F489944

General Info

Members Datasets Scaffolds Average Seq Length
1094 460 2188 177

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1253719|Ga0436360_1253719_149_751
Length 200
Sequence MGGAELGAERLFIGAPFKMSRIGKLPVAVPSGVNVTVEGDEVAVKGPKGELRRRVLEHVGVALEGGKVVVHRKGEAKQHRAAHGLTRTLVNNMIEGVSKGFRKSLEIQGVGYRAAKSGEKVNLTLGFSHPVSYEPPKGITLSVEGTNKIHVDGIDKQQVGQVAAEIRNLRPPEPYKGKGVRYEGEVVRKKLGKAXXXXKK

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
184 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
188 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
189 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
210 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
213 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
214 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
228 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
229 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
230 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
246 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
261 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
262 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
263 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
264 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
274 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
275 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
300 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
304 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
305 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
313 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
318 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
338 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
339 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
340 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
341 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
354 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
355 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
392 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
395 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
415 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
416 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
417 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
420 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
421 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
422 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
423 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
424 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
425 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
426 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
427 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
428 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
429 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
430 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
431 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
432 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
433 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
434 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
435 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
436 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
437 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
452 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
453 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
454 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
455 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
456 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
457 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
458 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
459 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
460 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.3
Metatranscriptomes 11.06
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 2.93
Rhizosphere 83.82
Stem 0
Stem Tuber 0
Unclassified 3.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_1253719 3300039438 Bacteria 808
2 LJQas_1011332 3300000549 Bacteria 1060
3 LJQas_1020987 3300000549 Bacteria 759
4 JGI24740J21852_10032375 3300001979 Bacteria 1672
5 JGI24739J22299_10020519 3300001989 Bacteria 2360
6 JGI24739J22299_10065933 3300001989 Bacteria 1135
7 JGI24737J22298_10058404 3300001990 Bacteria 1163
8 JGI24735J21928_10006549 3300002067 Bacteria 3829
9 JGI24745J21846_1000243 3300002073 Bacteria 4512
10 JGI25406J46586_10045823 3300003203 Unclassified 1502
11 Ga0006758J48902_1015144 3300003300 Bacteria 3291
12 rootH1_10017476 3300003316 Bacteria 1140
13 JGI26145J50221_1015996 3300003371 Unclassified 697
14 JGI25407J50210_10003808 3300003373 Bacteria 3646
15 Ga0058859_11666848 3300004798 Bacteria 6681
16 Ga0058863_10081680 3300004799 Bacteria 8733
17 Ga0058861_10081153 3300004800 Bacteria 10561
18 Ga0058860_11519682 3300004801 Unclassified 729
19 Ga0058862_10176130 3300004803 Bacteria 9071
20 Ga0065704_10013929 3300005289 Bacteria 2358
21 Ga0065704_10310477 3300005289 Bacteria 869
22 Ga0065707_10260152 3300005295 Bacteria 1099
23 Ga0070658_10002426 3300005327 Bacteria 15603
24 Ga0070658_10013418 3300005327 Bacteria 6575
25 Ga0070676_10062744 3300005328 Bacteria 2212
26 Ga0070683_100472532 3300005329 Bacteria 1197
27 Ga0070683_101326184 3300005329 Bacteria 692
28 Ga0070690_100194556 3300005330 Bacteria 1408
29 Ga0070670_100311522 3300005331 Bacteria 1378
30 Ga0070670_100633112 3300005331 Bacteria 959
31 Ga0070677_10112211 3300005333 Bacteria 1219
32 Ga0070680_100005522 3300005336 Bacteria 9570
33 Ga0070680_100301110 3300005336 Bacteria 1360
34 Ga0070682_100108095 3300005337 Bacteria 1849
35 Ga0070682_100456173 3300005337 Bacteria 980
36 Ga0068868_100130012 3300005338 Bacteria 2060
37 Ga0070691_10039056 3300005341 Bacteria 2242
38 Ga0070661_100304631 3300005344 Bacteria 1241
39 Ga0070669_101252117 3300005353 Bacteria 642
40 Ga0070675_100088085 3300005354 Bacteria 2597
41 Ga0070675_100623657 3300005354 Bacteria 979
42 Ga0070671_100069289 3300005355 Bacteria 2942
43 Ga0070671_100434575 3300005355 Bacteria 1125
44 Ga0070674_101370206 3300005356 Bacteria 632
45 Ga0070673_100050123 3300005364 Bacteria 3263
46 Ga0070673_100346530 3300005364 Bacteria 1317
47 Ga0070659_100553766 3300005366 Bacteria 985
48 Ga0070659_101594074 3300005366 Bacteria 583
49 Ga0070667_100001546 3300005367 Bacteria 20614
50 Ga0070667_100689172 3300005367 Bacteria 945
51 Ga0070714_100000519 3300005435 Bacteria 27946
52 Ga0070714_100010979 3300005435 Bacteria 7174
53 Ga0070714_100038902 3300005435 Bacteria 4002
54 Ga0070714_100073187 3300005435 Bacteria 2968
55 Ga0070714_100451565 3300005435 Bacteria 1221
56 Ga0070714_100786193 3300005435 Unclassified 921
57 Ga0070713_100786707 3300005436 Bacteria 912
58 Ga0070705_100012015 3300005440 Bacteria 4386
59 Ga0070708_100079869 3300005445 Bacteria 2960
60 Ga0070708_100414719 3300005445 Bacteria 1270
61 Ga0070708_100877106 3300005445 Bacteria 843
62 Ga0070663_100416023 3300005455 Bacteria 1102
63 Ga0070681_10005386 3300005458 Bacteria 12351
64 Ga0070681_10181889 3300005458 Bacteria 2023
65 Ga0070681_10249530 3300005458 Bacteria 1688
66 Ga0070681_10283665 3300005458 Bacteria 1567
67 Ga0070706_100005771 3300005467 Bacteria 11760
68 Ga0070706_100021749 3300005467 Bacteria 5905
69 Ga0070706_100060798 3300005467 Bacteria 3487
70 Ga0070706_100086360 3300005467 Bacteria 2907
71 Ga0070706_100094015 3300005467 Bacteria 2782
72 Ga0070706_100469667 3300005467 Bacteria 1170
73 Ga0070707_100006596 3300005468 Bacteria 10769
74 Ga0070707_100260424 3300005468 Bacteria 1687
75 Ga0070707_100367917 3300005468 Bacteria 1397
76 Ga0070707_100919066 3300005468 Unclassified 840
77 Ga0070698_100039505 3300005471 Bacteria 4857
78 Ga0070698_100064533 3300005471 Bacteria 3689
79 Ga0070698_100092897 3300005471 Bacteria 2998
80 Ga0070699_100102795 3300005518 Bacteria 2505
81 Ga0070679_100009896 3300005530 Bacteria 9022
82 Ga0070679_100035803 3300005530 Bacteria 4924
83 Ga0070679_100052255 3300005530 Bacteria 4071
84 Ga0070679_100422203 3300005530 Bacteria 1279
85 Ga0070679_101110144 3300005530 Bacteria 736
86 Ga0070679_101162550 3300005530 Bacteria 717
87 Ga0070684_100080553 3300005535 Bacteria 2880
88 Ga0070684_100518353 3300005535 Bacteria 1105
89 Ga0070684_100866514 3300005535 Bacteria 846
90 Ga0070684_101014956 3300005535 Bacteria 779
91 Ga0070684_101152728 3300005535 Bacteria 729
92 Ga0070684_101366149 3300005535 Unclassified 667
93 Ga0070697_100002003 3300005536 Bacteria 15614
94 Ga0070697_100051727 3300005536 Bacteria 3338
95 Ga0070697_100112708 3300005536 Bacteria 2269
96 Ga0068853_100021204 3300005539 Bacteria 5412
97 Ga0068853_100171689 3300005539 Bacteria 1962
98 Ga0068853_100242720 3300005539 Bacteria 1652
99 Ga0068853_100320550 3300005539 Bacteria 1437
100 Ga0070672_100029248 3300005543 Bacteria 4131
101 Ga0070695_100042259 3300005545 Bacteria 2893
102 Ga0070695_100739244 3300005545 Bacteria 784
103 Ga0070696_100027888 3300005546 Bacteria 3851
104 Ga0070696_101019814 3300005546 Bacteria 692
105 Ga0070704_100080301 3300005549 Bacteria 2398
106 Ga0068855_100011055 3300005563 Bacteria 10891
107 Ga0068855_100044376 3300005563 Bacteria 5261
108 Ga0070664_100819856 3300005564 Bacteria 871
109 Ga0068854_100000039 3300005578 Bacteria 94407
110 Ga0068854_100400572 3300005578 Bacteria 1136
111 Ga0068854_100566774 3300005578 Bacteria 965
112 Ga0068856_100002334 3300005614 Bacteria 19517
113 Ga0068856_100004352 3300005614 Bacteria 14113
114 Ga0068856_100414606 3300005614 Bacteria 1367
115 Ga0068852_100112440 3300005616 Bacteria 2478
116 Ga0068852_100126825 3300005616 Bacteria 2345
117 Ga0068852_100126863 3300005616 Bacteria 2345
118 Ga0068852_100148325 3300005616 Bacteria 2178
119 Ga0068852_101100491 3300005616 Bacteria 815
120 Ga0068864_100005865 3300005618 Bacteria 10062
121 Ga0068864_100466379 3300005618 Bacteria 1210
122 Ga0068864_100987440 3300005618 Bacteria 835
123 Ga0068861_100759110 3300005719 Bacteria 907
124 Ga0068863_100001338 3300005841 Bacteria 24526
125 Ga0068863_100016860 3300005841 Bacteria 7006
126 Ga0068863_100388856 3300005841 Bacteria 1363
127 Ga0068863_100449272 3300005841 Bacteria 1265
128 Ga0068863_101758844 3300005841 Bacteria 630
129 Ga0068860_100439747 3300005843 Bacteria 1295
130 Ga0068860_100448021 3300005843 Bacteria 1283
131 Ga0068860_100579261 3300005843 Unclassified 1126
132 Ga0068862_100000836 3300005844 Bacteria 30459
133 Ga0068862_100201289 3300005844 Bacteria 1796
134 Ga0068862_101119795 3300005844 Bacteria 783
135 Ga0081455_10009428 3300005937 Bacteria 10043
136 Ga0081455_10090574 3300005937 Bacteria 2479
137 Ga0081455_10118573 3300005937 Bacteria 2089
138 Ga0081539_10001876 3300005985 Bacteria 32944
139 Ga0081539_10002696 3300005985 Bacteria 24099
140 Ga0081539_10030228 3300005985 Bacteria 3367
141 Ga0081539_10113538 3300005985 Bacteria 1359
142 Ga0070717_10029749 3300006028 Bacteria 4385
143 Ga0075365_10000022 3300006038 Bacteria 64465
144 Ga0075365_10069816 3300006038 Bacteria 2362
145 Ga0075365_10089848 3300006038 Bacteria 2091
146 Ga0075365_10188819 3300006038 Bacteria 1442
147 Ga0075365_10447267 3300006038 Bacteria 912
148 Ga0075365_10497871 3300006038 Bacteria 861
149 Ga0075368_10048857 3300006042 Bacteria 1677
150 Ga0075368_10266116 3300006042 Bacteria 735
151 Ga0075363_100033980 3300006048 Bacteria 2660
152 Ga0075363_100080865 3300006048 Bacteria 1777
153 Ga0075363_100105724 3300006048 Bacteria 1561
154 Ga0075364_10000985 3300006051 Bacteria 15065
155 Ga0075364_10194889 3300006051 Bacteria 1372
156 Ga0075362_10239657 3300006177 Bacteria 890
157 Ga0075367_10030754 3300006178 Bacteria 3080
158 Ga0075367_10464222 3300006178 Bacteria 803
159 Ga0075369_10168099 3300006186 Unclassified 1006
160 Ga0075427_10000259 3300006194 Bacteria 5679
161 Ga0075366_10528685 3300006195 Unclassified 730
162 Ga0097621_100000003 3300006237 Bacteria 164830
163 Ga0097621_100158295 3300006237 Bacteria 1945
164 Ga0068871_100000013 3300006358 Bacteria 102533
165 Ga0068871_100713511 3300006358 Bacteria 919
166 Ga0068871_101009764 3300006358 Unclassified 775
167 Ga0068871_101353779 3300006358 Bacteria 670
168 Ga0075428_100093456 3300006844 Bacteria 3279
169 Ga0075428_100145249 3300006844 Bacteria 2578
170 Ga0075428_101079417 3300006844 Unclassified 848
171 Ga0075430_100221438 3300006846 Bacteria 1570
172 Ga0075430_100277403 3300006846 Bacteria 1387
173 Ga0075430_100370297 3300006846 Bacteria 1183
174 Ga0075431_100003767 3300006847 Bacteria 14739
175 Ga0075429_100029758 3300006880 Bacteria 4744
176 Ga0075436_100082948 3300006914 Bacteria 2224
177 Ga0097620_100027915 3300006931 Bacteria 5659
178 Ga0105244_10338770 3300009036 Bacteria 693
179 Ga0105240_10132772 3300009093 Bacteria 2984
180 Ga0105240_10168667 3300009093 Bacteria 2594
181 Ga0105240_10258457 3300009093 Bacteria 2010
182 Ga0105240_10746933 3300009093 Bacteria 1064
183 Ga0105240_11917813 3300009093 Bacteria 616
184 Ga0105245_10016124 3300009098 Bacteria 6511
185 Ga0105245_10022092 3300009098 Bacteria 5586
186 Ga0105245_10232985 3300009098 Bacteria 1782
187 Ga0105245_10284933 3300009098 Bacteria 1616
188 Ga0105245_10635929 3300009098 Bacteria 1096
189 Ga0105247_10166279 3300009101 Bacteria 1464
190 Ga0114129_10031086 3300009147 Bacteria 7552
191 Ga0114129_11472071 3300009147 Bacteria 838
192 Ga0105243_11575488 3300009148 Bacteria 683
193 Ga0105241_10001993 3300009174 Bacteria 15454
194 Ga0105241_10142001 3300009174 Bacteria 1956
195 Ga0105241_10152358 3300009174 Bacteria 1892
196 Ga0105241_10502991 3300009174 Bacteria 1081
197 Ga0105241_10731442 3300009174 Bacteria 906
198 Ga0105242_10003381 3300009176 Bacteria 12421
199 Ga0105248_10153043 3300009177 Bacteria 2602
200 Ga0105248_10592087 3300009177 Bacteria 1251
201 Ga0105237_10194860 3300009545 Bacteria 2026
202 Ga0105237_10293324 3300009545 Bacteria 1629
203 Ga0105238_10757487 3300009551 Bacteria 985
204 Ga0105238_11930005 3300009551 Bacteria 624
205 Ga0105249_10262411 3300009553 Bacteria 1717
206 Ga0105249_10406852 3300009553 Bacteria 1392
207 Ga0105249_10833232 3300009553 Bacteria 987
208 Ga0105032_101210 3300009979 Bacteria 2385
209 Ga0157370_10065219 3300013104 Bacteria 3445
210 Ga0157370_10400599 3300013104 Bacteria 1263
211 Ga0157370_10771027 3300013104 Bacteria 876
212 Ga0157369_10037648 3300013105 Bacteria 5295
213 Ga0157369_10351553 3300013105 Bacteria 1531
214 Ga0157369_10859241 3300013105 Bacteria 931
215 Ga0157374_10128502 3300013296 Bacteria 2451
216 Ga0157374_10244772 3300013296 Bacteria 1764
217 Ga0157374_10249498 3300013296 Bacteria 1746
218 Ga0157374_10568133 3300013296 Bacteria 1143
219 Ga0157378_11216508 3300013297 Bacteria 793
220 Ga0163162_10138655 3300013306 Bacteria 2544
221 Ga0163162_10175359 3300013306 Bacteria 2269
222 Ga0163162_10586208 3300013306 Bacteria 1242
223 Ga0163162_10720435 3300013306 Bacteria 1118
224 Ga0163162_11756325 3300013306 Bacteria 709
225 Ga0157372_10057778 3300013307 Bacteria 4337
226 Ga0157372_10167743 3300013307 Bacteria 2539
227 Ga0157372_10373824 3300013307 Bacteria 1661
228 Ga0157372_10800475 3300013307 Bacteria 1095
229 Ga0157372_11479550 3300013307 Bacteria 782
230 Ga0157375_10383381 3300013308 Bacteria 1572
231 Ga0157375_10872734 3300013308 Bacteria 1045
232 Ga0157375_11223493 3300013308 Bacteria 881
233 Ga0163163_10006948 3300014325 Bacteria 9943
234 Ga0163163_10011237 3300014325 Bacteria 8113
235 Ga0163163_10360035 3300014325 Bacteria 1511
236 Ga0163163_10518653 3300014325 Bacteria 1254
237 Ga0163163_10796684 3300014325 Bacteria 1008
238 Ga0157380_10000051 3300014326 Bacteria 68466
239 Ga0157380_10251534 3300014326 Bacteria 1600
240 Ga0157380_10852707 3300014326 Bacteria 933
241 Ga0157380_11209403 3300014326 Bacteria 799
242 Ga0182008_10058233 3300014497 Bacteria 1908
243 Ga0182008_10082236 3300014497 Bacteria 1585
244 Ga0182008_10234480 3300014497 Bacteria 942
245 Ga0182008_10350635 3300014497 Bacteria 783
246 Ga0157377_10409985 3300014745 Bacteria 925
247 Ga0157379_10000101 3300014968 Bacteria 58702
248 Ga0157379_10009261 3300014968 Bacteria 8574
249 Ga0157379_11830586 3300014968 Bacteria 597
250 Ga0157376_10024093 3300014969 Bacteria 4774
251 Ga0182006_1084553 3300015261 Bacteria 1152
252 Ga0163161_10131187 3300017792 Bacteria 1890
253 Ga0197907_10311092 3300020069 Bacteria 719
254 Ga0197907_10333276 3300020069 Bacteria 1845
255 Ga0197907_10773738 3300020069 Bacteria 1462
256 Ga0197907_10800216 3300020069 Bacteria 4495
257 Ga0197907_11130806 3300020069 Bacteria 1275
258 Ga0197907_11365827 3300020069 Bacteria 3388
259 Ga0206356_10169717 3300020070 Bacteria 735
260 Ga0206356_10226831 3300020070 Bacteria 1838
261 Ga0206356_10929817 3300020070 Unclassified 782
262 Ga0206356_11287527 3300020070 Bacteria 12032
263 Ga0206356_11574971 3300020070 Bacteria 10382
264 Ga0206349_1119855 3300020075 Bacteria 8453
265 Ga0206349_1637736 3300020075 Bacteria 1819
266 Ga0206355_1680354 3300020076 Bacteria 4028
267 Ga0206351_10175414 3300020077 Bacteria 7296
268 Ga0206352_10667425 3300020078 Bacteria 1063
269 Ga0206352_10734764 3300020078 Bacteria 661
270 Ga0206350_10443236 3300020080 Bacteria 4449
271 Ga0206350_10587188 3300020080 Bacteria 9712
272 Ga0206354_10391537 3300020081 Bacteria 2849
273 Ga0206354_11636011 3300020081 Bacteria 3050
274 Ga0206353_10434407 3300020082 Bacteria 2683
275 Ga0206353_11273815 3300020082 Bacteria 1556
276 Ga0206353_11828919 3300020082 Bacteria 1440
277 Ga0154015_1602284 3300020610 Bacteria 3657
278 Ga0213873_10000595 3300021358 Bacteria 5889
279 Ga0213873_10003193 3300021358 Bacteria 2931
280 Ga0213873_10018295 3300021358 Bacteria 1610
281 Ga0213873_10021366 3300021358 Bacteria 1522
282 Ga0213872_10004954 3300021361 Bacteria 6924
283 Ga0213872_10007856 3300021361 Bacteria 5211
284 Ga0213872_10112260 3300021361 Bacteria 1210
285 Ga0213874_10018062 3300021377 Bacteria 1901
286 Ga0213874_10030397 3300021377 Unclassified 1556
287 Ga0213876_10003555 3300021384 Bacteria 8881
288 Ga0213876_10012912 3300021384 Bacteria 4441
289 Ga0213876_10014070 3300021384 Bacteria 4243
290 Ga0213876_10351894 3300021384 Bacteria 783
291 Ga0213875_10000001 3300021388 Bacteria 2793540
292 Ga0213875_10012869 3300021388 Bacteria 4122
293 Ga0213875_10041646 3300021388 Bacteria 2161
294 Ga0213875_10169764 3300021388 Unclassified 1024
295 Ga0213875_10195584 3300021388 Bacteria 951
296 Ga0213871_10009458 3300021441 Bacteria 2184
297 Ga0213871_10077498 3300021441 Bacteria 948
298 Ga0224712_10000619 3300022467 Bacteria 7246
299 Ga0224712_10003141 3300022467 Bacteria 4227
300 Ga0224712_10153846 3300022467 Bacteria 1021
301 Ga0224712_10420420 3300022467 Bacteria 639
302 Ga0207682_10028296 3300025893 Bacteria 2236
303 Ga0207710_10106538 3300025900 Bacteria 1327
304 Ga0207688_10042403 3300025901 Bacteria 2533
305 Ga0207688_10164176 3300025901 Bacteria 1318
306 Ga0207680_10324918 3300025903 Bacteria 1076
307 Ga0207645_10048082 3300025907 Bacteria 2723
308 Ga0207645_10154236 3300025907 Bacteria 1500
309 Ga0207645_10390091 3300025907 Bacteria 935
310 Ga0207705_10116912 3300025909 Bacteria 1975
311 Ga0207705_11044194 3300025909 Bacteria 631
312 Ga0207684_10034076 3300025910 Bacteria 4328
313 Ga0207684_10068282 3300025910 Bacteria 3021
314 Ga0207684_10100069 3300025910 Bacteria 2477
315 Ga0207684_10211204 3300025910 Bacteria 1674
316 Ga0207684_10372727 3300025910 Bacteria 1228
317 Ga0207654_10001365 3300025911 Bacteria 12965
318 Ga0207654_10319989 3300025911 Bacteria 1060
319 Ga0207654_10549538 3300025911 Bacteria 820
320 Ga0207707_10024016 3300025912 Bacteria 5331
321 Ga0207707_10303873 3300025912 Bacteria 1379
322 Ga0207695_10116275 3300025913 Bacteria 2648
323 Ga0207695_10156152 3300025913 Bacteria 2216
324 Ga0207695_10192227 3300025913 Bacteria 1958
325 Ga0207695_10298515 3300025913 Bacteria 1502
326 Ga0207695_10308587 3300025913 Bacteria 1472
327 Ga0207695_10992685 3300025913 Bacteria 719
328 Ga0207660_10016445 3300025917 Bacteria 4897
329 Ga0207649_10238151 3300025920 Bacteria 1305
330 Ga0207652_10013911 3300025921 Bacteria 6514
331 Ga0207652_10036196 3300025921 Bacteria 4173
332 Ga0207652_10061003 3300025921 Bacteria 3255
333 Ga0207652_10494878 3300025921 Bacteria 1101
334 Ga0207646_10045629 3300025922 Bacteria 3934
335 Ga0207646_10049384 3300025922 Bacteria 3769
336 Ga0207646_10155120 3300025922 Bacteria 2065
337 Ga0207694_10834799 3300025924 Bacteria 779
338 Ga0207650_10362585 3300025925 Bacteria 1194
339 Ga0207659_10068746 3300025926 Bacteria 2577
340 Ga0207687_10004724 3300025927 Bacteria 9061
341 Ga0207687_10304270 3300025927 Unclassified 1285
342 Ga0207700_10527734 3300025928 Bacteria 1046
343 Ga0207700_10646612 3300025928 Bacteria 943
344 Ga0207664_10002006 3300025929 Bacteria 13411
345 Ga0207664_10040228 3300025929 Bacteria 3634
346 Ga0207664_10074167 3300025929 Bacteria 2748
347 Ga0207664_10169646 3300025929 Bacteria 1867
348 Ga0207664_10360769 3300025929 Bacteria 1287
349 Ga0207644_10020573 3300025931 Bacteria 4488
350 Ga0207690_10091738 3300025932 Bacteria 2148
351 Ga0207690_10639806 3300025932 Bacteria 871
352 Ga0207706_10330499 3300025933 Bacteria 1326
353 Ga0207706_10398213 3300025933 Bacteria 1194
354 Ga0207686_10000781 3300025934 Bacteria 19580
355 Ga0207704_10882007 3300025938 Bacteria 751
356 Ga0207691_10009551 3300025940 Bacteria 9308
357 Ga0207691_10527260 3300025940 Unclassified 1002
358 Ga0207691_10929260 3300025940 Bacteria 727
359 Ga0207711_10145542 3300025941 Bacteria 2135
360 Ga0207689_10357275 3300025942 Bacteria 1215
361 Ga0207661_10067883 3300025944 Bacteria 2901
362 Ga0207661_10121653 3300025944 Bacteria 2223
363 Ga0207661_10393341 3300025944 Bacteria 1256
364 Ga0207661_10760954 3300025944 Bacteria 892
365 Ga0207661_10945419 3300025944 Bacteria 794
366 Ga0207661_11114104 3300025944 Bacteria 727
367 Ga0207679_10815623 3300025945 Bacteria 851
368 Ga0207667_10001579 3300025949 Bacteria 28649
369 Ga0207667_10103107 3300025949 Bacteria 2943
370 Ga0207667_10150143 3300025949 Bacteria 2399
371 Ga0207667_11482633 3300025949 Bacteria 650
372 Ga0207651_10003118 3300025960 Bacteria 8064
373 Ga0207651_10693290 3300025960 Bacteria 897
374 Ga0207712_10015493 3300025961 Bacteria 4920
375 Ga0207712_10147470 3300025961 Bacteria 1813
376 Ga0207712_10183651 3300025961 Bacteria 1645
377 Ga0207668_11034222 3300025972 Bacteria 735
378 Ga0207640_10000024 3300025981 Bacteria 154876
379 Ga0207640_10151384 3300025981 Bacteria 1705
380 Ga0207640_10300351 3300025981 Bacteria 1270
381 Ga0207658_10005603 3300025986 Bacteria 8589
382 Ga0207677_10072215 3300026023 Bacteria 2439
383 Ga0207677_10341212 3300026023 Bacteria 1252
384 Ga0207703_10003502 3300026035 Bacteria 13129
385 Ga0207639_10001948 3300026041 Bacteria 13860
386 Ga0207639_10158693 3300026041 Bacteria 1904
387 Ga0207678_10062167 3300026067 Bacteria 3211
388 Ga0207678_10244885 3300026067 Bacteria 1536
389 Ga0207678_11292418 3300026067 Bacteria 645
390 Ga0207702_10003580 3300026078 Bacteria 14118
391 Ga0207702_10025526 3300026078 Bacteria 4905
392 Ga0207702_10403334 3300026078 Bacteria 1319
393 Ga0207641_10003356 3300026088 Bacteria 14232
394 Ga0207641_10009791 3300026088 Bacteria 7890
395 Ga0207641_10256022 3300026088 Bacteria 1637
396 Ga0207641_10721055 3300026088 Bacteria 983
397 Ga0207641_11718782 3300026088 Bacteria 629
398 Ga0207676_10007479 3300026095 Bacteria 7751
399 Ga0207676_10689264 3300026095 Bacteria 989
400 Ga0207674_10862747 3300026116 Bacteria 873
401 Ga0207675_100162293 3300026118 Bacteria 2132
402 Ga0207683_10266407 3300026121 Bacteria 1565
403 Ga0207683_10407855 3300026121 Bacteria 1251
404 Ga0207698_10014555 3300026142 Bacteria 5235
405 Ga0207698_10072106 3300026142 Bacteria 2744
406 Ga0207698_10101413 3300026142 Bacteria 2387
407 Ga0207698_10263011 3300026142 Bacteria 1586
408 Ga0207698_10387015 3300026142 Bacteria 1332
409 Ga0209998_10101827 3300027717 Bacteria 712
410 Ga0265356_1000525 3300028017 Bacteria 6878
411 Ga0268266_10217248 3300028379 Bacteria 1756
412 Ga0268266_10288535 3300028379 Bacteria 1528
413 Ga0268265_10000156 3300028380 Bacteria 83798
414 Ga0268265_10131898 3300028380 Bacteria 2078
415 Ga0268265_10961086 3300028380 Bacteria 842
416 Ga0268264_10086134 3300028381 Bacteria 2699
417 Ga0268264_10261615 3300028381 Bacteria 1612
418 Ga0265337_1043836 3300028556 Bacteria 1278
419 Ga0265326_10012298 3300028558 Bacteria 2517
420 Ga0265334_10007247 3300028573 Bacteria 4757
421 Ga0265334_10047737 3300028573 Bacteria 1650
422 Ga0265318_10022101 3300028577 Unclassified 2546
423 Ga0265318_10044756 3300028577 Bacteria 1674
424 Ga0265318_10215517 3300028577 Bacteria 701
425 Ga0265323_10012167 3300028653 Bacteria 3456
426 Ga0265323_10112210 3300028653 Bacteria 894
427 Ga0265323_10189094 3300028653 Bacteria 650
428 Ga0265322_10007533 3300028654 Bacteria 3173
429 Ga0265322_10008553 3300028654 Bacteria 2981
430 Ga0265322_10128186 3300028654 Bacteria 723
431 Ga0265336_10006414 3300028666 Unclassified 4241
432 Ga0265336_10029741 3300028666 Bacteria 1703
433 Ga0265336_10072437 3300028666 Bacteria 1030
434 Ga0265336_10100799 3300028666 Bacteria 860
435 Ga0265338_10000052 3300028800 Bacteria 209239
436 Ga0265338_10000054 3300028800 Bacteria 207383
437 Ga0265338_10000178 3300028800 Bacteria 118345
438 Ga0265338_10000366 3300028800 Bacteria 81024
439 Ga0265338_10000396 3300028800 Bacteria 78090
440 Ga0265338_10080483 3300028800 Bacteria 2737
441 Ga0265338_10084583 3300028800 Bacteria 2647
442 Ga0265338_10085544 3300028800 Bacteria 2628
443 Ga0265338_10151474 3300028800 Bacteria 1801
444 Ga0265338_10561404 3300028800 Bacteria 798
445 Ga0265324_10010795 3300029957 Bacteria 3503
446 Ga0265324_10024082 3300029957 Bacteria 2164
447 Ga0265324_10059466 3300029957 Bacteria 1307
448 Ga0265324_10192185 3300029957 Bacteria 693
449 Ga0265762_1003191 3300030760 Bacteria 2931
450 Ga0265762_1012092 3300030760 Bacteria 1545
451 Ga0265765_1013536 3300030879 Bacteria 934
452 Ga0265760_10000904 3300031090 Bacteria 8569
453 Ga0265330_10013203 3300031235 Bacteria 3852
454 Ga0265332_10008843 3300031238 Bacteria 4507
455 Ga0265332_10011261 3300031238 Bacteria 3977
456 Ga0265328_10022106 3300031239 Bacteria 2422
457 Ga0265320_10171585 3300031240 Bacteria 974
458 Ga0265325_10002829 3300031241 Bacteria 11578
459 Ga0265325_10013636 3300031241 Bacteria 4620
460 Ga0265325_10026083 3300031241 Bacteria 3168
461 Ga0265325_10030390 3300031241 Bacteria 2897
462 Ga0265325_10089657 3300031241 Unclassified 1518
463 Ga0265329_10008966 3300031242 Bacteria 3760
464 Ga0265340_10015913 3300031247 Bacteria 3902
465 Ga0265340_10017309 3300031247 Bacteria 3727
466 Ga0265340_10179788 3300031247 Bacteria 956
467 Ga0265339_10013311 3300031249 Bacteria 4990
468 Ga0265339_10024094 3300031249 Bacteria 3511
469 Ga0265339_10059896 3300031249 Unclassified 2052
470 Ga0265339_10142322 3300031249 Bacteria 1219
471 Ga0265339_10143592 3300031249 Bacteria 1212
472 Ga0265331_10014050 3300031250 Unclassified 4278
473 Ga0265331_10362469 3300031250 Bacteria 649
474 Ga0265327_10004316 3300031251 Bacteria 12681
475 Ga0265327_10026829 3300031251 Bacteria 3327
476 Ga0265327_10054273 3300031251 Bacteria 2075
477 Ga0265327_10069113 3300031251 Bacteria 1774
478 Ga0265316_10036091 3300031344 Bacteria 3998
479 Ga0265316_10061416 3300031344 Bacteria 2919
480 Ga0265316_10114249 3300031344 Bacteria 2043
481 Ga0265316_10148230 3300031344 Bacteria 1759
482 Ga0265316_10184223 3300031344 Bacteria 1553
483 Ga0265316_10377257 3300031344 Bacteria 1023
484 Ga0307408_100823598 3300031548 Bacteria 844
485 Ga0265313_10010254 3300031595 Bacteria 5958
486 Ga0265313_10024100 3300031595 Bacteria 3258
487 Ga0265313_10110775 3300031595 Bacteria 1207
488 Ga0307508_10040608 3300031616 Bacteria 4176
489 Ga0316575_10121553 3300031665 Bacteria 1068
490 Ga0316579_10003148 3300031691 Bacteria 6378
491 Ga0265314_10056945 3300031711 Bacteria 2688
492 Ga0265314_10257790 3300031711 Bacteria 997
493 Ga0265314_10445906 3300031711 Bacteria 690
494 Ga0265342_10006015 3300031712 Bacteria 9119
495 Ga0265342_10006331 3300031712 Bacteria 8825
496 Ga0265342_10042321 3300031712 Bacteria 2752
497 Ga0316576_10000044 3300031727 Bacteria 38025
498 Ga0316576_10040833 3300031727 Bacteria 3336
499 Ga0316576_10102429 3300031727 Bacteria 2141
500 Ga0316576_10120771 3300031727 Bacteria 1967
501 Ga0316576_10159441 3300031727 Bacteria 1701
502 Ga0316576_10164563 3300031727 Bacteria 1673
503 Ga0316576_10383256 3300031727 Bacteria 1044
504 Ga0316578_10036090 3300031728 Bacteria 2845
505 Ga0316578_10047642 3300031728 Bacteria 2501
506 Ga0307405_10040503 3300031731 Bacteria 2822
507 Ga0307405_10088557 3300031731 Unclassified 2043
508 Ga0307405_10201904 3300031731 Bacteria 1444
509 Ga0307405_10537633 3300031731 Bacteria 943
510 Ga0316577_10016991 3300031733 Bacteria 4015
511 Ga0316577_10134021 3300031733 Bacteria 1394
512 Ga0316577_10508590 3300031733 Bacteria 685
513 Ga0307413_10355754 3300031824 Bacteria 1132
514 Ga0307410_10477080 3300031852 Bacteria 1022
515 Ga0307410_10914426 3300031852 Unclassified 752
516 Ga0307410_11092447 3300031852 Bacteria 691
517 Ga0307410_11508453 3300031852 Bacteria 592
518 Ga0307406_10024435 3300031901 Bacteria 3609
519 Ga0307406_11556420 3300031901 Bacteria 583
520 Ga0307407_10022946 3300031903 Bacteria 3247
521 Ga0307407_10112594 3300031903 Unclassified 1711
522 Ga0307407_10474008 3300031903 Bacteria 913
523 Ga0307412_10196528 3300031911 Unclassified 1529
524 Ga0307412_11132929 3300031911 Bacteria 698
525 Ga0307412_11232736 3300031911 Bacteria 671
526 Ga0307409_100100999 3300031995 Bacteria 2392
527 Ga0307409_100392921 3300031995 Bacteria 1322
528 Ga0307416_100035072 3300032002 Bacteria 3826
529 Ga0307416_100074155 3300032002 Unclassified 2841
530 Ga0307416_100318729 3300032002 Bacteria 1555
531 Ga0307416_100513006 3300032002 Bacteria 1265
532 Ga0307416_100596914 3300032002 Bacteria 1183
533 Ga0307416_102470482 3300032002 Bacteria 618
534 Ga0307414_10066151 3300032004 Bacteria 2582
535 Ga0307411_10017055 3300032005 Bacteria 4125
536 Ga0307411_11573956 3300032005 Bacteria 606
537 Ga0307415_100045358 3300032126 Bacteria 2946
538 Ga0307415_100676782 3300032126 Bacteria 928
539 Ga0307415_100941902 3300032126 Bacteria 799
540 Ga0316583_10018078 3300032133 Bacteria 2532
541 Ga0316585_10022471 3300032137 Bacteria 1941
542 Ga0316580_10001591 3300032139 Bacteria 5993
543 Ga0316593_10000617 3300032168 Bacteria 6770
544 Ga0316593_10003813 3300032168 Bacteria 3791
545 Ga0316593_10004644 3300032168 Bacteria 3543
546 Ga0316593_10009065 3300032168 Bacteria 2796
547 Ga0316593_10013598 3300032168 Bacteria 2413
548 Ga0316593_10045668 3300032168 Bacteria 1468
549 Ga0316593_10057174 3300032168 Unclassified 1328
550 Ga0316593_10115814 3300032168 Bacteria 960
551 Ga0316593_10256387 3300032168 Bacteria 655
552 Ga0316592_1000648 3300033524 Bacteria 5065
553 Ga0316592_1000962 3300033524 Bacteria 4429
554 Ga0316592_1001542 3300033524 Bacteria 3743
555 Ga0316592_1005486 3300033524 Bacteria 2410
556 Ga0316592_1005684 3300033524 Bacteria 2378
557 Ga0316592_1008299 3300033524 Bacteria 2047
558 Ga0316592_1021735 3300033524 Bacteria 1368
559 Ga0316592_1027220 3300033524 Unclassified 1236
560 Ga0316588_1000021 3300033528 Bacteria 11292
561 Ga0316588_1006251 3300033528 Bacteria 2370
562 Ga0316588_1022587 3300033528 Unclassified 1438
563 Ga0316587_1049711 3300033529 Unclassified 766
564 Ga0316596_1000103 3300033541 Bacteria 10744
565 Ga0316596_1001763 3300033541 Bacteria 4493
566 Ga0316596_1002456 3300033541 Bacteria 3957
567 Ga0316596_1003921 3300033541 Bacteria 3297
568 Ga0316596_1029434 3300033541 Bacteria 1422
569 Ga0316596_1037856 3300033541 Bacteria 1263
570 Ga0316596_1051195 3300033541 Bacteria 1093
571 Ga0316596_1059076 3300033541 Bacteria 1022
572 Ga0316596_1062764 3300033541 Bacteria 992
573 Ga0373934_0107996 3300035086 Bacteria 1128
574 Ga0373944_0158224 3300035089 Bacteria 802
575 Ga0373923_0368975 3300035111 Bacteria 687
576 Ga0373960_0069319 3300035121 Bacteria 1087
577 Ga0373943_0080168 3300035170 Bacteria 1672
578 Ga0316574_0000425 3300035398 Bacteria 16756
579 Ga0316574_0004026 3300035398 Bacteria 7661
580 Ga0316574_0029464 3300035398 Bacteria 3316
581 Ga0316574_0037513 3300035398 Bacteria 2973
582 Ga0316574_0043756 3300035398 Bacteria 2768
583 Ga0316574_0061678 3300035398 Bacteria 2355
584 Ga0316574_0097531 3300035398 Bacteria 1879
585 Ga0316574_0269817 3300035398 Bacteria 1085
586 Ga0316574_0475492 3300035398 Bacteria 781
587 Ga0373931_0044819 3300035691 Bacteria 2334
588 Ga0373931_0236961 3300035691 Bacteria 1105
589 Ga0373935_0004181 3300035692 Bacteria 8454
590 Ga0373935_0151089 3300035692 Bacteria 1576
591 Ga0373927_0160436 3300035695 Bacteria 1473
592 Ga0373947_0170363 3300035725 Bacteria 1412
593 Ga0373947_0185913 3300035725 Bacteria 1355
594 Ga0373947_0191364 3300035725 Bacteria 1335
595 Ga0316582_0001841 3300036647 Bacteria 9599
596 Ga0316582_0006061 3300036647 Bacteria 6303
597 Ga0316582_0407926 3300036647 Bacteria 936
598 Ga0316584_0003484 3300036712 Bacteria 10242
599 Ga0316584_0025317 3300036712 Bacteria 4351
600 Ga0316584_0109969 3300036712 Bacteria 2062
601 Ga0316584_0176768 3300036712 Bacteria 1581
602 Ga0316584_0222519 3300036712 Bacteria 1386
603 Ga0373925_0018411 3300037068 Bacteria 5076
604 Ga0373925_0453019 3300037068 Bacteria 1051
605 Ga0395899_0000039 3300037312 Bacteria 269620
606 Ga0395899_0004980 3300037312 Bacteria 10333
607 Ga0395900_0069514 3300037418 Bacteria 3619
608 Ga0395900_0117663 3300037418 Bacteria 2727
609 Ga0395900_0350503 3300037418 Bacteria 1450
610 Ga0395900_0807168 3300037418 Bacteria 866
611 Ga0395898_0000226 3300037466 Bacteria 144727
612 Ga0395898_0008404 3300037466 Bacteria 10916
613 Ga0395898_0688006 3300037466 Bacteria 965
614 Ga0395905_0006755 3300037471 Bacteria 11491
615 Ga0436364_0196276 3300037853 Bacteria 736
616 Ga0436364_0273345 3300037853 Bacteria 2794207
617 Ga0436364_0539388 3300037853 Bacteria 1074
618 Ga0436364_0575822 3300037853 Bacteria 949
619 Ga0436364_0646491 3300037853 Bacteria 31122
620 Ga0436364_0798963 3300037853 Bacteria 719
621 Ga0436364_0990835 3300037853 Bacteria 965
622 Ga0436364_1111625 3300037853 Bacteria 1065
623 Ga0436364_1142864 3300037853 Bacteria 8474
624 Ga0436364_1200424 3300037853 Bacteria 6833
625 Ga0436364_1211243 3300037853 Bacteria 2300
626 Ga0436364_1276914 3300037853 Bacteria 1601
627 Ga0436364_1306001 3300037853 Bacteria 643
628 Ga0436364_1494664 3300037853 Bacteria 1093
629 Ga0395901_0018326 3300038443 Bacteria 7147
630 Ga0395901_0195273 3300038443 Bacteria 2122
631 Ga0395901_0312522 3300038443 Bacteria 1627
632 Ga0436365_0097047 3300039437 Bacteria 1057
633 Ga0436365_0230296 3300039437 Bacteria 9287
634 Ga0436365_0427864 3300039437 Bacteria 7737
635 Ga0436365_0767674 3300039437 Bacteria 2508
636 Ga0436365_0794964 3300039437 Bacteria 1264
637 Ga0436365_0979666 3300039437 Bacteria 1564
638 Ga0436365_1319563 3300039437 Bacteria 2068
639 Ga0436365_1660231 3300039437 Bacteria 11182
640 Ga0436365_1904939 3300039437 Bacteria 710
641 Ga0436360_0002462 3300039438 Bacteria 2855
642 Ga0436360_0355760 3300039438 Bacteria 1401
643 Ga0436360_0422973 3300039438 Bacteria 2567
644 Ga0436360_0651805 3300039438 Bacteria 1824
645 Ga0436360_0665312 3300039438 Bacteria 2846
646 Ga0436360_0766016 3300039438 Bacteria 1335
647 Ga0436360_0979202 3300039438 Bacteria 1801
648 Ga0436360_1033819 3300039438 Bacteria 4971
649 Ga0436360_1055305 3300039438 Bacteria 1635
650 Ga0436360_1112229 3300039438 Unclassified 589
651 Ga0436360_1146218 3300039438 Bacteria 819
652 Ga0436360_1149615 3300039438 Bacteria 818
653 Ga0436360_1209713 3300039438 Bacteria 1048
654 Ga0436360_1218238 3300039438 Bacteria 8853
655 Ga0436361_0080925 3300039447 Bacteria 1893
656 Ga0436361_0143737 3300039447 Bacteria 1789
657 Ga0436361_0269103 3300039447 Bacteria 2108
658 Ga0436361_0423980 3300039447 Bacteria 3126
659 Ga0436361_0473343 3300039447 Bacteria 3820
660 Ga0436361_0627825 3300039447 Bacteria 2427
661 Ga0436361_0738206 3300039447 Bacteria 2235
662 Ga0436361_0776532 3300039447 Bacteria 2134
663 Ga0436361_0801716 3300039447 Bacteria 823
664 Ga0436361_1140566 3300039447 Bacteria 907
665 Ga0436361_1143312 3300039447 Bacteria 1158
666 Ga0436361_1165208 3300039447 Bacteria 1531
667 Ga0436363_0138227 3300039450 Bacteria 1217
668 Ga0436363_0403132 3300039450 Bacteria 3451
669 Ga0436363_0634802 3300039450 Bacteria 44772
670 Ga0436363_0947238 3300039450 Bacteria 884
671 Ga0436363_1017066 3300039450 Bacteria 830
672 Ga0436363_1100879 3300039450 Unclassified 1442
673 Ga0436363_1252147 3300039450 Bacteria 1817
674 Ga0436362_0091064 3300039453 Unclassified 720
675 Ga0436362_0107616 3300039453 Bacteria 2198
676 Ga0436362_0109475 3300039453 Bacteria 6715
677 Ga0436362_0226828 3300039453 Bacteria 7212
678 Ga0436362_0399122 3300039453 Bacteria 2789
679 Ga0436362_0437798 3300039453 Bacteria 9219
680 Ga0436362_0595348 3300039453 Bacteria 706
681 Ga0436362_0684804 3300039453 Bacteria 4100
682 Ga0436362_0763995 3300039453 Bacteria 699
683 Ga0436362_0973701 3300039453 Bacteria 1269
684 Ga0436362_1010063 3300039453 Bacteria 652
685 Ga0436362_1075726 3300039453 Bacteria 1661
686 Ga0436362_1127986 3300039453 Bacteria 925
687 Ga0436362_1295225 3300039453 Bacteria 2828
688 Ga0451798_0436115 3300041458 Bacteria 731
689 Ga0451802_1017005 3300041460 Unclassified 798
690 Ga0451845_0268857 3300041501 Bacteria 616
691 Ga0451852_14070 3300041508 Bacteria 604
692 Ga0451843_0911427 3300041509 Bacteria 632
693 Ga0451855_1261441 3300041511 Bacteria 1014
694 Ga0451855_1789869 3300041511 Bacteria 879
695 Ga0450916_090822 3300042530 Bacteria 532
696 Ga0451577_0000433 3300042876 Bacteria 74789
697 Ga0451577_0009630 3300042876 Bacteria 9274
698 Ga0451577_0016499 3300042876 Bacteria 6838
699 Ga0451577_0019005 3300042876 Bacteria 6325
700 Ga0451577_0038053 3300042876 Bacteria 4328
701 Ga0451577_0094271 3300042876 Bacteria 2673
702 Ga0451577_0113079 3300042876 Bacteria 2430
703 Ga0451577_0121175 3300042876 Bacteria 2343
704 Ga0451577_0312572 3300042876 Bacteria 1424
705 Ga0451577_0325812 3300042876 Bacteria 1393
706 Ga0451577_0451515 3300042876 Bacteria 1167
707 Ga0451577_0883983 3300042876 Unclassified 805
708 Ga0451577_1105802 3300042876 Bacteria 709
709 Ga0451577_1262305 3300042876 Unclassified 658
710 Ga0466969_0044133 3300044656 Bacteria 2219
711 Ga0453683_0000522 3300044673 Bacteria 43145
712 Ga0453683_0003998 3300044673 Bacteria 10656
713 Ga0453683_0077428 3300044673 Bacteria 2082
714 Ga0453683_0117933 3300044673 Bacteria 1670
715 Ga0453683_0175995 3300044673 Bacteria 1356
716 Ga0453683_0199689 3300044673 Bacteria 1270
717 Ga0453683_0564067 3300044673 Bacteria 741
718 Ga0466965_0058570 3300044683 Bacteria 1921
719 Ga0466966_0012777 3300044684 Bacteria 5563
720 Ga0466966_0417838 3300044684 Bacteria 806
721 Ga0466961_0113127 3300044693 Bacteria 1707
722 Ga0466963_0030151 3300044694 Bacteria 3497
723 Ga0466964_0156772 3300044706 Bacteria 1060
724 Ga0453684_0000055 3300044712 Bacteria 532014
725 Ga0453684_0000171 3300044712 Bacteria 286600
726 Ga0453684_0000420 3300044712 Bacteria 172995
727 Ga0453684_0000506 3300044712 Bacteria 152143
728 Ga0453684_0000588 3300044712 Bacteria 135201
729 Ga0453684_0001549 3300044712 Bacteria 64220
730 Ga0453684_0001835 3300044712 Bacteria 55524
731 Ga0453684_0002161 3300044712 Bacteria 49180
732 Ga0453684_0002895 3300044712 Bacteria 40244
733 Ga0453684_0005528 3300044712 Bacteria 24941
734 Ga0453684_0005656 3300044712 Bacteria 24561
735 Ga0453684_0016436 3300044712 Bacteria 11569
736 Ga0453684_0030092 3300044712 Bacteria 7682
737 Ga0453684_0035909 3300044712 Bacteria 6839
738 Ga0453684_0057385 3300044712 Bacteria 5039
739 Ga0453684_0065863 3300044712 Bacteria 4617
740 Ga0453684_0075151 3300044712 Bacteria 4249
741 Ga0453684_0106268 3300044712 Bacteria 3421
742 Ga0453684_0143075 3300044712 Bacteria 2852
743 Ga0453684_0167534 3300044712 Bacteria 2592
744 Ga0453684_0168330 3300044712 Bacteria 2585
745 Ga0453684_0168811 3300044712 Bacteria 2581
746 Ga0453684_0168952 3300044712 Bacteria 2579
747 Ga0453684_0202716 3300044712 Bacteria 2311
748 Ga0453684_0219953 3300044712 Bacteria 2200
749 Ga0453684_0263102 3300044712 Bacteria 1975
750 Ga0453684_0273428 3300044712 Bacteria 1929
751 Ga0453684_0452149 3300044712 Bacteria 1429
752 Ga0453684_0546743 3300044712 Unclassified 1276
753 Ga0453684_0558997 3300044712 Bacteria 1259
754 Ga0453684_0741452 3300044712 Bacteria 1064
755 Ga0453684_1057136 3300044712 Bacteria 860
756 Ga0453684_1273020 3300044712 Bacteria 768
757 Ga0453684_1420829 3300044712 Bacteria 719
758 Ga0453684_1549238 3300044712 Bacteria 682
759 Ga0466971_0000005 3300044719 Bacteria 137073
760 Ga0466971_0283155 3300044719 Bacteria 794
761 Ga0466970_0021508 3300044765 Bacteria 3359
762 Ga0466970_0057209 3300044765 Bacteria 2085
763 Ga0466957_0069306 3300044842 Bacteria 2178
764 Ga0466957_0083253 3300044842 Bacteria 1995
765 Ga0466960_0039668 3300044901 Bacteria 2222
766 Ga0466960_0402246 3300044901 Bacteria 789
767 Ga0451576_0000204 3300045051 Bacteria 149459
768 Ga0451576_0000454 3300045051 Bacteria 93047
769 Ga0451576_0000689 3300045051 Bacteria 68784
770 Ga0451576_0016407 3300045051 Bacteria 8175
771 Ga0451576_0024947 3300045051 Bacteria 6450
772 Ga0451576_0031702 3300045051 Bacteria 5633
773 Ga0451576_0032623 3300045051 Bacteria 5541
774 Ga0451576_0034310 3300045051 Bacteria 5390
775 Ga0451576_0076007 3300045051 Bacteria 3495
776 Ga0451576_0099789 3300045051 Bacteria 3020
777 Ga0451576_0751403 3300045051 Bacteria 1024
778 Ga0451576_1172790 3300045051 Unclassified 803
779 Ga0466958_0005653 3300045836 Bacteria 6751
780 Ga0466958_0020009 3300045836 Bacteria 3900
781 Ga0466958_0569552 3300045836 Bacteria 736
782 Ga0466958_0726359 3300045836 Bacteria 647
783 Ga0466967_0001979 3300045976 Bacteria 12433
784 Ga0466967_0061054 3300045976 Bacteria 3343
785 Ga0466967_0088574 3300045976 Bacteria 2809
786 Ga0466967_0105905 3300045976 Bacteria 2577
787 Ga0466967_0116667 3300045976 Bacteria 2460
788 Ga0466967_0264149 3300045976 Bacteria 1647
789 Ga0466967_1792423 3300045976 Bacteria 611
790 Ga0495592_0163757 3300046454 Bacteria 1528
791 Ga0495603_0094891 3300046455 Bacteria 1743
792 Ga0495629_0088772 3300046459 Bacteria 2157
793 Ga0495629_0739081 3300046459 Bacteria 652
794 Ga0495638_0000070 3300046460 Bacteria 166954
795 Ga0495641_0239686 3300046461 Bacteria 815
796 Ga0495651_0370821 3300046462 Bacteria 941
797 Ga0495580_0002023 3300046472 Bacteria 17847
798 Ga0495585_0038134 3300046492 Bacteria 2705
799 Ga0495594_0304702 3300046499 Bacteria 907
800 Ga0495596_0034263 3300046500 Bacteria 2017
801 Ga0495608_0221722 3300046511 Bacteria 1186
802 Ga0495616_0080146 3300046513 Bacteria 1564
803 Ga0495620_0047535 3300046515 Bacteria 1846
804 Ga0495628_0364349 3300046516 Bacteria 1061
805 Ga0495628_0366101 3300046516 Bacteria 1058
806 Ga0495644_0155928 3300046523 Bacteria 875
807 Ga0495652_0611799 3300046529 Bacteria 742
808 Ga0495665_0074242 3300046531 Bacteria 1791
809 Ga0495640_0177675 3300046533 Bacteria 1358
810 Ga0495598_0201598 3300046537 Bacteria 719
811 Ga0495621_0023755 3300046539 Bacteria 2041
812 Ga0495645_0489943 3300046543 Bacteria 770
813 Ga0495656_0067316 3300046615 Bacteria 1580
814 Ga0495611_0051314 3300046648 Bacteria 1859
815 Ga0495659_0258467 3300046664 Bacteria 727
816 Ga0495661_0160588 3300046665 Bacteria 1207
817 Ga0495588_0168354 3300046674 Bacteria 1159
818 Ga0495657_0152480 3300046675 Bacteria 1434
819 Ga0495657_0778041 3300046675 Bacteria 548
820 Ga0495599_0466266 3300046678 Bacteria 746
821 Ga0495623_0210189 3300046679 Bacteria 1114
822 Ga0495658_0479285 3300046683 Bacteria 795
823 Ga0495624_0175255 3300046690 Bacteria 1308
824 Ga0495624_0528731 3300046690 Bacteria 705
825 Ga0495670_0400508 3300046691 Bacteria 741
826 Ga0495671_0134863 3300046692 Bacteria 1204
827 Ga0495604_0022605 3300047317 Bacteria 5021
828 Ga0495604_0152364 3300047317 Bacteria 1641
829 Ga0495674_0113319 3300047319 Bacteria 2297
830 Ga0495680_0064028 3300047322 Bacteria 2821
831 Ga0495685_030399 3300047447 Bacteria 1857
832 Ga0495681_0166072 3300047470 Bacteria 916
833 Ga0495684_0287403 3300047471 Bacteria 1185
834 Ga0495593_0055492 3300047673 Bacteria 2085
835 Ga0495614_0067207 3300048089 Bacteria 1543
836 Ga0495614_0260507 3300048089 Bacteria 795
837 Ga0495615_0003053 3300048090 Bacteria 2769
838 Ga0496100_0024180 3300048903 Bacteria 3701
839 Ga0496101_0019981 3300048904 Bacteria 4580
840 Ga0496101_0127638 3300048904 Bacteria 1929
841 Ga0496101_0351673 3300048904 Bacteria 1158
842 Ga0496102_0000521 3300048905 Bacteria 41977
843 Ga0496102_0008968 3300048905 Bacteria 8580
844 Ga0496102_0469355 3300048905 Bacteria 1179
845 Ga0496103_0000453 3300048906 Bacteria 34950
846 Ga0496103_0004001 3300048906 Bacteria 8953
847 Ga0496103_0216742 3300048906 Bacteria 1231
848 Ga0496104_0011710 3300048907 Bacteria 7867
849 Ga0496104_0682652 3300048907 Bacteria 935
850 Ga0496105_0037579 3300048908 Bacteria 3987
851 Ga0496106_0009483 3300048909 Bacteria 7196
852 Ga0496106_0102077 3300048909 Bacteria 2225
853 Ga0496106_0216500 3300048909 Bacteria 1526
854 Ga0496107_0056740 3300048910 Bacteria 2830
855 Ga0496107_0097517 3300048910 Bacteria 2152
856 Ga0496107_0560506 3300048910 Bacteria 846
857 Ga0496108_0060974 3300048911 Bacteria 3174
858 Ga0496108_0323400 3300048911 Bacteria 1345
859 Ga0496109_0282341 3300048912 Bacteria 1565
860 Ga0496110_0270447 3300048913 Bacteria 1547
861 Ga0496110_0296428 3300048913 Bacteria 1473
862 Ga0496111_0695855 3300048914 Bacteria 740
863 Ga0496114_0101670 3300048917 Bacteria 2454
864 Ga0496114_0185091 3300048917 Bacteria 1820
865 Ga0496114_0241555 3300048917 Bacteria 1588
866 Ga0496114_0834586 3300048917 Bacteria 801
867 Ga0496115_0216592 3300048918 Bacteria 1581
868 Ga0496116_0000173 3300048919 Bacteria 129928
869 Ga0496116_0001739 3300048919 Bacteria 23720
870 Ga0496116_0003301 3300048919 Bacteria 16049
871 Ga0496117_0000124 3300048920 Bacteria 169701
872 Ga0496117_0000144 3300048920 Bacteria 153831
873 Ga0496117_0031708 3300048920 Bacteria 4030
874 Ga0496118_0000096 3300048921 Bacteria 163988
875 Ga0496118_0012385 3300048921 Bacteria 8195
876 Ga0496118_0036819 3300048921 Bacteria 3949
877 Ga0496119_0000020 3300048922 Bacteria 285602
878 Ga0496119_0003189 3300048922 Bacteria 17184
879 Ga0496119_0009028 3300048922 Bacteria 8645
880 Ga0496120_0000006 3300048923 Bacteria 445068
881 Ga0496120_0004033 3300048923 Bacteria 12732
882 Ga0496120_0051139 3300048923 Bacteria 2362
883 Ga0496120_0089736 3300048923 Bacteria 1644
884 Ga0496120_0090271 3300048923 Bacteria 1638
885 Ga0496121_0016153 3300048924 Bacteria 7732
886 Ga0496122_0000040 3300048925 Bacteria 285095
887 Ga0496122_0000140 3300048925 Bacteria 169037
888 Ga0496122_0000802 3300048925 Bacteria 60277
889 Ga0496123_0000572 3300048926 Bacteria 62779
890 Ga0496123_0004284 3300048926 Bacteria 15176
891 Ga0496123_0007798 3300048926 Bacteria 9971
892 Ga0496124_0003352 3300048927 Bacteria 19709
893 Ga0496124_0096000 3300048927 Bacteria 2409
894 Ga0496125_0000010 3300048928 Bacteria 671167
895 Ga0496125_0000110 3300048928 Bacteria 192693
896 Ga0496125_0004049 3300048928 Bacteria 17170
897 Ga0496125_0006483 3300048928 Bacteria 12640
898 Ga0496125_0011762 3300048928 Bacteria 8722
899 Ga0496126_0000060 3300048929 Bacteria 264944
900 Ga0496126_0000246 3300048929 Bacteria 116854
901 Ga0496126_0000330 3300048929 Bacteria 101064
902 Ga0496126_0002082 3300048929 Bacteria 28029
903 Ga0496126_0131654 3300048929 Bacteria 2161
904 Ga0496126_0156649 3300048929 Bacteria 1949
905 Ga0496126_0447888 3300048929 Bacteria 1040
906 Ga0501306_020430 3300049127 Bacteria 921
907 Ga0501306_032012 3300049127 Bacteria 786
908 Ga0501309_029917 3300049129 Bacteria 800
909 Ga0501310_046146 3300049130 Bacteria 619
910 Ga0501305_007398 3300049161 Bacteria 1393
911 Ga0501307_000425 3300049162 Bacteria 2824
912 Ga0501296_045384 3300049519 Bacteria 631
913 Ga0501300_057751 3300049523 Bacteria 609
914 Ga0501311_006327 3300049527 Bacteria 1330
915 Ga0501312_003515 3300049528 Bacteria 1785
916 Ga0501313_008295 3300049529 Bacteria 1154
917 Ga0501315_010905 3300049531 Bacteria 1101
918 Ga0501315_018361 3300049531 Bacteria 922
919 Ga0501315_071662 3300049531 Bacteria 576
920 Ga0501316_017614 3300049532 Bacteria 878
921 Ga0501316_024289 3300049532 Bacteria 782
922 Ga0501316_029123 3300049532 Bacteria 732
923 Ga0501317_017738 3300049533 Bacteria 936
924 Ga0501317_026333 3300049533 Bacteria 820
925 Ga0501317_027225 3300049533 Bacteria 811
926 Ga0501318_001927 3300049534 Bacteria 1725
927 Ga0501318_016204 3300049534 Bacteria 898
928 Ga0501318_028307 3300049534 Bacteria 750
929 Ga0501319_004209 3300049535 Bacteria 994
930 Ga0501319_018983 3300049535 Bacteria 605
931 Ga0501320_001561 3300049536 Bacteria 1712
932 Ga0501321_034086 3300049537 Bacteria 692
933 Ga0501322_006519 3300049538 Bacteria 832
934 Ga0501322_012040 3300049538 Bacteria 683
935 Ga0501324_002357 3300049540 Bacteria 1360
936 Ga0501325_030486 3300049541 Bacteria 616
937 Ga0501327_04773 3300049543 Bacteria 784
938 Ga0501331_10332 3300049547 Bacteria 581
939 Ga0501334_06131 3300049550 Bacteria 805
940 Ga0501338_01088 3300049554 Bacteria 1388
941 Ga0501340_015584 3300049556 Bacteria 601
942 Ga0501031_0013728 3300049568 Bacteria 5280
943 Ga0501031_0131278 3300049568 Bacteria 1636
944 Ga0501031_0255102 3300049568 Bacteria 1140
945 Ga0501032_0401675 3300049569 Bacteria 880
946 Ga0501033_0000015 3300049570 Bacteria 218502
947 Ga0501034_0039000 3300049571 Bacteria 4811
948 Ga0501034_0804113 3300049571 Bacteria 833
949 Ga0501036_0277221 3300049572 Bacteria 1403
950 Ga0501036_0338927 3300049572 Bacteria 1256
951 Ga0501037_0120485 3300049573 Bacteria 1887
952 Ga0501038_0018195 3300049574 Bacteria 6343
953 Ga0501038_0321673 3300049574 Bacteria 1210
954 Ga0501039_0078087 3300049575 Bacteria 2575
955 Ga0501039_0385024 3300049575 Bacteria 1102
956 Ga0501039_0658355 3300049575 Bacteria 820
957 Ga0501040_0022758 3300049576 Bacteria 4198
958 Ga0501041_0045335 3300049577 Bacteria 2673
959 Ga0501041_0150222 3300049577 Bacteria 1454
960 Ga0501041_0423756 3300049577 Bacteria 844
961 Ga0501041_0454979 3300049577 Bacteria 813
962 Ga0501042_0121769 3300049578 Bacteria 1878
963 Ga0501042_0277938 3300049578 Bacteria 1209
964 Ga0501042_0412801 3300049578 Bacteria 978
965 Ga0501043_0665162 3300049579 Bacteria 764
966 Ga0501046_0213666 3300049580 Bacteria 1431
967 Ga0501046_0300941 3300049580 Bacteria 1171
968 Ga0501047_0367879 3300049581 Bacteria 1273
969 Ga0501047_0402215 3300049581 Bacteria 1202
970 Ga0501067_0042993 3300049583 Bacteria 2509
971 Ga0501067_0054095 3300049583 Bacteria 2224
972 Ga0501067_0311077 3300049583 Bacteria 877
973 Ga0501067_0625893 3300049583 Bacteria 604
974 Ga0501070_0025651 3300049586 Bacteria 4944
975 Ga0501070_0364933 3300049586 Bacteria 1171
976 Ga0501071_0206892 3300049587 Bacteria 1475
977 Ga0501071_0297608 3300049587 Bacteria 1223
978 Ga0501072_0101767 3300049588 Bacteria 2283
979 Ga0501072_0212229 3300049588 Bacteria 1543
980 Ga0501072_0229023 3300049588 Bacteria 1481
981 Ga0501074_0102509 3300049590 Bacteria 2049
982 Ga0501074_0119300 3300049590 Bacteria 1886
983 Ga0501074_0378653 3300049590 Bacteria 1004
984 Ga0501074_0504752 3300049590 Bacteria 857
985 Ga0501075_0061672 3300049591 Bacteria 2826
986 Ga0501075_0921791 3300049591 Unclassified 664
987 Ga0501075_1289454 3300049591 Bacteria 554
988 Ga0501076_0040257 3300049592 Bacteria 3672
989 Ga0501076_0410053 3300049592 Bacteria 1114
990 Ga0501076_0488219 3300049592 Bacteria 1015
991 Ga0501076_0720830 3300049592 Bacteria 823
992 Ga0501076_0901371 3300049592 Bacteria 729
993 Ga0501077_0100551 3300049593 Bacteria 1832
994 Ga0501223_127725 3300049663 Bacteria 541
995 Ga0501079_0097287 3300049741 Bacteria 2282
996 Ga0501079_0128052 3300049741 Bacteria 1975
997 Ga0501079_0340090 3300049741 Bacteria 1176
998 Ga0501079_0622349 3300049741 Bacteria 850
999 Ga0501080_0001402 3300049742 Bacteria 20194
1000 Ga0501080_0051233 3300049742 Bacteria 3841
1001 Ga0501080_0082414 3300049742 Bacteria 2988
1002 Ga0501080_0765808 3300049742 Bacteria 848
1003 Ga0501081_0115588 3300049743 Bacteria 1907
1004 Ga0501083_0139126 3300049744 Bacteria 1590
1005 Ga0501083_0256127 3300049744 Bacteria 1139
1006 Ga0501083_0584422 3300049744 Bacteria 727
1007 Ga0501035_0386981 3300049822 Bacteria 1166
1008 Ga0501035_0798519 3300049822 Bacteria 754
1009 Ga0501044_0002343 3300049823 Bacteria 21608
1010 Ga0501044_0114529 3300049823 Bacteria 2702
1011 Ga0501045_0131667 3300049824 Bacteria 1859
1012 Ga0501045_0139306 3300049824 Bacteria 1804
1013 Ga0501045_0484772 3300049824 Bacteria 918
1014 Ga0501212_017438 3300049851 Bacteria 1086
1015 nmdc:mga03683_198665_c1 3300050489 Bacteria 920
1016 nmdc:mga03n38_24275_c1 3300050490 Bacteria 2477
1017 nmdc:mga03n38_6768_c1 3300050490 Bacteria 4010
1018 nmdc:mga00v17_56028_c1 3300050491 Bacteria 2409
1019 nmdc:mga00v17_857_c1 3300050491 Bacteria 16451
1020 nmdc:mga0yw44_207684_c1 3300050492 Bacteria 1295
1021 nmdc:mga0yw44_24_c1 3300050492 Bacteria 63201
1022 nmdc:mga0yw44_340111_c1 3300050492 Bacteria 1009
1023 nmdc:mga0yw44_454317_c1 3300050492 Bacteria 868
1024 nmdc:mga06z11_26178_c1 3300050494 Bacteria 2774
1025 nmdc:mga07m45_490741_c1 3300050496 Bacteria 711
1026 nmdc:mga05p37_1465195_c1 3300050507 Bacteria 682
1027 nmdc:mga05p37_968139_c1 3300050507 Bacteria 908
1028 nmdc:mga09592_149121_c1 3300050508 Bacteria 2017
1029 nmdc:mga0qj67_353936_c1 3300050509 Unclassified 1187
1030 nmdc:mga0qj67_633462_c1 3300050509 Bacteria 854
1031 nmdc:mga06r32_34684_c1 3300050510 Bacteria 4759
1032 nmdc:mga0sz30_13608_c1 3300050516 Bacteria 3188
1033 Ga0495601_0081039 3300053077 Bacteria 2083
1034 Ga0495601_0084392 3300053077 Bacteria 2040
1035 Ga0495601_0148599 3300053077 Bacteria 1529
1036 Ga0495612_0112434 3300053078 Bacteria 1167
1037 Ga0495595_0234617 3300053084 Bacteria 917
1038 Ga0495619_0067906 3300053085 Bacteria 2381
1039 Ga0500643_000011 3300053087 Bacteria 385630
1040 Ga0500644_0073614 3300053088 Unclassified 1238
1041 Ga0500646_0000823 3300053090 Bacteria 8581
1042 Ga0500646_0085910 3300053090 Bacteria 967
1043 Ga0500583_0015393 3300053092 Bacteria 3024
1044 Ga0500650_0000001 3300053098 Bacteria 818797
1045 Ga0500555_000015 3300053103 Bacteria 230204
1046 Ga0500556_0002977 3300053104 Bacteria 5115
1047 Ga0500582_166635 3300053114 Bacteria 756
1048 Ga0500594_0000001 3300053118 Bacteria 1178472
1049 Ga0500655_001993 3300053133 Bacteria 3793
1050 Ga0500568_0050531 3300053139 Bacteria 1638
1051 Ga0500573_0039578 3300053140 Bacteria 2723
1052 Ga0500577_0021093 3300053142 Bacteria 2142
1053 Ga0500579_016957 3300053143 Bacteria 4707
1054 Ga0500616_0000020 3300053153 Bacteria 530404
1055 Ga0500616_0000144 3300053153 Bacteria 121889
1056 Ga0500616_0006989 3300053153 Bacteria 7263
1057 Ga0500616_0153811 3300053153 Unclassified 1062
1058 Ga0500633_0131975 3300053160 Unclassified 932
1059 Ga0500645_013743 3300053730 Bacteria 2593
1060 Ga0501084_0000009 3300054114 Bacteria 194961
1061 Ga0501084_0939700 3300054114 Bacteria 727
1062 Ga0501084_0945205 3300054114 Bacteria 725
1063 Ga0587066_089815 3300059490 Bacteria 680
1064 Ga0587070_117223 3300059491 Bacteria 632
1065 Ga0587073_0038139 3300059492 Bacteria 1033
1066 Ga0587073_0077499 3300059492 Bacteria 817
1067 Ga0587073_0161331 3300059492 Bacteria 643
1068 Ga0587080_044144 3300059503 Bacteria 822
1069 Ga0587080_065084 3300059503 Bacteria 718
1070 Ga0587082_032282 3300059504 Bacteria 919
1071 Ga0587088_091179 3300059508 Bacteria 667
1072 Ga0587091_026167 3300059511 Bacteria 1061
1073 Ga0587101_052505 3300059623 Bacteria 706
1074 Ga0587067_011258 3300059640 Bacteria 1375
1075 Ga0587079_108338 3300059647 Bacteria 672
1076 Ga0587107_000994 3300059652 Bacteria 2147
1077 Ga0587114_042212 3300059655 Bacteria 743
1078 Ga0587071_064004 3300060344 Bacteria 787
1079 Ga0587111_0000227 3300060346 Bacteria 4609
1080 Ga0501082_0052880 3300060353 Bacteria 3501
1081 Ga0501082_0276428 3300060353 Bacteria 1462
1082 Ga0501082_0281433 3300060353 Bacteria 1448
1083 Ga0501082_0901591 3300060353 Bacteria 773
1084 Ga0466962_0000007 3300061719 Bacteria 157857
1085 Ga0466962_0142444 3300061719 Bacteria 1161
1086 Ga0530510_0615440 3300061734 Bacteria 826
1087 Ga0530510_0699600 3300061734 Bacteria 772
1088 2787506690 2786546548 Bacteria 4745694
1089 2857479634 2857479173 Bacteria 2469263
1090 2857633015 2857632687 Bacteria 2448521
1091 2870801934 2870801768 Bacteria 2710986
1092 2870806323 2870804320 Bacteria 2552467
1093 2915361148 2915358134 Bacteria 6050864
1094 2919449334 2919446982 Bacteria 3994487
1095 Ga0436360_1253719
1096 LJQas_1011332
1097 LJQas_1020987
1098 JGI24740J21852_10032375
1099 JGI24739J22299_10020519
1100 JGI24739J22299_10065933
1101 JGI24737J22298_10058404
1102 JGI24735J21928_10006549
1103 JGI24745J21846_1000243
1104 JGI25406J46586_10045823
1105 Ga0006758J48902_1015144
1106 rootH1_10017476
1107 JGI26145J50221_1015996
1108 JGI25407J50210_10003808
1109 Ga0058859_11666848
1110 Ga0058863_10081680
1111 Ga0058861_10081153
1112 Ga0058860_11519682
1113 Ga0058862_10176130
1114 Ga0065704_10013929
1115 Ga0065704_10310477
1116 Ga0065707_10260152
1117 Ga0070658_10002426
1118 Ga0070658_10013418
1119 Ga0070676_10062744
1120 Ga0070683_100472532
1121 Ga0070683_101326184
1122 Ga0070690_100194556
1123 Ga0070670_100311522
1124 Ga0070670_100633112
1125 Ga0070677_10112211
1126 Ga0070680_100005522
1127 Ga0070680_100301110
1128 Ga0070682_100108095
1129 Ga0070682_100456173
1130 Ga0068868_100130012
1131 Ga0070691_10039056
1132 Ga0070661_100304631
1133 Ga0070669_101252117
1134 Ga0070675_100088085
1135 Ga0070675_100623657
1136 Ga0070671_100069289
1137 Ga0070671_100434575
1138 Ga0070674_101370206
1139 Ga0070673_100050123
1140 Ga0070673_100346530
1141 Ga0070659_100553766
1142 Ga0070659_101594074
1143 Ga0070667_100001546
1144 Ga0070667_100689172
1145 Ga0070714_100000519
1146 Ga0070714_100010979
1147 Ga0070714_100038902
1148 Ga0070714_100073187
1149 Ga0070714_100451565
1150 Ga0070714_100786193
1151 Ga0070713_100786707
1152 Ga0070705_100012015
1153 Ga0070708_100079869
1154 Ga0070708_100414719
1155 Ga0070708_100877106
1156 Ga0070663_100416023
1157 Ga0070681_10005386
1158 Ga0070681_10181889
1159 Ga0070681_10249530
1160 Ga0070681_10283665
1161 Ga0070706_100005771
1162 Ga0070706_100021749
1163 Ga0070706_100060798
1164 Ga0070706_100086360
1165 Ga0070706_100094015
1166 Ga0070706_100469667
1167 Ga0070707_100006596
1168 Ga0070707_100260424
1169 Ga0070707_100367917
1170 Ga0070707_100919066
1171 Ga0070698_100039505
1172 Ga0070698_100064533
1173 Ga0070698_100092897
1174 Ga0070699_100102795
1175 Ga0070679_100009896
1176 Ga0070679_100035803
1177 Ga0070679_100052255
1178 Ga0070679_100422203
1179 Ga0070679_101110144
1180 Ga0070679_101162550
1181 Ga0070684_100080553
1182 Ga0070684_100518353
1183 Ga0070684_100866514
1184 Ga0070684_101014956
1185 Ga0070684_101152728
1186 Ga0070684_101366149
1187 Ga0070697_100002003
1188 Ga0070697_100051727
1189 Ga0070697_100112708
1190 Ga0068853_100021204
1191 Ga0068853_100171689
1192 Ga0068853_100242720
1193 Ga0068853_100320550
1194 Ga0070672_100029248
1195 Ga0070695_100042259
1196 Ga0070695_100739244
1197 Ga0070696_100027888
1198 Ga0070696_101019814
1199 Ga0070704_100080301
1200 Ga0068855_100011055
1201 Ga0068855_100044376
1202 Ga0070664_100819856
1203 Ga0068854_100000039
1204 Ga0068854_100400572
1205 Ga0068854_100566774
1206 Ga0068856_100002334
1207 Ga0068856_100004352
1208 Ga0068856_100414606
1209 Ga0068852_100112440
1210 Ga0068852_100126825
1211 Ga0068852_100126863
1212 Ga0068852_100148325
1213 Ga0068852_101100491
1214 Ga0068864_100005865
1215 Ga0068864_100466379
1216 Ga0068864_100987440
1217 Ga0068861_100759110
1218 Ga0068863_100001338
1219 Ga0068863_100016860
1220 Ga0068863_100388856
1221 Ga0068863_100449272
1222 Ga0068863_101758844
1223 Ga0068860_100439747
1224 Ga0068860_100448021
1225 Ga0068860_100579261
1226 Ga0068862_100000836
1227 Ga0068862_100201289
1228 Ga0068862_101119795
1229 Ga0081455_10009428
1230 Ga0081455_10090574
1231 Ga0081455_10118573
1232 Ga0081539_10001876
1233 Ga0081539_10002696
1234 Ga0081539_10030228
1235 Ga0081539_10113538
1236 Ga0070717_10029749
1237 Ga0075365_10000022
1238 Ga0075365_10069816
1239 Ga0075365_10089848
1240 Ga0075365_10188819
1241 Ga0075365_10447267
1242 Ga0075365_10497871
1243 Ga0075368_10048857
1244 Ga0075368_10266116
1245 Ga0075363_100033980
1246 Ga0075363_100080865
1247 Ga0075363_100105724
1248 Ga0075364_10000985
1249 Ga0075364_10194889
1250 Ga0075362_10239657
1251 Ga0075367_10030754
1252 Ga0075367_10464222
1253 Ga0075369_10168099
1254 Ga0075427_10000259
1255 Ga0075366_10528685
1256 Ga0097621_100000003
1257 Ga0097621_100158295
1258 Ga0068871_100000013
1259 Ga0068871_100713511
1260 Ga0068871_101009764
1261 Ga0068871_101353779
1262 Ga0075428_100093456
1263 Ga0075428_100145249
1264 Ga0075428_101079417
1265 Ga0075430_100221438
1266 Ga0075430_100277403
1267 Ga0075430_100370297
1268 Ga0075431_100003767
1269 Ga0075429_100029758
1270 Ga0075436_100082948
1271 Ga0097620_100027915
1272 Ga0105244_10338770
1273 Ga0105240_10132772
1274 Ga0105240_10168667
1275 Ga0105240_10258457
1276 Ga0105240_10746933
1277 Ga0105240_11917813
1278 Ga0105245_10016124
1279 Ga0105245_10022092
1280 Ga0105245_10232985
1281 Ga0105245_10284933
1282 Ga0105245_10635929
1283 Ga0105247_10166279
1284 Ga0114129_10031086
1285 Ga0114129_11472071
1286 Ga0105243_11575488
1287 Ga0105241_10001993
1288 Ga0105241_10142001
1289 Ga0105241_10152358
1290 Ga0105241_10502991
1291 Ga0105241_10731442
1292 Ga0105242_10003381
1293 Ga0105248_10153043
1294 Ga0105248_10592087
1295 Ga0105237_10194860
1296 Ga0105237_10293324
1297 Ga0105238_10757487
1298 Ga0105238_11930005
1299 Ga0105249_10262411
1300 Ga0105249_10406852
1301 Ga0105249_10833232
1302 Ga0105032_101210
1303 Ga0157370_10065219
1304 Ga0157370_10400599
1305 Ga0157370_10771027
1306 Ga0157369_10037648
1307 Ga0157369_10351553
1308 Ga0157369_10859241
1309 Ga0157374_10128502
1310 Ga0157374_10244772
1311 Ga0157374_10249498
1312 Ga0157374_10568133
1313 Ga0157378_11216508
1314 Ga0163162_10138655
1315 Ga0163162_10175359
1316 Ga0163162_10586208
1317 Ga0163162_10720435
1318 Ga0163162_11756325
1319 Ga0157372_10057778
1320 Ga0157372_10167743
1321 Ga0157372_10373824
1322 Ga0157372_10800475
1323 Ga0157372_11479550
1324 Ga0157375_10383381
1325 Ga0157375_10872734
1326 Ga0157375_11223493
1327 Ga0163163_10006948
1328 Ga0163163_10011237
1329 Ga0163163_10360035
1330 Ga0163163_10518653
1331 Ga0163163_10796684
1332 Ga0157380_10000051
1333 Ga0157380_10251534
1334 Ga0157380_10852707
1335 Ga0157380_11209403
1336 Ga0182008_10058233
1337 Ga0182008_10082236
1338 Ga0182008_10234480
1339 Ga0182008_10350635
1340 Ga0157377_10409985
1341 Ga0157379_10000101
1342 Ga0157379_10009261
1343 Ga0157379_11830586
1344 Ga0157376_10024093
1345 Ga0182006_1084553
1346 Ga0163161_10131187
1347 Ga0197907_10311092
1348 Ga0197907_10333276
1349 Ga0197907_10773738
1350 Ga0197907_10800216
1351 Ga0197907_11130806
1352 Ga0197907_11365827
1353 Ga0206356_10169717
1354 Ga0206356_10226831
1355 Ga0206356_10929817
1356 Ga0206356_11287527
1357 Ga0206356_11574971
1358 Ga0206349_1119855
1359 Ga0206349_1637736
1360 Ga0206355_1680354
1361 Ga0206351_10175414
1362 Ga0206352_10667425
1363 Ga0206352_10734764
1364 Ga0206350_10443236
1365 Ga0206350_10587188
1366 Ga0206354_10391537
1367 Ga0206354_11636011
1368 Ga0206353_10434407
1369 Ga0206353_11273815
1370 Ga0206353_11828919
1371 Ga0154015_1602284
1372 Ga0213873_10000595
1373 Ga0213873_10003193
1374 Ga0213873_10018295
1375 Ga0213873_10021366
1376 Ga0213872_10004954
1377 Ga0213872_10007856
1378 Ga0213872_10112260
1379 Ga0213874_10018062
1380 Ga0213874_10030397
1381 Ga0213876_10003555
1382 Ga0213876_10012912
1383 Ga0213876_10014070
1384 Ga0213876_10351894
1385 Ga0213875_10000001
1386 Ga0213875_10012869
1387 Ga0213875_10041646
1388 Ga0213875_10169764
1389 Ga0213875_10195584
1390 Ga0213871_10009458
1391 Ga0213871_10077498
1392 Ga0224712_10000619
1393 Ga0224712_10003141
1394 Ga0224712_10153846
1395 Ga0224712_10420420
1396 Ga0207682_10028296
1397 Ga0207710_10106538
1398 Ga0207688_10042403
1399 Ga0207688_10164176
1400 Ga0207680_10324918
1401 Ga0207645_10048082
1402 Ga0207645_10154236
1403 Ga0207645_10390091
1404 Ga0207705_10116912
1405 Ga0207705_11044194
1406 Ga0207684_10034076
1407 Ga0207684_10068282
1408 Ga0207684_10100069
1409 Ga0207684_10211204
1410 Ga0207684_10372727
1411 Ga0207654_10001365
1412 Ga0207654_10319989
1413 Ga0207654_10549538
1414 Ga0207707_10024016
1415 Ga0207707_10303873
1416 Ga0207695_10116275
1417 Ga0207695_10156152
1418 Ga0207695_10192227
1419 Ga0207695_10298515
1420 Ga0207695_10308587
1421 Ga0207695_10992685
1422 Ga0207660_10016445
1423 Ga0207649_10238151
1424 Ga0207652_10013911
1425 Ga0207652_10036196
1426 Ga0207652_10061003
1427 Ga0207652_10494878
1428 Ga0207646_10045629
1429 Ga0207646_10049384
1430 Ga0207646_10155120
1431 Ga0207694_10834799
1432 Ga0207650_10362585
1433 Ga0207659_10068746
1434 Ga0207687_10004724
1435 Ga0207687_10304270
1436 Ga0207700_10527734
1437 Ga0207700_10646612
1438 Ga0207664_10002006
1439 Ga0207664_10040228
1440 Ga0207664_10074167
1441 Ga0207664_10169646
1442 Ga0207664_10360769
1443 Ga0207644_10020573
1444 Ga0207690_10091738
1445 Ga0207690_10639806
1446 Ga0207706_10330499
1447 Ga0207706_10398213
1448 Ga0207686_10000781
1449 Ga0207704_10882007
1450 Ga0207691_10009551
1451 Ga0207691_10527260
1452 Ga0207691_10929260
1453 Ga0207711_10145542
1454 Ga0207689_10357275
1455 Ga0207661_10067883
1456 Ga0207661_10121653
1457 Ga0207661_10393341
1458 Ga0207661_10760954
1459 Ga0207661_10945419
1460 Ga0207661_11114104
1461 Ga0207679_10815623
1462 Ga0207667_10001579
1463 Ga0207667_10103107
1464 Ga0207667_10150143
1465 Ga0207667_11482633
1466 Ga0207651_10003118
1467 Ga0207651_10693290
1468 Ga0207712_10015493
1469 Ga0207712_10147470
1470 Ga0207712_10183651
1471 Ga0207668_11034222
1472 Ga0207640_10000024
1473 Ga0207640_10151384
1474 Ga0207640_10300351
1475 Ga0207658_10005603
1476 Ga0207677_10072215
1477 Ga0207677_10341212
1478 Ga0207703_10003502
1479 Ga0207639_10001948
1480 Ga0207639_10158693
1481 Ga0207678_10062167
1482 Ga0207678_10244885
1483 Ga0207678_11292418
1484 Ga0207702_10003580
1485 Ga0207702_10025526
1486 Ga0207702_10403334
1487 Ga0207641_10003356
1488 Ga0207641_10009791
1489 Ga0207641_10256022
1490 Ga0207641_10721055
1491 Ga0207641_11718782
1492 Ga0207676_10007479
1493 Ga0207676_10689264
1494 Ga0207674_10862747
1495 Ga0207675_100162293
1496 Ga0207683_10266407
1497 Ga0207683_10407855
1498 Ga0207698_10014555
1499 Ga0207698_10072106
1500 Ga0207698_10101413
1501 Ga0207698_10263011
1502 Ga0207698_10387015
1503 Ga0209998_10101827
1504 Ga0265356_1000525
1505 Ga0268266_10217248
1506 Ga0268266_10288535
1507 Ga0268265_10000156
1508 Ga0268265_10131898
1509 Ga0268265_10961086
1510 Ga0268264_10086134
1511 Ga0268264_10261615
1512 Ga0265337_1043836
1513 Ga0265326_10012298
1514 Ga0265334_10007247
1515 Ga0265334_10047737
1516 Ga0265318_10022101
1517 Ga0265318_10044756
1518 Ga0265318_10215517
1519 Ga0265323_10012167
1520 Ga0265323_10112210
1521 Ga0265323_10189094
1522 Ga0265322_10007533
1523 Ga0265322_10008553
1524 Ga0265322_10128186
1525 Ga0265336_10006414
1526 Ga0265336_10029741
1527 Ga0265336_10072437
1528 Ga0265336_10100799
1529 Ga0265338_10000052
1530 Ga0265338_10000054
1531 Ga0265338_10000178
1532 Ga0265338_10000366
1533 Ga0265338_10000396
1534 Ga0265338_10080483
1535 Ga0265338_10084583
1536 Ga0265338_10085544
1537 Ga0265338_10151474
1538 Ga0265338_10561404
1539 Ga0265324_10010795
1540 Ga0265324_10024082
1541 Ga0265324_10059466
1542 Ga0265324_10192185
1543 Ga0265762_1003191
1544 Ga0265762_1012092
1545 Ga0265765_1013536
1546 Ga0265760_10000904
1547 Ga0265330_10013203
1548 Ga0265332_10008843
1549 Ga0265332_10011261
1550 Ga0265328_10022106
1551 Ga0265320_10171585
1552 Ga0265325_10002829
1553 Ga0265325_10013636
1554 Ga0265325_10026083
1555 Ga0265325_10030390
1556 Ga0265325_10089657
1557 Ga0265329_10008966
1558 Ga0265340_10015913
1559 Ga0265340_10017309
1560 Ga0265340_10179788
1561 Ga0265339_10013311
1562 Ga0265339_10024094
1563 Ga0265339_10059896
1564 Ga0265339_10142322
1565 Ga0265339_10143592
1566 Ga0265331_10014050
1567 Ga0265331_10362469
1568 Ga0265327_10004316
1569 Ga0265327_10026829
1570 Ga0265327_10054273
1571 Ga0265327_10069113
1572 Ga0265316_10036091
1573 Ga0265316_10061416
1574 Ga0265316_10114249
1575 Ga0265316_10148230
1576 Ga0265316_10184223
1577 Ga0265316_10377257
1578 Ga0307408_100823598
1579 Ga0265313_10010254
1580 Ga0265313_10024100
1581 Ga0265313_10110775
1582 Ga0307508_10040608
1583 Ga0316575_10121553
1584 Ga0316579_10003148
1585 Ga0265314_10056945
1586 Ga0265314_10257790
1587 Ga0265314_10445906
1588 Ga0265342_10006015
1589 Ga0265342_10006331
1590 Ga0265342_10042321
1591 Ga0316576_10000044
1592 Ga0316576_10040833
1593 Ga0316576_10102429
1594 Ga0316576_10120771
1595 Ga0316576_10159441
1596 Ga0316576_10164563
1597 Ga0316576_10383256
1598 Ga0316578_10036090
1599 Ga0316578_10047642
1600 Ga0307405_10040503
1601 Ga0307405_10088557
1602 Ga0307405_10201904
1603 Ga0307405_10537633
1604 Ga0316577_10016991
1605 Ga0316577_10134021
1606 Ga0316577_10508590
1607 Ga0307413_10355754
1608 Ga0307410_10477080
1609 Ga0307410_10914426
1610 Ga0307410_11092447
1611 Ga0307410_11508453
1612 Ga0307406_10024435
1613 Ga0307406_11556420
1614 Ga0307407_10022946
1615 Ga0307407_10112594
1616 Ga0307407_10474008
1617 Ga0307412_10196528
1618 Ga0307412_11132929
1619 Ga0307412_11232736
1620 Ga0307409_100100999
1621 Ga0307409_100392921
1622 Ga0307416_100035072
1623 Ga0307416_100074155
1624 Ga0307416_100318729
1625 Ga0307416_100513006
1626 Ga0307416_100596914
1627 Ga0307416_102470482
1628 Ga0307414_10066151
1629 Ga0307411_10017055
1630 Ga0307411_11573956
1631 Ga0307415_100045358
1632 Ga0307415_100676782
1633 Ga0307415_100941902
1634 Ga0316583_10018078
1635 Ga0316585_10022471
1636 Ga0316580_10001591
1637 Ga0316593_10000617
1638 Ga0316593_10003813
1639 Ga0316593_10004644
1640 Ga0316593_10009065
1641 Ga0316593_10013598
1642 Ga0316593_10045668
1643 Ga0316593_10057174
1644 Ga0316593_10115814
1645 Ga0316593_10256387
1646 Ga0316592_1000648
1647 Ga0316592_1000962
1648 Ga0316592_1001542
1649 Ga0316592_1005486
1650 Ga0316592_1005684
1651 Ga0316592_1008299
1652 Ga0316592_1021735
1653 Ga0316592_1027220
1654 Ga0316588_1000021
1655 Ga0316588_1006251
1656 Ga0316588_1022587
1657 Ga0316587_1049711
1658 Ga0316596_1000103
1659 Ga0316596_1001763
1660 Ga0316596_1002456
1661 Ga0316596_1003921
1662 Ga0316596_1029434
1663 Ga0316596_1037856
1664 Ga0316596_1051195
1665 Ga0316596_1059076
1666 Ga0316596_1062764
1667 Ga0373934_0107996
1668 Ga0373944_0158224
1669 Ga0373923_0368975
1670 Ga0373960_0069319
1671 Ga0373943_0080168
1672 Ga0316574_0000425
1673 Ga0316574_0004026
1674 Ga0316574_0029464
1675 Ga0316574_0037513
1676 Ga0316574_0043756
1677 Ga0316574_0061678
1678 Ga0316574_0097531
1679 Ga0316574_0269817
1680 Ga0316574_0475492
1681 Ga0373931_0044819
1682 Ga0373931_0236961
1683 Ga0373935_0004181
1684 Ga0373935_0151089
1685 Ga0373927_0160436
1686 Ga0373947_0170363
1687 Ga0373947_0185913
1688 Ga0373947_0191364
1689 Ga0316582_0001841
1690 Ga0316582_0006061
1691 Ga0316582_0407926
1692 Ga0316584_0003484
1693 Ga0316584_0025317
1694 Ga0316584_0109969
1695 Ga0316584_0176768
1696 Ga0316584_0222519
1697 Ga0373925_0018411
1698 Ga0373925_0453019
1699 Ga0395899_0000039
1700 Ga0395899_0004980
1701 Ga0395900_0069514
1702 Ga0395900_0117663
1703 Ga0395900_0350503
1704 Ga0395900_0807168
1705 Ga0395898_0000226
1706 Ga0395898_0008404
1707 Ga0395898_0688006
1708 Ga0395905_0006755
1709 Ga0436364_0196276
1710 Ga0436364_0273345
1711 Ga0436364_0539388
1712 Ga0436364_0575822
1713 Ga0436364_0646491
1714 Ga0436364_0798963
1715 Ga0436364_0990835
1716 Ga0436364_1111625
1717 Ga0436364_1142864
1718 Ga0436364_1200424
1719 Ga0436364_1211243
1720 Ga0436364_1276914
1721 Ga0436364_1306001
1722 Ga0436364_1494664
1723 Ga0395901_0018326
1724 Ga0395901_0195273
1725 Ga0395901_0312522
1726 Ga0436365_0097047
1727 Ga0436365_0230296
1728 Ga0436365_0427864
1729 Ga0436365_0767674
1730 Ga0436365_0794964
1731 Ga0436365_0979666
1732 Ga0436365_1319563
1733 Ga0436365_1660231
1734 Ga0436365_1904939
1735 Ga0436360_0002462
1736 Ga0436360_0355760
1737 Ga0436360_0422973
1738 Ga0436360_0651805
1739 Ga0436360_0665312
1740 Ga0436360_0766016
1741 Ga0436360_0979202
1742 Ga0436360_1033819
1743 Ga0436360_1055305
1744 Ga0436360_1112229
1745 Ga0436360_1146218
1746 Ga0436360_1149615
1747 Ga0436360_1209713
1748 Ga0436360_1218238
1749 Ga0436361_0080925
1750 Ga0436361_0143737
1751 Ga0436361_0269103
1752 Ga0436361_0423980
1753 Ga0436361_0473343
1754 Ga0436361_0627825
1755 Ga0436361_0738206
1756 Ga0436361_0776532
1757 Ga0436361_0801716
1758 Ga0436361_1140566
1759 Ga0436361_1143312
1760 Ga0436361_1165208
1761 Ga0436363_0138227
1762 Ga0436363_0403132
1763 Ga0436363_0634802
1764 Ga0436363_0947238
1765 Ga0436363_1017066
1766 Ga0436363_1100879
1767 Ga0436363_1252147
1768 Ga0436362_0091064
1769 Ga0436362_0107616
1770 Ga0436362_0109475
1771 Ga0436362_0226828
1772 Ga0436362_0399122
1773 Ga0436362_0437798
1774 Ga0436362_0595348
1775 Ga0436362_0684804
1776 Ga0436362_0763995
1777 Ga0436362_0973701
1778 Ga0436362_1010063
1779 Ga0436362_1075726
1780 Ga0436362_1127986
1781 Ga0436362_1295225
1782 Ga0451798_0436115
1783 Ga0451802_1017005
1784 Ga0451845_0268857
1785 Ga0451852_14070
1786 Ga0451843_0911427
1787 Ga0451855_1261441
1788 Ga0451855_1789869
1789 Ga0450916_090822
1790 Ga0451577_0000433
1791 Ga0451577_0009630
1792 Ga0451577_0016499
1793 Ga0451577_0019005
1794 Ga0451577_0038053
1795 Ga0451577_0094271
1796 Ga0451577_0113079
1797 Ga0451577_0121175
1798 Ga0451577_0312572
1799 Ga0451577_0325812
1800 Ga0451577_0451515
1801 Ga0451577_0883983
1802 Ga0451577_1105802
1803 Ga0451577_1262305
1804 Ga0466969_0044133
1805 Ga0453683_0000522
1806 Ga0453683_0003998
1807 Ga0453683_0077428
1808 Ga0453683_0117933
1809 Ga0453683_0175995
1810 Ga0453683_0199689
1811 Ga0453683_0564067
1812 Ga0466965_0058570
1813 Ga0466966_0012777
1814 Ga0466966_0417838
1815 Ga0466961_0113127
1816 Ga0466963_0030151
1817 Ga0466964_0156772
1818 Ga0453684_0000055
1819 Ga0453684_0000171
1820 Ga0453684_0000420
1821 Ga0453684_0000506
1822 Ga0453684_0000588
1823 Ga0453684_0001549
1824 Ga0453684_0001835
1825 Ga0453684_0002161
1826 Ga0453684_0002895
1827 Ga0453684_0005528
1828 Ga0453684_0005656
1829 Ga0453684_0016436
1830 Ga0453684_0030092
1831 Ga0453684_0035909
1832 Ga0453684_0057385
1833 Ga0453684_0065863
1834 Ga0453684_0075151
1835 Ga0453684_0106268
1836 Ga0453684_0143075
1837 Ga0453684_0167534
1838 Ga0453684_0168330
1839 Ga0453684_0168811
1840 Ga0453684_0168952
1841 Ga0453684_0202716
1842 Ga0453684_0219953
1843 Ga0453684_0263102
1844 Ga0453684_0273428
1845 Ga0453684_0452149
1846 Ga0453684_0546743
1847 Ga0453684_0558997
1848 Ga0453684_0741452
1849 Ga0453684_1057136
1850 Ga0453684_1273020
1851 Ga0453684_1420829
1852 Ga0453684_1549238
1853 Ga0466971_0000005
1854 Ga0466971_0283155
1855 Ga0466970_0021508
1856 Ga0466970_0057209
1857 Ga0466957_0069306
1858 Ga0466957_0083253
1859 Ga0466960_0039668
1860 Ga0466960_0402246
1861 Ga0451576_0000204
1862 Ga0451576_0000454
1863 Ga0451576_0000689
1864 Ga0451576_0016407
1865 Ga0451576_0024947
1866 Ga0451576_0031702
1867 Ga0451576_0032623
1868 Ga0451576_0034310
1869 Ga0451576_0076007
1870 Ga0451576_0099789
1871 Ga0451576_0751403
1872 Ga0451576_1172790
1873 Ga0466958_0005653
1874 Ga0466958_0020009
1875 Ga0466958_0569552
1876 Ga0466958_0726359
1877 Ga0466967_0001979
1878 Ga0466967_0061054
1879 Ga0466967_0088574
1880 Ga0466967_0105905
1881 Ga0466967_0116667
1882 Ga0466967_0264149
1883 Ga0466967_1792423
1884 Ga0495592_0163757
1885 Ga0495603_0094891
1886 Ga0495629_0088772
1887 Ga0495629_0739081
1888 Ga0495638_0000070
1889 Ga0495641_0239686
1890 Ga0495651_0370821
1891 Ga0495580_0002023
1892 Ga0495585_0038134
1893 Ga0495594_0304702
1894 Ga0495596_0034263
1895 Ga0495608_0221722
1896 Ga0495616_0080146
1897 Ga0495620_0047535
1898 Ga0495628_0364349
1899 Ga0495628_0366101
1900 Ga0495644_0155928
1901 Ga0495652_0611799
1902 Ga0495665_0074242
1903 Ga0495640_0177675
1904 Ga0495598_0201598
1905 Ga0495621_0023755
1906 Ga0495645_0489943
1907 Ga0495656_0067316
1908 Ga0495611_0051314
1909 Ga0495659_0258467
1910 Ga0495661_0160588
1911 Ga0495588_0168354
1912 Ga0495657_0152480
1913 Ga0495657_0778041
1914 Ga0495599_0466266
1915 Ga0495623_0210189
1916 Ga0495658_0479285
1917 Ga0495624_0175255
1918 Ga0495624_0528731
1919 Ga0495670_0400508
1920 Ga0495671_0134863
1921 Ga0495604_0022605
1922 Ga0495604_0152364
1923 Ga0495674_0113319
1924 Ga0495680_0064028
1925 Ga0495685_030399
1926 Ga0495681_0166072
1927 Ga0495684_0287403
1928 Ga0495593_0055492
1929 Ga0495614_0067207
1930 Ga0495614_0260507
1931 Ga0495615_0003053
1932 Ga0496100_0024180
1933 Ga0496101_0019981
1934 Ga0496101_0127638
1935 Ga0496101_0351673
1936 Ga0496102_0000521
1937 Ga0496102_0008968
1938 Ga0496102_0469355
1939 Ga0496103_0000453
1940 Ga0496103_0004001
1941 Ga0496103_0216742
1942 Ga0496104_0011710
1943 Ga0496104_0682652
1944 Ga0496105_0037579
1945 Ga0496106_0009483
1946 Ga0496106_0102077
1947 Ga0496106_0216500
1948 Ga0496107_0056740
1949 Ga0496107_0097517
1950 Ga0496107_0560506
1951 Ga0496108_0060974
1952 Ga0496108_0323400
1953 Ga0496109_0282341
1954 Ga0496110_0270447
1955 Ga0496110_0296428
1956 Ga0496111_0695855
1957 Ga0496114_0101670
1958 Ga0496114_0185091
1959 Ga0496114_0241555
1960 Ga0496114_0834586
1961 Ga0496115_0216592
1962 Ga0496116_0000173
1963 Ga0496116_0001739
1964 Ga0496116_0003301
1965 Ga0496117_0000124
1966 Ga0496117_0000144
1967 Ga0496117_0031708
1968 Ga0496118_0000096
1969 Ga0496118_0012385
1970 Ga0496118_0036819
1971 Ga0496119_0000020
1972 Ga0496119_0003189
1973 Ga0496119_0009028
1974 Ga0496120_0000006
1975 Ga0496120_0004033
1976 Ga0496120_0051139
1977 Ga0496120_0089736
1978 Ga0496120_0090271
1979 Ga0496121_0016153
1980 Ga0496122_0000040
1981 Ga0496122_0000140
1982 Ga0496122_0000802
1983 Ga0496123_0000572
1984 Ga0496123_0004284
1985 Ga0496123_0007798
1986 Ga0496124_0003352
1987 Ga0496124_0096000
1988 Ga0496125_0000010
1989 Ga0496125_0000110
1990 Ga0496125_0004049
1991 Ga0496125_0006483
1992 Ga0496125_0011762
1993 Ga0496126_0000060
1994 Ga0496126_0000246
1995 Ga0496126_0000330
1996 Ga0496126_0002082
1997 Ga0496126_0131654
1998 Ga0496126_0156649
1999 Ga0496126_0447888
2000 Ga0501306_020430
2001 Ga0501306_032012
2002 Ga0501309_029917
2003 Ga0501310_046146
2004 Ga0501305_007398
2005 Ga0501307_000425
2006 Ga0501296_045384
2007 Ga0501300_057751
2008 Ga0501311_006327
2009 Ga0501312_003515
2010 Ga0501313_008295
2011 Ga0501315_010905
2012 Ga0501315_018361
2013 Ga0501315_071662
2014 Ga0501316_017614
2015 Ga0501316_024289
2016 Ga0501316_029123
2017 Ga0501317_017738
2018 Ga0501317_026333
2019 Ga0501317_027225
2020 Ga0501318_001927
2021 Ga0501318_016204
2022 Ga0501318_028307
2023 Ga0501319_004209
2024 Ga0501319_018983
2025 Ga0501320_001561
2026 Ga0501321_034086
2027 Ga0501322_006519
2028 Ga0501322_012040
2029 Ga0501324_002357
2030 Ga0501325_030486
2031 Ga0501327_04773
2032 Ga0501331_10332
2033 Ga0501334_06131
2034 Ga0501338_01088
2035 Ga0501340_015584
2036 Ga0501031_0013728
2037 Ga0501031_0131278
2038 Ga0501031_0255102
2039 Ga0501032_0401675
2040 Ga0501033_0000015
2041 Ga0501034_0039000
2042 Ga0501034_0804113
2043 Ga0501036_0277221
2044 Ga0501036_0338927
2045 Ga0501037_0120485
2046 Ga0501038_0018195
2047 Ga0501038_0321673
2048 Ga0501039_0078087
2049 Ga0501039_0385024
2050 Ga0501039_0658355
2051 Ga0501040_0022758
2052 Ga0501041_0045335
2053 Ga0501041_0150222
2054 Ga0501041_0423756
2055 Ga0501041_0454979
2056 Ga0501042_0121769
2057 Ga0501042_0277938
2058 Ga0501042_0412801
2059 Ga0501043_0665162
2060 Ga0501046_0213666
2061 Ga0501046_0300941
2062 Ga0501047_0367879
2063 Ga0501047_0402215
2064 Ga0501067_0042993
2065 Ga0501067_0054095
2066 Ga0501067_0311077
2067 Ga0501067_0625893
2068 Ga0501070_0025651
2069 Ga0501070_0364933
2070 Ga0501071_0206892
2071 Ga0501071_0297608
2072 Ga0501072_0101767
2073 Ga0501072_0212229
2074 Ga0501072_0229023
2075 Ga0501074_0102509
2076 Ga0501074_0119300
2077 Ga0501074_0378653
2078 Ga0501074_0504752
2079 Ga0501075_0061672
2080 Ga0501075_0921791
2081 Ga0501075_1289454
2082 Ga0501076_0040257
2083 Ga0501076_0410053
2084 Ga0501076_0488219
2085 Ga0501076_0720830
2086 Ga0501076_0901371
2087 Ga0501077_0100551
2088 Ga0501223_127725
2089 Ga0501079_0097287
2090 Ga0501079_0128052
2091 Ga0501079_0340090
2092 Ga0501079_0622349
2093 Ga0501080_0001402
2094 Ga0501080_0051233
2095 Ga0501080_0082414
2096 Ga0501080_0765808
2097 Ga0501081_0115588
2098 Ga0501083_0139126
2099 Ga0501083_0256127
2100 Ga0501083_0584422
2101 Ga0501035_0386981
2102 Ga0501035_0798519
2103 Ga0501044_0002343
2104 Ga0501044_0114529
2105 Ga0501045_0131667
2106 Ga0501045_0139306
2107 Ga0501045_0484772
2108 Ga0501212_017438
2109 nmdc:mga03683_198665_c1
2110 nmdc:mga03n38_24275_c1
2111 nmdc:mga03n38_6768_c1
2112 nmdc:mga00v17_56028_c1
2113 nmdc:mga00v17_857_c1
2114 nmdc:mga0yw44_207684_c1
2115 nmdc:mga0yw44_24_c1
2116 nmdc:mga0yw44_340111_c1
2117 nmdc:mga0yw44_454317_c1
2118 nmdc:mga06z11_26178_c1
2119 nmdc:mga07m45_490741_c1
2120 nmdc:mga05p37_1465195_c1
2121 nmdc:mga05p37_968139_c1
2122 nmdc:mga09592_149121_c1
2123 nmdc:mga0qj67_353936_c1
2124 nmdc:mga0qj67_633462_c1
2125 nmdc:mga06r32_34684_c1
2126 nmdc:mga0sz30_13608_c1
2127 Ga0495601_0081039
2128 Ga0495601_0084392
2129 Ga0495601_0148599
2130 Ga0495612_0112434
2131 Ga0495595_0234617
2132 Ga0495619_0067906
2133 Ga0500643_000011
2134 Ga0500644_0073614
2135 Ga0500646_0000823
2136 Ga0500646_0085910
2137 Ga0500583_0015393
2138 Ga0500650_0000001
2139 Ga0500555_000015
2140 Ga0500556_0002977
2141 Ga0500582_166635
2142 Ga0500594_0000001
2143 Ga0500655_001993
2144 Ga0500568_0050531
2145 Ga0500573_0039578
2146 Ga0500577_0021093
2147 Ga0500579_016957
2148 Ga0500616_0000020
2149 Ga0500616_0000144
2150 Ga0500616_0006989
2151 Ga0500616_0153811
2152 Ga0500633_0131975
2153 Ga0500645_013743
2154 Ga0501084_0000009
2155 Ga0501084_0939700
2156 Ga0501084_0945205
2157 Ga0587066_089815
2158 Ga0587070_117223
2159 Ga0587073_0038139
2160 Ga0587073_0077499
2161 Ga0587073_0161331
2162 Ga0587080_044144
2163 Ga0587080_065084
2164 Ga0587082_032282
2165 Ga0587088_091179
2166 Ga0587091_026167
2167 Ga0587101_052505
2168 Ga0587067_011258
2169 Ga0587079_108338
2170 Ga0587107_000994
2171 Ga0587114_042212
2172 Ga0587071_064004
2173 Ga0587111_0000227
2174 Ga0501082_0052880
2175 Ga0501082_0276428
2176 Ga0501082_0281433
2177 Ga0501082_0901591
2178 Ga0466962_0000007
2179 Ga0466962_0142444
2180 Ga0530510_0615440
2181 Ga0530510_0699600
2182 2787506690
2183 2857479634
2184 2857633015
2185 2870801934
2186 2870806323
2187 2915361148
2188 2919449334

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

108

183

0.97

PF00347

Ribosomal_L6

Ribosomal protein L6

29

100

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_g cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.973 2 177
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9666 2 175
5dm7-assembly1.cif.gz_E crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.9652 8 175
8cvm-assembly1.cif.gz_g cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9623 2 177
5mmi-assembly1.cif.gz_G structure of the large subunit of the chloroplast ribosome 0.9617 2 177
ID Description Score Start End Superfamily
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9724 84 175 3.90.930.12
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9669 84 175 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.962 84 169 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9617 87 179 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9589 1 83 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A4Q7CIM0-F1-model_v4 50S ribosomal protein L6 1.002 86 162 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9932 54 162 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A6F8LZI7-F1-model_v4 Large ribosomal subunit protein uL6 0.9916 1 173 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A6G3V3R5-F1-model_v4 deleted 0.9871 1 143
AF-A0A2V5P1Y2-F1-model_v4 50S ribosomal protein L6 0.9871 82 177 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Map