F489946

General Info

Members Datasets Scaffolds Average Seq Length
1094 804 529 257

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0009816|Ga0495638_0009816_1653_2537
Length 294
Sequence VQAEEAKPEQATVTETVDAFHFGEFHIVQPRGRGHRSGMDAMLLAALVAGKGPMRVADLGAXXXXAGMAVASRIEGADVVLIERSAEMTEYARKSIDHAGNIRIAPRLSLVKADVTLKGKARIAAGLEDDVFDHVIMNPPFNDAGDRRAPDDLKAEAHAMDGDIFEDWIRTAGAILRPGGQLSLIARPESVADIIMACGRRFGGIEITMLHAREGESAIRLLATAIKGSRARLIFRAPLFMHGPFLDGEGSHRFLPFIDDLNNGRAAYPRLGKTRKTTAASARKSESIFGKHDA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
21 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
22 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
23 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
26 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
27 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
28 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
29 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
30 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
31 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
32 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
33 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
34 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
35 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
36 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
37 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
38 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
39 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
40 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
41 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
42 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
43 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
44 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
45 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
46 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
47 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
48 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
49 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
50 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
51 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
52 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
53 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
54 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
55 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
56 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
57 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
58 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
59 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
60 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
61 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
62 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
63 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
64 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
65 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
66 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
67 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
68 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
69 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
70 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
71 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
72 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
73 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
74 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
75 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
76 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
77 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
78 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
79 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
80 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
81 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
82 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
83 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
84 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
85 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
86 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
87 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
88 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
89 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
90 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
91 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
92 2643221557 Ensifer sp. Root558 Isolate Unclassified
93 2643221558 Rhizobium sp. Root149 Isolate Unclassified
94 2643221568 Rhizobium sp. Root564 Isolate Unclassified
95 2643221582 Rhizobium sp. Root651 Isolate Unclassified
96 2643221599 Rhizobium sp. Root708 Isolate Unclassified
97 2643221607 Rhizobium sp. Root73 Isolate Unclassified
98 2643221610 Ensifer sp. Root74 Isolate Unclassified
99 2643221618 Ensifer sp. Root231 Isolate Unclassified
100 2643221626 Ensifer sp. Root31 Isolate Unclassified
101 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
102 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
103 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
104 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
105 2643221655 Ensifer sp. Root1252 Isolate Unclassified
106 2643221659 Ensifer sp. Root127 Isolate Unclassified
107 2643221668 Ensifer sp. Root423 Isolate Unclassified
108 2643221675 Ensifer sp. Root1298 Isolate Unclassified
109 2643221680 Ensifer sp. Root1312 Isolate Unclassified
110 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
111 2643221688 Rhizobium sp. Root482 Isolate Unclassified
112 2643221693 Rhizobium sp. Root491 Isolate Unclassified
113 2643221698 Ensifer sp. Root142 Isolate Unclassified
114 2643221712 Ensifer sp. Root258 Isolate Unclassified
115 2643221718 Rhizobium sp. Root268 Isolate Unclassified
116 2643221723 Ensifer sp. Root278 Isolate Unclassified
117 2643221726 Ensifer sp. Root954 Isolate Unclassified
118 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
119 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
120 2718217927 Rhizobium sp. N324 Isolate Nodule
121 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
122 2718218009 Rhizobium sp. N561 Isolate Nodule
123 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
124 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
125 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
126 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
127 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
128 2718218363 Rhizobium sp. N113 Isolate Nodule
129 2718218365 Rhizobium sp. N731 Isolate Nodule
130 2718218366 Rhizobium sp. N621 Isolate Nodule
131 2718218423 Rhizobium sp. N941 Isolate Nodule
132 2721755514 Rhizobium sp. N6212 Isolate Nodule
133 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
134 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
135 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
136 2721755809 Rhizobium sp. N541 Isolate Nodule
137 2721755810 Rhizobium sp. N871 Isolate Nodule
138 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
139 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
140 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
141 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
142 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
143 2728369365 Rhizobium sp. N1341 Isolate Nodule
144 2728369397 Rhizobium sp. N1314 Isolate Nodule
145 2738541293 Rhizobium sp. GV031 Isolate Unclassified
146 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
147 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
148 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
149 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
150 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
151 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
152 2791355256 Rhizobium sp. M10 Isolate Nodule
153 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
154 2791355260 Rhizobium sp. L9 Isolate Nodule
155 2791355261 Rhizobium sp. J15 Isolate Nodule
156 2791355262 Rhizobium sp. M1 Isolate Nodule
157 2791355263 Rhizobium chutanense C5 Isolate Nodule
158 2791355264 Rhizobium sp. S9 Isolate Nodule
159 2791355265 Rhizobium sp. H4 Isolate Nodule
160 2791355266 Rhizobium sp. L43 Isolate Nodule
161 2791355267 Rhizobium sp. L18 Isolate Nodule
162 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
163 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
164 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
165 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
166 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
167 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
168 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
169 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
170 2802429633 Rhizobium anhuiense J3 Isolate Nodule
171 2802429634 Rhizobium anhuiense S10 Isolate Nodule
172 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
173 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
174 2802429637 Rhizobium anhuiense C15 Isolate Nodule
175 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
176 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
177 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
178 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
179 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
180 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
181 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
182 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
183 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
184 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
185 2838048938 Rhizobium pisi 27/80 Isolate Nodule
186 2838061910 Rhizobium phaseoli L15 Isolate Nodule
187 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
188 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
189 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
190 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
191 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
192 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
193 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
194 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
195 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
196 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
197 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
198 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
199 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
200 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
201 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
202 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
203 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
204 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
205 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
206 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
207 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
208 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
209 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
210 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
211 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
212 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
213 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
214 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
215 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
216 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
217 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
218 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
219 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
220 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
221 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
222 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
223 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
224 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
225 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
226 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
227 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
228 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
229 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
230 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
231 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
232 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
233 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
234 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
235 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
236 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
237 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
238 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
239 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
240 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
241 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
242 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
243 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
244 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
245 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
246 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
247 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
248 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
249 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
250 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
251 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
252 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
253 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
254 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
255 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
256 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
257 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
258 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
259 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
260 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
261 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
262 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
263 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
264 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
265 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
266 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
267 2844163670 Ensifer sp. 1H6 Isolate Unclassified
268 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
269 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
270 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
271 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
272 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
273 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
274 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
275 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
276 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
277 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
278 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
279 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
280 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
281 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
282 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
283 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
284 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
285 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
286 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
287 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
288 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
289 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
290 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
291 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
292 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
293 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
294 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
295 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
296 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
297 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
298 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
299 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
300 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
301 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
302 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
303 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
304 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
305 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
306 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
307 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
308 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
309 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
310 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
311 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
312 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
313 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
314 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
315 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
316 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
317 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
318 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
319 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
320 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
321 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
322 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
323 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
324 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
325 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
326 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
327 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
328 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
329 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
330 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
331 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
332 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
333 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
334 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
335 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
336 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
337 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
338 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
339 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
340 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
341 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
342 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
343 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
344 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
345 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
346 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
347 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
348 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
349 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
350 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
351 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
352 2933599457 Rhizobium phaseoli M3 Isolate Nodule
353 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
354 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
355 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
356 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
357 2936381700 Rhizobium chutanense C16 Isolate Unclassified
358 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
359 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
360 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
361 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
362 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
363 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
364 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
365 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
366 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
367 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
368 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
369 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
370 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
371 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
372 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
373 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
374 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
375 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
376 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
377 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
378 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
379 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
380 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
381 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
382 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
383 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
384 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
385 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
386 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
387 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
388 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
389 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
390 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
391 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
392 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
393 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
394 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
395 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
396 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
397 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
398 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
399 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
400 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
401 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
402 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
403 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
404 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
405 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
406 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
407 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
408 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
409 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
410 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
411 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
412 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
413 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
414 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
415 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
416 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
417 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
418 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
419 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
420 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
421 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
422 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
423 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
424 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
425 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
426 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
427 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
428 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
429 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
430 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
431 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
432 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
433 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
434 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
435 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
436 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
437 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
438 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
439 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
440 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
441 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
442 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
443 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
444 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
445 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
446 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
447 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
448 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
449 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
450 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
451 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
452 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
453 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
454 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
455 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
456 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
457 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
458 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
459 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
460 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
461 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
462 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
463 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
464 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
465 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
466 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
467 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
468 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
469 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
470 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
471 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
472 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
473 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
474 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
475 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
476 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
477 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
478 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
479 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
480 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
481 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
482 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
483 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
484 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
485 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
486 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
487 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
488 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
489 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
490 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
491 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
492 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
493 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
494 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
495 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
496 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
497 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
498 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
499 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
500 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
501 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
502 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
503 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
504 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
505 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
506 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
507 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
508 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
509 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
510 2996887358 Rhizobium sp. R711 Isolate Nodule
511 2996893221 Rhizobium sp. R635 Isolate Nodule
512 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
513 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
514 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
515 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
516 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
517 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
518 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
519 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
520 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
521 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
522 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
523 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
524 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
525 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
526 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
527 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
528 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
529 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
530 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
531 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
532 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
533 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
534 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
535 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
536 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
537 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
538 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
539 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
540 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
541 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
542 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
543 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
544 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
545 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
546 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
547 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
548 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
549 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
550 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
551 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
552 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
553 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
554 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
555 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
556 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
557 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
558 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
559 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
560 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
561 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
562 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
563 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
564 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
565 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
566 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
567 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
568 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
569 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
570 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
571 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
572 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
573 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
574 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
575 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
576 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
577 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
578 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
579 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
580 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
581 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
582 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
583 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
584 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
585 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
586 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
587 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
588 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
589 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
590 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
591 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
592 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
593 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
594 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
595 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
596 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
597 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
598 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
599 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
600 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
601 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
602 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
603 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
604 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
605 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
606 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
607 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
608 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
609 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
610 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
617 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
618 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
619 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
620 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
622 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
623 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
624 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
625 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
626 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
627 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
628 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
629 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
630 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
631 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
632 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
633 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
634 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
635 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
636 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
637 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
638 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
639 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
640 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
641 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
642 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
643 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
644 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
645 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
646 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
647 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
648 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
649 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
650 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
651 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
652 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
653 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
654 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
655 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
656 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
657 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
658 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
659 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
660 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
661 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
662 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
663 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
664 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
665 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
666 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
667 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
668 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
669 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
670 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
671 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
672 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
673 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
674 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
675 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
676 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
677 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
678 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
679 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
680 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
681 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
682 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
683 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
684 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
685 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
686 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
687 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
688 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
689 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
690 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
691 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
692 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
693 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
694 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
695 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
696 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
697 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
698 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
699 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
700 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
701 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
702 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
703 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
704 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
705 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
706 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
707 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
708 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
709 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
711 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
712 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
713 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
714 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
715 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
716 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
717 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
718 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
719 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
720 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
721 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
722 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
723 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
724 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
725 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
726 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
727 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
728 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
729 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
730 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
731 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
732 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
733 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
734 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
735 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
736 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
737 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
738 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
739 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
740 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
741 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
742 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
743 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
744 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
745 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
746 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
747 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
748 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
749 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
750 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
751 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
752 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
753 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
754 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
755 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
756 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
757 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
758 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
759 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
760 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
761 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
762 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
763 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
764 8005258706 Rhizobium sp. R693 Isolate Nodule
765 8005275841 Rhizobium sp. N4311 Isolate Nodule
766 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
767 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
768 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
769 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
770 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
771 8005321885 Rhizobium sp. R72 Isolate Nodule
772 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
773 8005382845 Rhizobium sp. R634 Isolate Nodule
774 8005395548 Rhizobium sp. R339 Isolate Nodule
775 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
776 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
777 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
778 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
779 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
780 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
781 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
782 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
783 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
784 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
785 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
786 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
787 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
788 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
789 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
790 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
791 8018176218 Rhizobium sp. N122 Isolate Nodule
792 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
793 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
794 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
795 8024501048 Rhizobium sp. H4 Isolate Nodule
796 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
797 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
798 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
799 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
800 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
801 8056382006 Rhizobium croatiense 13T Isolate Nodule
802 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
803 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
804 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.26
Metatranscriptomes 0.09
Isolates 51.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 17.46
Nodule 41.22
Rhizoplane 1.37
Rhizosphere 21.76
Stem 0
Stem Tuber 0
Unclassified 17.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000006 3300002704 Bacteria 244109
2 JGI25156J39149_1000019 3300002705 Bacteria 160845
3 JGI25162J39368_1001875 3300002737 Bacteria 9673
4 JGI25162J39368_1002018 3300002737 Bacteria 9003
5 JGI25154J39366_1000365 3300002738 Bacteria 25282
6 JGI25157J39369_1000024 3300002741 Bacteria 160844
7 JGI25152J39213_1001364 3300002773 Bacteria 10668
8 JGI25152J39213_1001530 3300002773 Bacteria 9828
9 JGI25152J39213_1015277 3300002773 Bacteria 1519
10 JGI25152J39213_1016284 3300002773 Bacteria 1439
11 JGI25150J39212_1000042 3300002774 Bacteria 84513
12 JGI25159J45721_1000021 3300002987 Bacteria 119754
13 JGI25151J46595_10000099 3300003187 Bacteria 117428
14 JGI25151J46595_10001860 3300003187 Bacteria 13545
15 JGI25151J46595_10009087 3300003187 Bacteria 4734
16 JGI25165J46597_1001938 3300003214 Bacteria 8158
17 JGI25165J46597_1002939 3300003214 Bacteria 4777
18 JGI25165J46597_1004195 3300003214 Bacteria 3185
19 JGI25153J46596_10000761 3300003215 Bacteria 19707
20 JGI25153J46596_10049148 3300003215 Bacteria 1226
21 JGI25153J46596_10051263 3300003215 Bacteria 1183
22 rootH1_10044780 3300003316 Bacteria 1651
23 rootH1_10104610 3300003316 Bacteria 1593
24 rootH2_10120526 3300003320 Bacteria 2003
25 rootH2_10256542 3300003320 Bacteria 1589
26 rootL2_10115041 3300003322 Bacteria 3629
27 rootH1_10035118 3300003323 Bacteria 3269
28 rootH1_10105424 3300003323 Bacteria 1715
29 rootH1_10178534 3300003323 Bacteria 1068
30 rootH1_10209197 3300003323 Bacteria 1041
31 JGI25160J50197_1000002 3300003354 Bacteria 561707
32 JGI25160J50197_1000261 3300003354 Bacteria 39695
33 JGI25160J50197_1001976 3300003354 Bacteria 9776
34 JGI25160J50197_1008147 3300003354 Bacteria 4022
35 JGI25160J50197_1031131 3300003354 Bacteria 1379
36 JGI25161J50226_1000195 3300003374 Bacteria 39695
37 JGI25161J50226_1001106 3300003374 Bacteria 9087
38 JGI25161J50226_1001515 3300003374 Bacteria 6868
39 Ga0055526_1001512 3300003771 Bacteria 16479
40 Ga0055526_1010009 3300003771 Bacteria 4473
41 Ga0055526_1019591 3300003771 Bacteria 2458
42 Ga0055526_1025637 3300003771 Bacteria 1885
43 Ga0055524_1001469 3300003775 Bacteria 13450
44 Ga0055524_1004697 3300003775 Bacteria 6261
45 Ga0055524_1010290 3300003775 Bacteria 3736
46 Ga0055524_1022698 3300003775 Bacteria 2042
47 Ga0055524_1025794 3300003775 Bacteria 1832
48 Ga0055524_1031336 3300003775 Bacteria 1531
49 Ga0055536_1011977 3300003781 Bacteria 3263
50 Ga0055528_1000263 3300003790 Bacteria 44623
51 Ga0055528_1007710 3300003790 Bacteria 4718
52 Ga0055528_1010543 3300003790 Bacteria 3748
53 Ga0055528_1011212 3300003790 Bacteria 3581
54 Ga0055528_1016523 3300003790 Bacteria 2604
55 Ga0055540_1035773 3300003792 Bacteria 1107
56 Ga0055531_10007471 3300003794 Bacteria 5956
57 Ga0058692_1005505 3300003856 Bacteria 3604
58 Ga0058692_1006931 3300003856 Bacteria 3055
59 Ga0055543_1000010 3300004625 Bacteria 198371
60 Ga0055543_1000215 3300004625 Bacteria 46312
61 Ga0055543_1000358 3300004625 Bacteria 30677
62 Ga0055543_1000923 3300004625 Bacteria 13689
63 Ga0065165_1000004 3300005262 Bacteria 377081
64 Ga0065165_1002152 3300005262 Bacteria 17826
65 Ga0065165_1009542 3300005262 Bacteria 4334
66 Ga0065165_1012112 3300005262 Bacteria 3534
67 Ga0065165_1027611 3300005262 Bacteria 1846
68 Ga0065165_1035815 3300005262 Bacteria 1520
69 Ga0070670_100000811 3300005331 Bacteria 24347
70 Ga0070666_10013250 3300005335 Bacteria 5228
71 Ga0070671_100024251 3300005355 Bacteria 4965
72 Ga0070667_100456539 3300005367 Bacteria 1168
73 Ga0070665_100050865 3300005548 Bacteria 4158
74 Ga0070665_100053285 3300005548 Bacteria 4057
75 Ga0070665_100189572 3300005548 Bacteria 2057
76 Ga0068855_100154182 3300005563 Bacteria 2611
77 Ga0068856_100162434 3300005614 Bacteria 2245
78 Ga0068852_100026503 3300005616 Bacteria 4713
79 Ga0081455_10084454 3300005937 Bacteria 2591
80 Ga0075365_10000341 3300006038 Bacteria 16645
81 Ga0075365_10067790 3300006038 Bacteria 2396
82 Ga0075365_10113509 3300006038 Bacteria 1864
83 Ga0075363_100147911 3300006048 Bacteria 1325
84 Ga0075364_10087839 3300006051 Bacteria 2061
85 Ga0075362_10007439 3300006177 Bacteria 4148
86 Ga0075367_10017298 3300006178 Bacteria 3955
87 Ga0075367_10042032 3300006178 Bacteria 2673
88 Ga0075369_10001103 3300006186 Bacteria 9069
89 Ga0075369_10019551 3300006186 Bacteria 2766
90 Ga0075366_10003971 3300006195 Bacteria 7897
91 Ga0075370_10016276 3300006353 Bacteria 4000
92 Ga0079104_1000210 3300006946 Bacteria 81817
93 Ga0099826_10003316 3300006948 Bacteria 10869
94 Ga0105251_10020730 3300009011 Bacteria 3448
95 Ga0105244_10110060 3300009036 Bacteria 1341
96 Ga0105250_10019885 3300009092 Bacteria 2715
97 Ga0105240_10000027 3300009093 Bacteria 348486
98 Ga0105243_10091152 3300009148 Bacteria 2510
99 Ga0105237_10000508 3300009545 Bacteria 54970
100 Ga0123340_1046711 3300009763 Bacteria 1739
101 Ga0123340_1046783 3300009763 Bacteria 1735
102 Ga0123341_1000027 3300009765 Bacteria 69241
103 Ga0123341_1049686 3300009765 Bacteria 2405
104 Ga0123341_1050067 3300009765 Bacteria 2384
105 Ga0123342_1023186 3300009766 Bacteria 4075
106 Ga0105239_10002593 3300010375 Bacteria 22866
107 Ga0105239_10320270 3300010375 Bacteria 1748
108 Ga0105246_10096120 3300011119 Bacteria 2146
109 Ga0157373_10014166 3300013100 Bacteria 5847
110 Ga0157371_10000058 3300013102 Bacteria 171756
111 Ga0157370_10000048 3300013104 Bacteria 124683
112 Ga0157370_10000792 3300013104 Bacteria 39754
113 Ga0157369_10185945 3300013105 Bacteria 2185
114 Ga0157369_10326090 3300013105 Bacteria 1596
115 Ga0171463_1001 3300013249 Bacteria 1406070
116 Ga0163163_10405133 3300014325 Bacteria 1422
117 Ga0182007_10001900 3300015262 Bacteria 10892
118 Ga0183363_1067 3300015690 Bacteria 32305
119 Ga0214544_1000008 3300021320 Bacteria 326027
120 Ga0214542_1000010 3300021321 Bacteria 262816
121 Ga0214542_1029774 3300021321 Bacteria 2195
122 Ga0214543_1000003 3300021327 Bacteria 692327
123 Ga0214543_1000004 3300021327 Bacteria 527190
124 Ga0228710_1000031 3300022740 Bacteria 95534
125 Ga0209435_100011 3300025206 Bacteria 413027
126 Ga0209436_102216 3300025208 Bacteria 6038
127 Ga0209563_101762 3300025230 Bacteria 5444
128 Ga0209437_100036 3300025233 Bacteria 469153
129 Ga0209437_100086 3300025233 Bacteria 254578
130 Ga0207425_1000012 3300025245 Bacteria 528324
131 Ga0207425_1004757 3300025245 Bacteria 3999
132 Ga0207425_1010289 3300025245 Bacteria 2283
133 Ga0207425_1028887 3300025245 Bacteria 1121
134 Ga0209646_1000024 3300025246 Bacteria 413027
135 Ga0209026_1000030 3300025250 Bacteria 329811
136 Ga0209677_100177 3300025253 Bacteria 54158
137 Ga0209148_1009921 3300025254 Bacteria 1828
138 Ga0209759_1000011 3300025256 Bacteria 413027
139 Ga0209129_1000086 3300025258 Bacteria 181543
140 Ga0209129_1000965 3300025258 Bacteria 17284
141 Ga0209129_1001065 3300025258 Bacteria 16216
142 Ga0209129_1001501 3300025258 Bacteria 12969
143 Ga0209129_1003602 3300025258 Bacteria 6626
144 Ga0209129_1003829 3300025258 Bacteria 6284
145 Ga0209129_1013324 3300025258 Bacteria 1819
146 Ga0209233_1000056 3300025261 Bacteria 438104
147 Ga0209233_1000110 3300025261 Bacteria 260825
148 Ga0209233_1000640 3300025261 Bacteria 17399
149 Ga0209565_1017396 3300025263 Bacteria 1577
150 Ga0209455_1003068 3300025272 Bacteria 6101
151 Ga0209673_1000091 3300025273 Bacteria 201875
152 Ga0209673_1000122 3300025273 Bacteria 170443
153 Ga0209673_1001847 3300025273 Bacteria 17281
154 Ga0209673_1002257 3300025273 Bacteria 13890
155 Ga0209673_1003203 3300025273 Bacteria 9917
156 Ga0209673_1003816 3300025273 Bacteria 8536
157 Ga0209673_1007275 3300025273 Bacteria 5141
158 Ga0209673_1027782 3300025273 Bacteria 1834
159 Ga0209130_1000008 3300025284 Bacteria 581232
160 Ga0209130_1000013 3300025284 Bacteria 412810
161 Ga0209130_1000015 3300025284 Bacteria 409631
162 Ga0209130_1006718 3300025284 Bacteria 3683
163 Ga0209675_1011574 3300025291 Bacteria 2917
164 Ga0209676_1007603 3300025292 Bacteria 5035
165 Ga0209676_1023318 3300025292 Bacteria 2028
166 Ga0209676_1044134 3300025292 Bacteria 1225
167 Ga0209025_1000024 3300025294 Bacteria 528324
168 Ga0209025_1000118 3300025294 Bacteria 214009
169 Ga0209025_1000425 3300025294 Bacteria 83943
170 Ga0209025_1000549 3300025294 Bacteria 70203
171 Ga0209025_1002239 3300025294 Bacteria 21292
172 Ga0209025_1003170 3300025294 Bacteria 15999
173 Ga0209025_1005506 3300025294 Bacteria 10292
174 Ga0209025_1009578 3300025294 Bacteria 6721
175 Ga0209025_1029753 3300025294 Bacteria 2633
176 Ga0209025_1035146 3300025294 Bacteria 2270
177 Ga0209025_1050792 3300025294 Bacteria 1654
178 Ga0209025_1065985 3300025294 Bacteria 1318
179 Ga0209564_1000091 3300025295 Bacteria 249103
180 Ga0209564_1000398 3300025295 Bacteria 77724
181 Ga0209564_1001660 3300025295 Bacteria 21392
182 Ga0209564_1001988 3300025295 Bacteria 17897
183 Ga0209564_1025910 3300025295 Bacteria 1955
184 Ga0209564_1049257 3300025295 Bacteria 1044
185 Ga0209758_1000046 3300025297 Bacteria 364931
186 Ga0209758_1000325 3300025297 Bacteria 91078
187 Ga0209758_1001314 3300025297 Bacteria 30234
188 Ga0209758_1001929 3300025297 Bacteria 22554
189 Ga0209758_1003374 3300025297 Bacteria 14624
190 Ga0209758_1007852 3300025297 Bacteria 7107
191 Ga0209758_1019346 3300025297 Bacteria 3286
192 Ga0209050_1013538 3300025298 Bacteria 3612
193 Ga0209050_1026838 3300025298 Bacteria 1915
194 Ga0209256_1000169 3300025299 Bacteria 131077
195 Ga0209256_1001378 3300025299 Bacteria 25439
196 Ga0209256_1001486 3300025299 Bacteria 23935
197 Ga0209256_1003791 3300025299 Bacteria 10162
198 Ga0209256_1004334 3300025299 Bacteria 9011
199 Ga0209256_1005505 3300025299 Bacteria 7245
200 Ga0209256_1031006 3300025299 Bacteria 1469
201 Ga0207426_1000016 3300025302 Bacteria 581232
202 Ga0207426_1000063 3300025302 Bacteria 358920
203 Ga0207426_1000081 3300025302 Bacteria 304502
204 Ga0207426_1000144 3300025302 Bacteria 191590
205 Ga0209051_1000205 3300025303 Bacteria 104781
206 Ga0209051_1014627 3300025303 Bacteria 3650
207 Ga0209051_1017189 3300025303 Bacteria 3240
208 Ga0209051_1051502 3300025303 Bacteria 1368
209 Ga0209257_1003359 3300025304 Bacteria 13832
210 Ga0209257_1006311 3300025304 Bacteria 7727
211 Ga0207695_10000024 3300025913 Bacteria 632311
212 Ga0207671_10000176 3300025914 Bacteria 98289
213 Ga0207650_10017791 3300025925 Bacteria 4978
214 Ga0207644_10042355 3300025931 Bacteria 3226
215 Ga0207667_10468185 3300025949 Bacteria 1280
216 Ga0207668_10031723 3300025972 Bacteria 3484
217 Ga0207702_10120780 3300026078 Bacteria 2345
218 Ga0209281_1000155 3300027111 Bacteria 164423
219 Ga0209281_1000253 3300027111 Bacteria 105600
220 Ga0209371_1000009 3300027312 Bacteria 963030
221 Ga0209371_1001205 3300027312 Bacteria 18688
222 Ga0209371_1003770 3300027312 Bacteria 7067
223 Ga0209282_1000025 3300027666 Bacteria 168676
224 Ga0209282_1001877 3300027666 Bacteria 11838
225 Ga0268266_10015167 3300028379 Bacteria 6616
226 Ga0268266_10038826 3300028379 Bacteria 4053
227 Ga0268266_10081239 3300028379 Bacteria 2826
228 Ga0268266_10151290 3300028379 Bacteria 2092
229 Ga0307515_10000154 3300028794 Bacteria 166582
230 Ga0307515_10003734 3300028794 Bacteria 31935
231 Ga0307515_10073935 3300028794 Bacteria 4569
232 Ga0307515_10218934 3300028794 Bacteria 1727
233 Ga0268256_1000010 3300030500 Bacteria 963034
234 Ga0268256_1004527 3300030500 Bacteria 5739
235 Ga0268256_1012512 3300030500 Bacteria 2621
236 Ga0307513_10001432 3300031456 Bacteria 34296
237 Ga0307513_10291229 3300031456 Bacteria 1404
238 Ga0307408_100287610 3300031548 Bacteria 1371
239 Ga0307410_10023710 3300031852 Bacteria 3821
240 Ga0307412_10002253 3300031911 Bacteria 10684
241 Ga0307412_10052489 3300031911 Bacteria 2700
242 Ga0307412_10518148 3300031911 Bacteria 996
243 Ga0315914_1000020 3300031967 Bacteria 121647
244 Ga0307409_100157597 3300031995 Bacteria 1981
245 Ga0307416_100169679 3300032002 Bacteria 2029
246 Ga0307416_100616168 3300032002 Bacteria 1167
247 Ga0315913_1000013 3300033430 Bacteria 121559
248 Ga0315915_1000015 3300033464 Bacteria 168491
249 Ga0373927_0000146 3300035695 Bacteria 55573
250 Ga0373925_0001219 3300037068 Bacteria 22707
251 Ga0395900_0256769 3300037418 Bacteria 1747
252 Ga0395900_0612283 3300037418 Bacteria 1029
253 Ga0395905_0000441 3300037471 Bacteria 58119
254 Ga0395905_0006786 3300037471 Bacteria 11473
255 Ga0395905_0093616 3300037471 Bacteria 2818
256 Ga0395901_0197637 3300038443 Bacteria 2108
257 Ga0395901_0510383 3300038443 Bacteria 1223
258 Ga0439466_0026155 3300041411 Bacteria 2032
259 Ga0439466_0062999 3300041411 Bacteria 1191
260 Ga0439466_0068082 3300041411 Bacteria 1138
261 Ga0439465_0006140 3300041413 Bacteria 3820
262 Ga0451795_0368178 3300041456 Bacteria 826
263 Ga0451837_0118587 3300041494 Bacteria 1977
264 Ga0451845_0963136 3300041501 Bacteria 1189
265 Ga0451846_65766 3300041502 Bacteria 1998
266 Ga0451847_0686743 3300041503 Bacteria 871
267 Ga0451849_0734293 3300041505 Bacteria 1521
268 Ga0451853_1619242 3300041512 Bacteria 3052
269 Ga0439449_0004953 3300042007 Bacteria 5125
270 Ga0439449_0050015 3300042007 Bacteria 1546
271 Ga0450918_016128 3300042531 Bacteria 1297
272 Ga0495629_0011919 3300046459 Bacteria 6305
273 Ga0495638_0009816 3300046460 Bacteria 6684
274 Ga0495638_0018504 3300046460 Bacteria 4625
275 Ga0495638_0044368 3300046460 Bacteria 2801
276 Ga0495638_0228824 3300046460 Bacteria 1035
277 Ga0495651_0245225 3300046462 Bacteria 1226
278 Ga0495605_0001233 3300046474 Bacteria 17043
279 Ga0495664_0077397 3300046477 Bacteria 1992
280 Ga0495585_0013373 3300046492 Bacteria 4807
281 Ga0495596_0075528 3300046500 Bacteria 1309
282 Ga0495607_0138632 3300046501 Bacteria 1257
283 Ga0495583_0099712 3300046506 Bacteria 1241
284 Ga0495606_0000762 3300046507 Bacteria 49554
285 Ga0495606_0015417 3300046507 Bacteria 5888
286 Ga0495606_0093901 3300046507 Bacteria 1839
287 Ga0495616_0133966 3300046513 Bacteria 1133
288 Ga0495631_0001700 3300046518 Bacteria 13071
289 Ga0495631_0108924 3300046518 Bacteria 1191
290 Ga0495632_0051996 3300046519 Bacteria 2015
291 Ga0495643_0022226 3300046522 Bacteria 3622
292 Ga0495648_0035378 3300046524 Bacteria 3238
293 Ga0495654_0054914 3300046530 Bacteria 1930
294 Ga0495640_0085525 3300046533 Bacteria 2090
295 Ga0495609_0090957 3300046538 Bacteria 1327
296 Ga0495609_0182422 3300046538 Bacteria 883
297 Ga0495597_0029144 3300046542 Bacteria 2522
298 Ga0495597_0103002 3300046542 Bacteria 1202
299 Ga0495622_0008297 3300046557 Bacteria 4812
300 Ga0495633_0014552 3300046558 Bacteria 4108
301 Ga0495633_0081037 3300046558 Bacteria 1510
302 Ga0495633_0163417 3300046558 Bacteria 1027
303 Ga0495668_0002936 3300046616 Bacteria 13453
304 Ga0495625_0001444 3300046660 Bacteria 28890
305 Ga0495625_0224084 3300046660 Bacteria 1230
306 Ga0495635_0147235 3300046663 Bacteria 1603
307 Ga0495588_0003056 3300046674 Bacteria 7239
308 Ga0495671_0085144 3300046692 Bacteria 1549
309 Ga0495671_0220420 3300046692 Bacteria 918
310 Ga0495600_0055009 3300046809 Bacteria 2599
311 Ga0495660_0080247 3300046810 Bacteria 1712
312 Ga0495604_0108265 3300047317 Bacteria 2030
313 Ga0495672_0058787 3300047320 Bacteria 2227
314 Ga0495676_0416192 3300047321 Bacteria 890
315 Ga0495683_0100170 3300047323 Bacteria 1394
316 Ga0495687_045326 3300047443 Bacteria 1905
317 Ga0495687_085869 3300047443 Bacteria 1218
318 Ga0495685_041743 3300047447 Bacteria 1567
319 Ga0495681_0001172 3300047470 Bacteria 19925
320 Ga0495686_0004080 3300047472 Bacteria 12188
321 Ga0495686_0013054 3300047472 Bacteria 5784
322 Ga0495686_0196045 3300047472 Bacteria 1161
323 Ga0495686_0285578 3300047472 Bacteria 916
324 Ga0496102_0189529 3300048905 Bacteria 1937
325 Ga0496104_0177728 3300048907 Bacteria 2039
326 Ga0496106_0000912 3300048909 Bacteria 21488
327 Ga0496107_0445023 3300048910 Bacteria 963
328 Ga0496111_0020904 3300048914 Bacteria 4563
329 Ga0496113_0194609 3300048916 Bacteria 1610
330 Ga0496116_0000080 3300048919 Bacteria 224530
331 Ga0496116_0001841 3300048919 Bacteria 22929
332 Ga0496116_0002642 3300048919 Bacteria 18565
333 Ga0496116_0022408 3300048919 Bacteria 4733
334 Ga0496116_0026286 3300048919 Bacteria 4261
335 Ga0496116_0044309 3300048919 Bacteria 3023
336 Ga0496116_0055957 3300048919 Bacteria 2588
337 Ga0496116_0064080 3300048919 Bacteria 2363
338 Ga0496116_0084830 3300048919 Bacteria 1949
339 Ga0496116_0108639 3300048919 Bacteria 1637
340 Ga0496116_0160653 3300048919 Bacteria 1233
341 Ga0496116_0166109 3300048919 Bacteria 1203
342 Ga0496117_0000002 3300048920 Bacteria 2483758
343 Ga0496117_0002297 3300048920 Bacteria 24621
344 Ga0496117_0004972 3300048920 Bacteria 14264
345 Ga0496117_0006068 3300048920 Bacteria 12398
346 Ga0496117_0148187 3300048920 Bacteria 1393
347 Ga0496117_0159038 3300048920 Bacteria 1326
348 Ga0496117_0191029 3300048920 Bacteria 1166
349 Ga0496118_0000233 3300048921 Bacteria 97731
350 Ga0496118_0001988 3300048921 Bacteria 29035
351 Ga0496118_0033033 3300048921 Bacteria 4253
352 Ga0496118_0034316 3300048921 Bacteria 4142
353 Ga0496118_0093832 3300048921 Bacteria 2054
354 Ga0496119_0015134 3300048922 Bacteria 5970
355 Ga0496119_0034935 3300048922 Bacteria 3300
356 Ga0496119_0038975 3300048922 Bacteria 3060
357 Ga0496119_0055869 3300048922 Bacteria 2395
358 Ga0496119_0097245 3300048922 Bacteria 1660
359 Ga0496120_0000021 3300048923 Bacteria 250966
360 Ga0496120_0023198 3300048923 Bacteria 3887
361 Ga0496121_0000001 3300048924 Bacteria 1830318
362 Ga0496121_0003778 3300048924 Bacteria 21151
363 Ga0496121_0009317 3300048924 Bacteria 11323
364 Ga0496121_0012314 3300048924 Bacteria 9354
365 Ga0496121_0027647 3300048924 Bacteria 5302
366 Ga0496121_0039218 3300048924 Bacteria 4179
367 Ga0496121_0041822 3300048924 Bacteria 3998
368 Ga0496121_0120880 3300048924 Bacteria 1978
369 Ga0496121_0150076 3300048924 Bacteria 1716
370 Ga0496121_0191521 3300048924 Bacteria 1466
371 Ga0496121_0237434 3300048924 Bacteria 1273
372 Ga0496122_0000001 3300048925 Bacteria 1827766
373 Ga0496122_0000009 3300048925 Bacteria 584024
374 Ga0496122_0000247 3300048925 Bacteria 121291
375 Ga0496122_0007204 3300048925 Bacteria 12452
376 Ga0496122_0027734 3300048925 Bacteria 4831
377 Ga0496122_0030322 3300048925 Bacteria 4534
378 Ga0496122_0031911 3300048925 Bacteria 4369
379 Ga0496122_0071891 3300048925 Bacteria 2462
380 Ga0496122_0163531 3300048925 Bacteria 1353
381 Ga0496123_0000001 3300048926 Bacteria 1831497
382 Ga0496123_0000020 3300048926 Bacteria 388748
383 Ga0496123_0000222 3300048926 Bacteria 115482
384 Ga0496123_0006783 3300048926 Bacteria 11002
385 Ga0496123_0017248 3300048926 Bacteria 5820
386 Ga0496123_0028989 3300048926 Bacteria 4086
387 Ga0496123_0095500 3300048926 Bacteria 1748
388 Ga0496123_0095833 3300048926 Bacteria 1744
389 Ga0496123_0105073 3300048926 Bacteria 1631
390 Ga0496123_0188965 3300048926 Bacteria 1067
391 Ga0496124_0000592 3300048927 Bacteria 61048
392 Ga0496124_0002069 3300048927 Bacteria 27175
393 Ga0496124_0004006 3300048927 Bacteria 17528
394 Ga0496124_0020386 3300048927 Bacteria 6127
395 Ga0496124_0045313 3300048927 Bacteria 3770
396 Ga0496124_0068688 3300048927 Bacteria 2944
397 Ga0496124_0076212 3300048927 Bacteria 2769
398 Ga0496124_0101742 3300048927 Bacteria 2327
399 Ga0496124_0110214 3300048927 Bacteria 2216
400 Ga0496124_0113414 3300048927 Bacteria 2178
401 Ga0496124_0232644 3300048927 Bacteria 1376
402 Ga0496124_0253941 3300048927 Bacteria 1298
403 Ga0496124_0388177 3300048927 Bacteria 973
404 Ga0496124_0388213 3300048927 Bacteria 973
405 Ga0496125_0000001 3300048928 Bacteria 1766138
406 Ga0496125_0000557 3300048928 Bacteria 64217
407 Ga0496125_0002964 3300048928 Bacteria 21337
408 Ga0496125_0016086 3300048928 Bacteria 7201
409 Ga0496125_0028713 3300048928 Bacteria 5016
410 Ga0496125_0123285 3300048928 Bacteria 1842
411 Ga0496126_0000438 3300048929 Bacteria 83060
412 Ga0496126_0000747 3300048929 Bacteria 58936
413 Ga0496126_0033716 3300048929 Bacteria 4816
414 Ga0496126_0322360 3300048929 Bacteria 1269
415 Ga0496126_0430874 3300048929 Bacteria 1064
416 Ga0496126_0493741 3300048929 Bacteria 979
417 Ga0495678_024016 3300049459 Bacteria 2639
418 Ga0495678_057422 3300049459 Bacteria 1475
419 Ga0495682_0056764 3300049460 Bacteria 1419
420 Ga0501031_0000015 3300049568 Bacteria 113809
421 Ga0501031_0030172 3300049568 Bacteria 3536
422 Ga0501031_0060236 3300049568 Bacteria 2474
423 Ga0501031_0073596 3300049568 Bacteria 2224
424 Ga0501032_0000008 3300049569 Bacteria 240313
425 Ga0501032_0029169 3300049569 Bacteria 3788
426 Ga0501032_0089354 3300049569 Bacteria 2045
427 Ga0501032_0165083 3300049569 Bacteria 1453
428 Ga0501033_0000012 3300049570 Bacteria 241599
429 Ga0501033_0000171 3300049570 Bacteria 61888
430 Ga0501033_0022307 3300049570 Bacteria 4776
431 Ga0501033_0029429 3300049570 Bacteria 4127
432 Ga0501033_0210965 3300049570 Bacteria 1385
433 Ga0501033_0220972 3300049570 Bacteria 1348
434 Ga0501033_0342566 3300049570 Bacteria 1048
435 Ga0501034_0000035 3300049571 Bacteria 241623
436 Ga0501034_0020260 3300049571 Bacteria 6792
437 Ga0501034_0034706 3300049571 Bacteria 5114
438 Ga0501034_0221040 3300049571 Bacteria 1846
439 Ga0501036_0000006 3300049572 Bacteria 241623
440 Ga0501036_0023150 3300049572 Bacteria 5229
441 Ga0501036_0092032 3300049572 Bacteria 2561
442 Ga0501036_0245676 3300049572 Bacteria 1500
443 Ga0501036_0623167 3300049572 Bacteria 894
444 Ga0501037_0000115 3300049573 Bacteria 74932
445 Ga0501038_0000007 3300049574 Bacteria 210775
446 Ga0501038_0057841 3300049574 Bacteria 3327
447 Ga0501039_0000012 3300049575 Bacteria 241623
448 Ga0501039_0190999 3300049575 Bacteria 1610
449 Ga0501039_0216351 3300049575 Bacteria 1506
450 Ga0501039_0223360 3300049575 Bacteria 1480
451 Ga0501040_0049079 3300049576 Bacteria 2885
452 Ga0501040_0197566 3300049576 Bacteria 1428
453 Ga0501043_0000432 3300049579 Bacteria 37703
454 Ga0501043_0047378 3300049579 Bacteria 3379
455 Ga0501043_0082467 3300049579 Bacteria 2527
456 Ga0501043_0164230 3300049579 Bacteria 1734
457 Ga0501043_0188005 3300049579 Bacteria 1607
458 Ga0501046_0076549 3300049580 Bacteria 2592
459 Ga0501046_0195178 3300049580 Bacteria 1508
460 Ga0501046_0246984 3300049580 Bacteria 1315
461 Ga0501046_0407173 3300049580 Bacteria 982
462 Ga0501047_0001526 3300049581 Bacteria 22616
463 Ga0501047_0301289 3300049581 Bacteria 1445
464 Ga0501067_0139334 3300049583 Bacteria 1351
465 Ga0501070_0005611 3300049586 Bacteria 10704
466 Ga0501070_0096215 3300049586 Bacteria 2450
467 Ga0501070_0333597 3300049586 Bacteria 1232
468 Ga0501072_0367681 3300049588 Bacteria 1142
469 Ga0501073_0152578 3300049589 Bacteria 1601
470 Ga0501074_0162779 3300049590 Bacteria 1593
471 Ga0501080_0038118 3300049742 Bacteria 4489
472 Ga0501080_0662977 3300049742 Bacteria 922
473 Ga0501083_0184099 3300049744 Bacteria 1363
474 Ga0501035_0000192 3300049822 Bacteria 74834
475 Ga0501035_0000841 3300049822 Bacteria 32800
476 Ga0501035_0075661 3300049822 Bacteria 2977
477 Ga0501035_0099965 3300049822 Bacteria 2546
478 Ga0501035_0134546 3300049822 Bacteria 2153
479 Ga0501044_0000015 3300049823 Bacteria 241623
480 Ga0501044_0114298 3300049823 Bacteria 2705
481 Ga0501044_0199922 3300049823 Bacteria 1957
482 Ga0501044_0330327 3300049823 Bacteria 1448
483 Ga0501045_0255171 3300049824 Bacteria 1305
484 nmdc:mga03683_15312_c1 3300050489 Bacteria 2860
485 nmdc:mga03n38_281521_c1 3300050490 Bacteria 888
486 nmdc:mga00v17_72_c1 3300050491 Bacteria 60922
487 nmdc:mga00v17_81455_c1 3300050491 Bacteria 2022
488 nmdc:mga00v17_91675_c1 3300050491 Bacteria 1909
489 nmdc:mga00v17_92_c1 3300050491 Bacteria 53037
490 nmdc:mga0yw44_169441_c1 3300050492 Bacteria 1433
491 nmdc:mga0yw44_201641_c1 3300050492 Bacteria 1314
492 nmdc:mga0yw44_4716_c1 3300050492 Bacteria 6309
493 nmdc:mga04h51_112683_c1 3300050495 Bacteria 1005
494 nmdc:mga0sz30_107529_c1 3300050516 Bacteria 1221
495 Ga0500610_0078634 3300053079 Bacteria 1718
496 Ga0495619_0026578 3300053085 Bacteria 3724
497 Ga0500578_0090956 3300053086 Bacteria 1936
498 Ga0500560_000887 3300053107 Bacteria 4687
499 Ga0500560_010826 3300053107 Bacteria 2301
500 Ga0500594_0003405 3300053118 Bacteria 3489
501 Ga0500608_024673 3300053122 Bacteria 2809
502 Ga0500614_017776 3300053123 Bacteria 1611
503 Ga0500618_003524 3300053125 Bacteria 5331
504 Ga0500618_005292 3300053125 Bacteria 3954
505 Ga0500618_019728 3300053125 Bacteria 1657
506 Ga0500628_006907 3300053129 Bacteria 1932
507 Ga0500642_0085535 3300053130 Bacteria 1453
508 Ga0500658_0046732 3300053134 Bacteria 1754
509 Ga0500559_0017768 3300053136 Bacteria 3006
510 Ga0500561_0003433 3300053137 Bacteria 2773
511 Ga0500568_0002068 3300053139 Bacteria 12164
512 Ga0500568_0011657 3300053139 Bacteria 4066
513 Ga0500568_0085599 3300053139 Bacteria 1193
514 Ga0500573_0016700 3300053140 Bacteria 4169
515 Ga0500573_0049037 3300053140 Bacteria 2430
516 Ga0500590_000811 3300053148 Bacteria 11687
517 Ga0500604_0026364 3300053151 Bacteria 1676
518 Ga0500616_0003108 3300053153 Bacteria 12998
519 Ga0500616_0062258 3300053153 Bacteria 1928
520 Ga0500616_0151485 3300053153 Bacteria 1073
521 Ga0500622_0000342 3300053156 Bacteria 45708
522 Ga0500622_0003075 3300053156 Bacteria 11504
523 Ga0500624_000370 3300053157 Bacteria 14500
524 Ga0500627_0018742 3300053158 Bacteria 2745
525 Ga0500627_0144869 3300053158 Bacteria 1073
526 Ga0500634_0009996 3300053161 Bacteria 4830
527 Ga0500636_0000023 3300053177 Bacteria 89900
528 Ga0500636_0001609 3300053177 Bacteria 12311
529 Ga0501082_0136746 3300060353 Bacteria 2126

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0285578 Ga0495686_0285578_253_900 199
2 3300053153 Ga0500616_0151485 Ga0500616_0151485_45_773 219
3 3300038443 Ga0395901_0510383 Ga0395901_0510383_510_1196 221
4 3300053122 Ga0500608_024673 Ga0500608_024673_1919_2746 223
5 3300013105 Ga0157369_10185945 Ga0157369_101859452 228
6 3300041456 Ga0451795_0368178 Ga0451795_0368178_19_744 228
7 3300041501 Ga0451845_0963136 Ga0451845_0963136_471_1157 228
8 3300041503 Ga0451847_0686743 Ga0451847_0686743_153_839 228
9 3300046507 Ga0495606_0000762 Ga0495606_0000762_11611_12303 228
10 3300046538 Ga0495609_0182422 Ga0495609_0182422_47_733 228
11 3300047472 Ga0495686_0196045 Ga0495686_0196045_130_822 228
12 3300048919 Ga0496116_0000080 Ga0496116_0000080_121102_121812 228
13 3300048919 Ga0496116_0166109 Ga0496116_0166109_471_1181 228
14 3300048922 Ga0496119_0097245 Ga0496119_0097245_169_879 228
15 3300048924 Ga0496121_0039218 Ga0496121_0039218_2702_3394 228
16 3300048927 Ga0496124_0253941 Ga0496124_0253941_320_1030 228
17 3300048928 Ga0496125_0016086 Ga0496125_0016086_81_791 228
18 3300048929 Ga0496126_0000747 Ga0496126_0000747_39551_40261 228
19 3300050489 nmdc:mga03683_15312_c1 nmdc:mga03683_15312_c1_2138_2848 228
20 3300050495 nmdc:mga04h51_112683_c1 nmdc:mga04h51_112683_c1_240_950 228
21 3300053177 Ga0500636_0000023 Ga0500636_0000023_86650_87369 228
22 3300031852 Ga0307410_10023710 Ga0307410_100237104 231
23 3300041413 Ga0439465_0006140 Ga0439465_0006140_481_1200 232
24 3300049572 Ga0501036_0623167 Ga0501036_0623167_99_878 232
25 3300005937 Ga0081455_10084454 Ga0081455_100844543 233
26 3300032002 Ga0307416_100169679 Ga0307416_1001696792 233
27 3300042007 Ga0439449_0004953 Ga0439449_0004953_2962_3798 233
28 3300005548 Ga0070665_100189572 Ga0070665_1001895723 241
29 3300028379 Ga0268266_10151290 Ga0268266_101512903 241
30 3300048920 Ga0496117_0004972 Ga0496117_0004972_354_1133 241
31 3300048924 Ga0496121_0012314 Ga0496121_0012314_282_1115 241
32 3300046460 Ga0495638_0018504 Ga0495638_0018504_939_1766 245
33 3300035695 Ga0373927_0000146 Ga0373927_0000146_43083_43853 246
34 3300037068 Ga0373925_0001219 Ga0373925_0001219_20475_21245 246
35 3300037471 Ga0395905_0000441 Ga0395905_0000441_37332_38153 246
36 3300010375 Ga0105239_10320270 Ga0105239_103202702 247
37 3300028794 Ga0307515_10073935 Ga0307515_100739352 247
38 3300037471 Ga0395905_0006786 Ga0395905_0006786_3922_4773 247
39 3300049570 Ga0501033_0029429 Ga0501033_0029429_1032_1808 248
40 3300053136 Ga0500559_0017768 Ga0500559_0017768_316_1137 248
41 3300053156 Ga0500622_0003075 Ga0500622_0003075_8413_9228 248
42 3300053139 Ga0500568_0085599 Ga0500568_0085599_381_1181 249
43 3300005262 Ga0065165_1027611 Ga0065165_10276112 250
44 3300037471 Ga0395905_0093616 Ga0395905_0093616_594_1406 250
45 3300049576 Ga0501040_0049079 Ga0501040_0049079_32_784 250
46 iso_pu_bacteria 2508501122 2509107231 250
47 iso_pu_bacteria 2509276019 2509374803 250
48 iso_pu_bacteria 2643221558 2643810421 250
49 iso_pu_bacteria 2850079185 2850080167 250
50 iso_pu_bacteria 2919100787 2919101208 250
51 iso_pu_bacteria 8056875544 8056879255 250
52 3300053140 Ga0500573_0016700 Ga0500573_0016700_366_1145 251
53 iso_pu_bacteria 2558860983 2561467310 251
54 iso_pu_bacteria 2643221568 2643856242 251
55 iso_pu_bacteria 2643221688 2644493722 251
56 iso_pu_bacteria 2919166419 2919166992 251
57 iso_pu_bacteria 2978969890 2978973410 251
58 iso_pu_bacteria 2984587000 2984591693 251
59 3300003775 Ga0055524_1004697 Ga0055524_10046974 252
60 3300003790 Ga0055528_1000263 Ga0055528_100026336 252
61 3300003856 Ga0058692_1006931 Ga0058692_10069312 252
62 3300025273 Ga0209673_1000122 Ga0209673_100012263 252
63 3300025292 Ga0209676_1044134 Ga0209676_10441342 252
64 3300025295 Ga0209564_1025910 Ga0209564_10259102 252
65 3300025299 Ga0209256_1001378 Ga0209256_100137815 252
66 3300027312 Ga0209371_1003770 Ga0209371_10037702 252
67 3300030500 Ga0268256_1012512 Ga0268256_10125122 252
68 3300046674 Ga0495588_0003056 Ga0495588_0003056_4939_5739 252
69 3300046692 Ga0495671_0220420 Ga0495671_0220420_74_874 252
70 3300047470 Ga0495681_0001172 Ga0495681_0001172_625_1425 252
71 3300053107 Ga0500560_000887 Ga0500560_000887_3353_4153 252
72 iso_pu_bacteria 2510065019 2510131626 252
73 iso_pu_bacteria 2510065057 2510304931 252
74 iso_pu_bacteria 2511231052 2511500721 252
75 iso_pu_bacteria 2512047086 2512532139 252
76 iso_pu_bacteria 2512875026 2512972527 252
77 iso_pu_bacteria 2513237084 2513571203 252
78 iso_pu_bacteria 2513237086 2513585715 252
79 iso_pu_bacteria 2513237089 2513605549 252
80 iso_pu_bacteria 2513237091 2513616786 252
81 iso_pu_bacteria 2513237093 2513632298 252
82 iso_pu_bacteria 2513237103 2513711624 252
83 iso_pu_bacteria 2513237140 2513880800 252
84 iso_pu_bacteria 2513237143 2513903794 252
85 iso_pu_bacteria 2513237156 2513986106 252
86 iso_pu_bacteria 2513237160 2514007523 252
87 iso_pu_bacteria 2515075009 2515110548 252
88 iso_pu_bacteria 2515154107 2515607854 252
89 iso_pu_bacteria 2516653046 2516891996 252
90 iso_pu_bacteria 2516653077 2517039249 252
91 iso_pu_bacteria 2517093000 2517093439 252
92 iso_pu_bacteria 2517487022 2517568809 252
93 iso_pu_bacteria 2524023207 2524450047 252
94 iso_pu_bacteria 2551306084 2551675938 252
95 iso_pu_bacteria 2551306085 2551686888 252
96 iso_pu_bacteria 2551306086 2551695248 252
97 iso_pu_bacteria 2551306089 2551708765 252
98 iso_pu_bacteria 2551306090 2551717568 252
99 iso_pu_bacteria 2551306092 2551733347 252
100 iso_pu_bacteria 2551306093 2551741730 252
101 iso_pu_bacteria 2643221557 2643807554 252
102 iso_pu_bacteria 2643221610 2644069965 252
103 iso_pu_bacteria 2643221637 2644206555 252
104 iso_pu_bacteria 2643221668 2644380937 252
105 iso_pu_bacteria 2643221675 2644414842 252
106 iso_pu_bacteria 2643221680 2644448499 252
107 iso_pu_bacteria 2643221718 2644650202 252
108 iso_pu_bacteria 2643221726 2644689194 252
109 iso_pu_bacteria 2724679232 2725950100 252
110 iso_pu_bacteria 2802428858 2802717451 252
111 iso_pu_bacteria 2802428859 2802723621 252
112 iso_pu_bacteria 2802428860 2802730930 252
113 iso_pu_bacteria 2802428861 2802735936 252
114 iso_pu_bacteria 2802428862 2802743855 252
115 iso_pu_bacteria 2802428863 2802752928 252
116 iso_pu_bacteria 2842110456 2842112351 252
117 iso_pu_bacteria 2842217011 2842218647 252
118 iso_pu_bacteria 2855825444 2855831916 252
119 iso_pu_bacteria 2855839649 2855840200 252
120 iso_pu_bacteria 2857516855 2857522233 252
121 iso_pu_bacteria 2858800743 2858804107 252
122 iso_pu_bacteria 2915980308 2915982289 252
123 iso_pu_bacteria 2915986958 2915991433 252
124 iso_pu_bacteria 2915993759 2915995773 252
125 iso_pu_bacteria 2916000859 2916006838 252
126 iso_pu_bacteria 2916007675 2916010989 252
127 iso_pu_bacteria 2916014648 2916021036 252
128 iso_pu_bacteria 2916021584 2916024629 252
129 iso_pu_bacteria 2916028427 2916032662 252
130 iso_pu_bacteria 2916035215 2916036073 252
131 iso_pu_bacteria 2916041962 2916045932 252
132 iso_pu_bacteria 2916048683 2916051604 252
133 iso_pu_bacteria 2916055098 2916059376 252
134 iso_pu_bacteria 2916061851 2916062625 252
135 iso_pu_bacteria 2916068649 2916071367 252
136 iso_pu_bacteria 2916076590 2916081936 252
137 iso_pu_bacteria 2921201388 2921204134 252
138 iso_pu_bacteria 2921208531 2921213142 252
139 iso_pu_bacteria 2921237296 2921239228 252
140 iso_pu_bacteria 2921244191 2921247579 252
141 iso_pu_bacteria 2921250672 2921250714 252
142 iso_pu_bacteria 2921257292 2921261912 252
143 iso_pu_bacteria 2921263974 2921268358 252
144 iso_pu_bacteria 2921282425 2921286950 252
145 iso_pu_bacteria 2921289301 2921291216 252
146 iso_pu_bacteria 2921296804 2921301002 252
147 iso_pu_bacteria 2924144063 2924149257 252
148 iso_pu_bacteria 2924150972 2924155780 252
149 iso_pu_bacteria 2924158325 2924161392 252
150 iso_pu_bacteria 2924165586 2924169588 252
151 iso_pu_bacteria 2924172951 2924177039 252
152 iso_pu_bacteria 2924179722 2924184701 252
153 iso_pu_bacteria 2924186466 2924190560 252
154 iso_pu_bacteria 2924193448 2924198299 252
155 iso_pu_bacteria 2924200457 2924205052 252
156 iso_pu_bacteria 2924207177 2924211915 252
157 iso_pu_bacteria 2924214083 2924218658 252
158 iso_pu_bacteria 2924221636 2924225484 252
159 iso_pu_bacteria 2924228884 2924234129 252
160 iso_pu_bacteria 2933586486 2933587680 252
161 iso_pu_bacteria 2936367885 2936368776 252
162 iso_pu_bacteria 2936375103 2936377146 252
163 iso_pu_bacteria 2936996657 2936999323 252
164 iso_pu_bacteria 2937002841 2937008075 252
165 iso_pu_bacteria 2937009748 2937014544 252
166 iso_pu_bacteria 2937016420 2937021471 252
167 iso_pu_bacteria 2937023124 2937026844 252
168 iso_pu_bacteria 2937029754 2937030109 252
169 iso_pu_bacteria 2937036028 2937037899 252
170 iso_pu_bacteria 2937042894 2937048909 252
171 iso_pu_bacteria 2937049772 2937053769 252
172 iso_pu_bacteria 2937056579 2937060939 252
173 iso_pu_bacteria 2937063883 2937070358 252
174 iso_pu_bacteria 2937071275 2937076481 252
175 iso_pu_bacteria 2937078374 2937080184 252
176 iso_pu_bacteria 2937084907 2937090471 252
177 iso_pu_bacteria 2937091812 2937094670 252
178 iso_pu_bacteria 2937098957 2937102077 252
179 iso_pu_bacteria 2937106411 2937109609 252
180 iso_pu_bacteria 2937113482 2937116978 252
181 iso_pu_bacteria 2937119839 2937124307 252
182 iso_pu_bacteria 2937126314 2937131236 252
183 iso_pu_bacteria 2957375807 2957377446 252
184 iso_pu_bacteria 2957382221 2957387158 252
185 iso_pu_bacteria 2957388812 2957392578 252
186 iso_pu_bacteria 2957395598 2957398535 252
187 iso_pu_bacteria 2957402308 2957407177 252
188 iso_pu_bacteria 2957408893 2957413281 252
189 iso_pu_bacteria 2957415311 2957420785 252
190 iso_pu_bacteria 2957422303 2957424283 252
191 iso_pu_bacteria 2957430029 2957433845 252
192 iso_pu_bacteria 2957437181 2957443149 252
193 iso_pu_bacteria 2957443900 2957446431 252
194 iso_pu_bacteria 2957450854 2957455725 252
195 iso_pu_bacteria 2957457609 2957462996 252
196 iso_pu_bacteria 2957464669 2957469460 252
197 iso_pu_bacteria 2957471148 2957474821 252
198 iso_pu_bacteria 2957478035 2957483459 252
199 iso_pu_bacteria 2957484790 2957488426 252
200 iso_pu_bacteria 2957491536 2957495420 252
201 iso_pu_bacteria 2957498199 2957502280 252
202 iso_pu_bacteria 2957505466 2957509369 252
203 iso_pu_bacteria 2960584000 2960588838 252
204 iso_pu_bacteria 2960591022 2960593727 252
205 iso_pu_bacteria 2960597568 2960601639 252
206 iso_pu_bacteria 2960603979 2960609553 252
207 iso_pu_bacteria 2960610863 2960614907 252
208 iso_pu_bacteria 2960617483 2960621068 252
209 iso_pu_bacteria 2960624210 2960628533 252
210 iso_pu_bacteria 2960631154 2960632963 252
211 iso_pu_bacteria 2960637947 2960640082 252
212 iso_pu_bacteria 2960645483 2960650311 252
213 iso_pu_bacteria 2960652885 2960653682 252
214 iso_pu_bacteria 2960660292 2960664757 252
215 iso_pu_bacteria 2960667422 2960672476 252
216 iso_pu_bacteria 2960674078 2960679130 252
217 iso_pu_bacteria 2960680706 2960685600 252
218 iso_pu_bacteria 2960687367 2960687972 252
219 iso_pu_bacteria 2960693952 2960695613 252
220 iso_pu_bacteria 2964607997 2964609790 252
221 iso_pu_bacteria 2964615318 2964619529 252
222 iso_pu_bacteria 2964621998 2964626800 252
223 iso_pu_bacteria 2964628898 2964630139 252
224 iso_pu_bacteria 2964636051 2964637458 252
225 iso_pu_bacteria 2964643177 2964647784 252
226 iso_pu_bacteria 2964649959 2964653582 252
227 iso_pu_bacteria 2964656573 2964661786 252
228 iso_pu_bacteria 2964663802 2964668960 252
229 iso_pu_bacteria 2964670856 2964672116 252
230 iso_pu_bacteria 2964678106 2964681324 252
231 iso_pu_bacteria 2964685014 2964689907 252
232 iso_pu_bacteria 2964691889 2964696853 252
233 iso_pu_bacteria 2964698721 2964699308 252
234 iso_pu_bacteria 2964705432 2964711059 252
235 iso_pu_bacteria 2964712639 2964715757 252
236 iso_pu_bacteria 2964719344 2964721524 252
237 iso_pu_bacteria 2967664464 2967670701 252
238 iso_pu_bacteria 2967671571 2967677708 252
239 iso_pu_bacteria 2967678726 2967680833 252
240 iso_pu_bacteria 2967693043 2967696658 252
241 iso_pu_bacteria 2967699805 2967701263 252
242 iso_pu_bacteria 2967706974 2967708772 252
243 iso_pu_bacteria 2967714385 2967718150 252
244 iso_pu_bacteria 2967721400 2967725952 252
245 iso_pu_bacteria 2967728569 2967729857 252
246 iso_pu_bacteria 2967735183 2967738254 252
247 iso_pu_bacteria 2967742019 2967744949 252
248 iso_pu_bacteria 2967748971 2967754104 252
249 iso_pu_bacteria 2967755722 2967756646 252
250 iso_pu_bacteria 2967762386 2967763067 252
251 iso_pu_bacteria 2967769361 2967774191 252
252 iso_pu_bacteria 2967775926 2967781523 252
253 iso_pu_bacteria 2970019648 2970020725 252
254 iso_pu_bacteria 2970026789 2970032536 252
255 iso_pu_bacteria 2970033650 2970037571 252
256 iso_pu_bacteria 2970040964 2970045241 252
257 iso_pu_bacteria 2970047711 2970053555 252
258 iso_pu_bacteria 2970054988 2970058744 252
259 iso_pu_bacteria 2970061556 2970065016 252
260 iso_pu_bacteria 2970068827 2970072757 252
261 iso_pu_bacteria 2970076120 2970081628 252
262 iso_pu_bacteria 2970082768 2970086202 252
263 iso_pu_bacteria 2970088815 2970094026 252
264 iso_pu_bacteria 2970095765 2970100814 252
265 iso_pu_bacteria 2970102677 2970106341 252
266 iso_pu_bacteria 2970109326 2970113612 252
267 iso_pu_bacteria 2970116247 2970120273 252
268 iso_pu_bacteria 2970122695 2970123769 252
269 iso_pu_bacteria 2970129317 2970132864 252
270 iso_pu_bacteria 2970136068 2970139901 252
271 iso_pu_bacteria 2970143518 2970145621 252
272 iso_pu_bacteria 2970149975 2970153663 252
273 iso_pu_bacteria 2970156795 2970158608 252
274 iso_pu_bacteria 2970164137 2970169281 252
275 iso_pu_bacteria 2970170962 2970177777 252
276 iso_pu_bacteria 2970177841 2970181483 252
277 iso_pu_bacteria 2970184632 2970191329 252
278 iso_pu_bacteria 2970191845 2970195812 252
279 iso_pu_bacteria 2977523885 2977529211 252
280 iso_pu_bacteria 2977530762 2977537595 252
281 iso_pu_bacteria 2977537788 2977540612 252
282 iso_pu_bacteria 2977544691 2977551727 252
283 iso_pu_bacteria 2977551784 2977555684 252
284 iso_pu_bacteria 2977558990 2977564017 252
285 iso_pu_bacteria 2977565890 2977570930 252
286 iso_pu_bacteria 2977572785 2977573324 252
287 iso_pu_bacteria 2977579622 2977584008 252
288 iso_pu_bacteria 2989349275 2989355375 252
289 iso_pu_bacteria 639633055 639646821 252
290 iso_pu_bacteria 648276728 648740238 252
291 iso_pu_bacteria 8003992118 8003992615 252
292 iso_pu_bacteria 8003999396 8003999935 252
293 iso_pu_bacteria 8005376324 8005377281 252
294 iso_pu_bacteria 8005460587 8005461189 252
295 iso_pu_bacteria 8005556819 8005560788 252
296 iso_pu_bacteria 8005563573 8005569771 252
297 iso_pu_bacteria 8018163183 8018167740 252
298 iso_pu_bacteria 8024479707 8024480444 252
299 iso_pu_bacteria 8057874678 8057881074 252
300 3300002773 JGI25152J39213_1015277 JGI25152J39213_10152772 253
301 3300002773 JGI25152J39213_1016284 JGI25152J39213_10162843 253
302 3300003187 JGI25151J46595_10009087 JGI25151J46595_100090873 253
303 3300005262 Ga0065165_1009542 Ga0065165_10095427 253
304 3300025258 Ga0209129_1000965 Ga0209129_100096510 253
305 3300025294 Ga0209025_1002239 Ga0209025_100223915 253
306 3300025294 Ga0209025_1029753 Ga0209025_10297532 253
307 3300053140 Ga0500573_0049037 Ga0500573_0049037_169_954 253
308 iso_pu_bacteria 2513237144 2513907953 253
309 iso_pu_bacteria 2513237146 2513927610 253
310 iso_pu_bacteria 2558860100 2558863795 253
311 iso_pu_bacteria 2599185170 2599419041 253
312 iso_pu_bacteria 2599185236 2599719426 253
313 iso_pu_bacteria 2838035591 2838037272 253
314 iso_pu_bacteria 2838074704 2838075509 253
315 iso_pu_bacteria 2838661181 2838663540 253
316 iso_pu_bacteria 2896384573 2896385397 253
317 iso_pu_bacteria 2913295892 2913297849 253
318 iso_pu_bacteria 2920760137 2920763187 253
319 iso_pu_bacteria 2920822456 2920823516 253
320 iso_pu_bacteria 2933016740 2933022353 253
321 iso_pu_bacteria 3005409236 3005411361 253
322 iso_pu_bacteria 643692032 643824668 253
323 iso_pu_bacteria 8024486573 8024489397 253
324 3300021321 Ga0214542_1029774 Ga0214542_10297742 254
325 3300021327 Ga0214543_1000003 Ga0214543_1000003167 254
326 3300025245 Ga0207425_1004757 Ga0207425_10047572 254
327 3300025294 Ga0209025_1035146 Ga0209025_10351462 254
328 3300025297 Ga0209758_1001314 Ga0209758_100131421 254
329 iso_pu_bacteria 2509276021 2509388275 254
330 iso_pu_bacteria 2509276033 2509443842 254
331 iso_pu_bacteria 2510461076 2510897919 254
332 iso_pu_bacteria 2510917022 2511134537 254
333 iso_pu_bacteria 2510917030 2511194473 254
334 iso_pu_bacteria 2513237085 2513579256 254
335 iso_pu_bacteria 2513237088 2513598516 254
336 iso_pu_bacteria 2513237138 2513866338 254
337 iso_pu_bacteria 2513237159 2513999888 254
338 iso_pu_bacteria 2513237162 2514020875 254
339 iso_pu_bacteria 2515154113 2515639014 254
340 iso_pu_bacteria 2515154114 2515645257 254
341 iso_pu_bacteria 2515154116 2515659470 254
342 iso_pu_bacteria 2515154134 2515742946 254
343 iso_pu_bacteria 2516653085 2517079493 254
344 iso_pu_bacteria 2517287029 2517405138 254
345 iso_pu_bacteria 2524023209 2524457646 254
346 iso_pu_bacteria 2529292951 2530647661 254
347 iso_pu_bacteria 2534681796 2535515229 254
348 iso_pu_bacteria 2537561587 2537872858 254
349 iso_pu_bacteria 2554235003 2554246661 254
350 iso_pu_bacteria 2558860242 2559293889 254
351 iso_pu_bacteria 2582581283 2585165149 254
352 iso_pu_bacteria 2582581294 2585204005 254
353 iso_pu_bacteria 2582581298 2585225731 254
354 iso_pu_bacteria 2582581299 2585229120 254
355 iso_pu_bacteria 2582581307 2585275311 254
356 iso_pu_bacteria 2582581308 2585281948 254
357 iso_pu_bacteria 2582581315 2585325849 254
358 iso_pu_bacteria 2582581316 2585330020 254
359 iso_pu_bacteria 2582581867 2585398417 254
360 iso_pu_bacteria 2585427526 2585528445 254
361 iso_pu_bacteria 2585427527 2585536446 254
362 iso_pu_bacteria 2585427528 2585539838 254
363 iso_pu_bacteria 2585427529 2585547994 254
364 iso_pu_bacteria 2585427530 2585556883 254
365 iso_pu_bacteria 2585427531 2585560246 254
366 iso_pu_bacteria 2585427590 2585819436 254
367 iso_pu_bacteria 2585427593 2585837819 254
368 iso_pu_bacteria 2585427608 2585901487 254
369 iso_pu_bacteria 2585427609 2585905572 254
370 iso_pu_bacteria 2585428125 2587979312 254
371 iso_pu_bacteria 2599185210 2599605440 254
372 iso_pu_bacteria 2600255279 2601609136 254
373 iso_pu_bacteria 2600255308 2601745911 254
374 iso_pu_bacteria 2615840624 2616295810 254
375 iso_pu_bacteria 2615840626 2616306193 254
376 iso_pu_bacteria 2615840698 2616553546 254
377 iso_pu_bacteria 2617270742 2617382602 254
378 iso_pu_bacteria 2643221582 2643921124 254
379 iso_pu_bacteria 2643221607 2644046994 254
380 iso_pu_bacteria 2643221618 2644103045 254
381 iso_pu_bacteria 2643221626 2644152026 254
382 iso_pu_bacteria 2643221634 2644190732 254
383 iso_pu_bacteria 2643221636 2644203567 254
384 iso_pu_bacteria 2643221643 2644241416 254
385 iso_pu_bacteria 2643221655 2644305972 254
386 iso_pu_bacteria 2643221659 2644330274 254
387 iso_pu_bacteria 2643221686 2644479783 254
388 iso_pu_bacteria 2643221693 2644519197 254
389 iso_pu_bacteria 2643221698 2644542973 254
390 iso_pu_bacteria 2643221712 2644619077 254
391 iso_pu_bacteria 2657244999 2657682028 254
392 iso_pu_bacteria 2667528174 2671112499 254
393 iso_pu_bacteria 2718217927 2719384319 254
394 iso_pu_bacteria 2718217997 2719664056 254
395 iso_pu_bacteria 2718218009 2719730376 254
396 iso_pu_bacteria 2718218199 2720490475 254
397 iso_pu_bacteria 2718218232 2720611856 254
398 iso_pu_bacteria 2718218233 2720618710 254
399 iso_pu_bacteria 2718218235 2720630110 254
400 iso_pu_bacteria 2718218269 2720773805 254
401 iso_pu_bacteria 2718218363 2721145799 254
402 iso_pu_bacteria 2718218365 2721157332 254
403 iso_pu_bacteria 2718218366 2721162678 254
404 iso_pu_bacteria 2718218423 2721398033 254
405 iso_pu_bacteria 2721755514 2722838848 254
406 iso_pu_bacteria 2721755556 2723025475 254
407 iso_pu_bacteria 2721755684 2723559058 254
408 iso_pu_bacteria 2721755685 2723565665 254
409 iso_pu_bacteria 2721755809 2724036843 254
410 iso_pu_bacteria 2721755810 2724043132 254
411 iso_pu_bacteria 2721755819 2724088412 254
412 iso_pu_bacteria 2721755822 2724102930 254
413 iso_pu_bacteria 2721755823 2724108793 254
414 iso_pu_bacteria 2728369352 2730106411 254
415 iso_pu_bacteria 2728369365 2730162943 254
416 iso_pu_bacteria 2728369397 2730296964 254
417 iso_pu_bacteria 2738541333 2739034695 254
418 iso_pu_bacteria 2775507266 2778174300 254
419 iso_pu_bacteria 2791355256 2793295075 254
420 iso_pu_bacteria 2791355259 2793315284 254
421 iso_pu_bacteria 2791355260 2793320144 254
422 iso_pu_bacteria 2791355261 2793328229 254
423 iso_pu_bacteria 2791355262 2793332571 254
424 iso_pu_bacteria 2791355263 2793343191 254
425 iso_pu_bacteria 2791355264 2793350722 254
426 iso_pu_bacteria 2791355265 2793353243 254
427 iso_pu_bacteria 2791355266 2793361037 254
428 iso_pu_bacteria 2791355267 2793364822 254
429 iso_pu_bacteria 2802429268 2804751046 254
430 iso_pu_bacteria 2802429605 2805927442 254
431 iso_pu_bacteria 2802429633 2806043994 254
432 iso_pu_bacteria 2802429634 2806052188 254
433 iso_pu_bacteria 2802429635 2806058489 254
434 iso_pu_bacteria 2802429636 2806066987 254
435 iso_pu_bacteria 2802429637 2806074730 254
436 iso_pu_bacteria 2808606387 2808986335 254
437 iso_pu_bacteria 2818991439 2819556467 254
438 iso_pu_bacteria 2818991448 2819608274 254
439 iso_pu_bacteria 2818991453 2819643460 254
440 iso_pu_bacteria 2838016132 2838022093 254
441 iso_pu_bacteria 2838022645 2838028984 254
442 iso_pu_bacteria 2838029111 2838029163 254
443 iso_pu_bacteria 2838042994 2838047238 254
444 iso_pu_bacteria 2838048938 2838053947 254
445 iso_pu_bacteria 2838061910 2838066718 254
446 iso_pu_bacteria 2838068647 2838073775 254
447 iso_pu_bacteria 2838668709 2838673205 254
448 iso_pu_bacteria 2838675328 2838677196 254
449 iso_pu_bacteria 2838680041 2838680737 254
450 iso_pu_bacteria 2838686498 2838692603 254
451 iso_pu_bacteria 2838694306 2838695230 254
452 iso_pu_bacteria 2838701080 2838704007 254
453 iso_pu_bacteria 2838707686 2838708606 254
454 iso_pu_bacteria 2838714209 2838716084 254
455 iso_pu_bacteria 2838719591 2838720116 254
456 iso_pu_bacteria 2838724970 2838726836 254
457 iso_pu_bacteria 2838729681 2838732675 254
458 iso_pu_bacteria 2838742623 2838745570 254
459 iso_pu_bacteria 2841846520 2841847050 254
460 iso_pu_bacteria 2841851746 2841855214 254
461 iso_pu_bacteria 2841864319 2841866665 254
462 iso_pu_bacteria 2842077413 2842080159 254
463 iso_pu_bacteria 2842118031 2842120779 254
464 iso_pu_bacteria 2842124991 2842126921 254
465 iso_pu_bacteria 2842130223 2842132089 254
466 iso_pu_bacteria 2842146304 2842148201 254
467 iso_pu_bacteria 2842152218 2842152742 254
468 iso_pu_bacteria 2842156927 2842161756 254
469 iso_pu_bacteria 2842163707 2842170155 254
470 iso_pu_bacteria 2842170452 2842172329 254
471 iso_pu_bacteria 2842175837 2842176361 254
472 iso_pu_bacteria 2842180545 2842185373 254
473 iso_pu_bacteria 2842187318 2842189191 254
474 iso_pu_bacteria 2842192696 2842193046 254
475 iso_pu_bacteria 2842198810 2842205087 254
476 iso_pu_bacteria 2842205361 2842206792 254
477 iso_pu_bacteria 2842211629 2842213505 254
478 iso_pu_bacteria 2842224351 2842224877 254
479 iso_pu_bacteria 2842229732 2842233311 254
480 iso_pu_bacteria 2842237096 2842238018 254
481 iso_pu_bacteria 2842243621 2842248685 254
482 iso_pu_bacteria 2842250916 2842253267 254
483 iso_pu_bacteria 2842257432 2842261828 254
484 iso_pu_bacteria 2842264693 2842267302 254
485 iso_pu_bacteria 2842271015 2842277108 254
486 iso_pu_bacteria 2842278818 2842280515 254
487 iso_pu_bacteria 2842285085 2842289466 254
488 iso_pu_bacteria 2842291075 2842293819 254
489 iso_pu_bacteria 2842298080 2842300739 254
490 iso_pu_bacteria 2842304105 2842306334 254
491 iso_pu_bacteria 2842311132 2842312481 254
492 iso_pu_bacteria 2842317721 2842322372 254
493 iso_pu_bacteria 2842341865 2842342929 254
494 iso_pu_bacteria 2842357229 2842358142 254
495 iso_pu_bacteria 2842363717 2842369916 254
496 iso_pu_bacteria 2842370503 2842371200 254
497 iso_pu_bacteria 2842377471 2842380215 254
498 iso_pu_bacteria 2842384541 2842387287 254
499 iso_pu_bacteria 2842395702 2842400706 254
500 iso_pu_bacteria 2842402390 2842406814 254
501 iso_pu_bacteria 2842409023 2842413689 254
502 iso_pu_bacteria 2842415677 2842420348 254
503 iso_pu_bacteria 2842422224 2842427223 254
504 iso_pu_bacteria 2842428310 2842431446 254
505 iso_pu_bacteria 2842434925 2842437781 254
506 iso_pu_bacteria 2842441272 2842444596 254
507 iso_pu_bacteria 2842447887 2842450349 254
508 iso_pu_bacteria 2842462802 2842465576 254
509 iso_pu_bacteria 2842469257 2842472386 254
510 iso_pu_bacteria 2842475841 2842476407 254
511 iso_pu_bacteria 2842482326 2842482481 254
512 iso_pu_bacteria 2842489311 2842495043 254
513 iso_pu_bacteria 2842495871 2842500952 254
514 iso_pu_bacteria 2842502639 2842502691 254
515 iso_pu_bacteria 2842509118 2842509335 254
516 iso_pu_bacteria 2842515876 2842517206 254
517 iso_pu_bacteria 2842521101 2842526461 254
518 iso_pu_bacteria 2844454524 2844455829 254
519 iso_pu_bacteria 2847670302 2847672145 254
520 iso_pu_bacteria 2847686936 2847688490 254
521 iso_pu_bacteria 2852387548 2852388627 254
522 iso_pu_bacteria 2856314179 2856317062 254
523 iso_pu_bacteria 2871444079 2871450318 254
524 iso_pu_bacteria 2878035449 2878037303 254
525 iso_pu_bacteria 2878760144 2878761632 254
526 iso_pu_bacteria 2878767105 2878768599 254
527 iso_pu_bacteria 2881147464 2881154101 254
528 iso_pu_bacteria 2889790730 2889791247 254
529 iso_pu_bacteria 2889914905 2889920290 254
530 iso_pu_bacteria 2891048133 2891048191 254
531 iso_pu_bacteria 2899792073 2899792486 254
532 iso_pu_bacteria 2899845264 2899847924 254
533 iso_pu_bacteria 2903540706 2903542209 254
534 iso_pu_bacteria 2906328253 2906331652 254
535 iso_pu_bacteria 2906414383 2906417122 254
536 iso_pu_bacteria 2919114240 2919116287 254
537 iso_pu_bacteria 2919408235 2919408932 254
538 iso_pu_bacteria 2922158528 2922162372 254
539 iso_pu_bacteria 2923556063 2923557328 254
540 iso_pu_bacteria 2924726620 2924729823 254
541 iso_pu_bacteria 2926754445 2926757241 254
542 iso_pu_bacteria 2926760298 2926761455 254
543 iso_pu_bacteria 2929138655 2929139081 254
544 iso_pu_bacteria 2933006813 2933007387 254
545 iso_pu_bacteria 2933011516 2933012151 254
546 iso_pu_bacteria 2933570622 2933573403 254
547 iso_pu_bacteria 2933594066 2933594599 254
548 iso_pu_bacteria 2933599457 2933604203 254
549 iso_pu_bacteria 2935894831 2935895753 254
550 iso_pu_bacteria 2935901341 2935907794 254
551 iso_pu_bacteria 2936381700 2936387319 254
552 iso_pu_bacteria 2937891427 2937896788 254
553 iso_pu_bacteria 2937994558 2937996062 254
554 iso_pu_bacteria 2958115193 2958115817 254
555 iso_pu_bacteria 2958165035 2958166534 254
556 iso_pu_bacteria 2961163497 2961164999 254
557 iso_pu_bacteria 2965018300 2965019824 254
558 iso_pu_bacteria 2965062239 2965064051 254
559 iso_pu_bacteria 2968091066 2968095550 254
560 iso_pu_bacteria 2968097103 2968103349 254
561 iso_pu_bacteria 2968128360 2968132314 254
562 iso_pu_bacteria 2968171901 2968173399 254
563 iso_pu_bacteria 2970554993 2970556488 254
564 iso_pu_bacteria 2977858184 2977860811 254
565 iso_pu_bacteria 2979089926 2979093259 254
566 iso_pu_bacteria 2979095461 2979099356 254
567 iso_pu_bacteria 2979100975 2979105227 254
568 iso_pu_bacteria 2979779861 2979781985 254
569 iso_pu_bacteria 2984509177 2984512917 254
570 iso_pu_bacteria 2984518228 2984520719 254
571 iso_pu_bacteria 2984537506 2984540012 254
572 iso_pu_bacteria 2984601300 2984602202 254
573 iso_pu_bacteria 2987659509 2987661006 254
574 iso_pu_bacteria 2996341866 2996342400 254
575 iso_pu_bacteria 2996887358 2996892051 254
576 iso_pu_bacteria 2996893221 2996893596 254
577 iso_pu_bacteria 3004188549 3004190056 254
578 iso_pu_bacteria 3005416602 3005422679 254
579 iso_pu_bacteria 3005445848 3005446310 254
580 iso_pu_bacteria 650716007 650739080 254
581 iso_pu_bacteria 8003570095 8003572712 254
582 iso_pu_bacteria 8004445564 8004446911 254
583 iso_pu_bacteria 8004703790 8004704056 254
584 iso_pu_bacteria 8005258706 8005263623 254
585 iso_pu_bacteria 8005275841 8005279034 254
586 iso_pu_bacteria 8005282627 8005283723 254
587 iso_pu_bacteria 8005289223 8005291855 254
588 iso_pu_bacteria 8005301065 8005303988 254
589 iso_pu_bacteria 8005307578 8005308807 254
590 iso_pu_bacteria 8005314921 8005321785 254
591 iso_pu_bacteria 8005321885 8005326578 254
592 iso_pu_bacteria 8005382845 8005387150 254
593 iso_pu_bacteria 8005395548 8005401910 254
594 iso_pu_bacteria 8005430974 8005433072 254
595 iso_pu_bacteria 8005497431 8005498799 254
596 iso_pu_bacteria 8005542996 8005543907 254
597 iso_pu_bacteria 8005570704 8005577071 254
598 iso_pu_bacteria 8005619151 8005619992 254
599 iso_pu_bacteria 8005626139 8005628591 254
600 iso_pu_bacteria 8005645114 8005646605 254
601 iso_pu_bacteria 8005668836 8005670210 254
602 iso_pu_bacteria 8005682033 8005684984 254
603 iso_pu_bacteria 8005688590 8005690414 254
604 iso_pu_bacteria 8005695170 8005697950 254
605 iso_pu_bacteria 8018127388 8018133269 254
606 iso_pu_bacteria 8018176218 8018181227 254
607 iso_pu_bacteria 8023680758 8023684065 254
608 iso_pu_bacteria 8024501048 8024503535 254
609 iso_pu_bacteria 8046767195 8046771037 254
610 iso_pu_bacteria 8054460903 8054461408 254
611 iso_pu_bacteria 8056375014 8056375779 254
612 iso_pu_bacteria 8056382006 8056386096 254
613 iso_pu_bacteria 8057575449 8057579801 254
614 3300003323 rootH1_10105424 rootH1_101054242 255
615 3300025230 Ga0209563_101762 Ga0209563_1017625 255
616 3300031911 Ga0307412_10052489 Ga0307412_100524894 255
617 3300031911 Ga0307412_10518148 Ga0307412_105181482 255
618 3300037418 Ga0395900_0256769 Ga0395900_0256769_45_839 255
619 3300037418 Ga0395900_0612283 Ga0395900_0612283_187_978 255
620 3300038443 Ga0395901_0197637 Ga0395901_0197637_190_984 255
621 3300048925 Ga0496122_0000009 Ga0496122_0000009_393631_394419 255
622 3300048926 Ga0496123_0000020 Ga0496123_0000020_198083_198871 255
623 3300048927 Ga0496124_0020386 Ga0496124_0020386_4067_4855 255
624 3300049568 Ga0501031_0060236 Ga0501031_0060236_1237_2013 255
625 3300049569 Ga0501032_0165083 Ga0501032_0165083_516_1304 255
626 3300049570 Ga0501033_0000171 Ga0501033_0000171_48352_49140 255
627 3300049575 Ga0501039_0216351 Ga0501039_0216351_59_835 255
628 3300049822 Ga0501035_0000841 Ga0501035_0000841_12750_13538 255
629 3300053125 Ga0500618_003524 Ga0500618_003524_2866_3684 255
630 iso_pu_bacteria 2510461069 2510839893 255
631 iso_pu_bacteria 2599185156 2599333175 255
632 iso_pu_bacteria 2738541317 2738945726 255
633 iso_pu_bacteria 2821123053 2821123767 255
634 iso_pu_bacteria 2838736955 2838739203 255
635 iso_pu_bacteria 2841840854 2841843101 255
636 iso_pu_bacteria 2842140634 2842142883 255
637 iso_pu_bacteria 2857531043 2857531329 255
638 iso_pu_bacteria 2891373044 2891376293 255
639 iso_pu_bacteria 2913308742 2913310592 255
640 3300003775 Ga0055524_1001469 Ga0055524_100146914 256
641 3300022740 Ga0228710_1000031 Ga0228710_100003153 256
642 3300025294 Ga0209025_1065985 Ga0209025_10659852 256
643 3300025299 Ga0209256_1000169 Ga0209256_100016968 256
644 3300027111 Ga0209281_1000155 Ga0209281_100015554 256
645 3300027666 Ga0209282_1000025 Ga0209282_1000025110 256
646 3300031967 Ga0315914_1000020 Ga0315914_1000020109 256
647 3300033430 Ga0315913_1000013 Ga0315913_100001312 256
648 3300033464 Ga0315915_1000015 Ga0315915_100001553 256
649 3300041411 Ga0439466_0068082 Ga0439466_0068082_279_1052 256
650 3300041494 Ga0451837_0118587 Ga0451837_0118587_166_936 256
651 3300049568 Ga0501031_0000015 Ga0501031_0000015_30635_31432 256
652 3300049569 Ga0501032_0000008 Ga0501032_0000008_176428_177225 256
653 3300049570 Ga0501033_0000012 Ga0501033_0000012_64400_65197 256
654 3300049571 Ga0501034_0000035 Ga0501034_0000035_64399_65196 256
655 3300049572 Ga0501036_0000006 Ga0501036_0000006_64399_65196 256
656 3300049573 Ga0501037_0000115 Ga0501037_0000115_9742_10539 256
657 3300049574 Ga0501038_0000007 Ga0501038_0000007_176428_177225 256
658 3300049575 Ga0501039_0000012 Ga0501039_0000012_64399_65196 256
659 3300049579 Ga0501043_0000432 Ga0501043_0000432_23232_24029 256
660 3300049580 Ga0501046_0076549 Ga0501046_0076549_356_1153 256
661 3300049581 Ga0501047_0001526 Ga0501047_0001526_12194_12991 256
662 3300049586 Ga0501070_0005611 Ga0501070_0005611_1970_2767 256
663 3300049822 Ga0501035_0000192 Ga0501035_0000192_64399_65196 256
664 3300049823 Ga0501044_0000015 Ga0501044_0000015_176428_177225 256
665 iso_pu_bacteria 2791355091 2792622319 256
666 iso_pu_bacteria 2791355092 2792628115 256
667 3300002987 JGI25159J45721_1000021 JGI25159J45721_100002151 257
668 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002346 257
669 3300003374 JGI25161J50226_1001106 JGI25161J50226_10011069 257
670 3300003771 Ga0055526_1001512 Ga0055526_100151215 257
671 3300003781 Ga0055536_1011977 Ga0055536_10119773 257
672 3300003794 Ga0055531_10007471 Ga0055531_100074715 257
673 3300004625 Ga0055543_1000010 Ga0055543_100001037 257
674 3300005262 Ga0065165_1000004 Ga0065165_100000432 257
675 3300005331 Ga0070670_100000811 Ga0070670_10000081114 257
676 3300013249 Ga0171463_1001 Ga0171463_1001560 257
677 3300015690 Ga0183363_1067 Ga0183363_10678 257
678 3300025208 Ga0209436_102216 Ga0209436_1022165 257
679 3300025284 Ga0209130_1000008 Ga0209130_1000008198 257
680 3300025292 Ga0209676_1007603 Ga0209676_10076032 257
681 3300025294 Ga0209025_1000425 Ga0209025_100042516 257
682 3300025295 Ga0209564_1000091 Ga0209564_100009135 257
683 3300025298 Ga0209050_1026838 Ga0209050_10268382 257
684 3300025299 Ga0209256_1004334 Ga0209256_10043342 257
685 3300025302 Ga0207426_1000016 Ga0207426_1000016363 257
686 3300025303 Ga0209051_1051502 Ga0209051_10515022 257
687 3300025304 Ga0209257_1006311 Ga0209257_10063115 257
688 3300025925 Ga0207650_10017791 Ga0207650_100177913 257
689 3300028794 Ga0307515_10003734 Ga0307515_100037346 257
690 3300046459 Ga0495629_0011919 Ga0495629_0011919_1610_2383 257
691 3300046462 Ga0495651_0245225 Ga0495651_0245225_409_1182 257
692 3300046477 Ga0495664_0077397 Ga0495664_0077397_781_1554 257
693 3300046507 Ga0495606_0015417 Ga0495606_0015417_524_1297 257
694 3300046533 Ga0495640_0085525 Ga0495640_0085525_877_1650 257
695 3300046557 Ga0495622_0008297 Ga0495622_0008297_1258_2031 257
696 3300046663 Ga0495635_0147235 Ga0495635_0147235_115_888 257
697 3300046809 Ga0495600_0055009 Ga0495600_0055009_349_1122 257
698 3300047317 Ga0495604_0108265 Ga0495604_0108265_506_1279 257
699 3300047321 Ga0495676_0416192 Ga0495676_0416192_61_834 257
700 3300047472 Ga0495686_0004080 Ga0495686_0004080_8504_9277 257
701 3300047472 Ga0495686_0013054 Ga0495686_0013054_4634_5407 257
702 3300048914 Ga0496111_0020904 Ga0496111_0020904_1131_1925 257
703 3300048924 Ga0496121_0191521 Ga0496121_0191521_13_786 257
704 3300048926 Ga0496123_0006783 Ga0496123_0006783_7415_8209 257
705 3300048927 Ga0496124_0076212 Ga0496124_0076212_1824_2618 257
706 3300049568 Ga0501031_0030172 Ga0501031_0030172_233_1027 257
707 3300049568 Ga0501031_0073596 Ga0501031_0073596_1198_1992 257
708 3300049569 Ga0501032_0029169 Ga0501032_0029169_76_870 257
709 3300049570 Ga0501033_0022307 Ga0501033_0022307_2367_3164 257
710 3300049570 Ga0501033_0210965 Ga0501033_0210965_463_1272 257
711 3300049570 Ga0501033_0220972 Ga0501033_0220972_489_1283 257
712 3300049570 Ga0501033_0342566 Ga0501033_0342566_198_1007 257
713 3300049571 Ga0501034_0034706 Ga0501034_0034706_200_994 257
714 3300049571 Ga0501034_0221040 Ga0501034_0221040_429_1223 257
715 3300049572 Ga0501036_0023150 Ga0501036_0023150_2749_3543 257
716 3300049572 Ga0501036_0092032 Ga0501036_0092032_82_876 257
717 3300049572 Ga0501036_0245676 Ga0501036_0245676_208_981 257
718 3300049574 Ga0501038_0057841 Ga0501038_0057841_1695_2489 257
719 3300049575 Ga0501039_0190999 Ga0501039_0190999_233_1027 257
720 3300049575 Ga0501039_0223360 Ga0501039_0223360_233_1027 257
721 3300049576 Ga0501040_0197566 Ga0501040_0197566_420_1214 257
722 3300049579 Ga0501043_0047378 Ga0501043_0047378_1344_2138 257
723 3300049579 Ga0501043_0082467 Ga0501043_0082467_1273_2067 257
724 3300049579 Ga0501043_0164230 Ga0501043_0164230_189_962 257
725 3300049580 Ga0501046_0195178 Ga0501046_0195178_534_1328 257
726 3300049580 Ga0501046_0246984 Ga0501046_0246984_370_1143 257
727 3300049586 Ga0501070_0096215 Ga0501070_0096215_756_1550 257
728 3300049586 Ga0501070_0333597 Ga0501070_0333597_137_931 257
729 3300049589 Ga0501073_0152578 Ga0501073_0152578_233_1006 257
730 3300049590 Ga0501074_0162779 Ga0501074_0162779_672_1466 257
731 3300049742 Ga0501080_0038118 Ga0501080_0038118_2513_3286 257
732 3300049742 Ga0501080_0662977 Ga0501080_0662977_91_885 257
733 3300049744 Ga0501083_0184099 Ga0501083_0184099_289_1062 257
734 3300049822 Ga0501035_0075661 Ga0501035_0075661_1695_2489 257
735 3300049822 Ga0501035_0099965 Ga0501035_0099965_66_860 257
736 3300049822 Ga0501035_0134546 Ga0501035_0134546_552_1325 257
737 3300049823 Ga0501044_0114298 Ga0501044_0114298_629_1423 257
738 3300049823 Ga0501044_0199922 Ga0501044_0199922_197_970 257
739 3300049824 Ga0501045_0255171 Ga0501045_0255171_281_1075 257
740 3300053085 Ga0495619_0026578 Ga0495619_0026578_315_1088 257
741 3300053123 Ga0500614_017776 Ga0500614_017776_496_1269 257
742 3300053125 Ga0500618_019728 Ga0500618_019728_449_1222 257
743 3300053148 Ga0500590_000811 Ga0500590_000811_338_1111 257
744 3300053158 Ga0500627_0018742 Ga0500627_0018742_1208_2008 257
745 iso_pu_bacteria 2599185352 2600191595 257
746 iso_pu_bacteria 2643221723 2644673892 257
747 iso_pu_bacteria 8049293176 8049293622 257
748 3300002704 JGI25155J39150_1000006 JGI25155J39150_1000006194 258
749 3300002705 JGI25156J39149_1000019 JGI25156J39149_100001953 258
750 3300002737 JGI25162J39368_1001875 JGI25162J39368_10018759 258
751 3300002737 JGI25162J39368_1002018 JGI25162J39368_10020188 258
752 3300002738 JGI25154J39366_1000365 JGI25154J39366_100036514 258
753 3300002741 JGI25157J39369_1000024 JGI25157J39369_1000024111 258
754 3300002773 JGI25152J39213_1001364 JGI25152J39213_10013649 258
755 3300002773 JGI25152J39213_1001530 JGI25152J39213_10015304 258
756 3300002774 JGI25150J39212_1000042 JGI25150J39212_100004219 258
757 3300003187 JGI25151J46595_10000099 JGI25151J46595_1000009960 258
758 3300003187 JGI25151J46595_10001860 JGI25151J46595_100018605 258
759 3300003214 JGI25165J46597_1001938 JGI25165J46597_10019382 258
760 3300003214 JGI25165J46597_1002939 JGI25165J46597_10029393 258
761 3300003214 JGI25165J46597_1004195 JGI25165J46597_10041954 258
762 3300003215 JGI25153J46596_10000761 JGI25153J46596_1000076114 258
763 3300003215 JGI25153J46596_10049148 JGI25153J46596_100491482 258
764 3300003215 JGI25153J46596_10051263 JGI25153J46596_100512632 258
765 3300003316 rootH1_10044780 rootH1_100447803 258
766 3300003316 rootH1_10104610 rootH1_101046102 258
767 3300003320 rootH2_10120526 rootH2_101205262 258
768 3300003320 rootH2_10256542 rootH2_102565422 258
769 3300003322 rootL2_10115041 rootL2_101150416 258
770 3300003323 rootH1_10035118 rootH1_100351182 258
771 3300003323 rootH1_10178534 rootH1_101785341 258
772 3300003323 rootH1_10209197 rootH1_102091971 258
773 3300003354 JGI25160J50197_1000261 JGI25160J50197_100026130 258
774 3300003354 JGI25160J50197_1001976 JGI25160J50197_10019764 258
775 3300003354 JGI25160J50197_1008147 JGI25160J50197_10081474 258
776 3300003354 JGI25160J50197_1031131 JGI25160J50197_10311312 258
777 3300003374 JGI25161J50226_1000195 JGI25161J50226_100019530 258
778 3300003374 JGI25161J50226_1001515 JGI25161J50226_10015153 258
779 3300003771 Ga0055526_1010009 Ga0055526_10100092 258
780 3300003771 Ga0055526_1019591 Ga0055526_10195912 258
781 3300003771 Ga0055526_1025637 Ga0055526_10256373 258
782 3300003775 Ga0055524_1010290 Ga0055524_10102902 258
783 3300003775 Ga0055524_1022698 Ga0055524_10226982 258
784 3300003775 Ga0055524_1025794 Ga0055524_10257943 258
785 3300003775 Ga0055524_1031336 Ga0055524_10313362 258
786 3300003790 Ga0055528_1007710 Ga0055528_10077104 258
787 3300003790 Ga0055528_1010543 Ga0055528_10105434 258
788 3300003790 Ga0055528_1011212 Ga0055528_10112123 258
789 3300003790 Ga0055528_1016523 Ga0055528_10165231 258
790 3300003792 Ga0055540_1035773 Ga0055540_10357732 258
791 3300003856 Ga0058692_1005505 Ga0058692_10055052 258
792 3300004625 Ga0055543_1000215 Ga0055543_100021540 258
793 3300004625 Ga0055543_1000358 Ga0055543_100035819 258
794 3300004625 Ga0055543_1000923 Ga0055543_100092313 258
795 3300005262 Ga0065165_1002152 Ga0065165_10021524 258
796 3300005262 Ga0065165_1012112 Ga0065165_10121123 258
797 3300005262 Ga0065165_1035815 Ga0065165_10358152 258
798 3300005335 Ga0070666_10013250 Ga0070666_100132503 258
799 3300005355 Ga0070671_100024251 Ga0070671_1000242514 258
800 3300005367 Ga0070667_100456539 Ga0070667_1004565392 258
801 3300005548 Ga0070665_100050865 Ga0070665_1000508655 258
802 3300005548 Ga0070665_100053285 Ga0070665_1000532853 258
803 3300005563 Ga0068855_100154182 Ga0068855_1001541822 258
804 3300005614 Ga0068856_100162434 Ga0068856_1001624343 258
805 3300005616 Ga0068852_100026503 Ga0068852_1000265032 258
806 3300006038 Ga0075365_10000341 Ga0075365_100003419 258
807 3300006038 Ga0075365_10067790 Ga0075365_100677903 258
808 3300006038 Ga0075365_10113509 Ga0075365_101135093 258
809 3300006048 Ga0075363_100147911 Ga0075363_1001479111 258
810 3300006051 Ga0075364_10087839 Ga0075364_100878392 258
811 3300006177 Ga0075362_10007439 Ga0075362_100074392 258
812 3300006178 Ga0075367_10017298 Ga0075367_100172982 258
813 3300006178 Ga0075367_10042032 Ga0075367_100420322 258
814 3300006186 Ga0075369_10001103 Ga0075369_100011033 258
815 3300006186 Ga0075369_10019551 Ga0075369_100195514 258
816 3300006195 Ga0075366_10003971 Ga0075366_100039715 258
817 3300006353 Ga0075370_10016276 Ga0075370_100162763 258
818 3300006946 Ga0079104_1000210 Ga0079104_100021023 258
819 3300006948 Ga0099826_10003316 Ga0099826_1000331610 258
820 3300009011 Ga0105251_10020730 Ga0105251_100207303 258
821 3300009036 Ga0105244_10110060 Ga0105244_101100601 258
822 3300009092 Ga0105250_10019885 Ga0105250_100198853 258
823 3300009093 Ga0105240_10000027 Ga0105240_1000002733 258
824 3300009148 Ga0105243_10091152 Ga0105243_100911524 258
825 3300009545 Ga0105237_10000508 Ga0105237_1000050821 258
826 3300009763 Ga0123340_1046711 Ga0123340_10467112 258
827 3300009763 Ga0123340_1046783 Ga0123340_10467832 258
828 3300009765 Ga0123341_1000027 Ga0123341_100002737 258
829 3300009765 Ga0123341_1049686 Ga0123341_10496862 258
830 3300009765 Ga0123341_1050067 Ga0123341_10500672 258
831 3300009766 Ga0123342_1023186 Ga0123342_10231864 258
832 3300010375 Ga0105239_10002593 Ga0105239_100025935 258
833 3300011119 Ga0105246_10096120 Ga0105246_100961203 258
834 3300013100 Ga0157373_10014166 Ga0157373_100141662 258
835 3300013102 Ga0157371_10000058 Ga0157371_1000005834 258
836 3300013104 Ga0157370_10000048 Ga0157370_1000004814 258
837 3300013104 Ga0157370_10000792 Ga0157370_100007925 258
838 3300013105 Ga0157369_10326090 Ga0157369_103260902 258
839 3300014325 Ga0163163_10405133 Ga0163163_104051332 258
840 3300015262 Ga0182007_10001900 Ga0182007_100019003 258
841 3300021320 Ga0214544_1000008 Ga0214544_1000008229 258
842 3300021321 Ga0214542_1000010 Ga0214542_1000010186 258
843 3300021327 Ga0214543_1000004 Ga0214543_1000004208 258
844 3300025206 Ga0209435_100011 Ga0209435_100011191 258
845 3300025233 Ga0209437_100036 Ga0209437_100036159 258
846 3300025233 Ga0209437_100086 Ga0209437_10008689 258
847 3300025245 Ga0207425_1000012 Ga0207425_1000012481 258
848 3300025245 Ga0207425_1010289 Ga0207425_10102893 258
849 3300025245 Ga0207425_1028887 Ga0207425_10288871 258
850 3300025246 Ga0209646_1000024 Ga0209646_1000024220 258
851 3300025250 Ga0209026_1000030 Ga0209026_1000030220 258
852 3300025253 Ga0209677_100177 Ga0209677_10017726 258
853 3300025254 Ga0209148_1009921 Ga0209148_10099211 258
854 3300025256 Ga0209759_1000011 Ga0209759_1000011191 258
855 3300025258 Ga0209129_1000086 Ga0209129_100008661 258
856 3300025258 Ga0209129_1001065 Ga0209129_100106515 258
857 3300025258 Ga0209129_1001501 Ga0209129_10015014 258
858 3300025258 Ga0209129_1003602 Ga0209129_10036029 258
859 3300025258 Ga0209129_1003829 Ga0209129_10038292 258
860 3300025258 Ga0209129_1013324 Ga0209129_10133242 258
861 3300025261 Ga0209233_1000056 Ga0209233_1000056433 258
862 3300025261 Ga0209233_1000110 Ga0209233_1000110159 258
863 3300025261 Ga0209233_1000640 Ga0209233_100064014 258
864 3300025263 Ga0209565_1017396 Ga0209565_10173962 258
865 3300025272 Ga0209455_1003068 Ga0209455_10030686 258
866 3300025273 Ga0209673_1000091 Ga0209673_100009197 258
867 3300025273 Ga0209673_1001847 Ga0209673_10018476 258
868 3300025273 Ga0209673_1002257 Ga0209673_100225710 258
869 3300025273 Ga0209673_1003203 Ga0209673_10032037 258
870 3300025273 Ga0209673_1003816 Ga0209673_10038165 258
871 3300025273 Ga0209673_1007275 Ga0209673_10072756 258
872 3300025273 Ga0209673_1027782 Ga0209673_10277822 258
873 3300025284 Ga0209130_1000013 Ga0209130_100001329 258
874 3300025284 Ga0209130_1000015 Ga0209130_1000015335 258
875 3300025284 Ga0209130_1006718 Ga0209130_10067185 258
876 3300025291 Ga0209675_1011574 Ga0209675_10115744 258
877 3300025292 Ga0209676_1023318 Ga0209676_10233181 258
878 3300025294 Ga0209025_1000024 Ga0209025_1000024481 258
879 3300025294 Ga0209025_1000118 Ga0209025_100011852 258
880 3300025294 Ga0209025_1000549 Ga0209025_100054923 258
881 3300025294 Ga0209025_1003170 Ga0209025_10031708 258
882 3300025294 Ga0209025_1005506 Ga0209025_10055069 258
883 3300025294 Ga0209025_1009578 Ga0209025_10095784 258
884 3300025294 Ga0209025_1050792 Ga0209025_10507922 258
885 3300025295 Ga0209564_1000398 Ga0209564_100039813 258
886 3300025295 Ga0209564_1001660 Ga0209564_100166013 258
887 3300025295 Ga0209564_1001988 Ga0209564_10019889 258
888 3300025295 Ga0209564_1049257 Ga0209564_10492572 258
889 3300025297 Ga0209758_1000046 Ga0209758_100004661 258
890 3300025297 Ga0209758_1000325 Ga0209758_100032535 258
891 3300025297 Ga0209758_1001929 Ga0209758_100192913 258
892 3300025297 Ga0209758_1003374 Ga0209758_100337411 258
893 3300025297 Ga0209758_1007852 Ga0209758_10078523 258
894 3300025297 Ga0209758_1019346 Ga0209758_10193465 258
895 3300025298 Ga0209050_1013538 Ga0209050_10135382 258
896 3300025299 Ga0209256_1001486 Ga0209256_10014869 258
897 3300025299 Ga0209256_1003791 Ga0209256_100379111 258
898 3300025299 Ga0209256_1005505 Ga0209256_10055055 258
899 3300025299 Ga0209256_1031006 Ga0209256_10310063 258
900 3300025302 Ga0207426_1000063 Ga0207426_100006371 258
901 3300025302 Ga0207426_1000081 Ga0207426_100008129 258
902 3300025302 Ga0207426_1000144 Ga0207426_1000144105 258
903 3300025303 Ga0209051_1000205 Ga0209051_100020583 258
904 3300025303 Ga0209051_1014627 Ga0209051_10146274 258
905 3300025303 Ga0209051_1017189 Ga0209051_10171893 258
906 3300025304 Ga0209257_1003359 Ga0209257_10033595 258
907 3300025913 Ga0207695_10000024 Ga0207695_10000024597 258
908 3300025914 Ga0207671_10000176 Ga0207671_1000017673 258
909 3300025931 Ga0207644_10042355 Ga0207644_100423553 258
910 3300025949 Ga0207667_10468185 Ga0207667_104681852 258
911 3300025972 Ga0207668_10031723 Ga0207668_100317232 258
912 3300026078 Ga0207702_10120780 Ga0207702_101207803 258
913 3300027111 Ga0209281_1000253 Ga0209281_100025346 258
914 3300027312 Ga0209371_1000009 Ga0209371_1000009409 258
915 3300027312 Ga0209371_1001205 Ga0209371_100120519 258
916 3300027666 Ga0209282_1001877 Ga0209282_10018778 258
917 3300028379 Ga0268266_10015167 Ga0268266_100151676 258
918 3300028379 Ga0268266_10038826 Ga0268266_100388263 258
919 3300028379 Ga0268266_10081239 Ga0268266_100812393 258
920 3300028794 Ga0307515_10000154 Ga0307515_10000154119 258
921 3300028794 Ga0307515_10218934 Ga0307515_102189342 258
922 3300030500 Ga0268256_1000010 Ga0268256_1000010408 258
923 3300030500 Ga0268256_1004527 Ga0268256_10045274 258
924 3300031456 Ga0307513_10001432 Ga0307513_1000143228 258
925 3300031456 Ga0307513_10291229 Ga0307513_102912292 258
926 3300031548 Ga0307408_100287610 Ga0307408_1002876101 258
927 3300031911 Ga0307412_10002253 Ga0307412_100022537 258
928 3300031995 Ga0307409_100157597 Ga0307409_1001575972 258
929 3300032002 Ga0307416_100616168 Ga0307416_1006161682 258
930 3300041411 Ga0439466_0026155 Ga0439466_0026155_641_1438 258
931 3300041411 Ga0439466_0062999 Ga0439466_0062999_145_924 258
932 3300041502 Ga0451846_65766 Ga0451846_65766_332_1108 258
933 3300041505 Ga0451849_0734293 Ga0451849_0734293_251_1027 258
934 3300041512 Ga0451853_1619242 Ga0451853_1619242_166_942 258
935 3300042007 Ga0439449_0050015 Ga0439449_0050015_537_1334 258
936 3300042531 Ga0450918_016128 Ga0450918_016128_44_823 258
937 3300046460 Ga0495638_0009816 Ga0495638_0009816_1653_2537 258
938 3300046460 Ga0495638_0044368 Ga0495638_0044368_1700_2476 258
939 3300046460 Ga0495638_0228824 Ga0495638_0228824_114_983 258
940 3300046474 Ga0495605_0001233 Ga0495605_0001233_15214_16011 258
941 3300046492 Ga0495585_0013373 Ga0495585_0013373_3914_4711 258
942 3300046500 Ga0495596_0075528 Ga0495596_0075528_212_988 258
943 3300046501 Ga0495607_0138632 Ga0495607_0138632_245_1021 258
944 3300046506 Ga0495583_0099712 Ga0495583_0099712_157_933 258
945 3300046507 Ga0495606_0093901 Ga0495606_0093901_104_880 258
946 3300046513 Ga0495616_0133966 Ga0495616_0133966_274_1071 258
947 3300046518 Ga0495631_0001700 Ga0495631_0001700_2796_3593 258
948 3300046518 Ga0495631_0108924 Ga0495631_0108924_248_1024 258
949 3300046519 Ga0495632_0051996 Ga0495632_0051996_795_1592 258
950 3300046522 Ga0495643_0022226 Ga0495643_0022226_2772_3548 258
951 3300046524 Ga0495648_0035378 Ga0495648_0035378_742_1518 258
952 3300046530 Ga0495654_0054914 Ga0495654_0054914_326_1102 258
953 3300046538 Ga0495609_0090957 Ga0495609_0090957_77_874 258
954 3300046542 Ga0495597_0029144 Ga0495597_0029144_1147_1923 258
955 3300046542 Ga0495597_0103002 Ga0495597_0103002_349_1146 258
956 3300046558 Ga0495633_0014552 Ga0495633_0014552_819_1595 258
957 3300046558 Ga0495633_0081037 Ga0495633_0081037_456_1232 258
958 3300046558 Ga0495633_0163417 Ga0495633_0163417_196_996 258
959 3300046616 Ga0495668_0002936 Ga0495668_0002936_435_1232 258
960 3300046660 Ga0495625_0001444 Ga0495625_0001444_12138_12935 258
961 3300046660 Ga0495625_0224084 Ga0495625_0224084_326_1102 258
962 3300046692 Ga0495671_0085144 Ga0495671_0085144_158_934 258
963 3300046810 Ga0495660_0080247 Ga0495660_0080247_389_1186 258
964 3300047320 Ga0495672_0058787 Ga0495672_0058787_993_1790 258
965 3300047323 Ga0495683_0100170 Ga0495683_0100170_143_919 258
966 3300047443 Ga0495687_045326 Ga0495687_045326_790_1566 258
967 3300047443 Ga0495687_085869 Ga0495687_085869_250_1026 258
968 3300047447 Ga0495685_041743 Ga0495685_041743_212_988 258
969 3300048905 Ga0496102_0189529 Ga0496102_0189529_485_1261 258
970 3300048907 Ga0496104_0177728 Ga0496104_0177728_1121_1921 258
971 3300048909 Ga0496106_0000912 Ga0496106_0000912_4546_5322 258
972 3300048910 Ga0496107_0445023 Ga0496107_0445023_164_940 258
973 3300048916 Ga0496113_0194609 Ga0496113_0194609_201_1001 258
974 3300048919 Ga0496116_0001841 Ga0496116_0001841_21933_22730 258
975 3300048919 Ga0496116_0002642 Ga0496116_0002642_9757_10563 258
976 3300048919 Ga0496116_0022408 Ga0496116_0022408_3409_4185 258
977 3300048919 Ga0496116_0026286 Ga0496116_0026286_3366_4142 258
978 3300048919 Ga0496116_0044309 Ga0496116_0044309_428_1213 258
979 3300048919 Ga0496116_0055957 Ga0496116_0055957_489_1289 258
980 3300048919 Ga0496116_0064080 Ga0496116_0064080_200_1006 258
981 3300048919 Ga0496116_0084830 Ga0496116_0084830_884_1690 258
982 3300048919 Ga0496116_0108639 Ga0496116_0108639_275_1081 258
983 3300048919 Ga0496116_0160653 Ga0496116_0160653_224_1000 258
984 3300048920 Ga0496117_0000002 Ga0496117_0000002_1934151_1934951 258
985 3300048920 Ga0496117_0002297 Ga0496117_0002297_16660_17436 258
986 3300048920 Ga0496117_0006068 Ga0496117_0006068_11042_11839 258
987 3300048920 Ga0496117_0148187 Ga0496117_0148187_317_1102 258
988 3300048920 Ga0496117_0159038 Ga0496117_0159038_41_841 258
989 3300048920 Ga0496117_0191029 Ga0496117_0191029_93_884 258
990 3300048921 Ga0496118_0000233 Ga0496118_0000233_75153_75953 258
991 3300048921 Ga0496118_0001988 Ga0496118_0001988_13728_14504 258
992 3300048921 Ga0496118_0033033 Ga0496118_0033033_433_1209 258
993 3300048921 Ga0496118_0034316 Ga0496118_0034316_2732_3529 258
994 3300048921 Ga0496118_0093832 Ga0496118_0093832_290_1066 258
995 3300048922 Ga0496119_0015134 Ga0496119_0015134_1801_2577 258
996 3300048922 Ga0496119_0034935 Ga0496119_0034935_957_1757 258
997 3300048922 Ga0496119_0038975 Ga0496119_0038975_461_1261 258
998 3300048922 Ga0496119_0055869 Ga0496119_0055869_1327_2103 258
999 3300048923 Ga0496120_0000021 Ga0496120_0000021_131624_132424 258
1000 3300048923 Ga0496120_0023198 Ga0496120_0023198_1214_1990 258
1001 3300048924 Ga0496121_0000001 Ga0496121_0000001_536960_537751 258
1002 3300048924 Ga0496121_0003778 Ga0496121_0003778_13685_14461 258
1003 3300048924 Ga0496121_0009317 Ga0496121_0009317_148_945 258
1004 3300048924 Ga0496121_0027647 Ga0496121_0027647_1541_2317 258
1005 3300048924 Ga0496121_0041822 Ga0496121_0041822_1235_2041 258
1006 3300048924 Ga0496121_0120880 Ga0496121_0120880_995_1771 258
1007 3300048924 Ga0496121_0150076 Ga0496121_0150076_858_1634 258
1008 3300048924 Ga0496121_0237434 Ga0496121_0237434_287_1072 258
1009 3300048925 Ga0496122_0000001 Ga0496122_0000001_1304941_1305741 258
1010 3300048925 Ga0496122_0000247 Ga0496122_0000247_99753_100559 258
1011 3300048925 Ga0496122_0007204 Ga0496122_0007204_305_1102 258
1012 3300048925 Ga0496122_0027734 Ga0496122_0027734_408_1184 258
1013 3300048925 Ga0496122_0030322 Ga0496122_0030322_3428_4234 258
1014 3300048925 Ga0496122_0031911 Ga0496122_0031911_1769_2545 258
1015 3300048925 Ga0496122_0071891 Ga0496122_0071891_1361_2146 258
1016 3300048925 Ga0496122_0163531 Ga0496122_0163531_125_901 258
1017 3300048926 Ga0496123_0000001 Ga0496123_0000001_1308672_1309472 258
1018 3300048926 Ga0496123_0000222 Ga0496123_0000222_99414_100220 258
1019 3300048926 Ga0496123_0017248 Ga0496123_0017248_200_997 258
1020 3300048926 Ga0496123_0028989 Ga0496123_0028989_435_1211 258
1021 3300048926 Ga0496123_0095500 Ga0496123_0095500_893_1684 258
1022 3300048926 Ga0496123_0095833 Ga0496123_0095833_393_1169 258
1023 3300048926 Ga0496123_0105073 Ga0496123_0105073_626_1420 258
1024 3300048926 Ga0496123_0188965 Ga0496123_0188965_99_884 258
1025 3300048927 Ga0496124_0000592 Ga0496124_0000592_15154_15960 258
1026 3300048927 Ga0496124_0002069 Ga0496124_0002069_8649_9434 258
1027 3300048927 Ga0496124_0004006 Ga0496124_0004006_5290_6090 258
1028 3300048927 Ga0496124_0045313 Ga0496124_0045313_1587_2384 258
1029 3300048927 Ga0496124_0068688 Ga0496124_0068688_1851_2627 258
1030 3300048927 Ga0496124_0101742 Ga0496124_0101742_1387_2181 258
1031 3300048927 Ga0496124_0110214 Ga0496124_0110214_70_846 258
1032 3300048927 Ga0496124_0113414 Ga0496124_0113414_796_1572 258
1033 3300048927 Ga0496124_0232644 Ga0496124_0232644_190_996 258
1034 3300048927 Ga0496124_0388177 Ga0496124_0388177_113_904 258
1035 3300048927 Ga0496124_0388213 Ga0496124_0388213_113_904 258
1036 3300048928 Ga0496125_0000001 Ga0496125_0000001_649043_649834 258
1037 3300048928 Ga0496125_0000557 Ga0496125_0000557_14978_15784 258
1038 3300048928 Ga0496125_0002964 Ga0496125_0002964_9453_10250 258
1039 3300048928 Ga0496125_0028713 Ga0496125_0028713_674_1450 258
1040 3300048928 Ga0496125_0123285 Ga0496125_0123285_943_1743 258
1041 3300048929 Ga0496126_0000438 Ga0496126_0000438_37202_38008 258
1042 3300048929 Ga0496126_0033716 Ga0496126_0033716_3629_4426 258
1043 3300048929 Ga0496126_0322360 Ga0496126_0322360_75_875 258
1044 3300048929 Ga0496126_0430874 Ga0496126_0430874_163_939 258
1045 3300048929 Ga0496126_0493741 Ga0496126_0493741_193_969 258
1046 3300049459 Ga0495678_024016 Ga0495678_024016_167_964 258
1047 3300049459 Ga0495678_057422 Ga0495678_057422_188_964 258
1048 3300049460 Ga0495682_0056764 Ga0495682_0056764_208_1005 258
1049 3300049569 Ga0501032_0089354 Ga0501032_0089354_466_1242 258
1050 3300049571 Ga0501034_0020260 Ga0501034_0020260_2612_3403 258
1051 3300049579 Ga0501043_0188005 Ga0501043_0188005_178_954 258
1052 3300049580 Ga0501046_0407173 Ga0501046_0407173_162_938 258
1053 3300049581 Ga0501047_0301289 Ga0501047_0301289_580_1356 258
1054 3300049583 Ga0501067_0139334 Ga0501067_0139334_57_833 258
1055 3300049588 Ga0501072_0367681 Ga0501072_0367681_294_1070 258
1056 3300049823 Ga0501044_0330327 Ga0501044_0330327_224_1000 258
1057 3300050490 nmdc:mga03n38_281521_c1 nmdc:mga03n38_281521_c1_38_838 258
1058 3300050491 nmdc:mga00v17_72_c1 nmdc:mga00v17_72_c1_68_868 258
1059 3300050491 nmdc:mga00v17_81455_c1 nmdc:mga00v17_81455_c1_309_1100 258
1060 3300050491 nmdc:mga00v17_91675_c1 nmdc:mga00v17_91675_c1_1013_1813 258
1061 3300050491 nmdc:mga00v17_92_c1 nmdc:mga00v17_92_c1_44599_45417 258
1062 3300050492 nmdc:mga0yw44_169441_c1 nmdc:mga0yw44_169441_c1_356_1138 258
1063 3300050492 nmdc:mga0yw44_201641_c1 nmdc:mga0yw44_201641_c1_465_1265 258
1064 3300050492 nmdc:mga0yw44_4716_c1 nmdc:mga0yw44_4716_c1_1749_2549 258
1065 3300050516 nmdc:mga0sz30_107529_c1 nmdc:mga0sz30_107529_c1_134_934 258
1066 3300053079 Ga0500610_0078634 Ga0500610_0078634_277_1074 258
1067 3300053086 Ga0500578_0090956 Ga0500578_0090956_951_1727 258
1068 3300053107 Ga0500560_010826 Ga0500560_010826_248_1048 258
1069 3300053118 Ga0500594_0003405 Ga0500594_0003405_2423_3220 258
1070 3300053125 Ga0500618_005292 Ga0500618_005292_157_933 258
1071 3300053129 Ga0500628_006907 Ga0500628_006907_798_1574 258
1072 3300053130 Ga0500642_0085535 Ga0500642_0085535_325_1122 258
1073 3300053134 Ga0500658_0046732 Ga0500658_0046732_762_1538 258
1074 3300053137 Ga0500561_0003433 Ga0500561_0003433_749_1549 258
1075 3300053139 Ga0500568_0002068 Ga0500568_0002068_9245_10042 258
1076 3300053139 Ga0500568_0011657 Ga0500568_0011657_421_1197 258
1077 3300053151 Ga0500604_0026364 Ga0500604_0026364_364_1146 258
1078 3300053153 Ga0500616_0003108 Ga0500616_0003108_5054_5851 258
1079 3300053153 Ga0500616_0062258 Ga0500616_0062258_122_898 258
1080 3300053156 Ga0500622_0000342 Ga0500622_0000342_36685_37461 258
1081 3300053157 Ga0500624_000370 Ga0500624_000370_9262_10062 258
1082 3300053158 Ga0500627_0144869 Ga0500627_0144869_153_950 258
1083 3300053161 Ga0500634_0009996 Ga0500634_0009996_806_1615 258
1084 3300053177 Ga0500636_0001609 Ga0500636_0001609_3854_4648 258
1085 3300060353 Ga0501082_0136746 Ga0501082_0136746_1101_1877 258
1086 iso_pu_bacteria 2582581304 2585257066 258
1087 iso_pu_bacteria 2585427594 2585844509 258
1088 iso_pu_bacteria 2643221599 2644007478 258
1089 iso_pu_bacteria 2738541293 2738803694 258
1090 iso_pu_bacteria 2775507049 2776912283 258
1091 iso_pu_bacteria 2842922631 2842923478 258
1092 iso_pu_bacteria 2844163670 2844170604 258
1093 iso_pu_bacteria 2941499720 2941500578 258
1094 iso_pu_bacteria 8055431914 8055433354 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

39

209

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozv-assembly1.cif.gz_A crystal structure of a predicted o-methyltransferase, protein atu636 from agrobacterium tumefaciens. 0.9846 32 257
2ozv-assembly1.cif.gz_A crystal structure of a predicted o-methyltransferase, protein atu636 from agrobacterium tumefaciens. 0.9659 32 257
3lpm-assembly1.cif.gz_B crystal structure of putative methyltransferase small domain protein from listeria monocytogenes 0.8824 1 250
7wm5-assembly1.cif.gz_A-2 crystal structure of apo trmm from mycoplasma capricolum 0.8822 30 249
3lpm-assembly1.cif.gz_B crystal structure of putative methyltransferase small domain protein from listeria monocytogenes 0.8714 1 250
ID Description Score Start End Superfamily
2ozvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9813 34 249 3.40.50.150
2ozvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9661 34 249 3.40.50.150
af_Q67VB2_1_103_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9205 46 103 3.40.50.150
3lpmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8987 7 250 3.40.50.150
3lpmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8908 7 250 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A349XXR1-F1-model_v4 Methyltransferase 0.9962 162 258 GO:0008168
GO:0032259
AF-D7H1X2-F1-model_v4 deleted 0.974 54 253
AF-D6LMM7-F1-model_v4 deleted 0.9739 32 254
AF-A0A7Z1USI1-F1-model_v4 deleted 0.9737 35 254
AF-A0A7I0JQL3-F1-model_v4 Methyltransferase 0.972 160 253 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
87.53 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map