | 235 |
| 238 | 3300006847 | Ga0075431_100043370 | Ga0075431_1000433705 | 235 |
| 239 | 3300006880 | Ga0075429_100083434 | Ga0075429_1000834343 | 235 |
| 240 | 3300006880 | Ga0075429_100129666 | Ga0075429_1001296663 | 235 |
| 241 | 3300009094 | Ga0111539_10146768 | Ga0111539_101467683 | 235 |
| 242 | 3300009098 | Ga0105245_10007676 | Ga0105245_1000767610 | 235 |
| 243 | 3300009147 | Ga0114129_10201392 | Ga0114129_102013924 | 235 |
| 244 | 3300010375 | Ga0105239_10821585 | Ga0105239_108215852 | 235 |
| 245 | 3300010375 | Ga0105239_11037786 | Ga0105239_110377861 | 235 |
| 246 | 3300011119 | Ga0105246_10339824 | Ga0105246_103398242 | 235 |
| 247 | 3300013105 | Ga0157369_10199327 | Ga0157369_101993273 | 235 |
| 248 | 3300013297 | Ga0157378_10381281 | Ga0157378_103812812 | 235 |
| 249 | 3300013306 | Ga0163162_10221827 | Ga0163162_102218272 | 235 |
| 250 | 3300014326 | Ga0157380_10095069 | Ga0157380_100950692 | 235 |
| 251 | 3300021384 | Ga0213876_10006963 | Ga0213876_100069637 | 235 |
| 252 | 3300021388 | Ga0213875_10097570 | Ga0213875_100975704 | 235 |
| 253 | 3300025907 | Ga0207645_10043029 | Ga0207645_100430292 | 235 |
| 254 | 3300025910 | Ga0207684_10015458 | Ga0207684_100154586 | 235 |
| 255 | 3300025917 | Ga0207660_10272551 | Ga0207660_102725511 | 235 |
| 256 | 3300025927 | Ga0207687_10012713 | Ga0207687_100127137 | 235 |
| 257 | 3300025937 | Ga0207669_10437204 | Ga0207669_104372041 | 235 |
| 258 | 3300026078 | Ga0207702_10532442 | Ga0207702_105324422 | 235 |
| 259 | 3300026095 | Ga0207676_10848985 | Ga0207676_108489851 | 235 |
| 260 | 3300026118 | Ga0207675_100314079 | Ga0207675_1003140792 | 235 |
| 261 | 3300026121 | Ga0207683_10075414 | Ga0207683_100754143 | 235 |
| 262 | 3300026121 | Ga0207683_10155034 | Ga0207683_101550343 | 235 |
| 263 | 3300027907 | Ga0207428_10403756 | Ga0207428_104037561 | 235 |
| 264 | 3300031456 | Ga0307513_10051706 | Ga0307513_100517063 | 235 |
| 265 | 3300031911 | Ga0307412_10193861 | Ga0307412_101938613 | 235 |
| 266 | 3300031911 | Ga0307412_10340767 | Ga0307412_103407672 | 235 |
| 267 | 3300032002 | Ga0307416_100324519 | Ga0307416_1003245192 | 235 |
| 268 | 3300034817 | Ga0373948_0015998 | Ga0373948_0015998_276_986 | 235 |
| 269 | 3300035117 | Ga0373953_0064474 | Ga0373953_0064474_122_835 | 235 |
| 270 | 3300035691 | Ga0373931_0000070 | Ga0373931_0000070_10706_11416 | 235 |
| 271 | 3300037853 | Ga0436364_0859478 | Ga0436364_0859478_672_1385 | 235 |
| 272 | 3300038735 | Ga0400485_08781 | Ga0400485_08781_3727_4440 | 235 |
| 273 | 3300039062 | Ga0400483_027616 | Ga0400483_027616_195_908 | 235 |
| 274 | 3300039062 | Ga0400483_058092 | Ga0400483_058092_225_938 | 235 |
| 275 | 3300039062 | Ga0400483_128414 | Ga0400483_128414_4021_4734 | 235 |
| 276 | 3300039437 | Ga0436365_0983079 | Ga0436365_0983079_3388_4101 | 235 |
| 277 | 3300039450 | Ga0436363_0836064 | Ga0436363_0836064_492_1205 | 235 |
| 278 | 3300042010 | Ga0439452_058374 | Ga0439452_058374_25_741 | 235 |
| 279 | 3300042437 | Ga0439444_0027144 | Ga0439444_0027144_107_829 | 235 |
| 280 | 3300042439 | Ga0439464_0001811 | Ga0439464_0001811_968_1690 | 235 |
| 281 | 3300042461 | Ga0439460_0012259 | Ga0439460_0012259_608_1330 | 235 |
| 282 | 3300044658 | Ga0466972_0018390 | Ga0466972_0018390_1245_1955 | 235 |
| 283 | 3300044683 | Ga0466965_0003626 | Ga0466965_0003626_1776_2486 | 235 |
| 284 | 3300044693 | Ga0466961_0033971 | Ga0466961_0033971_364_1077 | 235 |
| 285 | 3300044694 | Ga0466963_0033417 | Ga0466963_0033417_532_1245 | 235 |
| 286 | 3300044694 | Ga0466963_0101673 | Ga0466963_0101673_107_820 | 235 |
| 287 | 3300044694 | Ga0466963_0330718 | Ga0466963_0330718_253_966 | 235 |
| 288 | 3300044719 | Ga0466971_0097761 | Ga0466971_0097761_10_723 | 235 |
| 289 | 3300044719 | Ga0466971_0216303 | Ga0466971_0216303_56_769 | 235 |
| 290 | 3300044765 | Ga0466970_0003910 | Ga0466970_0003910_4602_5312 | 235 |
| 291 | 3300044901 | Ga0466960_0002286 | Ga0466960_0002286_1510_2220 | 235 |
| 292 | 3300044901 | Ga0466960_0007001 | Ga0466960_0007001_3169_3882 | 235 |
| 293 | 3300045836 | Ga0466958_0071272 | Ga0466958_0071272_269_982 | 235 |
| 294 | 3300045836 | Ga0466958_0089696 | Ga0466958_0089696_643_1356 | 235 |
| 295 | 3300045976 | Ga0466967_0012840 | Ga0466967_0012840_3091_3804 | 235 |
| 296 | 3300045976 | Ga0466967_0089291 | Ga0466967_0089291_321_1031 | 235 |
| 297 | 3300046454 | Ga0495592_0118747 | Ga0495592_0118747_707_1420 | 235 |
| 298 | 3300046459 | Ga0495629_0429982 | Ga0495629_0429982_132_845 | 235 |
| 299 | 3300046473 | Ga0495582_0135980 | Ga0495582_0135980_483_1199 | 235 |
| 300 | 3300046476 | Ga0495662_0062556 | Ga0495662_0062556_345_1061 | 235 |
| 301 | 3300046506 | Ga0495583_0016279 | Ga0495583_0016279_867_1655 | 235 |
| 302 | 3300046511 | Ga0495608_0296135 | Ga0495608_0296135_276_989 | 235 |
| 303 | 3300046517 | Ga0495630_0027145 | Ga0495630_0027145_3077_3796 | 235 |
| 304 | 3300046559 | Ga0495667_0066207 | Ga0495667_0066207_1387_2100 | 235 |
| 305 | 3300046642 | Ga0495634_0023847 | Ga0495634_0023847_1327_2043 | 235 |
| 306 | 3300046642 | Ga0495634_0236175 | Ga0495634_0236175_81_794 | 235 |
| 307 | 3300046681 | Ga0495647_0057534 | Ga0495647_0057534_395_1111 | 235 |
| 308 | 3300046681 | Ga0495647_0154614 | Ga0495647_0154614_254_967 | 235 |
| 309 | 3300046683 | Ga0495658_0039219 | Ga0495658_0039219_69_782 | 235 |
| 310 | 3300046689 | Ga0495613_0007630 | Ga0495613_0007630_6677_7393 | 235 |
| 311 | 3300046689 | Ga0495613_0161006 | Ga0495613_0161006_106_819 | 235 |
| 312 | 3300047317 | Ga0495604_0269251 | Ga0495604_0269251_146_859 | 235 |
| 313 | 3300048091 | Ga0495626_0072913 | Ga0495626_0072913_280_990 | 235 |
| 314 | 3300048911 | Ga0496108_0457907 | Ga0496108_0457907_194_907 | 235 |
| 315 | 3300048912 | Ga0496109_0908953 | Ga0496109_0908953_25_738 | 235 |
| 316 | 3300048913 | Ga0496110_0075396 | Ga0496110_0075396_1577_2290 | 235 |
| 317 | 3300048917 | Ga0496114_0410902 | Ga0496114_0410902_11_724 | 235 |
| 318 | 3300048920 | Ga0496117_0063979 | Ga0496117_0063979_969_1682 | 235 |
| 319 | 3300048921 | Ga0496118_0000452 | Ga0496118_0000452_49241_49954 | 235 |
| 320 | 3300049569 | Ga0501032_0010428 | Ga0501032_0010428_4120_4833 | 235 |
| 321 | 3300049570 | Ga0501033_0023185 | Ga0501033_0023185_706_1419 | 235 |
| 322 | 3300049571 | Ga0501034_0003015 | Ga0501034_0003015_6740_7456 | 235 |
| 323 | 3300049571 | Ga0501034_0004248 | Ga0501034_0004248_7290_8006 | 235 |
| 324 | 3300049571 | Ga0501034_0047165 | Ga0501034_0047165_2882_3592 | 235 |
| 325 | 3300049571 | Ga0501034_0065836 | Ga0501034_0065836_858_1571 | 235 |
| 326 | 3300049572 | Ga0501036_0051502 | Ga0501036_0051502_60_773 | 235 |
| 327 | 3300049573 | Ga0501037_0026732 | Ga0501037_0026732_3150_3863 | 235 |
| 328 | 3300049573 | Ga0501037_0047676 | Ga0501037_0047676_2001_2717 | 235 |
| 329 | 3300049578 | Ga0501042_0360269 | Ga0501042_0360269_268_990 | 235 |
| 330 | 3300049580 | Ga0501046_0013929 | Ga0501046_0013929_4351_5064 | 235 |
| 331 | 3300049581 | Ga0501047_0003181 | Ga0501047_0003181_540_1253 | 235 |
| 332 | 3300049582 | Ga0501048_0052459 | Ga0501048_0052459_415_1128 | 235 |
| 333 | 3300049583 | Ga0501067_0035400 | Ga0501067_0035400_890_1603 | 235 |
| 334 | 3300049584 | Ga0501068_0000013 | Ga0501068_0000013_48145_48861 | 235 |
| 335 | 3300049586 | Ga0501070_0006326 | Ga0501070_0006326_4264_4980 | 235 |
| 336 | 3300049586 | Ga0501070_0011228 | Ga0501070_0011228_2559_3272 | 235 |
| 337 | 3300049588 | Ga0501072_0009253 | Ga0501072_0009253_3204_3920 | 235 |
| 338 | 3300049589 | Ga0501073_0001202 | Ga0501073_0001202_12903_13619 | 235 |
| 339 | 3300049589 | Ga0501073_0174778 | Ga0501073_0174778_407_1120 | 235 |
| 340 | 3300049590 | Ga0501074_0006859 | Ga0501074_0006859_2663_3379 | 235 |
| 341 | 3300049742 | Ga0501080_0011291 | Ga0501080_0011291_3614_4330 | 235 |
| 342 | 3300049742 | Ga0501080_0333814 | Ga0501080_0333814_455_1183 | 235 |
| 343 | 3300049744 | Ga0501083_0014677 | Ga0501083_0014677_3435_4151 | 235 |
| 344 | 3300049744 | Ga0501083_0019555 | Ga0501083_0019555_3141_3857 | 235 |
| 345 | 3300049744 | Ga0501083_0100365 | Ga0501083_0100365_993_1709 | 235 |
| 346 | 3300049822 | Ga0501035_0001201 | Ga0501035_0001201_24559_25272 | 235 |
| 347 | 3300049823 | Ga0501044_0002283 | Ga0501044_0002283_19245_19958 | 235 |
| 348 | 3300049823 | Ga0501044_0602994 | Ga0501044_0602994_12_722 | 235 |
| 349 | 3300050490 | nmdc:mga03n38_7960_c1 | nmdc:mga03n38_7960_c1_193_918 | 235 |
| 350 | 3300050491 | nmdc:mga00v17_74838_c1 | nmdc:mga00v17_74838_c1_1208_1924 | 235 |
| 351 | 3300050492 | nmdc:mga0yw44_138246_c1 | nmdc:mga0yw44_138246_c1_182_898 | 235 |
| 352 | 3300050508 | nmdc:mga09592_151398_c1 | nmdc:mga09592_151398_c1_80_802 | 235 |
| 353 | 3300050509 | nmdc:mga0qj67_298076_c1 | nmdc:mga0qj67_298076_c1_289_1011 | 235 |
| 354 | 3300050509 | nmdc:mga0qj67_33851_c1 | nmdc:mga0qj67_33851_c1_1300_2100 | 235 |
| 355 | 3300050510 | nmdc:mga06r32_74568_c1 | nmdc:mga06r32_74568_c1_1276_1998 | 235 |
| 356 | 3300050510 | nmdc:mga06r32_869417_c1 | nmdc:mga06r32_869417_c1_27_749 | 235 |
| 357 | 3300050511 | nmdc:mga08y16_134535_c1 | nmdc:mga08y16_134535_c1_1558_2280 | 235 |
| 358 | 3300053078 | Ga0495612_0129504 | Ga0495612_0129504_269_1006 | 235 |
| 359 | 3300053078 | Ga0495612_0198064 | Ga0495612_0198064_141_860 | 235 |
| 360 | 3300053084 | Ga0495595_0024247 | Ga0495595_0024247_1459_2172 | 235 |
| 361 | 3300053085 | Ga0495619_0007407 | Ga0495619_0007407_2266_2979 | 235 |
| 362 | 3300053139 | Ga0500568_0000189 | Ga0500568_0000189_28032_28775 | 235 |
| 363 | 3300053153 | Ga0500616_0037029 | Ga0500616_0037029_1867_2589 | 235 |
| 364 | 3300053153 | Ga0500616_0059240 | Ga0500616_0059240_627_1340 | 235 |
| 365 | 3300054114 | Ga0501084_0000230 | Ga0501084_0000230_16551_17273 | 235 |
| 366 | 3300054114 | Ga0501084_0540733 | Ga0501084_0540733_166_888 | 235 |
| 367 | 3300061719 | Ga0466962_0055138 | Ga0466962_0055138_891_1604 | 235 |
| 368 | 3300061734 | Ga0530510_0228622 | Ga0530510_0228622_84_806 | 235 |
| 369 | 3300002073 | JGI24745J21846_1002320 | JGI24745J21846_10023202 | 236 |
| 370 | 3300002074 | JGI24748J21848_1007147 | JGI24748J21848_10071472 | 236 |
| 371 | 3300002077 | JGI24744J21845_10001349 | JGI24744J21845_100013491 | 236 |
| 372 | 3300002077 | JGI24744J21845_10011490 | JGI24744J21845_100114901 | 236 |
| 373 | 3300003320 | rootH2_10039752 | rootH2_100397525 | 236 |
| 374 | 3300003323 | rootH1_10169282 | rootH1_101692823 | 236 |
| 375 | 3300003792 | Ga0055540_1000118 | Ga0055540_100011845 | 236 |
| 376 | 3300003792 | Ga0055540_1000243 | Ga0055540_100024346 | 236 |
| 377 | 3300003792 | Ga0055540_1003862 | Ga0055540_10038625 | 236 |
| 378 | 3300003792 | Ga0055540_1014158 | Ga0055540_10141582 | 236 |
| 379 | 3300005331 | Ga0070670_100107856 | Ga0070670_1001078562 | 236 |
| 380 | 3300005334 | Ga0068869_100020924 | Ga0068869_1000209247 | 236 |
| 381 | 3300005334 | Ga0068869_100057787 | Ga0068869_1000577871 | 236 |
| 382 | 3300005337 | Ga0070682_100082895 | Ga0070682_1000828951 | 236 |
| 383 | 3300005337 | Ga0070682_100429136 | Ga0070682_1004291361 | 236 |
| 384 | 3300005338 | Ga0068868_100014673 | Ga0068868_1000146732 | 236 |
| 385 | 3300005338 | Ga0068868_100200257 | Ga0068868_1002002572 | 236 |
| 386 | 3300005340 | Ga0070689_100012121 | Ga0070689_1000121212 | 236 |
| 387 | 3300005341 | Ga0070691_10018762 | Ga0070691_100187622 | 236 |
| 388 | 3300005347 | Ga0070668_100000242 | Ga0070668_10000024210 | 236 |
| 389 | 3300005347 | Ga0070668_100009256 | Ga0070668_1000092568 | 236 |
| 390 | 3300005353 | Ga0070669_100005081 | Ga0070669_1000050815 | 236 |
| 391 | 3300005353 | Ga0070669_100030328 | Ga0070669_1000303283 | 236 |
| 392 | 3300005353 | Ga0070669_100393500 | Ga0070669_1003935001 | 236 |
| 393 | 3300005355 | Ga0070671_100002818 | Ga0070671_10000281814 | 236 |
| 394 | 3300005356 | Ga0070674_100004607 | Ga0070674_1000046075 | 236 |
| 395 | 3300005356 | Ga0070674_100234972 | Ga0070674_1002349722 | 236 |
| 396 | 3300005364 | Ga0070673_100182460 | Ga0070673_1001824602 | 236 |
| 397 | 3300005365 | Ga0070688_100006748 | Ga0070688_1000067484 | 236 |
| 398 | 3300005366 | Ga0070659_100004755 | Ga0070659_10000475510 | 236 |
| 399 | 3300005367 | Ga0070667_100000544 | Ga0070667_10000054413 | 236 |
| 400 | 3300005367 | Ga0070667_100010100 | Ga0070667_1000101008 | 236 |
| 401 | 3300005367 | Ga0070667_100027586 | Ga0070667_1000275861 | 236 |
| 402 | 3300005406 | Ga0070703_10074144 | Ga0070703_100741441 | 236 |
| 403 | 3300005434 | Ga0070709_10104574 | Ga0070709_101045742 | 236 |
| 404 | 3300005435 | Ga0070714_100314014 | Ga0070714_1003140142 | 236 |
| 405 | 3300005435 | Ga0070714_100811920 | Ga0070714_1008119202 | 236 |
| 406 | 3300005437 | Ga0070710_10003235 | Ga0070710_100032354 | 236 |
| 407 | 3300005437 | Ga0070710_10003876 | Ga0070710_100038764 | 236 |
| 408 | 3300005437 | Ga0070710_10096464 | Ga0070710_100964642 | 236 |
| 409 | 3300005438 | Ga0070701_10024593 | Ga0070701_100245933 | 236 |
| 410 | 3300005439 | Ga0070711_100000663 | Ga0070711_10000066314 | 236 |
| 411 | 3300005444 | Ga0070694_100044443 | Ga0070694_1000444436 | 236 |
| 412 | 3300005445 | Ga0070708_100459079 | Ga0070708_1004590792 | 236 |
| 413 | 3300005455 | Ga0070663_100000795 | Ga0070663_1000007952 | 236 |
| 414 | 3300005455 | Ga0070663_100010657 | Ga0070663_1000106574 | 236 |
| 415 | 3300005455 | Ga0070663_100194434 | Ga0070663_1001944341 | 236 |
| 416 | 3300005456 | Ga0070678_100000459 | Ga0070678_10000045917 | 236 |
| 417 | 3300005456 | Ga0070678_100676952 | Ga0070678_1006769521 | 236 |
| 418 | 3300005457 | Ga0070662_100004396 | Ga0070662_10000439610 | 236 |
| 419 | 3300005457 | Ga0070662_100289588 | Ga0070662_1002895882 | 236 |
| 420 | 3300005459 | Ga0068867_100007547 | Ga0068867_10000754710 | 236 |
| 421 | 3300005459 | Ga0068867_100399728 | Ga0068867_1003997281 | 236 |
| 422 | 3300005466 | Ga0070685_10027454 | Ga0070685_100274543 | 236 |
| 423 | 3300005539 | Ga0068853_100006833 | Ga0068853_10000683310 | 236 |
| 424 | 3300005539 | Ga0068853_100195840 | Ga0068853_1001958402 | 236 |
| 425 | 3300005543 | Ga0070672_100129753 | Ga0070672_1001297532 | 236 |
| 426 | 3300005546 | Ga0070696_100007179 | Ga0070696_1000071799 | 236 |
| 427 | 3300005547 | Ga0070693_100008532 | Ga0070693_1000085329 | 236 |
| 428 | 3300005548 | Ga0070665_100012650 | Ga0070665_1000126502 | 236 |
| 429 | 3300005548 | Ga0070665_100017385 | Ga0070665_1000173858 | 236 |
| 430 | 3300005548 | Ga0070665_100030781 | Ga0070665_1000307812 | 236 |
| 431 | 3300005548 | Ga0070665_100359237 | Ga0070665_1003592371 | 236 |
| 432 | 3300005548 | Ga0070665_100393789 | Ga0070665_1003937892 | 236 |
| 433 | 3300005549 | Ga0070704_100010478 | Ga0070704_1000104784 | 236 |
| 434 | 3300005549 | Ga0070704_100228884 | Ga0070704_1002288842 | 236 |
| 435 | 3300005563 | Ga0068855_100110559 | Ga0068855_1001105593 | 236 |
| 436 | 3300005563 | Ga0068855_100461077 | Ga0068855_1004610772 | 236 |
| 437 | 3300005578 | Ga0068854_100000608 | Ga0068854_1000006083 | 236 |
| 438 | 3300005578 | Ga0068854_100124372 | Ga0068854_1001243722 | 236 |
| 439 | 3300005615 | Ga0070702_100160319 | Ga0070702_1001603192 | 236 |
| 440 | 3300005616 | Ga0068852_100436113 | Ga0068852_1004361132 | 236 |
| 441 | 3300005617 | Ga0068859_100007479 | Ga0068859_1000074798 | 236 |
| 442 | 3300005617 | Ga0068859_100030153 | Ga0068859_10003015310 | 236 |
| 443 | 3300005718 | Ga0068866_10004533 | Ga0068866_100045332 | 236 |
| 444 | 3300005718 | Ga0068866_10120733 | Ga0068866_101207332 | 236 |
| 445 | 3300005719 | Ga0068861_100004705 | Ga0068861_1000047059 | 236 |
| 446 | 3300005719 | Ga0068861_100118447 | Ga0068861_1001184472 | 236 |
| 447 | 3300005842 | Ga0068858_100001820 | Ga0068858_1000018203 | 236 |
| 448 | 3300005842 | Ga0068858_100011821 | Ga0068858_1000118215 | 236 |
| 449 | 3300005842 | Ga0068858_100023732 | Ga0068858_10002373212 | 236 |
| 450 | 3300005842 | Ga0068858_100394941 | Ga0068858_1003949412 | 236 |
| 451 | 3300005843 | Ga0068860_100000048 | Ga0068860_100000048167 | 236 |
| 452 | 3300005843 | Ga0068860_100012097 | Ga0068860_1000120979 | 236 |
| 453 | 3300005843 | Ga0068860_100577302 | Ga0068860_1005773021 | 236 |
| 454 | 3300005843 | Ga0068860_100721246 | Ga0068860_1007212461 | 236 |
| 455 | 3300005844 | Ga0068862_100000053 | Ga0068862_100000053104 | 236 |
| 456 | 3300005844 | Ga0068862_100015980 | Ga0068862_1000159803 | 236 |
| 457 | 3300005937 | Ga0081455_10002841 | Ga0081455_100028417 | 236 |
| 458 | 3300005937 | Ga0081455_10031829 | Ga0081455_100318294 | 236 |
| 459 | 3300005937 | Ga0081455_10132807 | Ga0081455_101328072 | 236 |
| 460 | 3300005937 | Ga0081455_10133779 | Ga0081455_101337792 | 236 |
| 461 | 3300005981 | Ga0081538_10049765 | Ga0081538_100497652 | 236 |
| 462 | 3300006038 | Ga0075365_10002834 | Ga0075365_100028346 | 236 |
| 463 | 3300006038 | Ga0075365_10038635 | Ga0075365_100386352 | 236 |
| 464 | 3300006038 | Ga0075365_10040437 | Ga0075365_100404372 | 236 |
| 465 | 3300006038 | Ga0075365_10169232 | Ga0075365_101692322 | 236 |
| 466 | 3300006042 | Ga0075368_10041498 | Ga0075368_100414982 | 236 |
| 467 | 3300006048 | Ga0075363_100002416 | Ga0075363_1000024168 | 236 |
| 468 | 3300006048 | Ga0075363_100002790 | Ga0075363_1000027905 | 236 |
| 469 | 3300006048 | Ga0075363_100021877 | Ga0075363_1000218774 | 236 |
| 470 | 3300006048 | Ga0075363_100022307 | Ga0075363_1000223075 | 236 |
| 471 | 3300006048 | Ga0075363_100041344 | Ga0075363_1000413442 | 236 |
| 472 | 3300006048 | Ga0075363_100058980 | Ga0075363_1000589802 | 236 |
| 473 | 3300006048 | Ga0075363_100096794 | Ga0075363_1000967941 | 236 |
| 474 | 3300006048 | Ga0075363_100158657 | Ga0075363_1001586572 | 236 |
| 475 | 3300006048 | Ga0075363_100226049 | Ga0075363_1002260492 | 236 |
| 476 | 3300006048 | Ga0075363_100236523 | Ga0075363_1002365231 | 236 |
| 477 | 3300006051 | Ga0075364_10001709 | Ga0075364_100017096 | 236 |
| 478 | 3300006051 | Ga0075364_10002529 | Ga0075364_100025294 | 236 |
| 479 | 3300006051 | Ga0075364_10004937 | Ga0075364_1000493716 | 236 |
| 480 | 3300006051 | Ga0075364_10008520 | Ga0075364_100085207 | 236 |
| 481 | 3300006051 | Ga0075364_10014187 | Ga0075364_100141876 | 236 |
| 482 | 3300006051 | Ga0075364_10104427 | Ga0075364_101044272 | 236 |
| 483 | 3300006051 | Ga0075364_10187426 | Ga0075364_101874262 | 236 |
| 484 | 3300006051 | Ga0075364_10316909 | Ga0075364_103169092 | 236 |
| 485 | 3300006163 | Ga0070715_10072627 | Ga0070715_100726272 | 236 |
| 486 | 3300006175 | Ga0070712_100001159 | Ga0070712_10000115913 | 236 |
| 487 | 3300006175 | Ga0070712_100022461 | Ga0070712_1000224613 | 236 |
| 488 | 3300006175 | Ga0070712_100504505 | Ga0070712_1005045051 | 236 |
| 489 | 3300006177 | Ga0075362_10018711 | Ga0075362_100187112 | 236 |
| 490 | 3300006177 | Ga0075362_10084062 | Ga0075362_100840621 | 236 |
| 491 | 3300006177 | Ga0075362_10098756 | Ga0075362_100987562 | 236 |
| 492 | 3300006177 | Ga0075362_10225848 | Ga0075362_102258482 | 236 |
| 493 | 3300006178 | Ga0075367_10112226 | Ga0075367_101122262 | 236 |
| 494 | 3300006178 | Ga0075367_10205360 | Ga0075367_102053602 | 236 |
| 495 | 3300006186 | Ga0075369_10001719 | Ga0075369_100017196 | 236 |
| 496 | 3300006186 | Ga0075369_10003008 | Ga0075369_100030084 | 236 |
| 497 | 3300006186 | Ga0075369_10012059 | Ga0075369_100120593 | 236 |
| 498 | 3300006186 | Ga0075369_10028394 | Ga0075369_100283944 | 236 |
| 499 | 3300006186 | Ga0075369_10034831 | Ga0075369_100348312 | 236 |
| 500 | 3300006186 | Ga0075369_10059482 | Ga0075369_100594822 | 236 |
| 501 | 3300006186 | Ga0075369_10115180 | Ga0075369_101151802 | 236 |
| 502 | 3300006186 | Ga0075369_10121975 | Ga0075369_101219752 | 236 |
| 503 | 3300006237 | Ga0097621_100046178 | Ga0097621_1000461782 | 236 |
| 504 | 3300006353 | Ga0075370_10031081 | Ga0075370_100310817 | 236 |
| 505 | 3300006353 | Ga0075370_10115673 | Ga0075370_101156732 | 236 |
| 506 | 3300006353 | Ga0075370_10167716 | Ga0075370_101677162 | 236 |
| 507 | 3300006353 | Ga0075370_10231062 | Ga0075370_102310622 | 236 |
| 508 | 3300006353 | Ga0075370_10241140 | Ga0075370_102411401 | 236 |
| 509 | 3300006353 | Ga0075370_10274747 | Ga0075370_102747471 | 236 |
| 510 | 3300006358 | Ga0068871_100449400 | Ga0068871_1004494002 | 236 |
| 511 | 3300006844 | Ga0075428_100004799 | Ga0075428_10000479916 | 236 |
| 512 | 3300006846 | Ga0075430_100064811 | Ga0075430_1000648111 | 236 |
| 513 | 3300006846 | Ga0075430_100080372 | Ga0075430_1000803723 | 236 |
| 514 | 3300006847 | Ga0075431_100491627 | Ga0075431_1004916272 | 236 |
| 515 | 3300006880 | Ga0075429_100011604 | Ga0075429_1000116042 | 236 |
| 516 | 3300006881 | Ga0068865_100004581 | Ga0068865_1000045816 | 236 |
| 517 | 3300006931 | Ga0097620_100007479 | Ga0097620_1000074798 | 236 |
| 518 | 3300006931 | Ga0097620_100030152 | Ga0097620_10003015210 | 236 |
| 519 | 3300007788 | Ga0099795_10074357 | Ga0099795_100743572 | 236 |
| 520 | 3300009011 | Ga0105251_10018513 | Ga0105251_100185135 | 236 |
| 521 | 3300009092 | Ga0105250_10139551 | Ga0105250_101395512 | 236 |
| 522 | 3300009094 | Ga0111539_10003516 | Ga0111539_1000351611 | 236 |
| 523 | 3300009094 | Ga0111539_10382934 | Ga0111539_103829342 | 236 |
| 524 | 3300009094 | Ga0111539_10643535 | Ga0111539_106435352 | 236 |
| 525 | 3300009098 | Ga0105245_10001283 | Ga0105245_1000128320 | 236 |
| 526 | 3300009098 | Ga0105245_10058042 | Ga0105245_100580422 | 236 |
| 527 | 3300009101 | Ga0105247_10000118 | Ga0105247_1000011826 | 236 |
| 528 | 3300009101 | Ga0105247_10000195 | Ga0105247_1000019543 | 236 |
| 529 | 3300009101 | Ga0105247_10000413 | Ga0105247_1000041330 | 236 |
| 530 | 3300009101 | Ga0105247_10001525 | Ga0105247_1000152515 | 236 |
| 531 | 3300009101 | Ga0105247_10055705 | Ga0105247_100557053 | 236 |
| 532 | 3300009101 | Ga0105247_10092793 | Ga0105247_100927932 | 236 |
| 533 | 3300009147 | Ga0114129_10001629 | Ga0114129_1000162912 | 236 |
| 534 | 3300009147 | Ga0114129_10003146 | Ga0114129_1000314615 | 236 |
| 535 | 3300009147 | Ga0114129_10006791 | Ga0114129_1000679111 | 236 |
| 536 | 3300009148 | Ga0105243_10000773 | Ga0105243_1000077325 | 236 |
| 537 | 3300009148 | Ga0105243_10185687 | Ga0105243_101856871 | 236 |
| 538 | 3300009174 | Ga0105241_10012270 | Ga0105241_100122703 | 236 |
| 539 | 3300009176 | Ga0105242_10011770 | Ga0105242_100117704 | 236 |
| 540 | 3300009176 | Ga0105242_10092028 | Ga0105242_100920283 | 236 |
| 541 | 3300009176 | Ga0105242_10583699 | Ga0105242_105836991 | 236 |
| 542 | 3300009177 | Ga0105248_10000151 | Ga0105248_1000015133 | 236 |
| 543 | 3300009177 | Ga0105248_10007012 | Ga0105248_100070122 | 236 |
| 544 | 3300009177 | Ga0105248_10013545 | Ga0105248_1001354510 | 236 |
| 545 | 3300009545 | Ga0105237_10013445 | Ga0105237_100134454 | 236 |
| 546 | 3300009545 | Ga0105237_10036627 | Ga0105237_100366279 | 236 |
| 547 | 3300009545 | Ga0105237_10077118 | Ga0105237_100771184 | 236 |
| 548 | 3300009553 | Ga0105249_10000022 | Ga0105249_10000022159 | 236 |
| 549 | 3300009553 | Ga0105249_10004515 | Ga0105249_1000451510 | 236 |
| 550 | 3300009553 | Ga0105249_10155145 | Ga0105249_101551452 | 236 |
| 551 | 3300009553 | Ga0105249_10666839 | Ga0105249_106668392 | 236 |
| 552 | 3300010159 | Ga0099796_10057134 | Ga0099796_100571342 | 236 |
| 553 | 3300010375 | Ga0105239_10043734 | Ga0105239_100437344 | 236 |
| 554 | 3300010375 | Ga0105239_10095488 | Ga0105239_100954885 | 236 |
| 555 | 3300010375 | Ga0105239_10580723 | Ga0105239_105807231 | 236 |
| 556 | 3300010375 | Ga0105239_10684577 | Ga0105239_106845772 | 236 |
| 557 | 3300011119 | Ga0105246_10116320 | Ga0105246_101163203 | 236 |
| 558 | 3300011119 | Ga0105246_10374712 | Ga0105246_103747121 | 236 |
| 559 | 3300013105 | Ga0157369_10069869 | Ga0157369_100698692 | 236 |
| 560 | 3300013297 | Ga0157378_10002823 | Ga0157378_1000282316 | 236 |
| 561 | 3300013297 | Ga0157378_10319649 | Ga0157378_103196492 | 236 |
| 562 | 3300013306 | Ga0163162_10002292 | Ga0163162_1000229214 | 236 |
| 563 | 3300013306 | Ga0163162_10089288 | Ga0163162_100892882 | 236 |
| 564 | 3300013306 | Ga0163162_10130397 | Ga0163162_101303972 | 236 |
| 565 | 3300013306 | Ga0163162_10940275 | Ga0163162_109402751 | 236 |
| 566 | 3300013306 | Ga0163162_11289078 | Ga0163162_112890781 | 236 |
| 567 | 3300013307 | Ga0157372_10030734 | Ga0157372_1003073410 | 236 |
| 568 | 3300013307 | Ga0157372_10097249 | Ga0157372_100972493 | 236 |
| 569 | 3300013308 | Ga0157375_10028525 | Ga0157375_100285255 | 236 |
| 570 | 3300013308 | Ga0157375_10082487 | Ga0157375_100824874 | 236 |
| 571 | 3300013308 | Ga0157375_10262588 | Ga0157375_102625882 | 236 |
| 572 | 3300013308 | Ga0157375_10388900 | Ga0157375_103889001 | 236 |
| 573 | 3300014325 | Ga0163163_10003313 | Ga0163163_100033134 | 236 |
| 574 | 3300014325 | Ga0163163_11110220 | Ga0163163_111102201 | 236 |
| 575 | 3300014326 | Ga0157380_10006763 | Ga0157380_100067635 | 236 |
| 576 | 3300014326 | Ga0157380_10212413 | Ga0157380_102124132 | 236 |
| 577 | 3300014326 | Ga0157380_10779192 | Ga0157380_107791922 | 236 |
| 578 | 3300014326 | Ga0157380_11036224 | Ga0157380_110362241 | 236 |
| 579 | 3300014497 | Ga0182008_10113655 | Ga0182008_101136551 | 236 |
| 580 | 3300014745 | Ga0157377_10160789 | Ga0157377_101607892 | 236 |
| 581 | 3300014745 | Ga0157377_10277956 | Ga0157377_102779562 | 236 |
| 582 | 3300014968 | Ga0157379_10001742 | Ga0157379_100017427 | 236 |
| 583 | 3300014968 | Ga0157379_10048775 | Ga0157379_100487753 | 236 |
| 584 | 3300014968 | Ga0157379_10106220 | Ga0157379_101062203 | 236 |
| 585 | 3300014968 | Ga0157379_10265772 | Ga0157379_102657722 | 236 |
| 586 | 3300014969 | Ga0157376_10106149 | Ga0157376_101061493 | 236 |
| 587 | 3300017792 | Ga0163161_10000939 | Ga0163161_1000093922 | 236 |
| 588 | 3300017792 | Ga0163161_10095548 | Ga0163161_100955482 | 236 |
| 589 | 3300021384 | Ga0213876_10005702 | Ga0213876_100057026 | 236 |
| 590 | 3300021388 | Ga0213875_10178359 | Ga0213875_101783591 | 236 |
| 591 | 3300024225 | Ga0224572_1021500 | Ga0224572_10215002 | 236 |
| 592 | 3300025303 | Ga0209051_1000051 | Ga0209051_1000051237 | 236 |
| 593 | 3300025303 | Ga0209051_1001489 | Ga0209051_100148912 | 236 |
| 594 | 3300025303 | Ga0209051_1001900 | Ga0209051_100190011 | 236 |
| 595 | 3300025303 | Ga0209051_1066991 | Ga0209051_10669912 | 236 |
| 596 | 3300025711 | Ga0207696_1055064 | Ga0207696_10550642 | 236 |
| 597 | 3300025898 | Ga0207692_10006326 | Ga0207692_100063263 | 236 |
| 598 | 3300025898 | Ga0207692_10074385 | Ga0207692_100743852 | 236 |
| 599 | 3300025899 | Ga0207642_10000995 | Ga0207642_100009955 | 236 |
| 600 | 3300025900 | Ga0207710_10000029 | Ga0207710_10000029159 | 236 |
| 601 | 3300025900 | Ga0207710_10000076 | Ga0207710_1000007652 | 236 |
| 602 | 3300025900 | Ga0207710_10000091 | Ga0207710_1000009196 | 236 |
| 603 | 3300025900 | Ga0207710_10003297 | Ga0207710_100032974 | 236 |
| 604 | 3300025901 | Ga0207688_10001765 | Ga0207688_1000176512 | 236 |
| 605 | 3300025901 | Ga0207688_10002070 | Ga0207688_1000207010 | 236 |
| 606 | 3300025901 | Ga0207688_10262257 | Ga0207688_102622572 | 236 |
| 607 | 3300025903 | Ga0207680_10075538 | Ga0207680_100755382 | 236 |
| 608 | 3300025903 | Ga0207680_10082562 | Ga0207680_100825621 | 236 |
| 609 | 3300025904 | Ga0207647_10124217 | Ga0207647_101242172 | 236 |
| 610 | 3300025904 | Ga0207647_10274870 | Ga0207647_102748701 | 236 |
| 611 | 3300025905 | Ga0207685_10047646 | Ga0207685_100476462 | 236 |
| 612 | 3300025906 | Ga0207699_10144692 | Ga0207699_101446922 | 236 |
| 613 | 3300025911 | Ga0207654_10054565 | Ga0207654_100545653 | 236 |
| 614 | 3300025914 | Ga0207671_10010972 | Ga0207671_100109722 | 236 |
| 615 | 3300025914 | Ga0207671_10056830 | Ga0207671_100568302 | 236 |
| 616 | 3300025914 | Ga0207671_10063268 | Ga0207671_100632681 | 236 |
| 617 | 3300025914 | Ga0207671_10186716 | Ga0207671_101867162 | 236 |
| 618 | 3300025915 | Ga0207693_10000513 | Ga0207693_1000051329 | 236 |
| 619 | 3300025915 | Ga0207693_10021564 | Ga0207693_100215646 | 236 |
| 620 | 3300025916 | Ga0207663_10002243 | Ga0207663_100022435 | 236 |
| 621 | 3300025916 | Ga0207663_10007211 | Ga0207663_100072113 | 236 |
| 622 | 3300025916 | Ga0207663_10242952 | Ga0207663_102429522 | 236 |
| 623 | 3300025918 | Ga0207662_10044720 | Ga0207662_100447203 | 236 |
| 624 | 3300025919 | Ga0207657_10229717 | Ga0207657_102297171 | 236 |
| 625 | 3300025923 | Ga0207681_10001228 | Ga0207681_100012286 | 236 |
| 626 | 3300025923 | Ga0207681_10024065 | Ga0207681_100240653 | 236 |
| 627 | 3300025926 | Ga0207659_10409214 | Ga0207659_104092142 | 236 |
| 628 | 3300025927 | Ga0207687_10006399 | Ga0207687_1000639912 | 236 |
| 629 | 3300025928 | Ga0207700_10083531 | Ga0207700_100835317 | 236 |
| 630 | 3300025929 | Ga0207664_10240262 | Ga0207664_102402622 | 236 |
| 631 | 3300025929 | Ga0207664_10679061 | Ga0207664_106790612 | 236 |
| 632 | 3300025931 | Ga0207644_10045936 | Ga0207644_100459363 | 236 |
| 633 | 3300025931 | Ga0207644_10063626 | Ga0207644_100636262 | 236 |
| 634 | 3300025932 | Ga0207690_10083671 | Ga0207690_100836711 | 236 |
| 635 | 3300025933 | Ga0207706_10005762 | Ga0207706_1000576210 | 236 |
| 636 | 3300025933 | Ga0207706_10159703 | Ga0207706_101597032 | 236 |
| 637 | 3300025933 | Ga0207706_10718761 | Ga0207706_107187611 | 236 |
| 638 | 3300025935 | Ga0207709_10178107 | Ga0207709_101781072 | 236 |
| 639 | 3300025935 | Ga0207709_10422149 | Ga0207709_104221491 | 236 |
| 640 | 3300025936 | Ga0207670_10012662 | Ga0207670_1001266211 | 236 |
| 641 | 3300025937 | Ga0207669_10001354 | Ga0207669_1000135415 | 236 |
| 642 | 3300025937 | Ga0207669_10511703 | Ga0207669_105117031 | 236 |
| 643 | 3300025938 | Ga0207704_10009059 | Ga0207704_100090593 | 236 |
| 644 | 3300025938 | Ga0207704_10212038 | Ga0207704_102120382 | 236 |
| 645 | 3300025939 | Ga0207665_10000852 | Ga0207665_100008523 | 236 |
| 646 | 3300025940 | Ga0207691_10168095 | Ga0207691_101680952 | 236 |
| 647 | 3300025941 | Ga0207711_10000172 | Ga0207711_1000017244 | 236 |
| 648 | 3300025941 | Ga0207711_10037703 | Ga0207711_100377034 | 236 |
| 649 | 3300025941 | Ga0207711_10038570 | Ga0207711_100385705 | 236 |
| 650 | 3300025942 | Ga0207689_10026221 | Ga0207689_100262214 | 236 |
| 651 | 3300025949 | Ga0207667_10353098 | Ga0207667_103530982 | 236 |
| 652 | 3300025949 | Ga0207667_10393814 | Ga0207667_103938142 | 236 |
| 653 | 3300025960 | Ga0207651_10120996 | Ga0207651_101209961 | 236 |
| 654 | 3300025960 | Ga0207651_10306129 | Ga0207651_103061292 | 236 |
| 655 | 3300025961 | Ga0207712_10000005 | Ga0207712_10000005160 | 236 |
| 656 | 3300025961 | Ga0207712_10019806 | Ga0207712_100198064 | 236 |
| 657 | 3300025961 | Ga0207712_10077385 | Ga0207712_100773851 | 236 |
| 658 | 3300025961 | Ga0207712_10116233 | Ga0207712_101162332 | 236 |
| 659 | 3300025972 | Ga0207668_10008387 | Ga0207668_1000838712 | 236 |
| 660 | 3300025972 | Ga0207668_10089894 | Ga0207668_100898942 | 236 |
| 661 | 3300025981 | Ga0207640_10008326 | Ga0207640_100083265 | 236 |
| 662 | 3300025986 | Ga0207658_10000356 | Ga0207658_1000035619 | 236 |
| 663 | 3300025986 | Ga0207658_10003633 | Ga0207658_100036334 | 236 |
| 664 | 3300025986 | Ga0207658_10104456 | Ga0207658_101044563 | 236 |
| 665 | 3300026023 | Ga0207677_10015714 | Ga0207677_100157143 | 236 |
| 666 | 3300026023 | Ga0207677_10122968 | Ga0207677_101229682 | 236 |
| 667 | 3300026035 | Ga0207703_10000392 | Ga0207703_1000039218 | 236 |
| 668 | 3300026035 | Ga0207703_10009257 | Ga0207703_1000925711 | 236 |
| 669 | 3300026035 | Ga0207703_10034176 | Ga0207703_100341762 | 236 |
| 670 | 3300026041 | Ga0207639_10022607 | Ga0207639_1002260710 | 236 |
| 671 | 3300026041 | Ga0207639_10168686 | Ga0207639_101686861 | 236 |
| 672 | 3300026067 | Ga0207678_10000312 | Ga0207678_1000031214 | 236 |
| 673 | 3300026067 | Ga0207678_10008726 | Ga0207678_100087265 | 236 |
| 674 | 3300026067 | Ga0207678_10126186 | Ga0207678_101261863 | 236 |
| 675 | 3300026075 | Ga0207708_10049662 | Ga0207708_100496622 | 236 |
| 676 | 3300026088 | Ga0207641_10200930 | Ga0207641_102009302 | 236 |
| 677 | 3300026088 | Ga0207641_10679484 | Ga0207641_106794841 | 236 |
| 678 | 3300026089 | Ga0207648_10001669 | Ga0207648_1000166910 | 236 |
| 679 | 3300026089 | Ga0207648_10156982 | Ga0207648_101569821 | 236 |
| 680 | 3300026095 | Ga0207676_10261578 | Ga0207676_102615782 | 236 |
| 681 | 3300026095 | Ga0207676_10509274 | Ga0207676_105092742 | 236 |
| 682 | 3300026116 | Ga0207674_10614471 | Ga0207674_106144711 | 236 |
| 683 | 3300026118 | Ga0207675_100004512 | Ga0207675_1000045129 | 236 |
| 684 | 3300026118 | Ga0207675_100592497 | Ga0207675_1005924972 | 236 |
| 685 | 3300026121 | Ga0207683_10001309 | Ga0207683_1000130910 | 236 |
| 686 | 3300026121 | Ga0207683_10017976 | Ga0207683_100179764 | 236 |
| 687 | 3300026121 | Ga0207683_10749877 | Ga0207683_107498772 | 236 |
| 688 | 3300027907 | Ga0207428_10041400 | Ga0207428_100414002 | 236 |
| 689 | 3300028379 | Ga0268266_10007915 | Ga0268266_100079155 | 236 |
| 690 | 3300028379 | Ga0268266_10021881 | Ga0268266_100218812 | 236 |
| 691 | 3300028379 | Ga0268266_10055544 | Ga0268266_100555442 | 236 |
| 692 | 3300028379 | Ga0268266_10069556 | Ga0268266_100695562 | 236 |
| 693 | 3300028380 | Ga0268265_10000005 | Ga0268265_10000005452 | 236 |
| 694 | 3300028380 | Ga0268265_10047339 | Ga0268265_100473393 | 236 |
| 695 | 3300028380 | Ga0268265_10137513 | Ga0268265_101375132 | 236 |
| 696 | 3300028381 | Ga0268264_10000005 | Ga0268264_10000005160 | 236 |
| 697 | 3300028381 | Ga0268264_10005001 | Ga0268264_100050018 | 236 |
| 698 | 3300028381 | Ga0268264_10257260 | Ga0268264_102572601 | 236 |
| 699 | 3300028381 | Ga0268264_10425878 | Ga0268264_104258782 | 236 |
| 700 | 3300028666 | Ga0265336_10023226 | Ga0265336_100232262 | 236 |
| 701 | 3300028794 | Ga0307515_10049214 | Ga0307515_100492142 | 236 |
| 702 | 3300031251 | Ga0265327_10003360 | Ga0265327_100033604 | 236 |
| 703 | 3300031251 | Ga0265327_10007674 | Ga0265327_100076743 | 236 |
| 704 | 3300031456 | Ga0307513_10328386 | Ga0307513_103283861 | 236 |
| 705 | 3300031727 | Ga0316576_10038890 | Ga0316576_100388903 | 236 |
| 706 | 3300031727 | Ga0316576_10050442 | Ga0316576_100504424 | 236 |
| 707 | 3300031727 | Ga0316576_10089315 | Ga0316576_100893151 | 236 |
| 708 | 3300031728 | Ga0316578_10004340 | Ga0316578_100043402 | 236 |
| 709 | 3300031728 | Ga0316578_10310667 | Ga0316578_103106671 | 236 |
| 710 | 3300031824 | Ga0307413_10284024 | Ga0307413_102840242 | 236 |
| 711 | 3300031838 | Ga0307518_10004976 | Ga0307518_100049768 | 236 |
| 712 | 3300031901 | Ga0307406_10604970 | Ga0307406_106049701 | 236 |
| 713 | 3300031903 | Ga0307407_10278727 | Ga0307407_102787272 | 236 |
| 714 | 3300031995 | Ga0307409_100122099 | Ga0307409_1001220992 | 236 |
| 715 | 3300031995 | Ga0307409_100215620 | Ga0307409_1002156202 | 236 |
| 716 | 3300032002 | Ga0307416_100076770 | Ga0307416_1000767702 | 236 |
| 717 | 3300032002 | Ga0307416_100364835 | Ga0307416_1003648353 | 236 |
| 718 | 3300032004 | Ga0307414_10163103 | Ga0307414_101631032 | 236 |
| 719 | 3300032005 | Ga0307411_10645651 | Ga0307411_106456512 | 236 |
| 720 | 3300032126 | Ga0307415_100123955 | Ga0307415_1001239552 | 236 |
| 721 | 3300033179 | Ga0307507_10059312 | Ga0307507_100593123 | 236 |
| 722 | 3300033180 | Ga0307510_10062879 | Ga0307510_100628794 | 236 |
| 723 | 3300035084 | Ga0373928_0008232 | Ga0373928_0008232_337_1047 | 236 |
| 724 | 3300035085 | Ga0373929_0002852 | Ga0373929_0002852_2350_3069 | 236 |
| 725 | 3300035085 | Ga0373929_0039886 | Ga0373929_0039886_268_978 | 236 |
| 726 | 3300035112 | Ga0373932_0000149 | Ga0373932_0000149_12384_13103 | 236 |
| 727 | 3300035241 | Ga0373961_0074403 | Ga0373961_0074403_33_743 | 236 |
| 728 | 3300035398 | Ga0316574_0068231 | Ga0316574_0068231_258_989 | 236 |
| 729 | 3300035691 | Ga0373931_0000005 | Ga0373931_0000005_429191_429910 | 236 |
| 730 | 3300035691 | Ga0373931_0009617 | Ga0373931_0009617_2873_3583 | 236 |
| 731 | 3300035691 | Ga0373931_0084331 | Ga0373931_0084331_907_1617 | 236 |
| 732 | 3300035691 | Ga0373931_0254889 | Ga0373931_0254889_294_1004 | 236 |
| 733 | 3300035725 | Ga0373947_0157853 | Ga0373947_0157853_122_832 | 236 |
| 734 | 3300036401 | Ga0373937_0022133 | Ga0373937_0022133_3224_3964 | 236 |
| 735 | 3300036647 | Ga0316582_0028824 | Ga0316582_0028824_1342_2073 | 236 |
| 736 | 3300036712 | Ga0316584_0014998 | Ga0316584_0014998_203_919 | 236 |
| 737 | 3300036712 | Ga0316584_0020525 | Ga0316584_0020525_3131_3862 | 236 |
| 738 | 3300036712 | Ga0316584_0202556 | Ga0316584_0202556_698_1429 | 236 |
| 739 | 3300037068 | Ga0373925_0337512 | Ga0373925_0337512_242_952 | 236 |
| 740 | 3300037853 | Ga0436364_0376382 | Ga0436364_0376382_846_1592 | 236 |
| 741 | 3300037853 | Ga0436364_0627822 | Ga0436364_0627822_4871_5587 | 236 |
| 742 | 3300037853 | Ga0436364_0812123 | Ga0436364_0812123_228_944 | 236 |
| 743 | 3300037853 | Ga0436364_1330762 | Ga0436364_1330762_134_850 | 236 |
| 744 | 3300038443 | Ga0395901_0829400 | Ga0395901_0829400_30_740 | 236 |
| 745 | 3300039437 | Ga0436365_0530475 | Ga0436365_0530475_154_870 | 236 |
| 746 | 3300039437 | Ga0436365_1888780 | Ga0436365_1888780_13800_14516 | 236 |
| 747 | 3300039447 | Ga0436361_0376062 | Ga0436361_0376062_97_816 | 236 |
| 748 | 3300039450 | Ga0436363_0223575 | Ga0436363_0223575_538_1254 | 236 |
| 749 | 3300039450 | Ga0436363_0709713 | Ga0436363_0709713_410_1126 | 236 |
| 750 | 3300041410 | Ga0439461_0024936 | Ga0439461_0024936_264_977 | 236 |
| 751 | 3300041411 | Ga0439466_0020218 | Ga0439466_0020218_1105_1818 | 236 |
| 752 | 3300041413 | Ga0439465_0002227 | Ga0439465_0002227_1072_1785 | 236 |
| 753 | 3300041413 | Ga0439465_0002339 | Ga0439465_0002339_193_912 | 236 |
| 754 | 3300041413 | Ga0439465_0070137 | Ga0439465_0070137_381_1091 | 236 |
| 755 | 3300041486 | Ga0451807_2366488 | Ga0451807_2366488_27_749 | 236 |
| 756 | 3300042002 | Ga0439442_037188 | Ga0439442_037188_19_729 | 236 |
| 757 | 3300042004 | Ga0439445_0003083 | Ga0439445_0003083_2842_3555 | 236 |
| 758 | 3300042004 | Ga0439445_0093555 | Ga0439445_0093555_25_735 | 236 |
| 759 | 3300042005 | Ga0439448_0087574 | Ga0439448_0087574_198_911 | 236 |
| 760 | 3300042157 | Ga0439458_0089914 | Ga0439458_0089914_39_749 | 236 |
| 761 | 3300042876 | Ga0451577_0000984 | Ga0451577_0000984_38614_39330 | 236 |
| 762 | 3300044656 | Ga0466969_0117815 | Ga0466969_0117815_412_1122 | 236 |
| 763 | 3300044658 | Ga0466972_0002130 | Ga0466972_0002130_942_1655 | 236 |
| 764 | 3300044658 | Ga0466972_0015250 | Ga0466972_0015250_415_1152 | 236 |
| 765 | 3300044658 | Ga0466972_0024503 | Ga0466972_0024503_465_1175 | 236 |
| 766 | 3300044658 | Ga0466972_0097287 | Ga0466972_0097287_442_1152 | 236 |
| 767 | 3300044683 | Ga0466965_0008281 | Ga0466965_0008281_147_884 | 236 |
| 768 | 3300044683 | Ga0466965_0020332 | Ga0466965_0020332_2354_3064 | 236 |
| 769 | 3300044683 | Ga0466965_0029783 | Ga0466965_0029783_1120_1833 | 236 |
| 770 | 3300044693 | Ga0466961_0109927 | Ga0466961_0109927_461_1177 | 236 |
| 771 | 3300044693 | Ga0466961_0400133 | Ga0466961_0400133_85_795 | 236 |
| 772 | 3300044694 | Ga0466963_0362285 | Ga0466963_0362285_198_908 | 236 |
| 773 | 3300044712 | Ga0453684_0010613 | Ga0453684_0010613_7675_8391 | 236 |
| 774 | 3300044719 | Ga0466971_0087645 | Ga0466971_0087645_492_1202 | 236 |
| 775 | 3300044735 | Ga0466968_0018033 | Ga0466968_0018033_799_1512 | 236 |
| 776 | 3300044735 | Ga0466968_0223036 | Ga0466968_0223036_58_768 | 236 |
| 777 | 3300044765 | Ga0466970_0088771 | Ga0466970_0088771_934_1647 | 236 |
| 778 | 3300044765 | Ga0466970_0218293 | Ga0466970_0218293_131_847 | 236 |
| 779 | 3300044842 | Ga0466957_0004259 | Ga0466957_0004259_658_1371 | 236 |
| 780 | 3300044842 | Ga0466957_0122562 | Ga0466957_0122562_598_1314 | 236 |
| 781 | 3300044842 | Ga0466957_0216742 | Ga0466957_0216742_501_1211 | 236 |
| 782 | 3300044901 | Ga0466960_0000482 | Ga0466960_0000482_4490_5227 | 236 |
| 783 | 3300044901 | Ga0466960_0000689 | Ga0466960_0000689_2103_2816 | 236 |
| 784 | 3300044901 | Ga0466960_0021941 | Ga0466960_0021941_1616_2326 | 236 |
| 785 | 3300044901 | Ga0466960_0127999 | Ga0466960_0127999_88_798 | 236 |
| 786 | 3300044901 | Ga0466960_0128351 | Ga0466960_0128351_470_1180 | 236 |
| 787 | 3300044901 | Ga0466960_0167517 | Ga0466960_0167517_356_1072 | 236 |
| 788 | 3300045049 | Ga0466959_0004691 | Ga0466959_0004691_8414_9124 | 236 |
| 789 | 3300045049 | Ga0466959_0091764 | Ga0466959_0091764_798_1511 | 236 |
| 790 | 3300045051 | Ga0451576_0758626 | Ga0451576_0758626_161_877 | 236 |
| 791 | 3300045836 | Ga0466958_0005121 | Ga0466958_0005121_5221_5931 | 236 |
| 792 | 3300045836 | Ga0466958_0008266 | Ga0466958_0008266_4750_5466 | 236 |
| 793 | 3300045836 | Ga0466958_0130648 | Ga0466958_0130648_89_805 | 236 |
| 794 | 3300045836 | Ga0466958_0198345 | Ga0466958_0198345_470_1186 | 236 |
| 795 | 3300045976 | Ga0466967_0069194 | Ga0466967_0069194_1893_2621 | 236 |
| 796 | 3300045976 | Ga0466967_0592523 | Ga0466967_0592523_50_760 | 236 |
| 797 | 3300045976 | Ga0466967_0739844 | Ga0466967_0739844_198_920 | 236 |
| 798 | 3300046459 | Ga0495629_0004180 | Ga0495629_0004180_9928_10638 | 236 |
| 799 | 3300046461 | Ga0495641_0017750 | Ga0495641_0017750_1858_2568 | 236 |
| 800 | 3300046463 | Ga0495653_0227596 | Ga0495653_0227596_118_843 | 236 |
| 801 | 3300046524 | Ga0495648_0013467 | Ga0495648_0013467_80_805 | 236 |
| 802 | 3300046530 | Ga0495654_0045262 | Ga0495654_0045262_514_1239 | 236 |
| 803 | 3300046683 | Ga0495658_0003996 | Ga0495658_0003996_2470_3180 | 236 |
| 804 | 3300046690 | Ga0495624_0112641 | Ga0495624_0112641_118_828 | 236 |
| 805 | 3300046694 | Ga0495649_0231830 | Ga0495649_0231830_69_779 | 236 |
| 806 | 3300047319 | Ga0495674_0414921 | Ga0495674_0414921_211_921 | 236 |
| 807 | 3300047320 | Ga0495672_0002606 | Ga0495672_0002606_6739_7455 | 236 |
| 808 | 3300047320 | Ga0495672_0011184 | Ga0495672_0011184_529_1254 | 236 |
| 809 | 3300047320 | Ga0495672_0230903 | Ga0495672_0230903_84_800 | 236 |
| 810 | 3300047321 | Ga0495676_0453829 | Ga0495676_0453829_17_727 | 236 |
| 811 | 3300047322 | Ga0495680_0180509 | Ga0495680_0180509_625_1365 | 236 |
| 812 | 3300047469 | Ga0495673_0003826 | Ga0495673_0003826_1677_2402 | 236 |
| 813 | 3300047472 | Ga0495686_0001711 | Ga0495686_0001711_4244_4969 | 236 |
| 814 | 3300047673 | Ga0495593_0082906 | Ga0495593_0082906_332_1042 | 236 |
| 815 | 3300048091 | Ga0495626_0069970 | Ga0495626_0069970_739_1455 | 236 |
| 816 | 3300048903 | Ga0496100_0002422 | Ga0496100_0002422_2171_2884 | 236 |
| 817 | 3300048903 | Ga0496100_0003502 | Ga0496100_0003502_3863_4573 | 236 |
| 818 | 3300048903 | Ga0496100_0006840 | Ga0496100_0006840_4229_4954 | 236 |
| 819 | 3300048903 | Ga0496100_0067913 | Ga0496100_0067913_199_912 | 236 |
| 820 | 3300048903 | Ga0496100_0123595 | Ga0496100_0123595_158_883 | 236 |
| 821 | 3300048904 | Ga0496101_0000020 | Ga0496101_0000020_32604_33317 | 236 |
| 822 | 3300048904 | Ga0496101_0000047 | Ga0496101_0000047_56214_56939 | 236 |
| 823 | 3300048904 | Ga0496101_0003730 | Ga0496101_0003730_4245_4955 | 236 |
| 824 | 3300048904 | Ga0496101_0025795 | Ga0496101_0025795_1870_2595 | 236 |
| 825 | 3300048904 | Ga0496101_0100058 | Ga0496101_0100058_336_1049 | 236 |
| 826 | 3300048904 | Ga0496101_0239562 | Ga0496101_0239562_660_1370 | 236 |
| 827 | 3300048905 | Ga0496102_0000003 | Ga0496102_0000003_393347_394072 | 236 |
| 828 | 3300048905 | Ga0496102_0000050 | Ga0496102_0000050_95667_96392 | 236 |
| 829 | 3300048905 | Ga0496102_0004407 | Ga0496102_0004407_8145_8858 | 236 |
| 830 | 3300048905 | Ga0496102_0041387 | Ga0496102_0041387_515_1225 | 236 |
| 831 | 3300048905 | Ga0496102_0050426 | Ga0496102_0050426_2051_2761 | 236 |
| 832 | 3300048905 | Ga0496102_0131035 | Ga0496102_0131035_1121_1843 | 236 |
| 833 | 3300048905 | Ga0496102_0523255 | Ga0496102_0523255_32_742 | 236 |
| 834 | 3300048906 | Ga0496103_0000012 | Ga0496103_0000012_102859_103584 | 236 |
| 835 | 3300048906 | Ga0496103_0000831 | Ga0496103_0000831_3570_4295 | 236 |
| 836 | 3300048906 | Ga0496103_0001090 | Ga0496103_0001090_8775_9488 | 236 |
| 837 | 3300048906 | Ga0496103_0002661 | Ga0496103_0002661_3601_4311 | 236 |
| 838 | 3300048906 | Ga0496103_0150176 | Ga0496103_0150176_619_1329 | 236 |
| 839 | 3300048907 | Ga0496104_0040374 | Ga0496104_0040374_1069_1779 | 236 |
| 840 | 3300048907 | Ga0496104_0572024 | Ga0496104_0572024_98_823 | 236 |
| 841 | 3300048908 | Ga0496105_0019525 | Ga0496105_0019525_4694_5404 | 236 |
| 842 | 3300048908 | Ga0496105_0499753 | Ga0496105_0499753_50_760 | 236 |
| 843 | 3300048909 | Ga0496106_0001356 | Ga0496106_0001356_1302_2015 | 236 |
| 844 | 3300048909 | Ga0496106_0006678 | Ga0496106_0006678_4762_5472 | 236 |
| 845 | 3300048909 | Ga0496106_0012798 | Ga0496106_0012798_32_757 | 236 |
| 846 | 3300048909 | Ga0496106_0022520 | Ga0496106_0022520_622_1332 | 236 |
| 847 | 3300048909 | Ga0496106_0509002 | Ga0496106_0509002_100_813 | 236 |
| 848 | 3300048910 | Ga0496107_0004101 | Ga0496107_0004101_4648_5358 | 236 |
| 849 | 3300048910 | Ga0496107_0017352 | Ga0496107_0017352_1366_2079 | 236 |
| 850 | 3300048910 | Ga0496107_0086106 | Ga0496107_0086106_1433_2143 | 236 |
| 851 | 3300048910 | Ga0496107_0149666 | Ga0496107_0149666_708_1433 | 236 |
| 852 | 3300048910 | Ga0496107_0172107 | Ga0496107_0172107_253_978 | 236 |
| 853 | 3300048911 | Ga0496108_0001423 | Ga0496108_0001423_14142_14852 | 236 |
| 854 | 3300048911 | Ga0496108_0013592 | Ga0496108_0013592_4588_5298 | 236 |
| 855 | 3300048911 | Ga0496108_0033164 | Ga0496108_0033164_1943_2659 | 236 |
| 856 | 3300048911 | Ga0496108_0054383 | Ga0496108_0054383_1751_2464 | 236 |
| 857 | 3300048911 | Ga0496108_0279149 | Ga0496108_0279149_300_1025 | 236 |
| 858 | 3300048911 | Ga0496108_0849063 | Ga0496108_0849063_38_748 | 236 |
| 859 | 3300048912 | Ga0496109_0000104 | Ga0496109_0000104_76740_77453 | 236 |
| 860 | 3300048912 | Ga0496109_0015166 | Ga0496109_0015166_3600_4310 | 236 |
| 861 | 3300048912 | Ga0496109_0134769 | Ga0496109_0134769_556_1266 | 236 |
| 862 | 3300048912 | Ga0496109_0153597 | Ga0496109_0153597_989_1699 | 236 |
| 863 | 3300048912 | Ga0496109_0505214 | Ga0496109_0505214_392_1102 | 236 |
| 864 | 3300048913 | Ga0496110_0016323 | Ga0496110_0016323_1042_1752 | 236 |
| 865 | 3300048913 | Ga0496110_0029430 | Ga0496110_0029430_3441_4154 | 236 |
| 866 | 3300048913 | Ga0496110_0248476 | Ga0496110_0248476_106_828 | 236 |
| 867 | 3300048913 | Ga0496110_0491377 | Ga0496110_0491377_266_982 | 236 |
| 868 | 3300048913 | Ga0496110_0845403 | Ga0496110_0845403_69_779 | 236 |
| 869 | 3300048913 | Ga0496110_0919481 | Ga0496110_0919481_26_736 | 236 |
| 870 | 3300048914 | Ga0496111_0023404 | Ga0496111_0023404_542_1255 | 236 |
| 871 | 3300048914 | Ga0496111_0243824 | Ga0496111_0243824_444_1154 | 236 |
| 872 | 3300048915 | Ga0496112_0045499 | Ga0496112_0045499_1380_2093 | 236 |
| 873 | 3300048915 | Ga0496112_0172160 | Ga0496112_0172160_670_1380 | 236 |
| 874 | 3300048915 | Ga0496112_0331140 | Ga0496112_0331140_543_1253 | 236 |
| 875 | 3300048915 | Ga0496112_0385441 | Ga0496112_0385441_457_1167 | 236 |
| 876 | 3300048916 | Ga0496113_0003726 | Ga0496113_0003726_6575_7288 | 236 |
| 877 | 3300048916 | Ga0496113_0174560 | Ga0496113_0174560_409_1119 | 236 |
| 878 | 3300048916 | Ga0496113_0260399 | Ga0496113_0260399_543_1253 | 236 |
| 879 | 3300048916 | Ga0496113_0464450 | Ga0496113_0464450_145_855 | 236 |
| 880 | 3300048916 | Ga0496113_0521654 | Ga0496113_0521654_209_922 | 236 |
| 881 | 3300048917 | Ga0496114_0000793 | Ga0496114_0000793_19322_20035 | 236 |
| 882 | 3300048917 | Ga0496114_0006229 | Ga0496114_0006229_3815_4525 | 236 |
| 883 | 3300048917 | Ga0496114_0125026 | Ga0496114_0125026_1361_2071 | 236 |
| 884 | 3300048917 | Ga0496114_0259054 | Ga0496114_0259054_658_1380 | 236 |
| 885 | 3300048918 | Ga0496115_0013217 | Ga0496115_0013217_1603_2313 | 236 |
| 886 | 3300048918 | Ga0496115_0340559 | Ga0496115_0340559_121_831 | 236 |
| 887 | 3300048919 | Ga0496116_0000040 | Ga0496116_0000040_147987_148712 | 236 |
| 888 | 3300048919 | Ga0496116_0002883 | Ga0496116_0002883_12567_13280 | 236 |
| 889 | 3300048919 | Ga0496116_0065784 | Ga0496116_0065784_854_1579 | 236 |
| 890 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_198192_198917 | 236 |
| 891 | 3300048920 | Ga0496117_0000459 | Ga0496117_0000459_3015_3740 | 236 |
| 892 | 3300048920 | Ga0496117_0202713 | Ga0496117_0202713_210_923 | 236 |
| 893 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_198195_198920 | 236 |
| 894 | 3300048921 | Ga0496118_0003972 | Ga0496118_0003972_11462_12187 | 236 |
| 895 | 3300048921 | Ga0496118_0005190 | Ga0496118_0005190_1065_1778 | 236 |
| 896 | 3300048922 | Ga0496119_0000142 | Ga0496119_0000142_55329_56054 | 236 |
| 897 | 3300048922 | Ga0496119_0000357 | Ga0496119_0000357_21096_21809 | 236 |
| 898 | 3300048922 | Ga0496119_0004835 | Ga0496119_0004835_1367_2080 | 236 |
| 899 | 3300048922 | Ga0496119_0013089 | Ga0496119_0013089_3741_4466 | 236 |
| 900 | 3300048922 | Ga0496119_0013866 | Ga0496119_0013866_3085_3810 | 236 |
| 901 | 3300048922 | Ga0496119_0022264 | Ga0496119_0022264_351_1076 | 236 |
| 902 | 3300048922 | Ga0496119_0157093 | Ga0496119_0157093_74_787 | 236 |
| 903 | 3300048923 | Ga0496120_0000149 | Ga0496120_0000149_12906_13631 | 236 |
| 904 | 3300048923 | Ga0496120_0000230 | Ga0496120_0000230_80302_81015 | 236 |
| 905 | 3300048923 | Ga0496120_0027186 | Ga0496120_0027186_1395_2120 | 236 |
| 906 | 3300048923 | Ga0496120_0051991 | Ga0496120_0051991_1543_2256 | 236 |
| 907 | 3300048923 | Ga0496120_0092260 | Ga0496120_0092260_119_838 | 236 |
| 908 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_739128_739841 | 236 |
| 909 | 3300048924 | Ga0496121_0000019 | Ga0496121_0000019_402746_403471 | 236 |
| 910 | 3300048924 | Ga0496121_0038561 | Ga0496121_0038561_3005_3730 | 236 |
| 911 | 3300048925 | Ga0496122_0000078 | Ga0496122_0000078_78544_79257 | 236 |
| 912 | 3300048925 | Ga0496122_0009230 | Ga0496122_0009230_8239_8952 | 236 |
| 913 | 3300048926 | Ga0496123_0009351 | Ga0496123_0009351_6982_7695 | 236 |
| 914 | 3300048926 | Ga0496123_0021371 | Ga0496123_0021371_1028_1741 | 236 |
| 915 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_754748_755461 | 236 |
| 916 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_739128_739841 | 236 |
| 917 | 3300048929 | Ga0496126_0000009 | Ga0496126_0000009_10510_11223 | 236 |
| 918 | 3300048929 | Ga0496126_0000785 | Ga0496126_0000785_39818_40543 | 236 |
| 919 | 3300048929 | Ga0496126_0007337 | Ga0496126_0007337_6431_7156 | 236 |
| 920 | 3300048929 | Ga0496126_0022746 | Ga0496126_0022746_2521_3243 | 236 |
| 921 | 3300048929 | Ga0496126_0033616 | Ga0496126_0033616_2708_3421 | 236 |
| 922 | 3300049568 | Ga0501031_0021390 | Ga0501031_0021390_2683_3402 | 236 |
| 923 | 3300049568 | Ga0501031_0086164 | Ga0501031_0086164_859_1671 | 236 |
| 924 | 3300049568 | Ga0501031_0230615 | Ga0501031_0230615_364_1092 | 236 |
| 925 | 3300049569 | Ga0501032_0009961 | Ga0501032_0009961_5874_6602 | 236 |
| 926 | 3300049569 | Ga0501032_0084855 | Ga0501032_0084855_716_1429 | 236 |
| 927 | 3300049570 | Ga0501033_0003270 | Ga0501033_0003270_6479_7291 | 236 |
| 928 | 3300049571 | Ga0501034_0008438 | Ga0501034_0008438_9333_10046 | 236 |
| 929 | 3300049571 | Ga0501034_0112825 | Ga0501034_0112825_1739_2455 | 236 |
| 930 | 3300049571 | Ga0501034_0122475 | Ga0501034_0122475_743_1453 | 236 |
| 931 | 3300049571 | Ga0501034_0319159 | Ga0501034_0319159_719_1429 | 236 |
| 932 | 3300049571 | Ga0501034_0499811 | Ga0501034_0499811_56_796 | 236 |
| 933 | 3300049572 | Ga0501036_0014271 | Ga0501036_0014271_704_1423 | 236 |
| 934 | 3300049572 | Ga0501036_0034841 | Ga0501036_0034841_2048_2860 | 236 |
| 935 | 3300049572 | Ga0501036_0087476 | Ga0501036_0087476_521_1234 | 236 |
| 936 | 3300049572 | Ga0501036_0157668 | Ga0501036_0157668_1003_1731 | 236 |
| 937 | 3300049572 | Ga0501036_0264303 | Ga0501036_0264303_252_992 | 236 |
| 938 | 3300049572 | Ga0501036_0657786 | Ga0501036_0657786_18_737 | 236 |
| 939 | 3300049573 | Ga0501037_0003227 | Ga0501037_0003227_6088_6801 | 236 |
| 940 | 3300049573 | Ga0501037_0015365 | Ga0501037_0015365_294_1022 | 236 |
| 941 | 3300049573 | Ga0501037_0022637 | Ga0501037_0022637_2980_3792 | 236 |
| 942 | 3300049573 | Ga0501037_0348440 | Ga0501037_0348440_211_930 | 236 |
| 943 | 3300049574 | Ga0501038_0001047 | Ga0501038_0001047_23624_24337 | 236 |
| 944 | 3300049574 | Ga0501038_0004575 | Ga0501038_0004575_8217_9029 | 236 |
| 945 | 3300049574 | Ga0501038_0025858 | Ga0501038_0025858_174_902 | 236 |
| 946 | 3300049574 | Ga0501038_0100483 | Ga0501038_0100483_1008_1748 | 236 |
| 947 | 3300049574 | Ga0501038_0184883 | Ga0501038_0184883_238_957 | 236 |
| 948 | 3300049575 | Ga0501039_0002201 | Ga0501039_0002201_6897_7709 | 236 |
| 949 | 3300049575 | Ga0501039_0013791 | Ga0501039_0013791_2568_3281 | 236 |
| 950 | 3300049575 | Ga0501039_0018503 | Ga0501039_0018503_514_1233 | 236 |
| 951 | 3300049575 | Ga0501039_0022559 | Ga0501039_0022559_1552_2292 | 236 |
| 952 | 3300049575 | Ga0501039_0104330 | Ga0501039_0104330_546_1265 | 236 |
| 953 | 3300049576 | Ga0501040_0001028 | Ga0501040_0001028_10204_11016 | 236 |
| 954 | 3300049576 | Ga0501040_0010664 | Ga0501040_0010664_2993_3712 | 236 |
| 955 | 3300049576 | Ga0501040_0235571 | Ga0501040_0235571_72_791 | 236 |
| 956 | 3300049576 | Ga0501040_0275533 | Ga0501040_0275533_99_839 | 236 |
| 957 | 3300049577 | Ga0501041_0014439 | Ga0501041_0014439_143_955 | 236 |
| 958 | 3300049577 | Ga0501041_0053843 | Ga0501041_0053843_988_1728 | 236 |
| 959 | 3300049577 | Ga0501041_0064393 | Ga0501041_0064393_611_1330 | 236 |
| 960 | 3300049578 | Ga0501042_0001091 | Ga0501042_0001091_12170_12910 | 236 |
| 961 | 3300049578 | Ga0501042_0008175 | Ga0501042_0008175_4827_5546 | 236 |
| 962 | 3300049578 | Ga0501042_0059318 | Ga0501042_0059318_1143_1955 | 236 |
| 963 | 3300049579 | Ga0501043_0001283 | Ga0501043_0001283_11674_12387 | 236 |
| 964 | 3300049579 | Ga0501043_0085797 | Ga0501043_0085797_1148_1888 | 236 |
| 965 | 3300049580 | Ga0501046_0011417 | Ga0501046_0011417_892_1704 | 236 |
| 966 | 3300049580 | Ga0501046_0037849 | Ga0501046_0037849_731_1471 | 236 |
| 967 | 3300049580 | Ga0501046_0120515 | Ga0501046_0120515_67_786 | 236 |
| 968 | 3300049581 | Ga0501047_0018956 | Ga0501047_0018956_475_1200 | 236 |
| 969 | 3300049582 | Ga0501048_0007016 | Ga0501048_0007016_6391_7203 | 236 |
| 970 | 3300049582 | Ga0501048_0016487 | Ga0501048_0016487_1157_1876 | 236 |
| 971 | 3300049582 | Ga0501048_0091267 | Ga0501048_0091267_803_1522 | 236 |
| 972 | 3300049582 | Ga0501048_0119456 | Ga0501048_0119456_92_832 | 236 |
| 973 | 3300049584 | Ga0501068_0005418 | Ga0501068_0005418_3830_4546 | 236 |
| 974 | 3300049584 | Ga0501068_0047961 | Ga0501068_0047961_1730_2443 | 236 |
| 975 | 3300049584 | Ga0501068_0113270 | Ga0501068_0113270_639_1451 | 236 |
| 976 | 3300049584 | Ga0501068_0259259 | Ga0501068_0259259_370_1089 | 236 |
| 977 | 3300049584 | Ga0501068_0422822 | Ga0501068_0422822_43_783 | 236 |
| 978 | 3300049585 | Ga0501069_0013269 | Ga0501069_0013269_48_773 | 236 |
| 979 | 3300049586 | Ga0501070_0032913 | Ga0501070_0032913_409_1137 | 236 |
| 980 | 3300049586 | Ga0501070_0041793 | Ga0501070_0041793_1858_2598 | 236 |
| 981 | 3300049586 | Ga0501070_0099905 | Ga0501070_0099905_1195_1917 | 236 |
| 982 | 3300049586 | Ga0501070_0109387 | Ga0501070_0109387_705_1415 | 236 |
| 983 | 3300049586 | Ga0501070_0114448 | Ga0501070_0114448_1293_2006 | 236 |
| 984 | 3300049586 | Ga0501070_0703086 | Ga0501070_0703086_62_787 | 236 |
| 985 | 3300049587 | Ga0501071_0021003 | Ga0501071_0021003_1574_2314 | 236 |
| 986 | 3300049587 | Ga0501071_0040463 | Ga0501071_0040463_39_851 | 236 |
| 987 | 3300049587 | Ga0501071_0082547 | Ga0501071_0082547_1093_1812 | 236 |
| 988 | 3300049588 | Ga0501072_0003265 | Ga0501072_0003265_2186_2998 | 236 |
| 989 | 3300049588 | Ga0501072_0008699 | Ga0501072_0008699_1825_2544 | 236 |
| 990 | 3300049588 | Ga0501072_0124912 | Ga0501072_0124912_842_1561 | 236 |
| 991 | 3300049588 | Ga0501072_0159627 | Ga0501072_0159627_202_942 | 236 |
| 992 | 3300049588 | Ga0501072_0276087 | Ga0501072_0276087_132_851 | 236 |
| 993 | 3300049589 | Ga0501073_0107172 | Ga0501073_0107172_83_895 | 236 |
| 994 | 3300049589 | Ga0501073_0392660 | Ga0501073_0392660_143_859 | 236 |
| 995 | 3300049590 | Ga0501074_0039729 | Ga0501074_0039729_1485_2225 | 236 |
| 996 | 3300049591 | Ga0501075_0004110 | Ga0501075_0004110_6218_6937 | 236 |
| 997 | 3300049591 | Ga0501075_0012579 | Ga0501075_0012579_54_866 | 236 |
| 998 | 3300049591 | Ga0501075_0015241 | Ga0501075_0015241_2884_3624 | 236 |
| 999 | 3300049591 | Ga0501075_0064908 | Ga0501075_0064908_383_1102 | 236 |
| 1000 | 3300049592 | Ga0501076_0021127 | Ga0501076_0021127_891_1703 | 236 |
| 1001 | 3300049593 | Ga0501077_0000891 | Ga0501077_0000891_8979_9791 | 236 |
| 1002 | 3300049593 | Ga0501077_0021822 | Ga0501077_0021822_3080_3820 | 236 |
| 1003 | 3300049741 | Ga0501079_0006243 | Ga0501079_0006243_5738_6550 | 236 |
| 1004 | 3300049741 | Ga0501079_0032459 | Ga0501079_0032459_2017_2736 | 236 |
| 1005 | 3300049741 | Ga0501079_0033822 | Ga0501079_0033822_2505_3245 | 236 |
| 1006 | 3300049741 | Ga0501079_0365003 | Ga0501079_0365003_375_1094 | 236 |
| 1007 | 3300049742 | Ga0501080_0027388 | Ga0501080_0027388_4238_4966 | 236 |
| 1008 | 3300049743 | Ga0501081_0003048 | Ga0501081_0003048_2231_3043 | 236 |
| 1009 | 3300049743 | Ga0501081_0191167 | Ga0501081_0191167_390_1130 | 236 |
| 1010 | 3300049743 | Ga0501081_0211415 | Ga0501081_0211415_638_1354 | 236 |
| 1011 | 3300049822 | Ga0501035_0042300 | Ga0501035_0042300_787_1599 | 236 |
| 1012 | 3300049822 | Ga0501035_0215134 | Ga0501035_0215134_547_1275 | 236 |
| 1013 | 3300049823 | Ga0501044_0005129 | Ga0501044_0005129_327_1055 | 236 |
| 1014 | 3300049823 | Ga0501044_0022781 | Ga0501044_0022781_5634_6347 | 236 |
| 1015 | 3300049824 | Ga0501045_0001848 | Ga0501045_0001848_6671_7483 | 236 |
| 1016 | 3300049824 | Ga0501045_0010139 | Ga0501045_0010139_1055_1795 | 236 |
| 1017 | 3300049824 | Ga0501045_0025670 | Ga0501045_0025670_950_1669 | 236 |
| 1018 | 3300049824 | Ga0501045_0049608 | Ga0501045_0049608_1878_2597 | 236 |
| 1019 | 3300050489 | nmdc:mga03683_207115_c1 | nmdc:mga03683_207115_c1_92_802 | 236 |
| 1020 | 3300050489 | nmdc:mga03683_86628_c1 | nmdc:mga03683_86628_c1_34_744 | 236 |
| 1021 | 3300050490 | nmdc:mga03n38_118809_c1 | nmdc:mga03n38_118809_c1_467_1204 | 236 |
| 1022 | 3300050490 | nmdc:mga03n38_19183_c1 | nmdc:mga03n38_19183_c1_790_1500 | 236 |
| 1023 | 3300050490 | nmdc:mga03n38_210370_c1 | nmdc:mga03n38_210370_c1_204_914 | 236 |
| 1024 | 3300050490 | nmdc:mga03n38_325_c1 | nmdc:mga03n38_325_c1_3532_4248 | 236 |
| 1025 | 3300050490 | nmdc:mga03n38_36014_c1 | nmdc:mga03n38_36014_c1_291_1001 | 236 |
| 1026 | 3300050490 | nmdc:mga03n38_42755_c1 | nmdc:mga03n38_42755_c1_1240_1959 | 236 |
| 1027 | 3300050490 | nmdc:mga03n38_72887_c1 | nmdc:mga03n38_72887_c1_809_1519 | 236 |
| 1028 | 3300050490 | nmdc:mga03n38_83167_c1 | nmdc:mga03n38_83167_c1_330_1040 | 236 |
| 1029 | 3300050491 | nmdc:mga00v17_139468_c1 | nmdc:mga00v17_139468_c1_524_1243 | 236 |
| 1030 | 3300050491 | nmdc:mga00v17_158309_c1 | nmdc:mga00v17_158309_c1_198_908 | 236 |
| 1031 | 3300050491 | nmdc:mga00v17_165945_c1 | nmdc:mga00v17_165945_c1_330_1049 | 236 |
| 1032 | 3300050491 | nmdc:mga00v17_177789_c1 | nmdc:mga00v17_177789_c1_283_993 | 236 |
| 1033 | 3300050491 | nmdc:mga00v17_248675_c1 | nmdc:mga00v17_248675_c1_428_1138 | 236 |
| 1034 | 3300050491 | nmdc:mga00v17_2691_c1 | nmdc:mga00v17_2691_c1_7487_8203 | 236 |
| 1035 | 3300050491 | nmdc:mga00v17_335633_c1 | nmdc:mga00v17_335633_c1_180_893 | 236 |
| 1036 | 3300050491 | nmdc:mga00v17_34630_c1 | nmdc:mga00v17_34630_c1_334_1071 | 236 |
| 1037 | 3300050491 | nmdc:mga00v17_352591_c1 | nmdc:mga00v17_352591_c1_179_898 | 236 |
| 1038 | 3300050491 | nmdc:mga00v17_3888_c1 | nmdc:mga00v17_3888_c1_6091_6831 | 236 |
| 1039 | 3300050491 | nmdc:mga00v17_422191_c1 | nmdc:mga00v17_422191_c1_146_856 | 236 |
| 1040 | 3300050491 | nmdc:mga00v17_55294_c1 | nmdc:mga00v17_55294_c1_17_727 | 236 |
| 1041 | 3300050491 | nmdc:mga00v17_65643_c1 | nmdc:mga00v17_65643_c1_407_1123 | 236 |
| 1042 | 3300050491 | nmdc:mga00v17_8065_c1 | nmdc:mga00v17_8065_c1_344_1054 | 236 |
| 1043 | 3300050491 | nmdc:mga00v17_88356_c1 | nmdc:mga00v17_88356_c1_689_1405 | 236 |
| 1044 | 3300050492 | nmdc:mga0yw44_107028_c2 | nmdc:mga0yw44_107028_c2_208_918 | 236 |
| 1045 | 3300050492 | nmdc:mga0yw44_1794_c1 | nmdc:mga0yw44_1794_c1_547_1266 | 236 |
| 1046 | 3300050492 | nmdc:mga0yw44_24071_c1 | nmdc:mga0yw44_24071_c1_145_891 | 236 |
| 1047 | 3300050492 | nmdc:mga0yw44_24549_c1 | nmdc:mga0yw44_24549_c1_2550_3266 | 236 |
| 1048 | 3300050492 | nmdc:mga0yw44_385743_c1 | nmdc:mga0yw44_385743_c1_206_916 | 236 |
| 1049 | 3300050492 | nmdc:mga0yw44_418992_c1 | nmdc:mga0yw44_418992_c1_14_733 | 236 |
| 1050 | 3300050494 | nmdc:mga06z11_163148_c1 | nmdc:mga06z11_163148_c1_99_809 | 236 |
| 1051 | 3300050494 | nmdc:mga06z11_193207_c1 | nmdc:mga06z11_193207_c1_11_721 | 236 |
| 1052 | 3300050494 | nmdc:mga06z11_341926_c1 | nmdc:mga06z11_341926_c1_22_738 | 236 |
| 1053 | 3300050494 | nmdc:mga06z11_500455_c1 | nmdc:mga06z11_500455_c1_16_726 | 236 |
| 1054 | 3300050495 | nmdc:mga04h51_96980_c1 | nmdc:mga04h51_96980_c1_221_958 | 236 |
| 1055 | 3300050496 | nmdc:mga07m45_189458_c1 | nmdc:mga07m45_189458_c1_77_817 | 236 |
| 1056 | 3300050496 | nmdc:mga07m45_218123_c1 | nmdc:mga07m45_218123_c1_215_925 | 236 |
| 1057 | 3300050496 | nmdc:mga07m45_238021_c1 | nmdc:mga07m45_238021_c1_21_917 | 236 |
| 1058 | 3300050496 | nmdc:mga07m45_52756_c1 | nmdc:mga07m45_52756_c1_1327_2064 | 236 |
| 1059 | 3300050496 | nmdc:mga07m45_9664_c1 | nmdc:mga07m45_9664_c1_121_837 | 236 |
| 1060 | 3300050507 | nmdc:mga05p37_14137_c1 | nmdc:mga05p37_14137_c1_4828_5538 | 236 |
| 1061 | 3300050507 | nmdc:mga05p37_99626_c1 | nmdc:mga05p37_99626_c1_569_1300 | 236 |
| 1062 | 3300050508 | nmdc:mga09592_178633_c1 | nmdc:mga09592_178633_c1_671_1468 | 236 |
| 1063 | 3300050508 | nmdc:mga09592_57199_c1 | nmdc:mga09592_57199_c1_1824_2555 | 236 |
| 1064 | 3300050509 | nmdc:mga0qj67_10130_c1 | nmdc:mga0qj67_10130_c1_5171_5881 | 236 |
| 1065 | 3300050509 | nmdc:mga0qj67_250671_c1 | nmdc:mga0qj67_250671_c1_558_1289 | 236 |
| 1066 | 3300050509 | nmdc:mga0qj67_59404_c1 | nmdc:mga0qj67_59404_c1_1023_1820 | 236 |
| 1067 | 3300050510 | nmdc:mga06r32_24409_c1 | nmdc:mga06r32_24409_c1_3966_4763 | 236 |
| 1068 | 3300050510 | nmdc:mga06r32_452881_c1 | nmdc:mga06r32_452881_c1_153_863 | 236 |
| 1069 | 3300050510 | nmdc:mga06r32_99237_c1 | nmdc:mga06r32_99237_c1_21_752 | 236 |
| 1070 | 3300050511 | nmdc:mga08y16_149844_c1 | nmdc:mga08y16_149844_c1_94_813 | 236 |
| 1071 | 3300050511 | nmdc:mga08y16_51066_c1 | nmdc:mga08y16_51066_c1_763_1503 | 236 |
| 1072 | 3300050516 | nmdc:mga0sz30_16094_c2 | nmdc:mga0sz30_16094_c2_228_947 | 236 |
| 1073 | 3300050516 | nmdc:mga0sz30_2056_c1 | nmdc:mga0sz30_2056_c1_3414_4130 | 236 |
| 1074 | 3300050516 | nmdc:mga0sz30_20615_c2 | nmdc:mga0sz30_20615_c2_1383_2093 | 236 |
| 1075 | 3300050516 | nmdc:mga0sz30_28900_c1 | nmdc:mga0sz30_28900_c1_912_1622 | 236 |
| 1076 | 3300050516 | nmdc:mga0sz30_776_c1 | nmdc:mga0sz30_776_c1_6130_6840 | 236 |
| 1077 | 3300053080 | Ga0500635_0003906 | Ga0500635_0003906_1631_2356 | 236 |
| 1078 | 3300053131 | Ga0500652_000964 | Ga0500652_000964_2442_3167 | 236 |
| 1079 | 3300053153 | Ga0500616_0029359 | Ga0500616_0029359_1171_1896 | 236 |
| 1080 | 3300054114 | Ga0501084_0001967 | Ga0501084_0001967_6299_7111 | 236 |
| 1081 | 3300054114 | Ga0501084_0018562 | Ga0501084_0018562_1089_1808 | 236 |
| 1082 | 3300054114 | Ga0501084_0072851 | Ga0501084_0072851_468_1187 | 236 |
| 1083 | 3300054114 | Ga0501084_0124642 | Ga0501084_0124642_779_1519 | 236 |
| 1084 | 3300060353 | Ga0501082_0008758 | Ga0501082_0008758_1078_1890 | 236 |
| 1085 | 3300060353 | Ga0501082_0035405 | Ga0501082_0035405_400_1119 | 236 |
| 1086 | 3300060353 | Ga0501082_0224402 | Ga0501082_0224402_604_1323 | 236 |
| 1087 | 3300061719 | Ga0466962_0007543 | Ga0466962_0007543_3578_4288 | 236 |
| 1088 | 3300061734 | Ga0530510_0001967 | Ga0530510_0001967_1421_2233 | 236 |
| 1089 | 3300061734 | Ga0530510_0026019 | Ga0530510_0026019_3156_3896 | 236 |
| 1090 | 3300061734 | Ga0530510_0068608 | Ga0530510_0068608_1086_1805 | 236 |
| 1091 | iso_pu_bacteria | 2939582691 | 2939586763 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ysb-assembly1.cif.gz_B | crystal structure of ethe1 from myxococcus xanthus | 0.9108 | 5 | 234 |
| 5ve4-assembly1.cif.gz_A | crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans | 0.8635 | 5 | 234 |
| 8ewo-assembly2.cif.gz_B | crystal structure of putative glyoxylase ii from pseudomonas aeruginosa | 0.8628 | 27 | 203 |
| 2gcu-assembly2.cif.gz_D | x-ray structure of gene product from arabidopsis thaliana at1g53580 | 0.8609 | 3 | 234 |
| 5ve3-assembly2.cif.gz_A | crystal structure of wild-type persulfide dioxygenase-rhodanese fusion protein from burkholderia phytofirmans | 0.8562 | 4 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y4A5_15_234_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9999 | 13 | 231 | 3.60.15.10 |
| af_I6Y4A5_15_234_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9909 | 13 | 231 | 3.60.15.10 |
| af_Q86PD3_43_273_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9086 | 1 | 234 | 3.60.15.10 |
| af_O53534_19_208_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8769 | 25 | 213 | 3.60.15.10 |
| af_Q8N490_119_385_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8735 | 27 | 203 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1A1XH31-F1-model_v4 | deleted | 1.001 | 3 | 235 |
|
| AF-A0A7I7MTX2-F1-model_v4 | Glyoxalase II | 1.001 | 2 | 235 |
GO:0016787
|
| AF-A0A1A3PDE8-F1-model_v4 | MBL fold metallo-hydrolase | 1.001 | 2 | 202 |
GO:0016787
|
| AF-A0A4Q7QFP2-F1-model_v4 | deleted | 0.9986 | 1 | 235 |
|
| AF-X8FGR9-F1-model_v4 | deleted | 0.9984 | 69 | 235 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar