F489944
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1094 | 460 | 2188 | 177 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_1253719|Ga0436360_1253719_149_751 |
| Length | 200 |
| Sequence | MGGAELGAERLFIGAPFKMSRIGKLPVAVPSGVNVTVEGDEVAVKGPKGELRRRVLEHVGVALEGGKVVVHRKGEAKQHRAAHGLTRTLVNNMIEGVSKGFRKSLEIQGVGYRAAKSGEKVNLTLGFSHPVSYEPPKGITLSVEGTNKIHVDGIDKQQVGQVAAEIRNLRPPEPYKGKGVRYEGEVVRKKLGKAXXXXKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 12 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 118 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 125 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 126 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 130 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 210 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 214 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 215 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 228 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 229 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 230 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 246 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 257 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 258 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 261 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 262 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 263 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 264 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 273 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 274 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 275 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 334 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 337 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 338 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 339 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 340 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 341 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 344 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 345 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 346 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 347 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 348 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 354 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 355 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 404 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 406 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 415 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 420 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 422 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 423 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 424 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 425 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 426 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 429 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 431 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 432 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 433 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 434 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 435 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 436 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 453 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 454 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 455 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 456 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 457 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 458 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 459 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 460 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.3 |
| Metatranscriptomes | 11.06 |
| Isolates | 0.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.66 |
| Nodule | 0 |
| Rhizoplane | 2.93 |
| Rhizosphere | 83.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436360_1253719 | 3300039438 | Bacteria | 808 |
| 2 | LJQas_1011332 | 3300000549 | Bacteria | 1060 |
| 3 | LJQas_1020987 | 3300000549 | Bacteria | 759 |
| 4 | JGI24740J21852_10032375 | 3300001979 | Bacteria | 1672 |
| 5 | JGI24739J22299_10020519 | 3300001989 | Bacteria | 2360 |
| 6 | JGI24739J22299_10065933 | 3300001989 | Bacteria | 1135 |
| 7 | JGI24737J22298_10058404 | 3300001990 | Bacteria | 1163 |
| 8 | JGI24735J21928_10006549 | 3300002067 | Bacteria | 3829 |
| 9 | JGI24745J21846_1000243 | 3300002073 | Bacteria | 4512 |
| 10 | JGI25406J46586_10045823 | 3300003203 | Unclassified | 1502 |
| 11 | Ga0006758J48902_1015144 | 3300003300 | Bacteria | 3291 |
| 12 | rootH1_10017476 | 3300003316 | Bacteria | 1140 |
| 13 | JGI26145J50221_1015996 | 3300003371 | Unclassified | 697 |
| 14 | JGI25407J50210_10003808 | 3300003373 | Bacteria | 3646 |
| 15 | Ga0058859_11666848 | 3300004798 | Bacteria | 6681 |
| 16 | Ga0058863_10081680 | 3300004799 | Bacteria | 8733 |
| 17 | Ga0058861_10081153 | 3300004800 | Bacteria | 10561 |
| 18 | Ga0058860_11519682 | 3300004801 | Unclassified | 729 |
| 19 | Ga0058862_10176130 | 3300004803 | Bacteria | 9071 |
| 20 | Ga0065704_10013929 | 3300005289 | Bacteria | 2358 |
| 21 | Ga0065704_10310477 | 3300005289 | Bacteria | 869 |
| 22 | Ga0065707_10260152 | 3300005295 | Bacteria | 1099 |
| 23 | Ga0070658_10002426 | 3300005327 | Bacteria | 15603 |
| 24 | Ga0070658_10013418 | 3300005327 | Bacteria | 6575 |
| 25 | Ga0070676_10062744 | 3300005328 | Bacteria | 2212 |
| 26 | Ga0070683_100472532 | 3300005329 | Bacteria | 1197 |
| 27 | Ga0070683_101326184 | 3300005329 | Bacteria | 692 |
| 28 | Ga0070690_100194556 | 3300005330 | Bacteria | 1408 |
| 29 | Ga0070670_100311522 | 3300005331 | Bacteria | 1378 |
| 30 | Ga0070670_100633112 | 3300005331 | Bacteria | 959 |
| 31 | Ga0070677_10112211 | 3300005333 | Bacteria | 1219 |
| 32 | Ga0070680_100005522 | 3300005336 | Bacteria | 9570 |
| 33 | Ga0070680_100301110 | 3300005336 | Bacteria | 1360 |
| 34 | Ga0070682_100108095 | 3300005337 | Bacteria | 1849 |
| 35 | Ga0070682_100456173 | 3300005337 | Bacteria | 980 |
| 36 | Ga0068868_100130012 | 3300005338 | Bacteria | 2060 |
| 37 | Ga0070691_10039056 | 3300005341 | Bacteria | 2242 |
| 38 | Ga0070661_100304631 | 3300005344 | Bacteria | 1241 |
| 39 | Ga0070669_101252117 | 3300005353 | Bacteria | 642 |
| 40 | Ga0070675_100088085 | 3300005354 | Bacteria | 2597 |
| 41 | Ga0070675_100623657 | 3300005354 | Bacteria | 979 |
| 42 | Ga0070671_100069289 | 3300005355 | Bacteria | 2942 |
| 43 | Ga0070671_100434575 | 3300005355 | Bacteria | 1125 |
| 44 | Ga0070674_101370206 | 3300005356 | Bacteria | 632 |
| 45 | Ga0070673_100050123 | 3300005364 | Bacteria | 3263 |
| 46 | Ga0070673_100346530 | 3300005364 | Bacteria | 1317 |
| 47 | Ga0070659_100553766 | 3300005366 | Bacteria | 985 |
| 48 | Ga0070659_101594074 | 3300005366 | Bacteria | 583 |
| 49 | Ga0070667_100001546 | 3300005367 | Bacteria | 20614 |
| 50 | Ga0070667_100689172 | 3300005367 | Bacteria | 945 |
| 51 | Ga0070714_100000519 | 3300005435 | Bacteria | 27946 |
| 52 | Ga0070714_100010979 | 3300005435 | Bacteria | 7174 |
| 53 | Ga0070714_100038902 | 3300005435 | Bacteria | 4002 |
| 54 | Ga0070714_100073187 | 3300005435 | Bacteria | 2968 |
| 55 | Ga0070714_100451565 | 3300005435 | Bacteria | 1221 |
| 56 | Ga0070714_100786193 | 3300005435 | Unclassified | 921 |
| 57 | Ga0070713_100786707 | 3300005436 | Bacteria | 912 |
| 58 | Ga0070705_100012015 | 3300005440 | Bacteria | 4386 |
| 59 | Ga0070708_100079869 | 3300005445 | Bacteria | 2960 |
| 60 | Ga0070708_100414719 | 3300005445 | Bacteria | 1270 |
| 61 | Ga0070708_100877106 | 3300005445 | Bacteria | 843 |
| 62 | Ga0070663_100416023 | 3300005455 | Bacteria | 1102 |
| 63 | Ga0070681_10005386 | 3300005458 | Bacteria | 12351 |
| 64 | Ga0070681_10181889 | 3300005458 | Bacteria | 2023 |
| 65 | Ga0070681_10249530 | 3300005458 | Bacteria | 1688 |
| 66 | Ga0070681_10283665 | 3300005458 | Bacteria | 1567 |
| 67 | Ga0070706_100005771 | 3300005467 | Bacteria | 11760 |
| 68 | Ga0070706_100021749 | 3300005467 | Bacteria | 5905 |
| 69 | Ga0070706_100060798 | 3300005467 | Bacteria | 3487 |
| 70 | Ga0070706_100086360 | 3300005467 | Bacteria | 2907 |
| 71 | Ga0070706_100094015 | 3300005467 | Bacteria | 2782 |
| 72 | Ga0070706_100469667 | 3300005467 | Bacteria | 1170 |
| 73 | Ga0070707_100006596 | 3300005468 | Bacteria | 10769 |
| 74 | Ga0070707_100260424 | 3300005468 | Bacteria | 1687 |
| 75 | Ga0070707_100367917 | 3300005468 | Bacteria | 1397 |
| 76 | Ga0070707_100919066 | 3300005468 | Unclassified | 840 |
| 77 | Ga0070698_100039505 | 3300005471 | Bacteria | 4857 |
| 78 | Ga0070698_100064533 | 3300005471 | Bacteria | 3689 |
| 79 | Ga0070698_100092897 | 3300005471 | Bacteria | 2998 |
| 80 | Ga0070699_100102795 | 3300005518 | Bacteria | 2505 |
| 81 | Ga0070679_100009896 | 3300005530 | Bacteria | 9022 |
| 82 | Ga0070679_100035803 | 3300005530 | Bacteria | 4924 |
| 83 | Ga0070679_100052255 | 3300005530 | Bacteria | 4071 |
| 84 | Ga0070679_100422203 | 3300005530 | Bacteria | 1279 |
| 85 | Ga0070679_101110144 | 3300005530 | Bacteria | 736 |
| 86 | Ga0070679_101162550 | 3300005530 | Bacteria | 717 |
| 87 | Ga0070684_100080553 | 3300005535 | Bacteria | 2880 |
| 88 | Ga0070684_100518353 | 3300005535 | Bacteria | 1105 |
| 89 | Ga0070684_100866514 | 3300005535 | Bacteria | 846 |
| 90 | Ga0070684_101014956 | 3300005535 | Bacteria | 779 |
| 91 | Ga0070684_101152728 | 3300005535 | Bacteria | 729 |
| 92 | Ga0070684_101366149 | 3300005535 | Unclassified | 667 |
| 93 | Ga0070697_100002003 | 3300005536 | Bacteria | 15614 |
| 94 | Ga0070697_100051727 | 3300005536 | Bacteria | 3338 |
| 95 | Ga0070697_100112708 | 3300005536 | Bacteria | 2269 |
| 96 | Ga0068853_100021204 | 3300005539 | Bacteria | 5412 |
| 97 | Ga0068853_100171689 | 3300005539 | Bacteria | 1962 |
| 98 | Ga0068853_100242720 | 3300005539 | Bacteria | 1652 |
| 99 | Ga0068853_100320550 | 3300005539 | Bacteria | 1437 |
| 100 | Ga0070672_100029248 | 3300005543 | Bacteria | 4131 |
| 101 | Ga0070695_100042259 | 3300005545 | Bacteria | 2893 |
| 102 | Ga0070695_100739244 | 3300005545 | Bacteria | 784 |
| 103 | Ga0070696_100027888 | 3300005546 | Bacteria | 3851 |
| 104 | Ga0070696_101019814 | 3300005546 | Bacteria | 692 |
| 105 | Ga0070704_100080301 | 3300005549 | Bacteria | 2398 |
| 106 | Ga0068855_100011055 | 3300005563 | Bacteria | 10891 |
| 107 | Ga0068855_100044376 | 3300005563 | Bacteria | 5261 |
| 108 | Ga0070664_100819856 | 3300005564 | Bacteria | 871 |
| 109 | Ga0068854_100000039 | 3300005578 | Bacteria | 94407 |
| 110 | Ga0068854_100400572 | 3300005578 | Bacteria | 1136 |
| 111 | Ga0068854_100566774 | 3300005578 | Bacteria | 965 |
| 112 | Ga0068856_100002334 | 3300005614 | Bacteria | 19517 |
| 113 | Ga0068856_100004352 | 3300005614 | Bacteria | 14113 |
| 114 | Ga0068856_100414606 | 3300005614 | Bacteria | 1367 |
| 115 | Ga0068852_100112440 | 3300005616 | Bacteria | 2478 |
| 116 | Ga0068852_100126825 | 3300005616 | Bacteria | 2345 |
| 117 | Ga0068852_100126863 | 3300005616 | Bacteria | 2345 |
| 118 | Ga0068852_100148325 | 3300005616 | Bacteria | 2178 |
| 119 | Ga0068852_101100491 | 3300005616 | Bacteria | 815 |
| 120 | Ga0068864_100005865 | 3300005618 | Bacteria | 10062 |
| 121 | Ga0068864_100466379 | 3300005618 | Bacteria | 1210 |
| 122 | Ga0068864_100987440 | 3300005618 | Bacteria | 835 |
| 123 | Ga0068861_100759110 | 3300005719 | Bacteria | 907 |
| 124 | Ga0068863_100001338 | 3300005841 | Bacteria | 24526 |
| 125 | Ga0068863_100016860 | 3300005841 | Bacteria | 7006 |
| 126 | Ga0068863_100388856 | 3300005841 | Bacteria | 1363 |
| 127 | Ga0068863_100449272 | 3300005841 | Bacteria | 1265 |
| 128 | Ga0068863_101758844 | 3300005841 | Bacteria | 630 |
| 129 | Ga0068860_100439747 | 3300005843 | Bacteria | 1295 |
| 130 | Ga0068860_100448021 | 3300005843 | Bacteria | 1283 |
| 131 | Ga0068860_100579261 | 3300005843 | Unclassified | 1126 |
| 132 | Ga0068862_100000836 | 3300005844 | Bacteria | 30459 |
| 133 | Ga0068862_100201289 | 3300005844 | Bacteria | 1796 |
| 134 | Ga0068862_101119795 | 3300005844 | Bacteria | 783 |
| 135 | Ga0081455_10009428 | 3300005937 | Bacteria | 10043 |
| 136 | Ga0081455_10090574 | 3300005937 | Bacteria | 2479 |
| 137 | Ga0081455_10118573 | 3300005937 | Bacteria | 2089 |
| 138 | Ga0081539_10001876 | 3300005985 | Bacteria | 32944 |
| 139 | Ga0081539_10002696 | 3300005985 | Bacteria | 24099 |
| 140 | Ga0081539_10030228 | 3300005985 | Bacteria | 3367 |
| 141 | Ga0081539_10113538 | 3300005985 | Bacteria | 1359 |
| 142 | Ga0070717_10029749 | 3300006028 | Bacteria | 4385 |
| 143 | Ga0075365_10000022 | 3300006038 | Bacteria | 64465 |
| 144 | Ga0075365_10069816 | 3300006038 | Bacteria | 2362 |
| 145 | Ga0075365_10089848 | 3300006038 | Bacteria | 2091 |
| 146 | Ga0075365_10188819 | 3300006038 | Bacteria | 1442 |
| 147 | Ga0075365_10447267 | 3300006038 | Bacteria | 912 |
| 148 | Ga0075365_10497871 | 3300006038 | Bacteria | 861 |
| 149 | Ga0075368_10048857 | 3300006042 | Bacteria | 1677 |
| 150 | Ga0075368_10266116 | 3300006042 | Bacteria | 735 |
| 151 | Ga0075363_100033980 | 3300006048 | Bacteria | 2660 |
| 152 | Ga0075363_100080865 | 3300006048 | Bacteria | 1777 |
| 153 | Ga0075363_100105724 | 3300006048 | Bacteria | 1561 |
| 154 | Ga0075364_10000985 | 3300006051 | Bacteria | 15065 |
| 155 | Ga0075364_10194889 | 3300006051 | Bacteria | 1372 |
| 156 | Ga0075362_10239657 | 3300006177 | Bacteria | 890 |
| 157 | Ga0075367_10030754 | 3300006178 | Bacteria | 3080 |
| 158 | Ga0075367_10464222 | 3300006178 | Bacteria | 803 |
| 159 | Ga0075369_10168099 | 3300006186 | Unclassified | 1006 |
| 160 | Ga0075427_10000259 | 3300006194 | Bacteria | 5679 |
| 161 | Ga0075366_10528685 | 3300006195 | Unclassified | 730 |
| 162 | Ga0097621_100000003 | 3300006237 | Bacteria | 164830 |
| 163 | Ga0097621_100158295 | 3300006237 | Bacteria | 1945 |
| 164 | Ga0068871_100000013 | 3300006358 | Bacteria | 102533 |
| 165 | Ga0068871_100713511 | 3300006358 | Bacteria | 919 |
| 166 | Ga0068871_101009764 | 3300006358 | Unclassified | 775 |
| 167 | Ga0068871_101353779 | 3300006358 | Bacteria | 670 |
| 168 | Ga0075428_100093456 | 3300006844 | Bacteria | 3279 |
| 169 | Ga0075428_100145249 | 3300006844 | Bacteria | 2578 |
| 170 | Ga0075428_101079417 | 3300006844 | Unclassified | 848 |
| 171 | Ga0075430_100221438 | 3300006846 | Bacteria | 1570 |
| 172 | Ga0075430_100277403 | 3300006846 | Bacteria | 1387 |
| 173 | Ga0075430_100370297 | 3300006846 | Bacteria | 1183 |
| 174 | Ga0075431_100003767 | 3300006847 | Bacteria | 14739 |
| 175 | Ga0075429_100029758 | 3300006880 | Bacteria | 4744 |
| 176 | Ga0075436_100082948 | 3300006914 | Bacteria | 2224 |
| 177 | Ga0097620_100027915 | 3300006931 | Bacteria | 5659 |
| 178 | Ga0105244_10338770 | 3300009036 | Bacteria | 693 |
| 179 | Ga0105240_10132772 | 3300009093 | Bacteria | 2984 |
| 180 | Ga0105240_10168667 | 3300009093 | Bacteria | 2594 |
| 181 | Ga0105240_10258457 | 3300009093 | Bacteria | 2010 |
| 182 | Ga0105240_10746933 | 3300009093 | Bacteria | 1064 |
| 183 | Ga0105240_11917813 | 3300009093 | Bacteria | 616 |
| 184 | Ga0105245_10016124 | 3300009098 | Bacteria | 6511 |
| 185 | Ga0105245_10022092 | 3300009098 | Bacteria | 5586 |
| 186 | Ga0105245_10232985 | 3300009098 | Bacteria | 1782 |
| 187 | Ga0105245_10284933 | 3300009098 | Bacteria | 1616 |
| 188 | Ga0105245_10635929 | 3300009098 | Bacteria | 1096 |
| 189 | Ga0105247_10166279 | 3300009101 | Bacteria | 1464 |
| 190 | Ga0114129_10031086 | 3300009147 | Bacteria | 7552 |
| 191 | Ga0114129_11472071 | 3300009147 | Bacteria | 838 |
| 192 | Ga0105243_11575488 | 3300009148 | Bacteria | 683 |
| 193 | Ga0105241_10001993 | 3300009174 | Bacteria | 15454 |
| 194 | Ga0105241_10142001 | 3300009174 | Bacteria | 1956 |
| 195 | Ga0105241_10152358 | 3300009174 | Bacteria | 1892 |
| 196 | Ga0105241_10502991 | 3300009174 | Bacteria | 1081 |
| 197 | Ga0105241_10731442 | 3300009174 | Bacteria | 906 |
| 198 | Ga0105242_10003381 | 3300009176 | Bacteria | 12421 |
| 199 | Ga0105248_10153043 | 3300009177 | Bacteria | 2602 |
| 200 | Ga0105248_10592087 | 3300009177 | Bacteria | 1251 |
| 201 | Ga0105237_10194860 | 3300009545 | Bacteria | 2026 |
| 202 | Ga0105237_10293324 | 3300009545 | Bacteria | 1629 |
| 203 | Ga0105238_10757487 | 3300009551 | Bacteria | 985 |
| 204 | Ga0105238_11930005 | 3300009551 | Bacteria | 624 |
| 205 | Ga0105249_10262411 | 3300009553 | Bacteria | 1717 |
| 206 | Ga0105249_10406852 | 3300009553 | Bacteria | 1392 |
| 207 | Ga0105249_10833232 | 3300009553 | Bacteria | 987 |
| 208 | Ga0105032_101210 | 3300009979 | Bacteria | 2385 |
| 209 | Ga0157370_10065219 | 3300013104 | Bacteria | 3445 |
| 210 | Ga0157370_10400599 | 3300013104 | Bacteria | 1263 |
| 211 | Ga0157370_10771027 | 3300013104 | Bacteria | 876 |
| 212 | Ga0157369_10037648 | 3300013105 | Bacteria | 5295 |
| 213 | Ga0157369_10351553 | 3300013105 | Bacteria | 1531 |
| 214 | Ga0157369_10859241 | 3300013105 | Bacteria | 931 |
| 215 | Ga0157374_10128502 | 3300013296 | Bacteria | 2451 |
| 216 | Ga0157374_10244772 | 3300013296 | Bacteria | 1764 |
| 217 | Ga0157374_10249498 | 3300013296 | Bacteria | 1746 |
| 218 | Ga0157374_10568133 | 3300013296 | Bacteria | 1143 |
| 219 | Ga0157378_11216508 | 3300013297 | Bacteria | 793 |
| 220 | Ga0163162_10138655 | 3300013306 | Bacteria | 2544 |
| 221 | Ga0163162_10175359 | 3300013306 | Bacteria | 2269 |
| 222 | Ga0163162_10586208 | 3300013306 | Bacteria | 1242 |
| 223 | Ga0163162_10720435 | 3300013306 | Bacteria | 1118 |
| 224 | Ga0163162_11756325 | 3300013306 | Bacteria | 709 |
| 225 | Ga0157372_10057778 | 3300013307 | Bacteria | 4337 |
| 226 | Ga0157372_10167743 | 3300013307 | Bacteria | 2539 |
| 227 | Ga0157372_10373824 | 3300013307 | Bacteria | 1661 |
| 228 | Ga0157372_10800475 | 3300013307 | Bacteria | 1095 |
| 229 | Ga0157372_11479550 | 3300013307 | Bacteria | 782 |
| 230 | Ga0157375_10383381 | 3300013308 | Bacteria | 1572 |
| 231 | Ga0157375_10872734 | 3300013308 | Bacteria | 1045 |
| 232 | Ga0157375_11223493 | 3300013308 | Bacteria | 881 |
| 233 | Ga0163163_10006948 | 3300014325 | Bacteria | 9943 |
| 234 | Ga0163163_10011237 | 3300014325 | Bacteria | 8113 |
| 235 | Ga0163163_10360035 | 3300014325 | Bacteria | 1511 |
| 236 | Ga0163163_10518653 | 3300014325 | Bacteria | 1254 |
| 237 | Ga0163163_10796684 | 3300014325 | Bacteria | 1008 |
| 238 | Ga0157380_10000051 | 3300014326 | Bacteria | 68466 |
| 239 | Ga0157380_10251534 | 3300014326 | Bacteria | 1600 |
| 240 | Ga0157380_10852707 | 3300014326 | Bacteria | 933 |
| 241 | Ga0157380_11209403 | 3300014326 | Bacteria | 799 |
| 242 | Ga0182008_10058233 | 3300014497 | Bacteria | 1908 |
| 243 | Ga0182008_10082236 | 3300014497 | Bacteria | 1585 |
| 244 | Ga0182008_10234480 | 3300014497 | Bacteria | 942 |
| 245 | Ga0182008_10350635 | 3300014497 | Bacteria | 783 |
| 246 | Ga0157377_10409985 | 3300014745 | Bacteria | 925 |
| 247 | Ga0157379_10000101 | 3300014968 | Bacteria | 58702 |
| 248 | Ga0157379_10009261 | 3300014968 | Bacteria | 8574 |
| 249 | Ga0157379_11830586 | 3300014968 | Bacteria | 597 |
| 250 | Ga0157376_10024093 | 3300014969 | Bacteria | 4774 |
| 251 | Ga0182006_1084553 | 3300015261 | Bacteria | 1152 |
| 252 | Ga0163161_10131187 | 3300017792 | Bacteria | 1890 |
| 253 | Ga0197907_10311092 | 3300020069 | Bacteria | 719 |
| 254 | Ga0197907_10333276 | 3300020069 | Bacteria | 1845 |
| 255 | Ga0197907_10773738 | 3300020069 | Bacteria | 1462 |
| 256 | Ga0197907_10800216 | 3300020069 | Bacteria | 4495 |
| 257 | Ga0197907_11130806 | 3300020069 | Bacteria | 1275 |
| 258 | Ga0197907_11365827 | 3300020069 | Bacteria | 3388 |
| 259 | Ga0206356_10169717 | 3300020070 | Bacteria | 735 |
| 260 | Ga0206356_10226831 | 3300020070 | Bacteria | 1838 |
| 261 | Ga0206356_10929817 | 3300020070 | Unclassified | 782 |
| 262 | Ga0206356_11287527 | 3300020070 | Bacteria | 12032 |
| 263 | Ga0206356_11574971 | 3300020070 | Bacteria | 10382 |
| 264 | Ga0206349_1119855 | 3300020075 | Bacteria | 8453 |
| 265 | Ga0206349_1637736 | 3300020075 | Bacteria | 1819 |
| 266 | Ga0206355_1680354 | 3300020076 | Bacteria | 4028 |
| 267 | Ga0206351_10175414 | 3300020077 | Bacteria | 7296 |
| 268 | Ga0206352_10667425 | 3300020078 | Bacteria | 1063 |
| 269 | Ga0206352_10734764 | 3300020078 | Bacteria | 661 |
| 270 | Ga0206350_10443236 | 3300020080 | Bacteria | 4449 |
| 271 | Ga0206350_10587188 | 3300020080 | Bacteria | 9712 |
| 272 | Ga0206354_10391537 | 3300020081 | Bacteria | 2849 |
| 273 | Ga0206354_11636011 | 3300020081 | Bacteria | 3050 |
| 274 | Ga0206353_10434407 | 3300020082 | Bacteria | 2683 |
| 275 | Ga0206353_11273815 | 3300020082 | Bacteria | 1556 |
| 276 | Ga0206353_11828919 | 3300020082 | Bacteria | 1440 |
| 277 | Ga0154015_1602284 | 3300020610 | Bacteria | 3657 |
| 278 | Ga0213873_10000595 | 3300021358 | Bacteria | 5889 |
| 279 | Ga0213873_10003193 | 3300021358 | Bacteria | 2931 |
| 280 | Ga0213873_10018295 | 3300021358 | Bacteria | 1610 |
| 281 | Ga0213873_10021366 | 3300021358 | Bacteria | 1522 |
| 282 | Ga0213872_10004954 | 3300021361 | Bacteria | 6924 |
| 283 | Ga0213872_10007856 | 3300021361 | Bacteria | 5211 |
| 284 | Ga0213872_10112260 | 3300021361 | Bacteria | 1210 |
| 285 | Ga0213874_10018062 | 3300021377 | Bacteria | 1901 |
| 286 | Ga0213874_10030397 | 3300021377 | Unclassified | 1556 |
| 287 | Ga0213876_10003555 | 3300021384 | Bacteria | 8881 |
| 288 | Ga0213876_10012912 | 3300021384 | Bacteria | 4441 |
| 289 | Ga0213876_10014070 | 3300021384 | Bacteria | 4243 |
| 290 | Ga0213876_10351894 | 3300021384 | Bacteria | 783 |
| 291 | Ga0213875_10000001 | 3300021388 | Bacteria | 2793540 |
| 292 | Ga0213875_10012869 | 3300021388 | Bacteria | 4122 |
| 293 | Ga0213875_10041646 | 3300021388 | Bacteria | 2161 |
| 294 | Ga0213875_10169764 | 3300021388 | Unclassified | 1024 |
| 295 | Ga0213875_10195584 | 3300021388 | Bacteria | 951 |
| 296 | Ga0213871_10009458 | 3300021441 | Bacteria | 2184 |
| 297 | Ga0213871_10077498 | 3300021441 | Bacteria | 948 |
| 298 | Ga0224712_10000619 | 3300022467 | Bacteria | 7246 |
| 299 | Ga0224712_10003141 | 3300022467 | Bacteria | 4227 |
| 300 | Ga0224712_10153846 | 3300022467 | Bacteria | 1021 |
| 301 | Ga0224712_10420420 | 3300022467 | Bacteria | 639 |
| 302 | Ga0207682_10028296 | 3300025893 | Bacteria | 2236 |
| 303 | Ga0207710_10106538 | 3300025900 | Bacteria | 1327 |
| 304 | Ga0207688_10042403 | 3300025901 | Bacteria | 2533 |
| 305 | Ga0207688_10164176 | 3300025901 | Bacteria | 1318 |
| 306 | Ga0207680_10324918 | 3300025903 | Bacteria | 1076 |
| 307 | Ga0207645_10048082 | 3300025907 | Bacteria | 2723 |
| 308 | Ga0207645_10154236 | 3300025907 | Bacteria | 1500 |
| 309 | Ga0207645_10390091 | 3300025907 | Bacteria | 935 |
| 310 | Ga0207705_10116912 | 3300025909 | Bacteria | 1975 |
| 311 | Ga0207705_11044194 | 3300025909 | Bacteria | 631 |
| 312 | Ga0207684_10034076 | 3300025910 | Bacteria | 4328 |
| 313 | Ga0207684_10068282 | 3300025910 | Bacteria | 3021 |
| 314 | Ga0207684_10100069 | 3300025910 | Bacteria | 2477 |
| 315 | Ga0207684_10211204 | 3300025910 | Bacteria | 1674 |
| 316 | Ga0207684_10372727 | 3300025910 | Bacteria | 1228 |
| 317 | Ga0207654_10001365 | 3300025911 | Bacteria | 12965 |
| 318 | Ga0207654_10319989 | 3300025911 | Bacteria | 1060 |
| 319 | Ga0207654_10549538 | 3300025911 | Bacteria | 820 |
| 320 | Ga0207707_10024016 | 3300025912 | Bacteria | 5331 |
| 321 | Ga0207707_10303873 | 3300025912 | Bacteria | 1379 |
| 322 | Ga0207695_10116275 | 3300025913 | Bacteria | 2648 |
| 323 | Ga0207695_10156152 | 3300025913 | Bacteria | 2216 |
| 324 | Ga0207695_10192227 | 3300025913 | Bacteria | 1958 |
| 325 | Ga0207695_10298515 | 3300025913 | Bacteria | 1502 |
| 326 | Ga0207695_10308587 | 3300025913 | Bacteria | 1472 |
| 327 | Ga0207695_10992685 | 3300025913 | Bacteria | 719 |
| 328 | Ga0207660_10016445 | 3300025917 | Bacteria | 4897 |
| 329 | Ga0207649_10238151 | 3300025920 | Bacteria | 1305 |
| 330 | Ga0207652_10013911 | 3300025921 | Bacteria | 6514 |
| 331 | Ga0207652_10036196 | 3300025921 | Bacteria | 4173 |
| 332 | Ga0207652_10061003 | 3300025921 | Bacteria | 3255 |
| 333 | Ga0207652_10494878 | 3300025921 | Bacteria | 1101 |
| 334 | Ga0207646_10045629 | 3300025922 | Bacteria | 3934 |
| 335 | Ga0207646_10049384 | 3300025922 | Bacteria | 3769 |
| 336 | Ga0207646_10155120 | 3300025922 | Bacteria | 2065 |
| 337 | Ga0207694_10834799 | 3300025924 | Bacteria | 779 |
| 338 | Ga0207650_10362585 | 3300025925 | Bacteria | 1194 |
| 339 | Ga0207659_10068746 | 3300025926 | Bacteria | 2577 |
| 340 | Ga0207687_10004724 | 3300025927 | Bacteria | 9061 |
| 341 | Ga0207687_10304270 | 3300025927 | Unclassified | 1285 |
| 342 | Ga0207700_10527734 | 3300025928 | Bacteria | 1046 |
| 343 | Ga0207700_10646612 | 3300025928 | Bacteria | 943 |
| 344 | Ga0207664_10002006 | 3300025929 | Bacteria | 13411 |
| 345 | Ga0207664_10040228 | 3300025929 | Bacteria | 3634 |
| 346 | Ga0207664_10074167 | 3300025929 | Bacteria | 2748 |
| 347 | Ga0207664_10169646 | 3300025929 | Bacteria | 1867 |
| 348 | Ga0207664_10360769 | 3300025929 | Bacteria | 1287 |
| 349 | Ga0207644_10020573 | 3300025931 | Bacteria | 4488 |
| 350 | Ga0207690_10091738 | 3300025932 | Bacteria | 2148 |
| 351 | Ga0207690_10639806 | 3300025932 | Bacteria | 871 |
| 352 | Ga0207706_10330499 | 3300025933 | Bacteria | 1326 |
| 353 | Ga0207706_10398213 | 3300025933 | Bacteria | 1194 |
| 354 | Ga0207686_10000781 | 3300025934 | Bacteria | 19580 |
| 355 | Ga0207704_10882007 | 3300025938 | Bacteria | 751 |
| 356 | Ga0207691_10009551 | 3300025940 | Bacteria | 9308 |
| 357 | Ga0207691_10527260 | 3300025940 | Unclassified | 1002 |
| 358 | Ga0207691_10929260 | 3300025940 | Bacteria | 727 |
| 359 | Ga0207711_10145542 | 3300025941 | Bacteria | 2135 |
| 360 | Ga0207689_10357275 | 3300025942 | Bacteria | 1215 |
| 361 | Ga0207661_10067883 | 3300025944 | Bacteria | 2901 |
| 362 | Ga0207661_10121653 | 3300025944 | Bacteria | 2223 |
| 363 | Ga0207661_10393341 | 3300025944 | Bacteria | 1256 |
| 364 | Ga0207661_10760954 | 3300025944 | Bacteria | 892 |
| 365 | Ga0207661_10945419 | 3300025944 | Bacteria | 794 |
| 366 | Ga0207661_11114104 | 3300025944 | Bacteria | 727 |
| 367 | Ga0207679_10815623 | 3300025945 | Bacteria | 851 |
| 368 | Ga0207667_10001579 | 3300025949 | Bacteria | 28649 |
| 369 | Ga0207667_10103107 | 3300025949 | Bacteria | 2943 |
| 370 | Ga0207667_10150143 | 3300025949 | Bacteria | 2399 |
| 371 | Ga0207667_11482633 | 3300025949 | Bacteria | 650 |
| 372 | Ga0207651_10003118 | 3300025960 | Bacteria | 8064 |
| 373 | Ga0207651_10693290 | 3300025960 | Bacteria | 897 |
| 374 | Ga0207712_10015493 | 3300025961 | Bacteria | 4920 |
| 375 | Ga0207712_10147470 | 3300025961 | Bacteria | 1813 |
| 376 | Ga0207712_10183651 | 3300025961 | Bacteria | 1645 |
| 377 | Ga0207668_11034222 | 3300025972 | Bacteria | 735 |
| 378 | Ga0207640_10000024 | 3300025981 | Bacteria | 154876 |
| 379 | Ga0207640_10151384 | 3300025981 | Bacteria | 1705 |
| 380 | Ga0207640_10300351 | 3300025981 | Bacteria | 1270 |
| 381 | Ga0207658_10005603 | 3300025986 | Bacteria | 8589 |
| 382 | Ga0207677_10072215 | 3300026023 | Bacteria | 2439 |
| 383 | Ga0207677_10341212 | 3300026023 | Bacteria | 1252 |
| 384 | Ga0207703_10003502 | 3300026035 | Bacteria | 13129 |
| 385 | Ga0207639_10001948 | 3300026041 | Bacteria | 13860 |
| 386 | Ga0207639_10158693 | 3300026041 | Bacteria | 1904 |
| 387 | Ga0207678_10062167 | 3300026067 | Bacteria | 3211 |
| 388 | Ga0207678_10244885 | 3300026067 | Bacteria | 1536 |
| 389 | Ga0207678_11292418 | 3300026067 | Bacteria | 645 |
| 390 | Ga0207702_10003580 | 3300026078 | Bacteria | 14118 |
| 391 | Ga0207702_10025526 | 3300026078 | Bacteria | 4905 |
| 392 | Ga0207702_10403334 | 3300026078 | Bacteria | 1319 |
| 393 | Ga0207641_10003356 | 3300026088 | Bacteria | 14232 |
| 394 | Ga0207641_10009791 | 3300026088 | Bacteria | 7890 |
| 395 | Ga0207641_10256022 | 3300026088 | Bacteria | 1637 |
| 396 | Ga0207641_10721055 | 3300026088 | Bacteria | 983 |
| 397 | Ga0207641_11718782 | 3300026088 | Bacteria | 629 |
| 398 | Ga0207676_10007479 | 3300026095 | Bacteria | 7751 |
| 399 | Ga0207676_10689264 | 3300026095 | Bacteria | 989 |
| 400 | Ga0207674_10862747 | 3300026116 | Bacteria | 873 |
| 401 | Ga0207675_100162293 | 3300026118 | Bacteria | 2132 |
| 402 | Ga0207683_10266407 | 3300026121 | Bacteria | 1565 |
| 403 | Ga0207683_10407855 | 3300026121 | Bacteria | 1251 |
| 404 | Ga0207698_10014555 | 3300026142 | Bacteria | 5235 |
| 405 | Ga0207698_10072106 | 3300026142 | Bacteria | 2744 |
| 406 | Ga0207698_10101413 | 3300026142 | Bacteria | 2387 |
| 407 | Ga0207698_10263011 | 3300026142 | Bacteria | 1586 |
| 408 | Ga0207698_10387015 | 3300026142 | Bacteria | 1332 |
| 409 | Ga0209998_10101827 | 3300027717 | Bacteria | 712 |
| 410 | Ga0265356_1000525 | 3300028017 | Bacteria | 6878 |
| 411 | Ga0268266_10217248 | 3300028379 | Bacteria | 1756 |
| 412 | Ga0268266_10288535 | 3300028379 | Bacteria | 1528 |
| 413 | Ga0268265_10000156 | 3300028380 | Bacteria | 83798 |
| 414 | Ga0268265_10131898 | 3300028380 | Bacteria | 2078 |
| 415 | Ga0268265_10961086 | 3300028380 | Bacteria | 842 |
| 416 | Ga0268264_10086134 | 3300028381 | Bacteria | 2699 |
| 417 | Ga0268264_10261615 | 3300028381 | Bacteria | 1612 |
| 418 | Ga0265337_1043836 | 3300028556 | Bacteria | 1278 |
| 419 | Ga0265326_10012298 | 3300028558 | Bacteria | 2517 |
| 420 | Ga0265334_10007247 | 3300028573 | Bacteria | 4757 |
| 421 | Ga0265334_10047737 | 3300028573 | Bacteria | 1650 |
| 422 | Ga0265318_10022101 | 3300028577 | Unclassified | 2546 |
| 423 | Ga0265318_10044756 | 3300028577 | Bacteria | 1674 |
| 424 | Ga0265318_10215517 | 3300028577 | Bacteria | 701 |
| 425 | Ga0265323_10012167 | 3300028653 | Bacteria | 3456 |
| 426 | Ga0265323_10112210 | 3300028653 | Bacteria | 894 |
| 427 | Ga0265323_10189094 | 3300028653 | Bacteria | 650 |
| 428 | Ga0265322_10007533 | 3300028654 | Bacteria | 3173 |
| 429 | Ga0265322_10008553 | 3300028654 | Bacteria | 2981 |
| 430 | Ga0265322_10128186 | 3300028654 | Bacteria | 723 |
| 431 | Ga0265336_10006414 | 3300028666 | Unclassified | 4241 |
| 432 | Ga0265336_10029741 | 3300028666 | Bacteria | 1703 |
| 433 | Ga0265336_10072437 | 3300028666 | Bacteria | 1030 |
| 434 | Ga0265336_10100799 | 3300028666 | Bacteria | 860 |
| 435 | Ga0265338_10000052 | 3300028800 | Bacteria | 209239 |
| 436 | Ga0265338_10000054 | 3300028800 | Bacteria | 207383 |
| 437 | Ga0265338_10000178 | 3300028800 | Bacteria | 118345 |
| 438 | Ga0265338_10000366 | 3300028800 | Bacteria | 81024 |
| 439 | Ga0265338_10000396 | 3300028800 | Bacteria | 78090 |
| 440 | Ga0265338_10080483 | 3300028800 | Bacteria | 2737 |
| 441 | Ga0265338_10084583 | 3300028800 | Bacteria | 2647 |
| 442 | Ga0265338_10085544 | 3300028800 | Bacteria | 2628 |
| 443 | Ga0265338_10151474 | 3300028800 | Bacteria | 1801 |
| 444 | Ga0265338_10561404 | 3300028800 | Bacteria | 798 |
| 445 | Ga0265324_10010795 | 3300029957 | Bacteria | 3503 |
| 446 | Ga0265324_10024082 | 3300029957 | Bacteria | 2164 |
| 447 | Ga0265324_10059466 | 3300029957 | Bacteria | 1307 |
| 448 | Ga0265324_10192185 | 3300029957 | Bacteria | 693 |
| 449 | Ga0265762_1003191 | 3300030760 | Bacteria | 2931 |
| 450 | Ga0265762_1012092 | 3300030760 | Bacteria | 1545 |
| 451 | Ga0265765_1013536 | 3300030879 | Bacteria | 934 |
| 452 | Ga0265760_10000904 | 3300031090 | Bacteria | 8569 |
| 453 | Ga0265330_10013203 | 3300031235 | Bacteria | 3852 |
| 454 | Ga0265332_10008843 | 3300031238 | Bacteria | 4507 |
| 455 | Ga0265332_10011261 | 3300031238 | Bacteria | 3977 |
| 456 | Ga0265328_10022106 | 3300031239 | Bacteria | 2422 |
| 457 | Ga0265320_10171585 | 3300031240 | Bacteria | 974 |
| 458 | Ga0265325_10002829 | 3300031241 | Bacteria | 11578 |
| 459 | Ga0265325_10013636 | 3300031241 | Bacteria | 4620 |
| 460 | Ga0265325_10026083 | 3300031241 | Bacteria | 3168 |
| 461 | Ga0265325_10030390 | 3300031241 | Bacteria | 2897 |
| 462 | Ga0265325_10089657 | 3300031241 | Unclassified | 1518 |
| 463 | Ga0265329_10008966 | 3300031242 | Bacteria | 3760 |
| 464 | Ga0265340_10015913 | 3300031247 | Bacteria | 3902 |
| 465 | Ga0265340_10017309 | 3300031247 | Bacteria | 3727 |
| 466 | Ga0265340_10179788 | 3300031247 | Bacteria | 956 |
| 467 | Ga0265339_10013311 | 3300031249 | Bacteria | 4990 |
| 468 | Ga0265339_10024094 | 3300031249 | Bacteria | 3511 |
| 469 | Ga0265339_10059896 | 3300031249 | Unclassified | 2052 |
| 470 | Ga0265339_10142322 | 3300031249 | Bacteria | 1219 |
| 471 | Ga0265339_10143592 | 3300031249 | Bacteria | 1212 |
| 472 | Ga0265331_10014050 | 3300031250 | Unclassified | 4278 |
| 473 | Ga0265331_10362469 | 3300031250 | Bacteria | 649 |
| 474 | Ga0265327_10004316 | 3300031251 | Bacteria | 12681 |
| 475 | Ga0265327_10026829 | 3300031251 | Bacteria | 3327 |
| 476 | Ga0265327_10054273 | 3300031251 | Bacteria | 2075 |
| 477 | Ga0265327_10069113 | 3300031251 | Bacteria | 1774 |
| 478 | Ga0265316_10036091 | 3300031344 | Bacteria | 3998 |
| 479 | Ga0265316_10061416 | 3300031344 | Bacteria | 2919 |
| 480 | Ga0265316_10114249 | 3300031344 | Bacteria | 2043 |
| 481 | Ga0265316_10148230 | 3300031344 | Bacteria | 1759 |
| 482 | Ga0265316_10184223 | 3300031344 | Bacteria | 1553 |
| 483 | Ga0265316_10377257 | 3300031344 | Bacteria | 1023 |
| 484 | Ga0307408_100823598 | 3300031548 | Bacteria | 844 |
| 485 | Ga0265313_10010254 | 3300031595 | Bacteria | 5958 |
| 486 | Ga0265313_10024100 | 3300031595 | Bacteria | 3258 |
| 487 | Ga0265313_10110775 | 3300031595 | Bacteria | 1207 |
| 488 | Ga0307508_10040608 | 3300031616 | Bacteria | 4176 |
| 489 | Ga0316575_10121553 | 3300031665 | Bacteria | 1068 |
| 490 | Ga0316579_10003148 | 3300031691 | Bacteria | 6378 |
| 491 | Ga0265314_10056945 | 3300031711 | Bacteria | 2688 |
| 492 | Ga0265314_10257790 | 3300031711 | Bacteria | 997 |
| 493 | Ga0265314_10445906 | 3300031711 | Bacteria | 690 |
| 494 | Ga0265342_10006015 | 3300031712 | Bacteria | 9119 |
| 495 | Ga0265342_10006331 | 3300031712 | Bacteria | 8825 |
| 496 | Ga0265342_10042321 | 3300031712 | Bacteria | 2752 |
| 497 | Ga0316576_10000044 | 3300031727 | Bacteria | 38025 |
| 498 | Ga0316576_10040833 | 3300031727 | Bacteria | 3336 |
| 499 | Ga0316576_10102429 | 3300031727 | Bacteria | 2141 |
| 500 | Ga0316576_10120771 | 3300031727 | Bacteria | 1967 |
| 501 | Ga0316576_10159441 | 3300031727 | Bacteria | 1701 |
| 502 | Ga0316576_10164563 | 3300031727 | Bacteria | 1673 |
| 503 | Ga0316576_10383256 | 3300031727 | Bacteria | 1044 |
| 504 | Ga0316578_10036090 | 3300031728 | Bacteria | 2845 |
| 505 | Ga0316578_10047642 | 3300031728 | Bacteria | 2501 |
| 506 | Ga0307405_10040503 | 3300031731 | Bacteria | 2822 |
| 507 | Ga0307405_10088557 | 3300031731 | Unclassified | 2043 |
| 508 | Ga0307405_10201904 | 3300031731 | Bacteria | 1444 |
| 509 | Ga0307405_10537633 | 3300031731 | Bacteria | 943 |
| 510 | Ga0316577_10016991 | 3300031733 | Bacteria | 4015 |
| 511 | Ga0316577_10134021 | 3300031733 | Bacteria | 1394 |
| 512 | Ga0316577_10508590 | 3300031733 | Bacteria | 685 |
| 513 | Ga0307413_10355754 | 3300031824 | Bacteria | 1132 |
| 514 | Ga0307410_10477080 | 3300031852 | Bacteria | 1022 |
| 515 | Ga0307410_10914426 | 3300031852 | Unclassified | 752 |
| 516 | Ga0307410_11092447 | 3300031852 | Bacteria | 691 |
| 517 | Ga0307410_11508453 | 3300031852 | Bacteria | 592 |
| 518 | Ga0307406_10024435 | 3300031901 | Bacteria | 3609 |
| 519 | Ga0307406_11556420 | 3300031901 | Bacteria | 583 |
| 520 | Ga0307407_10022946 | 3300031903 | Bacteria | 3247 |
| 521 | Ga0307407_10112594 | 3300031903 | Unclassified | 1711 |
| 522 | Ga0307407_10474008 | 3300031903 | Bacteria | 913 |
| 523 | Ga0307412_10196528 | 3300031911 | Unclassified | 1529 |
| 524 | Ga0307412_11132929 | 3300031911 | Bacteria | 698 |
| 525 | Ga0307412_11232736 | 3300031911 | Bacteria | 671 |
| 526 | Ga0307409_100100999 | 3300031995 | Bacteria | 2392 |
| 527 | Ga0307409_100392921 | 3300031995 | Bacteria | 1322 |
| 528 | Ga0307416_100035072 | 3300032002 | Bacteria | 3826 |
| 529 | Ga0307416_100074155 | 3300032002 | Unclassified | 2841 |
| 530 | Ga0307416_100318729 | 3300032002 | Bacteria | 1555 |
| 531 | Ga0307416_100513006 | 3300032002 | Bacteria | 1265 |
| 532 | Ga0307416_100596914 | 3300032002 | Bacteria | 1183 |
| 533 | Ga0307416_102470482 | 3300032002 | Bacteria | 618 |
| 534 | Ga0307414_10066151 | 3300032004 | Bacteria | 2582 |
| 535 | Ga0307411_10017055 | 3300032005 | Bacteria | 4125 |
| 536 | Ga0307411_11573956 | 3300032005 | Bacteria | 606 |
| 537 | Ga0307415_100045358 | 3300032126 | Bacteria | 2946 |
| 538 | Ga0307415_100676782 | 3300032126 | Bacteria | 928 |
| 539 | Ga0307415_100941902 | 3300032126 | Bacteria | 799 |
| 540 | Ga0316583_10018078 | 3300032133 | Bacteria | 2532 |
| 541 | Ga0316585_10022471 | 3300032137 | Bacteria | 1941 |
| 542 | Ga0316580_10001591 | 3300032139 | Bacteria | 5993 |
| 543 | Ga0316593_10000617 | 3300032168 | Bacteria | 6770 |
| 544 | Ga0316593_10003813 | 3300032168 | Bacteria | 3791 |
| 545 | Ga0316593_10004644 | 3300032168 | Bacteria | 3543 |
| 546 | Ga0316593_10009065 | 3300032168 | Bacteria | 2796 |
| 547 | Ga0316593_10013598 | 3300032168 | Bacteria | 2413 |
| 548 | Ga0316593_10045668 | 3300032168 | Bacteria | 1468 |
| 549 | Ga0316593_10057174 | 3300032168 | Unclassified | 1328 |
| 550 | Ga0316593_10115814 | 3300032168 | Bacteria | 960 |
| 551 | Ga0316593_10256387 | 3300032168 | Bacteria | 655 |
| 552 | Ga0316592_1000648 | 3300033524 | Bacteria | 5065 |
| 553 | Ga0316592_1000962 | 3300033524 | Bacteria | 4429 |
| 554 | Ga0316592_1001542 | 3300033524 | Bacteria | 3743 |
| 555 | Ga0316592_1005486 | 3300033524 | Bacteria | 2410 |
| 556 | Ga0316592_1005684 | 3300033524 | Bacteria | 2378 |
| 557 | Ga0316592_1008299 | 3300033524 | Bacteria | 2047 |
| 558 | Ga0316592_1021735 | 3300033524 | Bacteria | 1368 |
| 559 | Ga0316592_1027220 | 3300033524 | Unclassified | 1236 |
| 560 | Ga0316588_1000021 | 3300033528 | Bacteria | 11292 |
| 561 | Ga0316588_1006251 | 3300033528 | Bacteria | 2370 |
| 562 | Ga0316588_1022587 | 3300033528 | Unclassified | 1438 |
| 563 | Ga0316587_1049711 | 3300033529 | Unclassified | 766 |
| 564 | Ga0316596_1000103 | 3300033541 | Bacteria | 10744 |
| 565 | Ga0316596_1001763 | 3300033541 | Bacteria | 4493 |
| 566 | Ga0316596_1002456 | 3300033541 | Bacteria | 3957 |
| 567 | Ga0316596_1003921 | 3300033541 | Bacteria | 3297 |
| 568 | Ga0316596_1029434 | 3300033541 | Bacteria | 1422 |
| 569 | Ga0316596_1037856 | 3300033541 | Bacteria | 1263 |
| 570 | Ga0316596_1051195 | 3300033541 | Bacteria | 1093 |
| 571 | Ga0316596_1059076 | 3300033541 | Bacteria | 1022 |
| 572 | Ga0316596_1062764 | 3300033541 | Bacteria | 992 |
| 573 | Ga0373934_0107996 | 3300035086 | Bacteria | 1128 |
| 574 | Ga0373944_0158224 | 3300035089 | Bacteria | 802 |
| 575 | Ga0373923_0368975 | 3300035111 | Bacteria | 687 |
| 576 | Ga0373960_0069319 | 3300035121 | Bacteria | 1087 |
| 577 | Ga0373943_0080168 | 3300035170 | Bacteria | 1672 |
| 578 | Ga0316574_0000425 | 3300035398 | Bacteria | 16756 |
| 579 | Ga0316574_0004026 | 3300035398 | Bacteria | 7661 |
| 580 | Ga0316574_0029464 | 3300035398 | Bacteria | 3316 |
| 581 | Ga0316574_0037513 | 3300035398 | Bacteria | 2973 |
| 582 | Ga0316574_0043756 | 3300035398 | Bacteria | 2768 |
| 583 | Ga0316574_0061678 | 3300035398 | Bacteria | 2355 |
| 584 | Ga0316574_0097531 | 3300035398 | Bacteria | 1879 |
| 585 | Ga0316574_0269817 | 3300035398 | Bacteria | 1085 |
| 586 | Ga0316574_0475492 | 3300035398 | Bacteria | 781 |
| 587 | Ga0373931_0044819 | 3300035691 | Bacteria | 2334 |
| 588 | Ga0373931_0236961 | 3300035691 | Bacteria | 1105 |
| 589 | Ga0373935_0004181 | 3300035692 | Bacteria | 8454 |
| 590 | Ga0373935_0151089 | 3300035692 | Bacteria | 1576 |
| 591 | Ga0373927_0160436 | 3300035695 | Bacteria | 1473 |
| 592 | Ga0373947_0170363 | 3300035725 | Bacteria | 1412 |
| 593 | Ga0373947_0185913 | 3300035725 | Bacteria | 1355 |
| 594 | Ga0373947_0191364 | 3300035725 | Bacteria | 1335 |
| 595 | Ga0316582_0001841 | 3300036647 | Bacteria | 9599 |
| 596 | Ga0316582_0006061 | 3300036647 | Bacteria | 6303 |
| 597 | Ga0316582_0407926 | 3300036647 | Bacteria | 936 |
| 598 | Ga0316584_0003484 | 3300036712 | Bacteria | 10242 |
| 599 | Ga0316584_0025317 | 3300036712 | Bacteria | 4351 |
| 600 | Ga0316584_0109969 | 3300036712 | Bacteria | 2062 |
| 601 | Ga0316584_0176768 | 3300036712 | Bacteria | 1581 |
| 602 | Ga0316584_0222519 | 3300036712 | Bacteria | 1386 |
| 603 | Ga0373925_0018411 | 3300037068 | Bacteria | 5076 |
| 604 | Ga0373925_0453019 | 3300037068 | Bacteria | 1051 |
| 605 | Ga0395899_0000039 | 3300037312 | Bacteria | 269620 |
| 606 | Ga0395899_0004980 | 3300037312 | Bacteria | 10333 |
| 607 | Ga0395900_0069514 | 3300037418 | Bacteria | 3619 |
| 608 | Ga0395900_0117663 | 3300037418 | Bacteria | 2727 |
| 609 | Ga0395900_0350503 | 3300037418 | Bacteria | 1450 |
| 610 | Ga0395900_0807168 | 3300037418 | Bacteria | 866 |
| 611 | Ga0395898_0000226 | 3300037466 | Bacteria | 144727 |
| 612 | Ga0395898_0008404 | 3300037466 | Bacteria | 10916 |
| 613 | Ga0395898_0688006 | 3300037466 | Bacteria | 965 |
| 614 | Ga0395905_0006755 | 3300037471 | Bacteria | 11491 |
| 615 | Ga0436364_0196276 | 3300037853 | Bacteria | 736 |
| 616 | Ga0436364_0273345 | 3300037853 | Bacteria | 2794207 |
| 617 | Ga0436364_0539388 | 3300037853 | Bacteria | 1074 |
| 618 | Ga0436364_0575822 | 3300037853 | Bacteria | 949 |
| 619 | Ga0436364_0646491 | 3300037853 | Bacteria | 31122 |
| 620 | Ga0436364_0798963 | 3300037853 | Bacteria | 719 |
| 621 | Ga0436364_0990835 | 3300037853 | Bacteria | 965 |
| 622 | Ga0436364_1111625 | 3300037853 | Bacteria | 1065 |
| 623 | Ga0436364_1142864 | 3300037853 | Bacteria | 8474 |
| 624 | Ga0436364_1200424 | 3300037853 | Bacteria | 6833 |
| 625 | Ga0436364_1211243 | 3300037853 | Bacteria | 2300 |
| 626 | Ga0436364_1276914 | 3300037853 | Bacteria | 1601 |
| 627 | Ga0436364_1306001 | 3300037853 | Bacteria | 643 |
| 628 | Ga0436364_1494664 | 3300037853 | Bacteria | 1093 |
| 629 | Ga0395901_0018326 | 3300038443 | Bacteria | 7147 |
| 630 | Ga0395901_0195273 | 3300038443 | Bacteria | 2122 |
| 631 | Ga0395901_0312522 | 3300038443 | Bacteria | 1627 |
| 632 | Ga0436365_0097047 | 3300039437 | Bacteria | 1057 |
| 633 | Ga0436365_0230296 | 3300039437 | Bacteria | 9287 |
| 634 | Ga0436365_0427864 | 3300039437 | Bacteria | 7737 |
| 635 | Ga0436365_0767674 | 3300039437 | Bacteria | 2508 |
| 636 | Ga0436365_0794964 | 3300039437 | Bacteria | 1264 |
| 637 | Ga0436365_0979666 | 3300039437 | Bacteria | 1564 |
| 638 | Ga0436365_1319563 | 3300039437 | Bacteria | 2068 |
| 639 | Ga0436365_1660231 | 3300039437 | Bacteria | 11182 |
| 640 | Ga0436365_1904939 | 3300039437 | Bacteria | 710 |
| 641 | Ga0436360_0002462 | 3300039438 | Bacteria | 2855 |
| 642 | Ga0436360_0355760 | 3300039438 | Bacteria | 1401 |
| 643 | Ga0436360_0422973 | 3300039438 | Bacteria | 2567 |
| 644 | Ga0436360_0651805 | 3300039438 | Bacteria | 1824 |
| 645 | Ga0436360_0665312 | 3300039438 | Bacteria | 2846 |
| 646 | Ga0436360_0766016 | 3300039438 | Bacteria | 1335 |
| 647 | Ga0436360_0979202 | 3300039438 | Bacteria | 1801 |
| 648 | Ga0436360_1033819 | 3300039438 | Bacteria | 4971 |
| 649 | Ga0436360_1055305 | 3300039438 | Bacteria | 1635 |
| 650 | Ga0436360_1112229 | 3300039438 | Unclassified | 589 |
| 651 | Ga0436360_1146218 | 3300039438 | Bacteria | 819 |
| 652 | Ga0436360_1149615 | 3300039438 | Bacteria | 818 |
| 653 | Ga0436360_1209713 | 3300039438 | Bacteria | 1048 |
| 654 | Ga0436360_1218238 | 3300039438 | Bacteria | 8853 |
| 655 | Ga0436361_0080925 | 3300039447 | Bacteria | 1893 |
| 656 | Ga0436361_0143737 | 3300039447 | Bacteria | 1789 |
| 657 | Ga0436361_0269103 | 3300039447 | Bacteria | 2108 |
| 658 | Ga0436361_0423980 | 3300039447 | Bacteria | 3126 |
| 659 | Ga0436361_0473343 | 3300039447 | Bacteria | 3820 |
| 660 | Ga0436361_0627825 | 3300039447 | Bacteria | 2427 |
| 661 | Ga0436361_0738206 | 3300039447 | Bacteria | 2235 |
| 662 | Ga0436361_0776532 | 3300039447 | Bacteria | 2134 |
| 663 | Ga0436361_0801716 | 3300039447 | Bacteria | 823 |
| 664 | Ga0436361_1140566 | 3300039447 | Bacteria | 907 |
| 665 | Ga0436361_1143312 | 3300039447 | Bacteria | 1158 |
| 666 | Ga0436361_1165208 | 3300039447 | Bacteria | 1531 |
| 667 | Ga0436363_0138227 | 3300039450 | Bacteria | 1217 |
| 668 | Ga0436363_0403132 | 3300039450 | Bacteria | 3451 |
| 669 | Ga0436363_0634802 | 3300039450 | Bacteria | 44772 |
| 670 | Ga0436363_0947238 | 3300039450 | Bacteria | 884 |
| 671 | Ga0436363_1017066 | 3300039450 | Bacteria | 830 |
| 672 | Ga0436363_1100879 | 3300039450 | Unclassified | 1442 |
| 673 | Ga0436363_1252147 | 3300039450 | Bacteria | 1817 |
| 674 | Ga0436362_0091064 | 3300039453 | Unclassified | 720 |
| 675 | Ga0436362_0107616 | 3300039453 | Bacteria | 2198 |
| 676 | Ga0436362_0109475 | 3300039453 | Bacteria | 6715 |
| 677 | Ga0436362_0226828 | 3300039453 | Bacteria | 7212 |
| 678 | Ga0436362_0399122 | 3300039453 | Bacteria | 2789 |
| 679 | Ga0436362_0437798 | 3300039453 | Bacteria | 9219 |
| 680 | Ga0436362_0595348 | 3300039453 | Bacteria | 706 |
| 681 | Ga0436362_0684804 | 3300039453 | Bacteria | 4100 |
| 682 | Ga0436362_0763995 | 3300039453 | Bacteria | 699 |
| 683 | Ga0436362_0973701 | 3300039453 | Bacteria | 1269 |
| 684 | Ga0436362_1010063 | 3300039453 | Bacteria | 652 |
| 685 | Ga0436362_1075726 | 3300039453 | Bacteria | 1661 |
| 686 | Ga0436362_1127986 | 3300039453 | Bacteria | 925 |
| 687 | Ga0436362_1295225 | 3300039453 | Bacteria | 2828 |
| 688 | Ga0451798_0436115 | 3300041458 | Bacteria | 731 |
| 689 | Ga0451802_1017005 | 3300041460 | Unclassified | 798 |
| 690 | Ga0451845_0268857 | 3300041501 | Bacteria | 616 |
| 691 | Ga0451852_14070 | 3300041508 | Bacteria | 604 |
| 692 | Ga0451843_0911427 | 3300041509 | Bacteria | 632 |
| 693 | Ga0451855_1261441 | 3300041511 | Bacteria | 1014 |
| 694 | Ga0451855_1789869 | 3300041511 | Bacteria | 879 |
| 695 | Ga0450916_090822 | 3300042530 | Bacteria | 532 |
| 696 | Ga0451577_0000433 | 3300042876 | Bacteria | 74789 |
| 697 | Ga0451577_0009630 | 3300042876 | Bacteria | 9274 |
| 698 | Ga0451577_0016499 | 3300042876 | Bacteria | 6838 |
| 699 | Ga0451577_0019005 | 3300042876 | Bacteria | 6325 |
| 700 | Ga0451577_0038053 | 3300042876 | Bacteria | 4328 |
| 701 | Ga0451577_0094271 | 3300042876 | Bacteria | 2673 |
| 702 | Ga0451577_0113079 | 3300042876 | Bacteria | 2430 |
| 703 | Ga0451577_0121175 | 3300042876 | Bacteria | 2343 |
| 704 | Ga0451577_0312572 | 3300042876 | Bacteria | 1424 |
| 705 | Ga0451577_0325812 | 3300042876 | Bacteria | 1393 |
| 706 | Ga0451577_0451515 | 3300042876 | Bacteria | 1167 |
| 707 | Ga0451577_0883983 | 3300042876 | Unclassified | 805 |
| 708 | Ga0451577_1105802 | 3300042876 | Bacteria | 709 |
| 709 | Ga0451577_1262305 | 3300042876 | Unclassified | 658 |
| 710 | Ga0466969_0044133 | 3300044656 | Bacteria | 2219 |
| 711 | Ga0453683_0000522 | 3300044673 | Bacteria | 43145 |
| 712 | Ga0453683_0003998 | 3300044673 | Bacteria | 10656 |
| 713 | Ga0453683_0077428 | 3300044673 | Bacteria | 2082 |
| 714 | Ga0453683_0117933 | 3300044673 | Bacteria | 1670 |
| 715 | Ga0453683_0175995 | 3300044673 | Bacteria | 1356 |
| 716 | Ga0453683_0199689 | 3300044673 | Bacteria | 1270 |
| 717 | Ga0453683_0564067 | 3300044673 | Bacteria | 741 |
| 718 | Ga0466965_0058570 | 3300044683 | Bacteria | 1921 |
| 719 | Ga0466966_0012777 | 3300044684 | Bacteria | 5563 |
| 720 | Ga0466966_0417838 | 3300044684 | Bacteria | 806 |
| 721 | Ga0466961_0113127 | 3300044693 | Bacteria | 1707 |
| 722 | Ga0466963_0030151 | 3300044694 | Bacteria | 3497 |
| 723 | Ga0466964_0156772 | 3300044706 | Bacteria | 1060 |
| 724 | Ga0453684_0000055 | 3300044712 | Bacteria | 532014 |
| 725 | Ga0453684_0000171 | 3300044712 | Bacteria | 286600 |
| 726 | Ga0453684_0000420 | 3300044712 | Bacteria | 172995 |
| 727 | Ga0453684_0000506 | 3300044712 | Bacteria | 152143 |
| 728 | Ga0453684_0000588 | 3300044712 | Bacteria | 135201 |
| 729 | Ga0453684_0001549 | 3300044712 | Bacteria | 64220 |
| 730 | Ga0453684_0001835 | 3300044712 | Bacteria | 55524 |
| 731 | Ga0453684_0002161 | 3300044712 | Bacteria | 49180 |
| 732 | Ga0453684_0002895 | 3300044712 | Bacteria | 40244 |
| 733 | Ga0453684_0005528 | 3300044712 | Bacteria | 24941 |
| 734 | Ga0453684_0005656 | 3300044712 | Bacteria | 24561 |
| 735 | Ga0453684_0016436 | 3300044712 | Bacteria | 11569 |
| 736 | Ga0453684_0030092 | 3300044712 | Bacteria | 7682 |
| 737 | Ga0453684_0035909 | 3300044712 | Bacteria | 6839 |
| 738 | Ga0453684_0057385 | 3300044712 | Bacteria | 5039 |
| 739 | Ga0453684_0065863 | 3300044712 | Bacteria | 4617 |
| 740 | Ga0453684_0075151 | 3300044712 | Bacteria | 4249 |
| 741 | Ga0453684_0106268 | 3300044712 | Bacteria | 3421 |
| 742 | Ga0453684_0143075 | 3300044712 | Bacteria | 2852 |
| 743 | Ga0453684_0167534 | 3300044712 | Bacteria | 2592 |
| 744 | Ga0453684_0168330 | 3300044712 | Bacteria | 2585 |
| 745 | Ga0453684_0168811 | 3300044712 | Bacteria | 2581 |
| 746 | Ga0453684_0168952 | 3300044712 | Bacteria | 2579 |
| 747 | Ga0453684_0202716 | 3300044712 | Bacteria | 2311 |
| 748 | Ga0453684_0219953 | 3300044712 | Bacteria | 2200 |
| 749 | Ga0453684_0263102 | 3300044712 | Bacteria | 1975 |
| 750 | Ga0453684_0273428 | 3300044712 | Bacteria | 1929 |
| 751 | Ga0453684_0452149 | 3300044712 | Bacteria | 1429 |
| 752 | Ga0453684_0546743 | 3300044712 | Unclassified | 1276 |
| 753 | Ga0453684_0558997 | 3300044712 | Bacteria | 1259 |
| 754 | Ga0453684_0741452 | 3300044712 | Bacteria | 1064 |
| 755 | Ga0453684_1057136 | 3300044712 | Bacteria | 860 |
| 756 | Ga0453684_1273020 | 3300044712 | Bacteria | 768 |
| 757 | Ga0453684_1420829 | 3300044712 | Bacteria | 719 |
| 758 | Ga0453684_1549238 | 3300044712 | Bacteria | 682 |
| 759 | Ga0466971_0000005 | 3300044719 | Bacteria | 137073 |
| 760 | Ga0466971_0283155 | 3300044719 | Bacteria | 794 |
| 761 | Ga0466970_0021508 | 3300044765 | Bacteria | 3359 |
| 762 | Ga0466970_0057209 | 3300044765 | Bacteria | 2085 |
| 763 | Ga0466957_0069306 | 3300044842 | Bacteria | 2178 |
| 764 | Ga0466957_0083253 | 3300044842 | Bacteria | 1995 |
| 765 | Ga0466960_0039668 | 3300044901 | Bacteria | 2222 |
| 766 | Ga0466960_0402246 | 3300044901 | Bacteria | 789 |
| 767 | Ga0451576_0000204 | 3300045051 | Bacteria | 149459 |
| 768 | Ga0451576_0000454 | 3300045051 | Bacteria | 93047 |
| 769 | Ga0451576_0000689 | 3300045051 | Bacteria | 68784 |
| 770 | Ga0451576_0016407 | 3300045051 | Bacteria | 8175 |
| 771 | Ga0451576_0024947 | 3300045051 | Bacteria | 6450 |
| 772 | Ga0451576_0031702 | 3300045051 | Bacteria | 5633 |
| 773 | Ga0451576_0032623 | 3300045051 | Bacteria | 5541 |
| 774 | Ga0451576_0034310 | 3300045051 | Bacteria | 5390 |
| 775 | Ga0451576_0076007 | 3300045051 | Bacteria | 3495 |
| 776 | Ga0451576_0099789 | 3300045051 | Bacteria | 3020 |
| 777 | Ga0451576_0751403 | 3300045051 | Bacteria | 1024 |
| 778 | Ga0451576_1172790 | 3300045051 | Unclassified | 803 |
| 779 | Ga0466958_0005653 | 3300045836 | Bacteria | 6751 |
| 780 | Ga0466958_0020009 | 3300045836 | Bacteria | 3900 |
| 781 | Ga0466958_0569552 | 3300045836 | Bacteria | 736 |
| 782 | Ga0466958_0726359 | 3300045836 | Bacteria | 647 |
| 783 | Ga0466967_0001979 | 3300045976 | Bacteria | 12433 |
| 784 | Ga0466967_0061054 | 3300045976 | Bacteria | 3343 |
| 785 | Ga0466967_0088574 | 3300045976 | Bacteria | 2809 |
| 786 | Ga0466967_0105905 | 3300045976 | Bacteria | 2577 |
| 787 | Ga0466967_0116667 | 3300045976 | Bacteria | 2460 |
| 788 | Ga0466967_0264149 | 3300045976 | Bacteria | 1647 |
| 789 | Ga0466967_1792423 | 3300045976 | Bacteria | 611 |
| 790 | Ga0495592_0163757 | 3300046454 | Bacteria | 1528 |
| 791 | Ga0495603_0094891 | 3300046455 | Bacteria | 1743 |
| 792 | Ga0495629_0088772 | 3300046459 | Bacteria | 2157 |
| 793 | Ga0495629_0739081 | 3300046459 | Bacteria | 652 |
| 794 | Ga0495638_0000070 | 3300046460 | Bacteria | 166954 |
| 795 | Ga0495641_0239686 | 3300046461 | Bacteria | 815 |
| 796 | Ga0495651_0370821 | 3300046462 | Bacteria | 941 |
| 797 | Ga0495580_0002023 | 3300046472 | Bacteria | 17847 |
| 798 | Ga0495585_0038134 | 3300046492 | Bacteria | 2705 |
| 799 | Ga0495594_0304702 | 3300046499 | Bacteria | 907 |
| 800 | Ga0495596_0034263 | 3300046500 | Bacteria | 2017 |
| 801 | Ga0495608_0221722 | 3300046511 | Bacteria | 1186 |
| 802 | Ga0495616_0080146 | 3300046513 | Bacteria | 1564 |
| 803 | Ga0495620_0047535 | 3300046515 | Bacteria | 1846 |
| 804 | Ga0495628_0364349 | 3300046516 | Bacteria | 1061 |
| 805 | Ga0495628_0366101 | 3300046516 | Bacteria | 1058 |
| 806 | Ga0495644_0155928 | 3300046523 | Bacteria | 875 |
| 807 | Ga0495652_0611799 | 3300046529 | Bacteria | 742 |
| 808 | Ga0495665_0074242 | 3300046531 | Bacteria | 1791 |
| 809 | Ga0495640_0177675 | 3300046533 | Bacteria | 1358 |
| 810 | Ga0495598_0201598 | 3300046537 | Bacteria | 719 |
| 811 | Ga0495621_0023755 | 3300046539 | Bacteria | 2041 |
| 812 | Ga0495645_0489943 | 3300046543 | Bacteria | 770 |
| 813 | Ga0495656_0067316 | 3300046615 | Bacteria | 1580 |
| 814 | Ga0495611_0051314 | 3300046648 | Bacteria | 1859 |
| 815 | Ga0495659_0258467 | 3300046664 | Bacteria | 727 |
| 816 | Ga0495661_0160588 | 3300046665 | Bacteria | 1207 |
| 817 | Ga0495588_0168354 | 3300046674 | Bacteria | 1159 |
| 818 | Ga0495657_0152480 | 3300046675 | Bacteria | 1434 |
| 819 | Ga0495657_0778041 | 3300046675 | Bacteria | 548 |
| 820 | Ga0495599_0466266 | 3300046678 | Bacteria | 746 |
| 821 | Ga0495623_0210189 | 3300046679 | Bacteria | 1114 |
| 822 | Ga0495658_0479285 | 3300046683 | Bacteria | 795 |
| 823 | Ga0495624_0175255 | 3300046690 | Bacteria | 1308 |
| 824 | Ga0495624_0528731 | 3300046690 | Bacteria | 705 |
| 825 | Ga0495670_0400508 | 3300046691 | Bacteria | 741 |
| 826 | Ga0495671_0134863 | 3300046692 | Bacteria | 1204 |
| 827 | Ga0495604_0022605 | 3300047317 | Bacteria | 5021 |
| 828 | Ga0495604_0152364 | 3300047317 | Bacteria | 1641 |
| 829 | Ga0495674_0113319 | 3300047319 | Bacteria | 2297 |
| 830 | Ga0495680_0064028 | 3300047322 | Bacteria | 2821 |
| 831 | Ga0495685_030399 | 3300047447 | Bacteria | 1857 |
| 832 | Ga0495681_0166072 | 3300047470 | Bacteria | 916 |
| 833 | Ga0495684_0287403 | 3300047471 | Bacteria | 1185 |
| 834 | Ga0495593_0055492 | 3300047673 | Bacteria | 2085 |
| 835 | Ga0495614_0067207 | 3300048089 | Bacteria | 1543 |
| 836 | Ga0495614_0260507 | 3300048089 | Bacteria | 795 |
| 837 | Ga0495615_0003053 | 3300048090 | Bacteria | 2769 |
| 838 | Ga0496100_0024180 | 3300048903 | Bacteria | 3701 |
| 839 | Ga0496101_0019981 | 3300048904 | Bacteria | 4580 |
| 840 | Ga0496101_0127638 | 3300048904 | Bacteria | 1929 |
| 841 | Ga0496101_0351673 | 3300048904 | Bacteria | 1158 |
| 842 | Ga0496102_0000521 | 3300048905 | Bacteria | 41977 |
| 843 | Ga0496102_0008968 | 3300048905 | Bacteria | 8580 |
| 844 | Ga0496102_0469355 | 3300048905 | Bacteria | 1179 |
| 845 | Ga0496103_0000453 | 3300048906 | Bacteria | 34950 |
| 846 | Ga0496103_0004001 | 3300048906 | Bacteria | 8953 |
| 847 | Ga0496103_0216742 | 3300048906 | Bacteria | 1231 |
| 848 | Ga0496104_0011710 | 3300048907 | Bacteria | 7867 |
| 849 | Ga0496104_0682652 | 3300048907 | Bacteria | 935 |
| 850 | Ga0496105_0037579 | 3300048908 | Bacteria | 3987 |
| 851 | Ga0496106_0009483 | 3300048909 | Bacteria | 7196 |
| 852 | Ga0496106_0102077 | 3300048909 | Bacteria | 2225 |
| 853 | Ga0496106_0216500 | 3300048909 | Bacteria | 1526 |
| 854 | Ga0496107_0056740 | 3300048910 | Bacteria | 2830 |
| 855 | Ga0496107_0097517 | 3300048910 | Bacteria | 2152 |
| 856 | Ga0496107_0560506 | 3300048910 | Bacteria | 846 |
| 857 | Ga0496108_0060974 | 3300048911 | Bacteria | 3174 |
| 858 | Ga0496108_0323400 | 3300048911 | Bacteria | 1345 |
| 859 | Ga0496109_0282341 | 3300048912 | Bacteria | 1565 |
| 860 | Ga0496110_0270447 | 3300048913 | Bacteria | 1547 |
| 861 | Ga0496110_0296428 | 3300048913 | Bacteria | 1473 |
| 862 | Ga0496111_0695855 | 3300048914 | Bacteria | 740 |
| 863 | Ga0496114_0101670 | 3300048917 | Bacteria | 2454 |
| 864 | Ga0496114_0185091 | 3300048917 | Bacteria | 1820 |
| 865 | Ga0496114_0241555 | 3300048917 | Bacteria | 1588 |
| 866 | Ga0496114_0834586 | 3300048917 | Bacteria | 801 |
| 867 | Ga0496115_0216592 | 3300048918 | Bacteria | 1581 |
| 868 | Ga0496116_0000173 | 3300048919 | Bacteria | 129928 |
| 869 | Ga0496116_0001739 | 3300048919 | Bacteria | 23720 |
| 870 | Ga0496116_0003301 | 3300048919 | Bacteria | 16049 |
| 871 | Ga0496117_0000124 | 3300048920 | Bacteria | 169701 |
| 872 | Ga0496117_0000144 | 3300048920 | Bacteria | 153831 |
| 873 | Ga0496117_0031708 | 3300048920 | Bacteria | 4030 |
| 874 | Ga0496118_0000096 | 3300048921 | Bacteria | 163988 |
| 875 | Ga0496118_0012385 | 3300048921 | Bacteria | 8195 |
| 876 | Ga0496118_0036819 | 3300048921 | Bacteria | 3949 |
| 877 | Ga0496119_0000020 | 3300048922 | Bacteria | 285602 |
| 878 | Ga0496119_0003189 | 3300048922 | Bacteria | 17184 |
| 879 | Ga0496119_0009028 | 3300048922 | Bacteria | 8645 |
| 880 | Ga0496120_0000006 | 3300048923 | Bacteria | 445068 |
| 881 | Ga0496120_0004033 | 3300048923 | Bacteria | 12732 |
| 882 | Ga0496120_0051139 | 3300048923 | Bacteria | 2362 |
| 883 | Ga0496120_0089736 | 3300048923 | Bacteria | 1644 |
| 884 | Ga0496120_0090271 | 3300048923 | Bacteria | 1638 |
| 885 | Ga0496121_0016153 | 3300048924 | Bacteria | 7732 |
| 886 | Ga0496122_0000040 | 3300048925 | Bacteria | 285095 |
| 887 | Ga0496122_0000140 | 3300048925 | Bacteria | 169037 |
| 888 | Ga0496122_0000802 | 3300048925 | Bacteria | 60277 |
| 889 | Ga0496123_0000572 | 3300048926 | Bacteria | 62779 |
| 890 | Ga0496123_0004284 | 3300048926 | Bacteria | 15176 |
| 891 | Ga0496123_0007798 | 3300048926 | Bacteria | 9971 |
| 892 | Ga0496124_0003352 | 3300048927 | Bacteria | 19709 |
| 893 | Ga0496124_0096000 | 3300048927 | Bacteria | 2409 |
| 894 | Ga0496125_0000010 | 3300048928 | Bacteria | 671167 |
| 895 | Ga0496125_0000110 | 3300048928 | Bacteria | 192693 |
| 896 | Ga0496125_0004049 | 3300048928 | Bacteria | 17170 |
| 897 | Ga0496125_0006483 | 3300048928 | Bacteria | 12640 |
| 898 | Ga0496125_0011762 | 3300048928 | Bacteria | 8722 |
| 899 | Ga0496126_0000060 | 3300048929 | Bacteria | 264944 |
| 900 | Ga0496126_0000246 | 3300048929 | Bacteria | 116854 |
| 901 | Ga0496126_0000330 | 3300048929 | Bacteria | 101064 |
| 902 | Ga0496126_0002082 | 3300048929 | Bacteria | 28029 |
| 903 | Ga0496126_0131654 | 3300048929 | Bacteria | 2161 |
| 904 | Ga0496126_0156649 | 3300048929 | Bacteria | 1949 |
| 905 | Ga0496126_0447888 | 3300048929 | Bacteria | 1040 |
| 906 | Ga0501306_020430 | 3300049127 | Bacteria | 921 |
| 907 | Ga0501306_032012 | 3300049127 | Bacteria | 786 |
| 908 | Ga0501309_029917 | 3300049129 | Bacteria | 800 |
| 909 | Ga0501310_046146 | 3300049130 | Bacteria | 619 |
| 910 | Ga0501305_007398 | 3300049161 | Bacteria | 1393 |
| 911 | Ga0501307_000425 | 3300049162 | Bacteria | 2824 |
| 912 | Ga0501296_045384 | 3300049519 | Bacteria | 631 |
| 913 | Ga0501300_057751 | 3300049523 | Bacteria | 609 |
| 914 | Ga0501311_006327 | 3300049527 | Bacteria | 1330 |
| 915 | Ga0501312_003515 | 3300049528 | Bacteria | 1785 |
| 916 | Ga0501313_008295 | 3300049529 | Bacteria | 1154 |
| 917 | Ga0501315_010905 | 3300049531 | Bacteria | 1101 |
| 918 | Ga0501315_018361 | 3300049531 | Bacteria | 922 |
| 919 | Ga0501315_071662 | 3300049531 | Bacteria | 576 |
| 920 | Ga0501316_017614 | 3300049532 | Bacteria | 878 |
| 921 | Ga0501316_024289 | 3300049532 | Bacteria | 782 |
| 922 | Ga0501316_029123 | 3300049532 | Bacteria | 732 |
| 923 | Ga0501317_017738 | 3300049533 | Bacteria | 936 |
| 924 | Ga0501317_026333 | 3300049533 | Bacteria | 820 |
| 925 | Ga0501317_027225 | 3300049533 | Bacteria | 811 |
| 926 | Ga0501318_001927 | 3300049534 | Bacteria | 1725 |
| 927 | Ga0501318_016204 | 3300049534 | Bacteria | 898 |
| 928 | Ga0501318_028307 | 3300049534 | Bacteria | 750 |
| 929 | Ga0501319_004209 | 3300049535 | Bacteria | 994 |
| 930 | Ga0501319_018983 | 3300049535 | Bacteria | 605 |
| 931 | Ga0501320_001561 | 3300049536 | Bacteria | 1712 |
| 932 | Ga0501321_034086 | 3300049537 | Bacteria | 692 |
| 933 | Ga0501322_006519 | 3300049538 | Bacteria | 832 |
| 934 | Ga0501322_012040 | 3300049538 | Bacteria | 683 |
| 935 | Ga0501324_002357 | 3300049540 | Bacteria | 1360 |
| 936 | Ga0501325_030486 | 3300049541 | Bacteria | 616 |
| 937 | Ga0501327_04773 | 3300049543 | Bacteria | 784 |
| 938 | Ga0501331_10332 | 3300049547 | Bacteria | 581 |
| 939 | Ga0501334_06131 | 3300049550 | Bacteria | 805 |
| 940 | Ga0501338_01088 | 3300049554 | Bacteria | 1388 |
| 941 | Ga0501340_015584 | 3300049556 | Bacteria | 601 |
| 942 | Ga0501031_0013728 | 3300049568 | Bacteria | 5280 |
| 943 | Ga0501031_0131278 | 3300049568 | Bacteria | 1636 |
| 944 | Ga0501031_0255102 | 3300049568 | Bacteria | 1140 |
| 945 | Ga0501032_0401675 | 3300049569 | Bacteria | 880 |
| 946 | Ga0501033_0000015 | 3300049570 | Bacteria | 218502 |
| 947 | Ga0501034_0039000 | 3300049571 | Bacteria | 4811 |
| 948 | Ga0501034_0804113 | 3300049571 | Bacteria | 833 |
| 949 | Ga0501036_0277221 | 3300049572 | Bacteria | 1403 |
| 950 | Ga0501036_0338927 | 3300049572 | Bacteria | 1256 |
| 951 | Ga0501037_0120485 | 3300049573 | Bacteria | 1887 |
| 952 | Ga0501038_0018195 | 3300049574 | Bacteria | 6343 |
| 953 | Ga0501038_0321673 | 3300049574 | Bacteria | 1210 |
| 954 | Ga0501039_0078087 | 3300049575 | Bacteria | 2575 |
| 955 | Ga0501039_0385024 | 3300049575 | Bacteria | 1102 |
| 956 | Ga0501039_0658355 | 3300049575 | Bacteria | 820 |
| 957 | Ga0501040_0022758 | 3300049576 | Bacteria | 4198 |
| 958 | Ga0501041_0045335 | 3300049577 | Bacteria | 2673 |
| 959 | Ga0501041_0150222 | 3300049577 | Bacteria | 1454 |
| 960 | Ga0501041_0423756 | 3300049577 | Bacteria | 844 |
| 961 | Ga0501041_0454979 | 3300049577 | Bacteria | 813 |
| 962 | Ga0501042_0121769 | 3300049578 | Bacteria | 1878 |
| 963 | Ga0501042_0277938 | 3300049578 | Bacteria | 1209 |
| 964 | Ga0501042_0412801 | 3300049578 | Bacteria | 978 |
| 965 | Ga0501043_0665162 | 3300049579 | Bacteria | 764 |
| 966 | Ga0501046_0213666 | 3300049580 | Bacteria | 1431 |
| 967 | Ga0501046_0300941 | 3300049580 | Bacteria | 1171 |
| 968 | Ga0501047_0367879 | 3300049581 | Bacteria | 1273 |
| 969 | Ga0501047_0402215 | 3300049581 | Bacteria | 1202 |
| 970 | Ga0501067_0042993 | 3300049583 | Bacteria | 2509 |
| 971 | Ga0501067_0054095 | 3300049583 | Bacteria | 2224 |
| 972 | Ga0501067_0311077 | 3300049583 | Bacteria | 877 |
| 973 | Ga0501067_0625893 | 3300049583 | Bacteria | 604 |
| 974 | Ga0501070_0025651 | 3300049586 | Bacteria | 4944 |
| 975 | Ga0501070_0364933 | 3300049586 | Bacteria | 1171 |
| 976 | Ga0501071_0206892 | 3300049587 | Bacteria | 1475 |
| 977 | Ga0501071_0297608 | 3300049587 | Bacteria | 1223 |
| 978 | Ga0501072_0101767 | 3300049588 | Bacteria | 2283 |
| 979 | Ga0501072_0212229 | 3300049588 | Bacteria | 1543 |
| 980 | Ga0501072_0229023 | 3300049588 | Bacteria | 1481 |
| 981 | Ga0501074_0102509 | 3300049590 | Bacteria | 2049 |
| 982 | Ga0501074_0119300 | 3300049590 | Bacteria | 1886 |
| 983 | Ga0501074_0378653 | 3300049590 | Bacteria | 1004 |
| 984 | Ga0501074_0504752 | 3300049590 | Bacteria | 857 |
| 985 | Ga0501075_0061672 | 3300049591 | Bacteria | 2826 |
| 986 | Ga0501075_0921791 | 3300049591 | Unclassified | 664 |
| 987 | Ga0501075_1289454 | 3300049591 | Bacteria | 554 |
| 988 | Ga0501076_0040257 | 3300049592 | Bacteria | 3672 |
| 989 | Ga0501076_0410053 | 3300049592 | Bacteria | 1114 |
| 990 | Ga0501076_0488219 | 3300049592 | Bacteria | 1015 |
| 991 | Ga0501076_0720830 | 3300049592 | Bacteria | 823 |
| 992 | Ga0501076_0901371 | 3300049592 | Bacteria | 729 |
| 993 | Ga0501077_0100551 | 3300049593 | Bacteria | 1832 |
| 994 | Ga0501223_127725 | 3300049663 | Bacteria | 541 |
| 995 | Ga0501079_0097287 | 3300049741 | Bacteria | 2282 |
| 996 | Ga0501079_0128052 | 3300049741 | Bacteria | 1975 |
| 997 | Ga0501079_0340090 | 3300049741 | Bacteria | 1176 |
| 998 | Ga0501079_0622349 | 3300049741 | Bacteria | 850 |
| 999 | Ga0501080_0001402 | 3300049742 | Bacteria | 20194 |
| 1000 | Ga0501080_0051233 | 3300049742 | Bacteria | 3841 |
| 1001 | Ga0501080_0082414 | 3300049742 | Bacteria | 2988 |
| 1002 | Ga0501080_0765808 | 3300049742 | Bacteria | 848 |
| 1003 | Ga0501081_0115588 | 3300049743 | Bacteria | 1907 |
| 1004 | Ga0501083_0139126 | 3300049744 | Bacteria | 1590 |
| 1005 | Ga0501083_0256127 | 3300049744 | Bacteria | 1139 |
| 1006 | Ga0501083_0584422 | 3300049744 | Bacteria | 727 |
| 1007 | Ga0501035_0386981 | 3300049822 | Bacteria | 1166 |
| 1008 | Ga0501035_0798519 | 3300049822 | Bacteria | 754 |
| 1009 | Ga0501044_0002343 | 3300049823 | Bacteria | 21608 |
| 1010 | Ga0501044_0114529 | 3300049823 | Bacteria | 2702 |
| 1011 | Ga0501045_0131667 | 3300049824 | Bacteria | 1859 |
| 1012 | Ga0501045_0139306 | 3300049824 | Bacteria | 1804 |
| 1013 | Ga0501045_0484772 | 3300049824 | Bacteria | 918 |
| 1014 | Ga0501212_017438 | 3300049851 | Bacteria | 1086 |
| 1015 | nmdc:mga03683_198665_c1 | 3300050489 | Bacteria | 920 |
| 1016 | nmdc:mga03n38_24275_c1 | 3300050490 | Bacteria | 2477 |
| 1017 | nmdc:mga03n38_6768_c1 | 3300050490 | Bacteria | 4010 |
| 1018 | nmdc:mga00v17_56028_c1 | 3300050491 | Bacteria | 2409 |
| 1019 | nmdc:mga00v17_857_c1 | 3300050491 | Bacteria | 16451 |
| 1020 | nmdc:mga0yw44_207684_c1 | 3300050492 | Bacteria | 1295 |
| 1021 | nmdc:mga0yw44_24_c1 | 3300050492 | Bacteria | 63201 |
| 1022 | nmdc:mga0yw44_340111_c1 | 3300050492 | Bacteria | 1009 |
| 1023 | nmdc:mga0yw44_454317_c1 | 3300050492 | Bacteria | 868 |
| 1024 | nmdc:mga06z11_26178_c1 | 3300050494 | Bacteria | 2774 |
| 1025 | nmdc:mga07m45_490741_c1 | 3300050496 | Bacteria | 711 |
| 1026 | nmdc:mga05p37_1465195_c1 | 3300050507 | Bacteria | 682 |
| 1027 | nmdc:mga05p37_968139_c1 | 3300050507 | Bacteria | 908 |
| 1028 | nmdc:mga09592_149121_c1 | 3300050508 | Bacteria | 2017 |
| 1029 | nmdc:mga0qj67_353936_c1 | 3300050509 | Unclassified | 1187 |
| 1030 | nmdc:mga0qj67_633462_c1 | 3300050509 | Bacteria | 854 |
| 1031 | nmdc:mga06r32_34684_c1 | 3300050510 | Bacteria | 4759 |
| 1032 | nmdc:mga0sz30_13608_c1 | 3300050516 | Bacteria | 3188 |
| 1033 | Ga0495601_0081039 | 3300053077 | Bacteria | 2083 |
| 1034 | Ga0495601_0084392 | 3300053077 | Bacteria | 2040 |
| 1035 | Ga0495601_0148599 | 3300053077 | Bacteria | 1529 |
| 1036 | Ga0495612_0112434 | 3300053078 | Bacteria | 1167 |
| 1037 | Ga0495595_0234617 | 3300053084 | Bacteria | 917 |
| 1038 | Ga0495619_0067906 | 3300053085 | Bacteria | 2381 |
| 1039 | Ga0500643_000011 | 3300053087 | Bacteria | 385630 |
| 1040 | Ga0500644_0073614 | 3300053088 | Unclassified | 1238 |
| 1041 | Ga0500646_0000823 | 3300053090 | Bacteria | 8581 |
| 1042 | Ga0500646_0085910 | 3300053090 | Bacteria | 967 |
| 1043 | Ga0500583_0015393 | 3300053092 | Bacteria | 3024 |
| 1044 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 1045 | Ga0500555_000015 | 3300053103 | Bacteria | 230204 |
| 1046 | Ga0500556_0002977 | 3300053104 | Bacteria | 5115 |
| 1047 | Ga0500582_166635 | 3300053114 | Bacteria | 756 |
| 1048 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 1049 | Ga0500655_001993 | 3300053133 | Bacteria | 3793 |
| 1050 | Ga0500568_0050531 | 3300053139 | Bacteria | 1638 |
| 1051 | Ga0500573_0039578 | 3300053140 | Bacteria | 2723 |
| 1052 | Ga0500577_0021093 | 3300053142 | Bacteria | 2142 |
| 1053 | Ga0500579_016957 | 3300053143 | Bacteria | 4707 |
| 1054 | Ga0500616_0000020 | 3300053153 | Bacteria | 530404 |
| 1055 | Ga0500616_0000144 | 3300053153 | Bacteria | 121889 |
| 1056 | Ga0500616_0006989 | 3300053153 | Bacteria | 7263 |
| 1057 | Ga0500616_0153811 | 3300053153 | Unclassified | 1062 |
| 1058 | Ga0500633_0131975 | 3300053160 | Unclassified | 932 |
| 1059 | Ga0500645_013743 | 3300053730 | Bacteria | 2593 |
| 1060 | Ga0501084_0000009 | 3300054114 | Bacteria | 194961 |
| 1061 | Ga0501084_0939700 | 3300054114 | Bacteria | 727 |
| 1062 | Ga0501084_0945205 | 3300054114 | Bacteria | 725 |
| 1063 | Ga0587066_089815 | 3300059490 | Bacteria | 680 |
| 1064 | Ga0587070_117223 | 3300059491 | Bacteria | 632 |
| 1065 | Ga0587073_0038139 | 3300059492 | Bacteria | 1033 |
| 1066 | Ga0587073_0077499 | 3300059492 | Bacteria | 817 |
| 1067 | Ga0587073_0161331 | 3300059492 | Bacteria | 643 |
| 1068 | Ga0587080_044144 | 3300059503 | Bacteria | 822 |
| 1069 | Ga0587080_065084 | 3300059503 | Bacteria | 718 |
| 1070 | Ga0587082_032282 | 3300059504 | Bacteria | 919 |
| 1071 | Ga0587088_091179 | 3300059508 | Bacteria | 667 |
| 1072 | Ga0587091_026167 | 3300059511 | Bacteria | 1061 |
| 1073 | Ga0587101_052505 | 3300059623 | Bacteria | 706 |
| 1074 | Ga0587067_011258 | 3300059640 | Bacteria | 1375 |
| 1075 | Ga0587079_108338 | 3300059647 | Bacteria | 672 |
| 1076 | Ga0587107_000994 | 3300059652 | Bacteria | 2147 |
| 1077 | Ga0587114_042212 | 3300059655 | Bacteria | 743 |
| 1078 | Ga0587071_064004 | 3300060344 | Bacteria | 787 |
| 1079 | Ga0587111_0000227 | 3300060346 | Bacteria | 4609 |
| 1080 | Ga0501082_0052880 | 3300060353 | Bacteria | 3501 |
| 1081 | Ga0501082_0276428 | 3300060353 | Bacteria | 1462 |
| 1082 | Ga0501082_0281433 | 3300060353 | Bacteria | 1448 |
| 1083 | Ga0501082_0901591 | 3300060353 | Bacteria | 773 |
| 1084 | Ga0466962_0000007 | 3300061719 | Bacteria | 157857 |
| 1085 | Ga0466962_0142444 | 3300061719 | Bacteria | 1161 |
| 1086 | Ga0530510_0615440 | 3300061734 | Bacteria | 826 |
| 1087 | Ga0530510_0699600 | 3300061734 | Bacteria | 772 |
| 1088 | 2787506690 | 2786546548 | Bacteria | 4745694 |
| 1089 | 2857479634 | 2857479173 | Bacteria | 2469263 |
| 1090 | 2857633015 | 2857632687 | Bacteria | 2448521 |
| 1091 | 2870801934 | 2870801768 | Bacteria | 2710986 |
| 1092 | 2870806323 | 2870804320 | Bacteria | 2552467 |
| 1093 | 2915361148 | 2915358134 | Bacteria | 6050864 |
| 1094 | 2919449334 | 2919446982 | Bacteria | 3994487 |
| 1095 | Ga0436360_1253719 | |||
| 1096 | LJQas_1011332 | |||
| 1097 | LJQas_1020987 | |||
| 1098 | JGI24740J21852_10032375 | |||
| 1099 | JGI24739J22299_10020519 | |||
| 1100 | JGI24739J22299_10065933 | |||
| 1101 | JGI24737J22298_10058404 | |||
| 1102 | JGI24735J21928_10006549 | |||
| 1103 | JGI24745J21846_1000243 | |||
| 1104 | JGI25406J46586_10045823 | |||
| 1105 | Ga0006758J48902_1015144 | |||
| 1106 | rootH1_10017476 | |||
| 1107 | JGI26145J50221_1015996 | |||
| 1108 | JGI25407J50210_10003808 | |||
| 1109 | Ga0058859_11666848 | |||
| 1110 | Ga0058863_10081680 | |||
| 1111 | Ga0058861_10081153 | |||
| 1112 | Ga0058860_11519682 | |||
| 1113 | Ga0058862_10176130 | |||
| 1114 | Ga0065704_10013929 | |||
| 1115 | Ga0065704_10310477 | |||
| 1116 | Ga0065707_10260152 | |||
| 1117 | Ga0070658_10002426 | |||
| 1118 | Ga0070658_10013418 | |||
| 1119 | Ga0070676_10062744 | |||
| 1120 | Ga0070683_100472532 | |||
| 1121 | Ga0070683_101326184 | |||
| 1122 | Ga0070690_100194556 | |||
| 1123 | Ga0070670_100311522 | |||
| 1124 | Ga0070670_100633112 | |||
| 1125 | Ga0070677_10112211 | |||
| 1126 | Ga0070680_100005522 | |||
| 1127 | Ga0070680_100301110 | |||
| 1128 | Ga0070682_100108095 | |||
| 1129 | Ga0070682_100456173 | |||
| 1130 | Ga0068868_100130012 | |||
| 1131 | Ga0070691_10039056 | |||
| 1132 | Ga0070661_100304631 | |||
| 1133 | Ga0070669_101252117 | |||
| 1134 | Ga0070675_100088085 | |||
| 1135 | Ga0070675_100623657 | |||
| 1136 | Ga0070671_100069289 | |||
| 1137 | Ga0070671_100434575 | |||
| 1138 | Ga0070674_101370206 | |||
| 1139 | Ga0070673_100050123 | |||
| 1140 | Ga0070673_100346530 | |||
| 1141 | Ga0070659_100553766 | |||
| 1142 | Ga0070659_101594074 | |||
| 1143 | Ga0070667_100001546 | |||
| 1144 | Ga0070667_100689172 | |||
| 1145 | Ga0070714_100000519 | |||
| 1146 | Ga0070714_100010979 | |||
| 1147 | Ga0070714_100038902 | |||
| 1148 | Ga0070714_100073187 | |||
| 1149 | Ga0070714_100451565 | |||
| 1150 | Ga0070714_100786193 | |||
| 1151 | Ga0070713_100786707 | |||
| 1152 | Ga0070705_100012015 | |||
| 1153 | Ga0070708_100079869 | |||
| 1154 | Ga0070708_100414719 | |||
| 1155 | Ga0070708_100877106 | |||
| 1156 | Ga0070663_100416023 | |||
| 1157 | Ga0070681_10005386 | |||
| 1158 | Ga0070681_10181889 | |||
| 1159 | Ga0070681_10249530 | |||
| 1160 | Ga0070681_10283665 | |||
| 1161 | Ga0070706_100005771 | |||
| 1162 | Ga0070706_100021749 | |||
| 1163 | Ga0070706_100060798 | |||
| 1164 | Ga0070706_100086360 | |||
| 1165 | Ga0070706_100094015 | |||
| 1166 | Ga0070706_100469667 | |||
| 1167 | Ga0070707_100006596 | |||
| 1168 | Ga0070707_100260424 | |||
| 1169 | Ga0070707_100367917 | |||
| 1170 | Ga0070707_100919066 | |||
| 1171 | Ga0070698_100039505 | |||
| 1172 | Ga0070698_100064533 | |||
| 1173 | Ga0070698_100092897 | |||
| 1174 | Ga0070699_100102795 | |||
| 1175 | Ga0070679_100009896 | |||
| 1176 | Ga0070679_100035803 | |||
| 1177 | Ga0070679_100052255 | |||
| 1178 | Ga0070679_100422203 | |||
| 1179 | Ga0070679_101110144 | |||
| 1180 | Ga0070679_101162550 | |||
| 1181 | Ga0070684_100080553 | |||
| 1182 | Ga0070684_100518353 | |||
| 1183 | Ga0070684_100866514 | |||
| 1184 | Ga0070684_101014956 | |||
| 1185 | Ga0070684_101152728 | |||
| 1186 | Ga0070684_101366149 | |||
| 1187 | Ga0070697_100002003 | |||
| 1188 | Ga0070697_100051727 | |||
| 1189 | Ga0070697_100112708 | |||
| 1190 | Ga0068853_100021204 | |||
| 1191 | Ga0068853_100171689 | |||
| 1192 | Ga0068853_100242720 | |||
| 1193 | Ga0068853_100320550 | |||
| 1194 | Ga0070672_100029248 | |||
| 1195 | Ga0070695_100042259 | |||
| 1196 | Ga0070695_100739244 | |||
| 1197 | Ga0070696_100027888 | |||
| 1198 | Ga0070696_101019814 | |||
| 1199 | Ga0070704_100080301 | |||
| 1200 | Ga0068855_100011055 | |||
| 1201 | Ga0068855_100044376 | |||
| 1202 | Ga0070664_100819856 | |||
| 1203 | Ga0068854_100000039 | |||
| 1204 | Ga0068854_100400572 | |||
| 1205 | Ga0068854_100566774 | |||
| 1206 | Ga0068856_100002334 | |||
| 1207 | Ga0068856_100004352 | |||
| 1208 | Ga0068856_100414606 | |||
| 1209 | Ga0068852_100112440 | |||
| 1210 | Ga0068852_100126825 | |||
| 1211 | Ga0068852_100126863 | |||
| 1212 | Ga0068852_100148325 | |||
| 1213 | Ga0068852_101100491 | |||
| 1214 | Ga0068864_100005865 | |||
| 1215 | Ga0068864_100466379 | |||
| 1216 | Ga0068864_100987440 | |||
| 1217 | Ga0068861_100759110 | |||
| 1218 | Ga0068863_100001338 | |||
| 1219 | Ga0068863_100016860 | |||
| 1220 | Ga0068863_100388856 | |||
| 1221 | Ga0068863_100449272 | |||
| 1222 | Ga0068863_101758844 | |||
| 1223 | Ga0068860_100439747 | |||
| 1224 | Ga0068860_100448021 | |||
| 1225 | Ga0068860_100579261 | |||
| 1226 | Ga0068862_100000836 | |||
| 1227 | Ga0068862_100201289 | |||
| 1228 | Ga0068862_101119795 | |||
| 1229 | Ga0081455_10009428 | |||
| 1230 | Ga0081455_10090574 | |||
| 1231 | Ga0081455_10118573 | |||
| 1232 | Ga0081539_10001876 | |||
| 1233 | Ga0081539_10002696 | |||
| 1234 | Ga0081539_10030228 | |||
| 1235 | Ga0081539_10113538 | |||
| 1236 | Ga0070717_10029749 | |||
| 1237 | Ga0075365_10000022 | |||
| 1238 | Ga0075365_10069816 | |||
| 1239 | Ga0075365_10089848 | |||
| 1240 | Ga0075365_10188819 | |||
| 1241 | Ga0075365_10447267 | |||
| 1242 | Ga0075365_10497871 | |||
| 1243 | Ga0075368_10048857 | |||
| 1244 | Ga0075368_10266116 | |||
| 1245 | Ga0075363_100033980 | |||
| 1246 | Ga0075363_100080865 | |||
| 1247 | Ga0075363_100105724 | |||
| 1248 | Ga0075364_10000985 | |||
| 1249 | Ga0075364_10194889 | |||
| 1250 | Ga0075362_10239657 | |||
| 1251 | Ga0075367_10030754 | |||
| 1252 | Ga0075367_10464222 | |||
| 1253 | Ga0075369_10168099 | |||
| 1254 | Ga0075427_10000259 | |||
| 1255 | Ga0075366_10528685 | |||
| 1256 | Ga0097621_100000003 | |||
| 1257 | Ga0097621_100158295 | |||
| 1258 | Ga0068871_100000013 | |||
| 1259 | Ga0068871_100713511 | |||
| 1260 | Ga0068871_101009764 | |||
| 1261 | Ga0068871_101353779 | |||
| 1262 | Ga0075428_100093456 | |||
| 1263 | Ga0075428_100145249 | |||
| 1264 | Ga0075428_101079417 | |||
| 1265 | Ga0075430_100221438 | |||
| 1266 | Ga0075430_100277403 | |||
| 1267 | Ga0075430_100370297 | |||
| 1268 | Ga0075431_100003767 | |||
| 1269 | Ga0075429_100029758 | |||
| 1270 | Ga0075436_100082948 | |||
| 1271 | Ga0097620_100027915 | |||
| 1272 | Ga0105244_10338770 | |||
| 1273 | Ga0105240_10132772 | |||
| 1274 | Ga0105240_10168667 | |||
| 1275 | Ga0105240_10258457 | |||
| 1276 | Ga0105240_10746933 | |||
| 1277 | Ga0105240_11917813 | |||
| 1278 | Ga0105245_10016124 | |||
| 1279 | Ga0105245_10022092 | |||
| 1280 | Ga0105245_10232985 | |||
| 1281 | Ga0105245_10284933 | |||
| 1282 | Ga0105245_10635929 | |||
| 1283 | Ga0105247_10166279 | |||
| 1284 | Ga0114129_10031086 | |||
| 1285 | Ga0114129_11472071 | |||
| 1286 | Ga0105243_11575488 | |||
| 1287 | Ga0105241_10001993 | |||
| 1288 | Ga0105241_10142001 | |||
| 1289 | Ga0105241_10152358 | |||
| 1290 | Ga0105241_10502991 | |||
| 1291 | Ga0105241_10731442 | |||
| 1292 | Ga0105242_10003381 | |||
| 1293 | Ga0105248_10153043 | |||
| 1294 | Ga0105248_10592087 | |||
| 1295 | Ga0105237_10194860 | |||
| 1296 | Ga0105237_10293324 | |||
| 1297 | Ga0105238_10757487 | |||
| 1298 | Ga0105238_11930005 | |||
| 1299 | Ga0105249_10262411 | |||
| 1300 | Ga0105249_10406852 | |||
| 1301 | Ga0105249_10833232 | |||
| 1302 | Ga0105032_101210 | |||
| 1303 | Ga0157370_10065219 | |||
| 1304 | Ga0157370_10400599 | |||
| 1305 | Ga0157370_10771027 | |||
| 1306 | Ga0157369_10037648 | |||
| 1307 | Ga0157369_10351553 | |||
| 1308 | Ga0157369_10859241 | |||
| 1309 | Ga0157374_10128502 | |||
| 1310 | Ga0157374_10244772 | |||
| 1311 | Ga0157374_10249498 | |||
| 1312 | Ga0157374_10568133 | |||
| 1313 | Ga0157378_11216508 | |||
| 1314 | Ga0163162_10138655 | |||
| 1315 | Ga0163162_10175359 | |||
| 1316 | Ga0163162_10586208 | |||
| 1317 | Ga0163162_10720435 | |||
| 1318 | Ga0163162_11756325 | |||
| 1319 | Ga0157372_10057778 | |||
| 1320 | Ga0157372_10167743 | |||
| 1321 | Ga0157372_10373824 | |||
| 1322 | Ga0157372_10800475 | |||
| 1323 | Ga0157372_11479550 | |||
| 1324 | Ga0157375_10383381 | |||
| 1325 | Ga0157375_10872734 | |||
| 1326 | Ga0157375_11223493 | |||
| 1327 | Ga0163163_10006948 | |||
| 1328 | Ga0163163_10011237 | |||
| 1329 | Ga0163163_10360035 | |||
| 1330 | Ga0163163_10518653 | |||
| 1331 | Ga0163163_10796684 | |||
| 1332 | Ga0157380_10000051 | |||
| 1333 | Ga0157380_10251534 | |||
| 1334 | Ga0157380_10852707 | |||
| 1335 | Ga0157380_11209403 | |||
| 1336 | Ga0182008_10058233 | |||
| 1337 | Ga0182008_10082236 | |||
| 1338 | Ga0182008_10234480 | |||
| 1339 | Ga0182008_10350635 | |||
| 1340 | Ga0157377_10409985 | |||
| 1341 | Ga0157379_10000101 | |||
| 1342 | Ga0157379_10009261 | |||
| 1343 | Ga0157379_11830586 | |||
| 1344 | Ga0157376_10024093 | |||
| 1345 | Ga0182006_1084553 | |||
| 1346 | Ga0163161_10131187 | |||
| 1347 | Ga0197907_10311092 | |||
| 1348 | Ga0197907_10333276 | |||
| 1349 | Ga0197907_10773738 | |||
| 1350 | Ga0197907_10800216 | |||
| 1351 | Ga0197907_11130806 | |||
| 1352 | Ga0197907_11365827 | |||
| 1353 | Ga0206356_10169717 | |||
| 1354 | Ga0206356_10226831 | |||
| 1355 | Ga0206356_10929817 | |||
| 1356 | Ga0206356_11287527 | |||
| 1357 | Ga0206356_11574971 | |||
| 1358 | Ga0206349_1119855 | |||
| 1359 | Ga0206349_1637736 | |||
| 1360 | Ga0206355_1680354 | |||
| 1361 | Ga0206351_10175414 | |||
| 1362 | Ga0206352_10667425 | |||
| 1363 | Ga0206352_10734764 | |||
| 1364 | Ga0206350_10443236 | |||
| 1365 | Ga0206350_10587188 | |||
| 1366 | Ga0206354_10391537 | |||
| 1367 | Ga0206354_11636011 | |||
| 1368 | Ga0206353_10434407 | |||
| 1369 | Ga0206353_11273815 | |||
| 1370 | Ga0206353_11828919 | |||
| 1371 | Ga0154015_1602284 | |||
| 1372 | Ga0213873_10000595 | |||
| 1373 | Ga0213873_10003193 | |||
| 1374 | Ga0213873_10018295 | |||
| 1375 | Ga0213873_10021366 | |||
| 1376 | Ga0213872_10004954 | |||
| 1377 | Ga0213872_10007856 | |||
| 1378 | Ga0213872_10112260 | |||
| 1379 | Ga0213874_10018062 | |||
| 1380 | Ga0213874_10030397 | |||
| 1381 | Ga0213876_10003555 | |||
| 1382 | Ga0213876_10012912 | |||
| 1383 | Ga0213876_10014070 | |||
| 1384 | Ga0213876_10351894 | |||
| 1385 | Ga0213875_10000001 | |||
| 1386 | Ga0213875_10012869 | |||
| 1387 | Ga0213875_10041646 | |||
| 1388 | Ga0213875_10169764 | |||
| 1389 | Ga0213875_10195584 | |||
| 1390 | Ga0213871_10009458 | |||
| 1391 | Ga0213871_10077498 | |||
| 1392 | Ga0224712_10000619 | |||
| 1393 | Ga0224712_10003141 | |||
| 1394 | Ga0224712_10153846 | |||
| 1395 | Ga0224712_10420420 | |||
| 1396 | Ga0207682_10028296 | |||
| 1397 | Ga0207710_10106538 | |||
| 1398 | Ga0207688_10042403 | |||
| 1399 | Ga0207688_10164176 | |||
| 1400 | Ga0207680_10324918 | |||
| 1401 | Ga0207645_10048082 | |||
| 1402 | Ga0207645_10154236 | |||
| 1403 | Ga0207645_10390091 | |||
| 1404 | Ga0207705_10116912 | |||
| 1405 | Ga0207705_11044194 | |||
| 1406 | Ga0207684_10034076 | |||
| 1407 | Ga0207684_10068282 | |||
| 1408 | Ga0207684_10100069 | |||
| 1409 | Ga0207684_10211204 | |||
| 1410 | Ga0207684_10372727 | |||
| 1411 | Ga0207654_10001365 | |||
| 1412 | Ga0207654_10319989 | |||
| 1413 | Ga0207654_10549538 | |||
| 1414 | Ga0207707_10024016 | |||
| 1415 | Ga0207707_10303873 | |||
| 1416 | Ga0207695_10116275 | |||
| 1417 | Ga0207695_10156152 | |||
| 1418 | Ga0207695_10192227 | |||
| 1419 | Ga0207695_10298515 | |||
| 1420 | Ga0207695_10308587 | |||
| 1421 | Ga0207695_10992685 | |||
| 1422 | Ga0207660_10016445 | |||
| 1423 | Ga0207649_10238151 | |||
| 1424 | Ga0207652_10013911 | |||
| 1425 | Ga0207652_10036196 | |||
| 1426 | Ga0207652_10061003 | |||
| 1427 | Ga0207652_10494878 | |||
| 1428 | Ga0207646_10045629 | |||
| 1429 | Ga0207646_10049384 | |||
| 1430 | Ga0207646_10155120 | |||
| 1431 | Ga0207694_10834799 | |||
| 1432 | Ga0207650_10362585 | |||
| 1433 | Ga0207659_10068746 | |||
| 1434 | Ga0207687_10004724 | |||
| 1435 | Ga0207687_10304270 | |||
| 1436 | Ga0207700_10527734 | |||
| 1437 | Ga0207700_10646612 | |||
| 1438 | Ga0207664_10002006 | |||
| 1439 | Ga0207664_10040228 | |||
| 1440 | Ga0207664_10074167 | |||
| 1441 | Ga0207664_10169646 | |||
| 1442 | Ga0207664_10360769 | |||
| 1443 | Ga0207644_10020573 | |||
| 1444 | Ga0207690_10091738 | |||
| 1445 | Ga0207690_10639806 | |||
| 1446 | Ga0207706_10330499 | |||
| 1447 | Ga0207706_10398213 | |||
| 1448 | Ga0207686_10000781 | |||
| 1449 | Ga0207704_10882007 | |||
| 1450 | Ga0207691_10009551 | |||
| 1451 | Ga0207691_10527260 | |||
| 1452 | Ga0207691_10929260 | |||
| 1453 | Ga0207711_10145542 | |||
| 1454 | Ga0207689_10357275 | |||
| 1455 | Ga0207661_10067883 | |||
| 1456 | Ga0207661_10121653 | |||
| 1457 | Ga0207661_10393341 | |||
| 1458 | Ga0207661_10760954 | |||
| 1459 | Ga0207661_10945419 | |||
| 1460 | Ga0207661_11114104 | |||
| 1461 | Ga0207679_10815623 | |||
| 1462 | Ga0207667_10001579 | |||
| 1463 | Ga0207667_10103107 | |||
| 1464 | Ga0207667_10150143 | |||
| 1465 | Ga0207667_11482633 | |||
| 1466 | Ga0207651_10003118 | |||
| 1467 | Ga0207651_10693290 | |||
| 1468 | Ga0207712_10015493 | |||
| 1469 | Ga0207712_10147470 | |||
| 1470 | Ga0207712_10183651 | |||
| 1471 | Ga0207668_11034222 | |||
| 1472 | Ga0207640_10000024 | |||
| 1473 | Ga0207640_10151384 | |||
| 1474 | Ga0207640_10300351 | |||
| 1475 | Ga0207658_10005603 | |||
| 1476 | Ga0207677_10072215 | |||
| 1477 | Ga0207677_10341212 | |||
| 1478 | Ga0207703_10003502 | |||
| 1479 | Ga0207639_10001948 | |||
| 1480 | Ga0207639_10158693 | |||
| 1481 | Ga0207678_10062167 | |||
| 1482 | Ga0207678_10244885 | |||
| 1483 | Ga0207678_11292418 | |||
| 1484 | Ga0207702_10003580 | |||
| 1485 | Ga0207702_10025526 | |||
| 1486 | Ga0207702_10403334 | |||
| 1487 | Ga0207641_10003356 | |||
| 1488 | Ga0207641_10009791 | |||
| 1489 | Ga0207641_10256022 | |||
| 1490 | Ga0207641_10721055 | |||
| 1491 | Ga0207641_11718782 | |||
| 1492 | Ga0207676_10007479 | |||
| 1493 | Ga0207676_10689264 | |||
| 1494 | Ga0207674_10862747 | |||
| 1495 | Ga0207675_100162293 | |||
| 1496 | Ga0207683_10266407 | |||
| 1497 | Ga0207683_10407855 | |||
| 1498 | Ga0207698_10014555 | |||
| 1499 | Ga0207698_10072106 | |||
| 1500 | Ga0207698_10101413 | |||
| 1501 | Ga0207698_10263011 | |||
| 1502 | Ga0207698_10387015 | |||
| 1503 | Ga0209998_10101827 | |||
| 1504 | Ga0265356_1000525 | |||
| 1505 | Ga0268266_10217248 | |||
| 1506 | Ga0268266_10288535 | |||
| 1507 | Ga0268265_10000156 | |||
| 1508 | Ga0268265_10131898 | |||
| 1509 | Ga0268265_10961086 | |||
| 1510 | Ga0268264_10086134 | |||
| 1511 | Ga0268264_10261615 | |||
| 1512 | Ga0265337_1043836 | |||
| 1513 | Ga0265326_10012298 | |||
| 1514 | Ga0265334_10007247 | |||
| 1515 | Ga0265334_10047737 | |||
| 1516 | Ga0265318_10022101 | |||
| 1517 | Ga0265318_10044756 | |||
| 1518 | Ga0265318_10215517 | |||
| 1519 | Ga0265323_10012167 | |||
| 1520 | Ga0265323_10112210 | |||
| 1521 | Ga0265323_10189094 | |||
| 1522 | Ga0265322_10007533 | |||
| 1523 | Ga0265322_10008553 | |||
| 1524 | Ga0265322_10128186 | |||
| 1525 | Ga0265336_10006414 | |||
| 1526 | Ga0265336_10029741 | |||
| 1527 | Ga0265336_10072437 | |||
| 1528 | Ga0265336_10100799 | |||
| 1529 | Ga0265338_10000052 | |||
| 1530 | Ga0265338_10000054 | |||
| 1531 | Ga0265338_10000178 | |||
| 1532 | Ga0265338_10000366 | |||
| 1533 | Ga0265338_10000396 | |||
| 1534 | Ga0265338_10080483 | |||
| 1535 | Ga0265338_10084583 | |||
| 1536 | Ga0265338_10085544 | |||
| 1537 | Ga0265338_10151474 | |||
| 1538 | Ga0265338_10561404 | |||
| 1539 | Ga0265324_10010795 | |||
| 1540 | Ga0265324_10024082 | |||
| 1541 | Ga0265324_10059466 | |||
| 1542 | Ga0265324_10192185 | |||
| 1543 | Ga0265762_1003191 | |||
| 1544 | Ga0265762_1012092 | |||
| 1545 | Ga0265765_1013536 | |||
| 1546 | Ga0265760_10000904 | |||
| 1547 | Ga0265330_10013203 | |||
| 1548 | Ga0265332_10008843 | |||
| 1549 | Ga0265332_10011261 | |||
| 1550 | Ga0265328_10022106 | |||
| 1551 | Ga0265320_10171585 | |||
| 1552 | Ga0265325_10002829 | |||
| 1553 | Ga0265325_10013636 | |||
| 1554 | Ga0265325_10026083 | |||
| 1555 | Ga0265325_10030390 | |||
| 1556 | Ga0265325_10089657 | |||
| 1557 | Ga0265329_10008966 | |||
| 1558 | Ga0265340_10015913 | |||
| 1559 | Ga0265340_10017309 | |||
| 1560 | Ga0265340_10179788 | |||
| 1561 | Ga0265339_10013311 | |||
| 1562 | Ga0265339_10024094 | |||
| 1563 | Ga0265339_10059896 | |||
| 1564 | Ga0265339_10142322 | |||
| 1565 | Ga0265339_10143592 | |||
| 1566 | Ga0265331_10014050 | |||
| 1567 | Ga0265331_10362469 | |||
| 1568 | Ga0265327_10004316 | |||
| 1569 | Ga0265327_10026829 | |||
| 1570 | Ga0265327_10054273 | |||
| 1571 | Ga0265327_10069113 | |||
| 1572 | Ga0265316_10036091 | |||
| 1573 | Ga0265316_10061416 | |||
| 1574 | Ga0265316_10114249 | |||
| 1575 | Ga0265316_10148230 | |||
| 1576 | Ga0265316_10184223 | |||
| 1577 | Ga0265316_10377257 | |||
| 1578 | Ga0307408_100823598 | |||
| 1579 | Ga0265313_10010254 | |||
| 1580 | Ga0265313_10024100 | |||
| 1581 | Ga0265313_10110775 | |||
| 1582 | Ga0307508_10040608 | |||
| 1583 | Ga0316575_10121553 | |||
| 1584 | Ga0316579_10003148 | |||
| 1585 | Ga0265314_10056945 | |||
| 1586 | Ga0265314_10257790 | |||
| 1587 | Ga0265314_10445906 | |||
| 1588 | Ga0265342_10006015 | |||
| 1589 | Ga0265342_10006331 | |||
| 1590 | Ga0265342_10042321 | |||
| 1591 | Ga0316576_10000044 | |||
| 1592 | Ga0316576_10040833 | |||
| 1593 | Ga0316576_10102429 | |||
| 1594 | Ga0316576_10120771 | |||
| 1595 | Ga0316576_10159441 | |||
| 1596 | Ga0316576_10164563 | |||
| 1597 | Ga0316576_10383256 | |||
| 1598 | Ga0316578_10036090 | |||
| 1599 | Ga0316578_10047642 | |||
| 1600 | Ga0307405_10040503 | |||
| 1601 | Ga0307405_10088557 | |||
| 1602 | Ga0307405_10201904 | |||
| 1603 | Ga0307405_10537633 | |||
| 1604 | Ga0316577_10016991 | |||
| 1605 | Ga0316577_10134021 | |||
| 1606 | Ga0316577_10508590 | |||
| 1607 | Ga0307413_10355754 | |||
| 1608 | Ga0307410_10477080 | |||
| 1609 | Ga0307410_10914426 | |||
| 1610 | Ga0307410_11092447 | |||
| 1611 | Ga0307410_11508453 | |||
| 1612 | Ga0307406_10024435 | |||
| 1613 | Ga0307406_11556420 | |||
| 1614 | Ga0307407_10022946 | |||
| 1615 | Ga0307407_10112594 | |||
| 1616 | Ga0307407_10474008 | |||
| 1617 | Ga0307412_10196528 | |||
| 1618 | Ga0307412_11132929 | |||
| 1619 | Ga0307412_11232736 | |||
| 1620 | Ga0307409_100100999 | |||
| 1621 | Ga0307409_100392921 | |||
| 1622 | Ga0307416_100035072 | |||
| 1623 | Ga0307416_100074155 | |||
| 1624 | Ga0307416_100318729 | |||
| 1625 | Ga0307416_100513006 | |||
| 1626 | Ga0307416_100596914 | |||
| 1627 | Ga0307416_102470482 | |||
| 1628 | Ga0307414_10066151 | |||
| 1629 | Ga0307411_10017055 | |||
| 1630 | Ga0307411_11573956 | |||
| 1631 | Ga0307415_100045358 | |||
| 1632 | Ga0307415_100676782 | |||
| 1633 | Ga0307415_100941902 | |||
| 1634 | Ga0316583_10018078 | |||
| 1635 | Ga0316585_10022471 | |||
| 1636 | Ga0316580_10001591 | |||
| 1637 | Ga0316593_10000617 | |||
| 1638 | Ga0316593_10003813 | |||
| 1639 | Ga0316593_10004644 | |||
| 1640 | Ga0316593_10009065 | |||
| 1641 | Ga0316593_10013598 | |||
| 1642 | Ga0316593_10045668 | |||
| 1643 | Ga0316593_10057174 | |||
| 1644 | Ga0316593_10115814 | |||
| 1645 | Ga0316593_10256387 | |||
| 1646 | Ga0316592_1000648 | |||
| 1647 | Ga0316592_1000962 | |||
| 1648 | Ga0316592_1001542 | |||
| 1649 | Ga0316592_1005486 | |||
| 1650 | Ga0316592_1005684 | |||
| 1651 | Ga0316592_1008299 | |||
| 1652 | Ga0316592_1021735 | |||
| 1653 | Ga0316592_1027220 | |||
| 1654 | Ga0316588_1000021 | |||
| 1655 | Ga0316588_1006251 | |||
| 1656 | Ga0316588_1022587 | |||
| 1657 | Ga0316587_1049711 | |||
| 1658 | Ga0316596_1000103 | |||
| 1659 | Ga0316596_1001763 | |||
| 1660 | Ga0316596_1002456 | |||
| 1661 | Ga0316596_1003921 | |||
| 1662 | Ga0316596_1029434 | |||
| 1663 | Ga0316596_1037856 | |||
| 1664 | Ga0316596_1051195 | |||
| 1665 | Ga0316596_1059076 | |||
| 1666 | Ga0316596_1062764 | |||
| 1667 | Ga0373934_0107996 | |||
| 1668 | Ga0373944_0158224 | |||
| 1669 | Ga0373923_0368975 | |||
| 1670 | Ga0373960_0069319 | |||
| 1671 | Ga0373943_0080168 | |||
| 1672 | Ga0316574_0000425 | |||
| 1673 | Ga0316574_0004026 | |||
| 1674 | Ga0316574_0029464 | |||
| 1675 | Ga0316574_0037513 | |||
| 1676 | Ga0316574_0043756 | |||
| 1677 | Ga0316574_0061678 | |||
| 1678 | Ga0316574_0097531 | |||
| 1679 | Ga0316574_0269817 | |||
| 1680 | Ga0316574_0475492 | |||
| 1681 | Ga0373931_0044819 | |||
| 1682 | Ga0373931_0236961 | |||
| 1683 | Ga0373935_0004181 | |||
| 1684 | Ga0373935_0151089 | |||
| 1685 | Ga0373927_0160436 | |||
| 1686 | Ga0373947_0170363 | |||
| 1687 | Ga0373947_0185913 | |||
| 1688 | Ga0373947_0191364 | |||
| 1689 | Ga0316582_0001841 | |||
| 1690 | Ga0316582_0006061 | |||
| 1691 | Ga0316582_0407926 | |||
| 1692 | Ga0316584_0003484 | |||
| 1693 | Ga0316584_0025317 | |||
| 1694 | Ga0316584_0109969 | |||
| 1695 | Ga0316584_0176768 | |||
| 1696 | Ga0316584_0222519 | |||
| 1697 | Ga0373925_0018411 | |||
| 1698 | Ga0373925_0453019 | |||
| 1699 | Ga0395899_0000039 | |||
| 1700 | Ga0395899_0004980 | |||
| 1701 | Ga0395900_0069514 | |||
| 1702 | Ga0395900_0117663 | |||
| 1703 | Ga0395900_0350503 | |||
| 1704 | Ga0395900_0807168 | |||
| 1705 | Ga0395898_0000226 | |||
| 1706 | Ga0395898_0008404 | |||
| 1707 | Ga0395898_0688006 | |||
| 1708 | Ga0395905_0006755 | |||
| 1709 | Ga0436364_0196276 | |||
| 1710 | Ga0436364_0273345 | |||
| 1711 | Ga0436364_0539388 | |||
| 1712 | Ga0436364_0575822 | |||
| 1713 | Ga0436364_0646491 | |||
| 1714 | Ga0436364_0798963 | |||
| 1715 | Ga0436364_0990835 | |||
| 1716 | Ga0436364_1111625 | |||
| 1717 | Ga0436364_1142864 | |||
| 1718 | Ga0436364_1200424 | |||
| 1719 | Ga0436364_1211243 | |||
| 1720 | Ga0436364_1276914 | |||
| 1721 | Ga0436364_1306001 | |||
| 1722 | Ga0436364_1494664 | |||
| 1723 | Ga0395901_0018326 | |||
| 1724 | Ga0395901_0195273 | |||
| 1725 | Ga0395901_0312522 | |||
| 1726 | Ga0436365_0097047 | |||
| 1727 | Ga0436365_0230296 | |||
| 1728 | Ga0436365_0427864 | |||
| 1729 | Ga0436365_0767674 | |||
| 1730 | Ga0436365_0794964 | |||
| 1731 | Ga0436365_0979666 | |||
| 1732 | Ga0436365_1319563 | |||
| 1733 | Ga0436365_1660231 | |||
| 1734 | Ga0436365_1904939 | |||
| 1735 | Ga0436360_0002462 | |||
| 1736 | Ga0436360_0355760 | |||
| 1737 | Ga0436360_0422973 | |||
| 1738 | Ga0436360_0651805 | |||
| 1739 | Ga0436360_0665312 | |||
| 1740 | Ga0436360_0766016 | |||
| 1741 | Ga0436360_0979202 | |||
| 1742 | Ga0436360_1033819 | |||
| 1743 | Ga0436360_1055305 | |||
| 1744 | Ga0436360_1112229 | |||
| 1745 | Ga0436360_1146218 | |||
| 1746 | Ga0436360_1149615 | |||
| 1747 | Ga0436360_1209713 | |||
| 1748 | Ga0436360_1218238 | |||
| 1749 | Ga0436361_0080925 | |||
| 1750 | Ga0436361_0143737 | |||
| 1751 | Ga0436361_0269103 | |||
| 1752 | Ga0436361_0423980 | |||
| 1753 | Ga0436361_0473343 | |||
| 1754 | Ga0436361_0627825 | |||
| 1755 | Ga0436361_0738206 | |||
| 1756 | Ga0436361_0776532 | |||
| 1757 | Ga0436361_0801716 | |||
| 1758 | Ga0436361_1140566 | |||
| 1759 | Ga0436361_1143312 | |||
| 1760 | Ga0436361_1165208 | |||
| 1761 | Ga0436363_0138227 | |||
| 1762 | Ga0436363_0403132 | |||
| 1763 | Ga0436363_0634802 | |||
| 1764 | Ga0436363_0947238 | |||
| 1765 | Ga0436363_1017066 | |||
| 1766 | Ga0436363_1100879 | |||
| 1767 | Ga0436363_1252147 | |||
| 1768 | Ga0436362_0091064 | |||
| 1769 | Ga0436362_0107616 | |||
| 1770 | Ga0436362_0109475 | |||
| 1771 | Ga0436362_0226828 | |||
| 1772 | Ga0436362_0399122 | |||
| 1773 | Ga0436362_0437798 | |||
| 1774 | Ga0436362_0595348 | |||
| 1775 | Ga0436362_0684804 | |||
| 1776 | Ga0436362_0763995 | |||
| 1777 | Ga0436362_0973701 | |||
| 1778 | Ga0436362_1010063 | |||
| 1779 | Ga0436362_1075726 | |||
| 1780 | Ga0436362_1127986 | |||
| 1781 | Ga0436362_1295225 | |||
| 1782 | Ga0451798_0436115 | |||
| 1783 | Ga0451802_1017005 | |||
| 1784 | Ga0451845_0268857 | |||
| 1785 | Ga0451852_14070 | |||
| 1786 | Ga0451843_0911427 | |||
| 1787 | Ga0451855_1261441 | |||
| 1788 | Ga0451855_1789869 | |||
| 1789 | Ga0450916_090822 | |||
| 1790 | Ga0451577_0000433 | |||
| 1791 | Ga0451577_0009630 | |||
| 1792 | Ga0451577_0016499 | |||
| 1793 | Ga0451577_0019005 | |||
| 1794 | Ga0451577_0038053 | |||
| 1795 | Ga0451577_0094271 | |||
| 1796 | Ga0451577_0113079 | |||
| 1797 | Ga0451577_0121175 | |||
| 1798 | Ga0451577_0312572 | |||
| 1799 | Ga0451577_0325812 | |||
| 1800 | Ga0451577_0451515 | |||
| 1801 | Ga0451577_0883983 | |||
| 1802 | Ga0451577_1105802 | |||
| 1803 | Ga0451577_1262305 | |||
| 1804 | Ga0466969_0044133 | |||
| 1805 | Ga0453683_0000522 | |||
| 1806 | Ga0453683_0003998 | |||
| 1807 | Ga0453683_0077428 | |||
| 1808 | Ga0453683_0117933 | |||
| 1809 | Ga0453683_0175995 | |||
| 1810 | Ga0453683_0199689 | |||
| 1811 | Ga0453683_0564067 | |||
| 1812 | Ga0466965_0058570 | |||
| 1813 | Ga0466966_0012777 | |||
| 1814 | Ga0466966_0417838 | |||
| 1815 | Ga0466961_0113127 | |||
| 1816 | Ga0466963_0030151 | |||
| 1817 | Ga0466964_0156772 | |||
| 1818 | Ga0453684_0000055 | |||
| 1819 | Ga0453684_0000171 | |||
| 1820 | Ga0453684_0000420 | |||
| 1821 | Ga0453684_0000506 | |||
| 1822 | Ga0453684_0000588 | |||
| 1823 | Ga0453684_0001549 | |||
| 1824 | Ga0453684_0001835 | |||
| 1825 | Ga0453684_0002161 | |||
| 1826 | Ga0453684_0002895 | |||
| 1827 | Ga0453684_0005528 | |||
| 1828 | Ga0453684_0005656 | |||
| 1829 | Ga0453684_0016436 | |||
| 1830 | Ga0453684_0030092 | |||
| 1831 | Ga0453684_0035909 | |||
| 1832 | Ga0453684_0057385 | |||
| 1833 | Ga0453684_0065863 | |||
| 1834 | Ga0453684_0075151 | |||
| 1835 | Ga0453684_0106268 | |||
| 1836 | Ga0453684_0143075 | |||
| 1837 | Ga0453684_0167534 | |||
| 1838 | Ga0453684_0168330 | |||
| 1839 | Ga0453684_0168811 | |||
| 1840 | Ga0453684_0168952 | |||
| 1841 | Ga0453684_0202716 | |||
| 1842 | Ga0453684_0219953 | |||
| 1843 | Ga0453684_0263102 | |||
| 1844 | Ga0453684_0273428 | |||
| 1845 | Ga0453684_0452149 | |||
| 1846 | Ga0453684_0546743 | |||
| 1847 | Ga0453684_0558997 | |||
| 1848 | Ga0453684_0741452 | |||
| 1849 | Ga0453684_1057136 | |||
| 1850 | Ga0453684_1273020 | |||
| 1851 | Ga0453684_1420829 | |||
| 1852 | Ga0453684_1549238 | |||
| 1853 | Ga0466971_0000005 | |||
| 1854 | Ga0466971_0283155 | |||
| 1855 | Ga0466970_0021508 | |||
| 1856 | Ga0466970_0057209 | |||
| 1857 | Ga0466957_0069306 | |||
| 1858 | Ga0466957_0083253 | |||
| 1859 | Ga0466960_0039668 | |||
| 1860 | Ga0466960_0402246 | |||
| 1861 | Ga0451576_0000204 | |||
| 1862 | Ga0451576_0000454 | |||
| 1863 | Ga0451576_0000689 | |||
| 1864 | Ga0451576_0016407 | |||
| 1865 | Ga0451576_0024947 | |||
| 1866 | Ga0451576_0031702 | |||
| 1867 | Ga0451576_0032623 | |||
| 1868 | Ga0451576_0034310 | |||
| 1869 | Ga0451576_0076007 | |||
| 1870 | Ga0451576_0099789 | |||
| 1871 | Ga0451576_0751403 | |||
| 1872 | Ga0451576_1172790 | |||
| 1873 | Ga0466958_0005653 | |||
| 1874 | Ga0466958_0020009 | |||
| 1875 | Ga0466958_0569552 | |||
| 1876 | Ga0466958_0726359 | |||
| 1877 | Ga0466967_0001979 | |||
| 1878 | Ga0466967_0061054 | |||
| 1879 | Ga0466967_0088574 | |||
| 1880 | Ga0466967_0105905 | |||
| 1881 | Ga0466967_0116667 | |||
| 1882 | Ga0466967_0264149 | |||
| 1883 | Ga0466967_1792423 | |||
| 1884 | Ga0495592_0163757 | |||
| 1885 | Ga0495603_0094891 | |||
| 1886 | Ga0495629_0088772 | |||
| 1887 | Ga0495629_0739081 | |||
| 1888 | Ga0495638_0000070 | |||
| 1889 | Ga0495641_0239686 | |||
| 1890 | Ga0495651_0370821 | |||
| 1891 | Ga0495580_0002023 | |||
| 1892 | Ga0495585_0038134 | |||
| 1893 | Ga0495594_0304702 | |||
| 1894 | Ga0495596_0034263 | |||
| 1895 | Ga0495608_0221722 | |||
| 1896 | Ga0495616_0080146 | |||
| 1897 | Ga0495620_0047535 | |||
| 1898 | Ga0495628_0364349 | |||
| 1899 | Ga0495628_0366101 | |||
| 1900 | Ga0495644_0155928 | |||
| 1901 | Ga0495652_0611799 | |||
| 1902 | Ga0495665_0074242 | |||
| 1903 | Ga0495640_0177675 | |||
| 1904 | Ga0495598_0201598 | |||
| 1905 | Ga0495621_0023755 | |||
| 1906 | Ga0495645_0489943 | |||
| 1907 | Ga0495656_0067316 | |||
| 1908 | Ga0495611_0051314 | |||
| 1909 | Ga0495659_0258467 | |||
| 1910 | Ga0495661_0160588 | |||
| 1911 | Ga0495588_0168354 | |||
| 1912 | Ga0495657_0152480 | |||
| 1913 | Ga0495657_0778041 | |||
| 1914 | Ga0495599_0466266 | |||
| 1915 | Ga0495623_0210189 | |||
| 1916 | Ga0495658_0479285 | |||
| 1917 | Ga0495624_0175255 | |||
| 1918 | Ga0495624_0528731 | |||
| 1919 | Ga0495670_0400508 | |||
| 1920 | Ga0495671_0134863 | |||
| 1921 | Ga0495604_0022605 | |||
| 1922 | Ga0495604_0152364 | |||
| 1923 | Ga0495674_0113319 | |||
| 1924 | Ga0495680_0064028 | |||
| 1925 | Ga0495685_030399 | |||
| 1926 | Ga0495681_0166072 | |||
| 1927 | Ga0495684_0287403 | |||
| 1928 | Ga0495593_0055492 | |||
| 1929 | Ga0495614_0067207 | |||
| 1930 | Ga0495614_0260507 | |||
| 1931 | Ga0495615_0003053 | |||
| 1932 | Ga0496100_0024180 | |||
| 1933 | Ga0496101_0019981 | |||
| 1934 | Ga0496101_0127638 | |||
| 1935 | Ga0496101_0351673 | |||
| 1936 | Ga0496102_0000521 | |||
| 1937 | Ga0496102_0008968 | |||
| 1938 | Ga0496102_0469355 | |||
| 1939 | Ga0496103_0000453 | |||
| 1940 | Ga0496103_0004001 | |||
| 1941 | Ga0496103_0216742 | |||
| 1942 | Ga0496104_0011710 | |||
| 1943 | Ga0496104_0682652 | |||
| 1944 | Ga0496105_0037579 | |||
| 1945 | Ga0496106_0009483 | |||
| 1946 | Ga0496106_0102077 | |||
| 1947 | Ga0496106_0216500 | |||
| 1948 | Ga0496107_0056740 | |||
| 1949 | Ga0496107_0097517 | |||
| 1950 | Ga0496107_0560506 | |||
| 1951 | Ga0496108_0060974 | |||
| 1952 | Ga0496108_0323400 | |||
| 1953 | Ga0496109_0282341 | |||
| 1954 | Ga0496110_0270447 | |||
| 1955 | Ga0496110_0296428 | |||
| 1956 | Ga0496111_0695855 | |||
| 1957 | Ga0496114_0101670 | |||
| 1958 | Ga0496114_0185091 | |||
| 1959 | Ga0496114_0241555 | |||
| 1960 | Ga0496114_0834586 | |||
| 1961 | Ga0496115_0216592 | |||
| 1962 | Ga0496116_0000173 | |||
| 1963 | Ga0496116_0001739 | |||
| 1964 | Ga0496116_0003301 | |||
| 1965 | Ga0496117_0000124 | |||
| 1966 | Ga0496117_0000144 | |||
| 1967 | Ga0496117_0031708 | |||
| 1968 | Ga0496118_0000096 | |||
| 1969 | Ga0496118_0012385 | |||
| 1970 | Ga0496118_0036819 | |||
| 1971 | Ga0496119_0000020 | |||
| 1972 | Ga0496119_0003189 | |||
| 1973 | Ga0496119_0009028 | |||
| 1974 | Ga0496120_0000006 | |||
| 1975 | Ga0496120_0004033 | |||
| 1976 | Ga0496120_0051139 | |||
| 1977 | Ga0496120_0089736 | |||
| 1978 | Ga0496120_0090271 | |||
| 1979 | Ga0496121_0016153 | |||
| 1980 | Ga0496122_0000040 | |||
| 1981 | Ga0496122_0000140 | |||
| 1982 | Ga0496122_0000802 | |||
| 1983 | Ga0496123_0000572 | |||
| 1984 | Ga0496123_0004284 | |||
| 1985 | Ga0496123_0007798 | |||
| 1986 | Ga0496124_0003352 | |||
| 1987 | Ga0496124_0096000 | |||
| 1988 | Ga0496125_0000010 | |||
| 1989 | Ga0496125_0000110 | |||
| 1990 | Ga0496125_0004049 | |||
| 1991 | Ga0496125_0006483 | |||
| 1992 | Ga0496125_0011762 | |||
| 1993 | Ga0496126_0000060 | |||
| 1994 | Ga0496126_0000246 | |||
| 1995 | Ga0496126_0000330 | |||
| 1996 | Ga0496126_0002082 | |||
| 1997 | Ga0496126_0131654 | |||
| 1998 | Ga0496126_0156649 | |||
| 1999 | Ga0496126_0447888 | |||
| 2000 | Ga0501306_020430 | |||
| 2001 | Ga0501306_032012 | |||
| 2002 | Ga0501309_029917 | |||
| 2003 | Ga0501310_046146 | |||
| 2004 | Ga0501305_007398 | |||
| 2005 | Ga0501307_000425 | |||
| 2006 | Ga0501296_045384 | |||
| 2007 | Ga0501300_057751 | |||
| 2008 | Ga0501311_006327 | |||
| 2009 | Ga0501312_003515 | |||
| 2010 | Ga0501313_008295 | |||
| 2011 | Ga0501315_010905 | |||
| 2012 | Ga0501315_018361 | |||
| 2013 | Ga0501315_071662 | |||
| 2014 | Ga0501316_017614 | |||
| 2015 | Ga0501316_024289 | |||
| 2016 | Ga0501316_029123 | |||
| 2017 | Ga0501317_017738 | |||
| 2018 | Ga0501317_026333 | |||
| 2019 | Ga0501317_027225 | |||
| 2020 | Ga0501318_001927 | |||
| 2021 | Ga0501318_016204 | |||
| 2022 | Ga0501318_028307 | |||
| 2023 | Ga0501319_004209 | |||
| 2024 | Ga0501319_018983 | |||
| 2025 | Ga0501320_001561 | |||
| 2026 | Ga0501321_034086 | |||
| 2027 | Ga0501322_006519 | |||
| 2028 | Ga0501322_012040 | |||
| 2029 | Ga0501324_002357 | |||
| 2030 | Ga0501325_030486 | |||
| 2031 | Ga0501327_04773 | |||
| 2032 | Ga0501331_10332 | |||
| 2033 | Ga0501334_06131 | |||
| 2034 | Ga0501338_01088 | |||
| 2035 | Ga0501340_015584 | |||
| 2036 | Ga0501031_0013728 | |||
| 2037 | Ga0501031_0131278 | |||
| 2038 | Ga0501031_0255102 | |||
| 2039 | Ga0501032_0401675 | |||
| 2040 | Ga0501033_0000015 | |||
| 2041 | Ga0501034_0039000 | |||
| 2042 | Ga0501034_0804113 | |||
| 2043 | Ga0501036_0277221 | |||
| 2044 | Ga0501036_0338927 | |||
| 2045 | Ga0501037_0120485 | |||
| 2046 | Ga0501038_0018195 | |||
| 2047 | Ga0501038_0321673 | |||
| 2048 | Ga0501039_0078087 | |||
| 2049 | Ga0501039_0385024 | |||
| 2050 | Ga0501039_0658355 | |||
| 2051 | Ga0501040_0022758 | |||
| 2052 | Ga0501041_0045335 | |||
| 2053 | Ga0501041_0150222 | |||
| 2054 | Ga0501041_0423756 | |||
| 2055 | Ga0501041_0454979 | |||
| 2056 | Ga0501042_0121769 | |||
| 2057 | Ga0501042_0277938 | |||
| 2058 | Ga0501042_0412801 | |||
| 2059 | Ga0501043_0665162 | |||
| 2060 | Ga0501046_0213666 | |||
| 2061 | Ga0501046_0300941 | |||
| 2062 | Ga0501047_0367879 | |||
| 2063 | Ga0501047_0402215 | |||
| 2064 | Ga0501067_0042993 | |||
| 2065 | Ga0501067_0054095 | |||
| 2066 | Ga0501067_0311077 | |||
| 2067 | Ga0501067_0625893 | |||
| 2068 | Ga0501070_0025651 | |||
| 2069 | Ga0501070_0364933 | |||
| 2070 | Ga0501071_0206892 | |||
| 2071 | Ga0501071_0297608 | |||
| 2072 | Ga0501072_0101767 | |||
| 2073 | Ga0501072_0212229 | |||
| 2074 | Ga0501072_0229023 | |||
| 2075 | Ga0501074_0102509 | |||
| 2076 | Ga0501074_0119300 | |||
| 2077 | Ga0501074_0378653 | |||
| 2078 | Ga0501074_0504752 | |||
| 2079 | Ga0501075_0061672 | |||
| 2080 | Ga0501075_0921791 | |||
| 2081 | Ga0501075_1289454 | |||
| 2082 | Ga0501076_0040257 | |||
| 2083 | Ga0501076_0410053 | |||
| 2084 | Ga0501076_0488219 | |||
| 2085 | Ga0501076_0720830 | |||
| 2086 | Ga0501076_0901371 | |||
| 2087 | Ga0501077_0100551 | |||
| 2088 | Ga0501223_127725 | |||
| 2089 | Ga0501079_0097287 | |||
| 2090 | Ga0501079_0128052 | |||
| 2091 | Ga0501079_0340090 | |||
| 2092 | Ga0501079_0622349 | |||
| 2093 | Ga0501080_0001402 | |||
| 2094 | Ga0501080_0051233 | |||
| 2095 | Ga0501080_0082414 | |||
| 2096 | Ga0501080_0765808 | |||
| 2097 | Ga0501081_0115588 | |||
| 2098 | Ga0501083_0139126 | |||
| 2099 | Ga0501083_0256127 | |||
| 2100 | Ga0501083_0584422 | |||
| 2101 | Ga0501035_0386981 | |||
| 2102 | Ga0501035_0798519 | |||
| 2103 | Ga0501044_0002343 | |||
| 2104 | Ga0501044_0114529 | |||
| 2105 | Ga0501045_0131667 | |||
| 2106 | Ga0501045_0139306 | |||
| 2107 | Ga0501045_0484772 | |||
| 2108 | Ga0501212_017438 | |||
| 2109 | nmdc:mga03683_198665_c1 | |||
| 2110 | nmdc:mga03n38_24275_c1 | |||
| 2111 | nmdc:mga03n38_6768_c1 | |||
| 2112 | nmdc:mga00v17_56028_c1 | |||
| 2113 | nmdc:mga00v17_857_c1 | |||
| 2114 | nmdc:mga0yw44_207684_c1 | |||
| 2115 | nmdc:mga0yw44_24_c1 | |||
| 2116 | nmdc:mga0yw44_340111_c1 | |||
| 2117 | nmdc:mga0yw44_454317_c1 | |||
| 2118 | nmdc:mga06z11_26178_c1 | |||
| 2119 | nmdc:mga07m45_490741_c1 | |||
| 2120 | nmdc:mga05p37_1465195_c1 | |||
| 2121 | nmdc:mga05p37_968139_c1 | |||
| 2122 | nmdc:mga09592_149121_c1 | |||
| 2123 | nmdc:mga0qj67_353936_c1 | |||
| 2124 | nmdc:mga0qj67_633462_c1 | |||
| 2125 | nmdc:mga06r32_34684_c1 | |||
| 2126 | nmdc:mga0sz30_13608_c1 | |||
| 2127 | Ga0495601_0081039 | |||
| 2128 | Ga0495601_0084392 | |||
| 2129 | Ga0495601_0148599 | |||
| 2130 | Ga0495612_0112434 | |||
| 2131 | Ga0495595_0234617 | |||
| 2132 | Ga0495619_0067906 | |||
| 2133 | Ga0500643_000011 | |||
| 2134 | Ga0500644_0073614 | |||
| 2135 | Ga0500646_0000823 | |||
| 2136 | Ga0500646_0085910 | |||
| 2137 | Ga0500583_0015393 | |||
| 2138 | Ga0500650_0000001 | |||
| 2139 | Ga0500555_000015 | |||
| 2140 | Ga0500556_0002977 | |||
| 2141 | Ga0500582_166635 | |||
| 2142 | Ga0500594_0000001 | |||
| 2143 | Ga0500655_001993 | |||
| 2144 | Ga0500568_0050531 | |||
| 2145 | Ga0500573_0039578 | |||
| 2146 | Ga0500577_0021093 | |||
| 2147 | Ga0500579_016957 | |||
| 2148 | Ga0500616_0000020 | |||
| 2149 | Ga0500616_0000144 | |||
| 2150 | Ga0500616_0006989 | |||
| 2151 | Ga0500616_0153811 | |||
| 2152 | Ga0500633_0131975 | |||
| 2153 | Ga0500645_013743 | |||
| 2154 | Ga0501084_0000009 | |||
| 2155 | Ga0501084_0939700 | |||
| 2156 | Ga0501084_0945205 | |||
| 2157 | Ga0587066_089815 | |||
| 2158 | Ga0587070_117223 | |||
| 2159 | Ga0587073_0038139 | |||
| 2160 | Ga0587073_0077499 | |||
| 2161 | Ga0587073_0161331 | |||
| 2162 | Ga0587080_044144 | |||
| 2163 | Ga0587080_065084 | |||
| 2164 | Ga0587082_032282 | |||
| 2165 | Ga0587088_091179 | |||
| 2166 | Ga0587091_026167 | |||
| 2167 | Ga0587101_052505 | |||
| 2168 | Ga0587067_011258 | |||
| 2169 | Ga0587079_108338 | |||
| 2170 | Ga0587107_000994 | |||
| 2171 | Ga0587114_042212 | |||
| 2172 | Ga0587071_064004 | |||
| 2173 | Ga0587111_0000227 | |||
| 2174 | Ga0501082_0052880 | |||
| 2175 | Ga0501082_0276428 | |||
| 2176 | Ga0501082_0281433 | |||
| 2177 | Ga0501082_0901591 | |||
| 2178 | Ga0466962_0000007 | |||
| 2179 | Ga0466962_0142444 | |||
| 2180 | Ga0530510_0615440 | |||
| 2181 | Ga0530510_0699600 | |||
| 2182 | 2787506690 | |||
| 2183 | 2857479634 | |||
| 2184 | 2857633015 | |||
| 2185 | 2870801934 | |||
| 2186 | 2870806323 | |||
| 2187 | 2915361148 | |||
| 2188 | 2919449334 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cvm-assembly1.cif.gz_g | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.973 | 2 | 177 |
| 6boh-assembly2.cif.gz_NB | antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome | 0.9666 | 2 | 175 |
| 5dm7-assembly1.cif.gz_E | crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a | 0.9652 | 8 | 175 |
| 8cvm-assembly1.cif.gz_g | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9623 | 2 | 177 |
| 5mmi-assembly1.cif.gz_G | structure of the large subunit of the chloroplast ribosome | 0.9617 | 2 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q09865_118_210_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9724 | 84 | 175 | 3.90.930.12 |
| af_O21037_77_170_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9669 | 84 | 175 | 3.90.930.12 |
| 3knmH02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.962 | 84 | 169 | 3.90.930.12 |
| af_Q6AU10_7_103_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9617 | 87 | 179 | 3.90.930.12 |
| af_Q2FW21_1_82_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9589 | 1 | 83 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7CIM0-F1-model_v4 | 50S ribosomal protein L6 | 1.002 | 86 | 162 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A357CQG9-F1-model_v4 | 50S ribosomal protein L6 | 0.9932 | 54 | 162 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A6F8LZI7-F1-model_v4 | Large ribosomal subunit protein uL6 | 0.9916 | 1 | 173 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A6G3V3R5-F1-model_v4 | deleted | 0.9871 | 1 | 143 |
|
| AF-A0A2V5P1Y2-F1-model_v4 | 50S ribosomal protein L6 | 0.9871 | 82 | 177 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |