F489946
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1094 | 804 | 529 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0009816|Ga0495638_0009816_1653_2537 |
| Length | 294 |
| Sequence | VQAEEAKPEQATVTETVDAFHFGEFHIVQPRGRGHRSGMDAMLLAALVAGKGPMRVADLGAXXXXAGMAVASRIEGADVVLIERSAEMTEYARKSIDHAGNIRIAPRLSLVKADVTLKGKARIAAGLEDDVFDHVIMNPPFNDAGDRRAPDDLKAEAHAMDGDIFEDWIRTAGAILRPGGQLSLIARPESVADIIMACGRRFGGIEITMLHAREGESAIRLLATAIKGSRARLIFRAPLFMHGPFLDGEGSHRFLPFIDDLNNGRAAYPRLGKTRKTTAASARKSESIFGKHDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 15 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 18 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 19 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 20 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 21 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 22 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 23 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 24 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 25 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 26 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 27 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 28 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 29 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 30 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 31 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 32 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 33 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 34 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 35 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 36 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 37 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 38 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 39 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 40 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 41 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 42 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 43 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 44 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 45 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 46 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 47 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 48 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 49 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 50 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 51 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 52 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 53 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 54 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 55 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 56 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 57 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 58 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 59 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 60 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 61 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 62 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 63 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 64 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 65 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 66 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 67 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 68 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 69 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 70 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 71 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 72 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 73 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 74 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 75 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 76 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 77 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 78 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 79 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 80 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 81 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 82 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 83 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 84 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 85 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 86 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 87 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 88 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 89 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 90 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 91 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 92 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 93 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 94 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 95 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 96 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 97 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 98 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 99 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 100 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 101 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 102 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 103 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 104 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 105 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 106 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 107 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 108 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 109 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 110 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 111 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 112 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 113 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 114 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 115 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 116 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 117 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 118 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 119 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 120 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 121 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 122 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 123 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 124 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 125 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 126 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 127 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 128 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 129 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 130 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 131 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 132 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 133 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 134 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 135 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 136 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 137 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 138 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 139 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 140 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 141 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 142 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 143 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 144 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 145 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 146 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 147 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 148 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 149 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 150 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 151 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 152 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 153 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 154 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 155 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 156 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 157 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 158 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 159 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 160 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 161 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 162 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 163 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 164 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 165 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 166 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 167 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 168 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 169 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 170 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 171 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 172 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 173 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 174 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 175 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 176 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 177 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 178 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 179 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 180 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 181 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 182 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 183 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 184 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 185 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 186 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 187 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 188 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 189 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 190 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 191 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 192 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 193 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 194 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 195 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 196 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 197 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 198 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 199 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 200 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 201 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 202 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 203 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 204 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 205 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 206 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 207 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 208 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 209 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 210 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 211 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 212 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 213 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 214 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 215 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 216 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 217 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 218 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 219 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 220 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 221 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 222 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 223 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 224 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 225 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 226 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 227 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 228 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 229 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 230 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 231 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 232 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 233 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 234 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 235 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 236 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 237 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 238 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 239 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 240 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 241 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 242 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 243 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 244 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 245 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 246 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 247 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 248 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 249 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 250 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 251 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 252 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 253 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 254 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 255 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 256 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 257 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 258 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 259 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 260 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 261 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 262 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 263 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 264 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 265 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 266 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 267 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 268 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 269 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 270 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 271 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 272 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 273 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 274 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 275 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 276 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 277 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 278 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 279 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 280 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 281 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 282 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 283 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 284 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 285 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 286 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 287 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 288 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 289 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 290 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 291 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 292 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 293 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 294 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 295 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 296 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 297 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 298 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 299 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 300 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 301 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 302 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 303 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 304 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 305 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 306 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 307 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 308 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 309 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 310 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 311 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 312 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 313 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 314 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 315 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 316 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 317 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 318 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 319 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 320 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 321 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 322 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 323 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 324 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 325 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 326 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 327 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 328 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 329 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 330 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 331 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 332 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 333 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 334 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 335 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 336 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 337 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 338 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 339 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 340 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 341 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 342 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 343 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 344 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 345 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 346 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 347 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 348 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 349 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 350 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 351 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 352 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 353 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 354 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 355 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 356 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 357 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 358 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 359 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 360 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 361 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 362 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 363 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 364 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 365 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 366 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 367 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 368 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 369 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 370 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 371 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 372 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 373 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 374 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 375 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 376 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 377 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 378 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 379 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 380 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 381 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 382 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 383 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 384 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 385 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 386 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 387 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 388 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 389 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 390 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 391 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 392 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 393 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 394 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 395 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 396 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 397 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 398 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 399 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 400 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 401 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 402 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 403 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 404 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 405 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 406 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 407 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 408 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 409 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 410 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 411 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 412 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 413 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 414 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 415 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 416 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 417 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 418 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 419 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 420 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 421 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 422 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 423 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 424 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 425 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 426 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 427 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 428 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 429 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 430 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 431 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 432 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 433 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 434 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 435 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 436 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 437 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 438 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 439 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 440 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 441 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 442 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 443 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 444 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 445 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 446 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 447 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 448 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 449 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 450 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 451 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 452 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 453 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 454 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 455 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 456 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 457 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 458 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 459 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 460 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 461 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 462 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 463 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 464 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 465 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 466 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 467 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 468 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 469 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 470 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 471 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 472 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 473 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 474 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 475 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 476 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 477 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 478 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 479 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 480 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 481 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 482 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 483 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 484 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 485 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 486 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 487 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 488 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 489 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 490 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 491 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 492 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 493 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 494 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 495 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 496 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 497 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 498 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 499 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 500 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 501 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 502 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 503 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 504 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 505 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 506 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 507 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 508 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 509 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 510 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 511 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 512 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 513 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 514 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 515 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 516 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 517 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 518 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 519 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 520 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 521 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 522 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 523 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 524 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 525 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 526 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 527 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 528 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 529 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 530 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 531 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 532 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 533 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 534 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 535 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 536 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 537 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 538 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 539 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 540 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 541 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 542 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 543 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 544 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 545 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 546 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 547 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 548 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 549 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 550 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 551 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 552 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 553 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 554 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 555 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 556 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 557 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 558 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 559 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 560 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 561 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 562 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 563 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 564 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 565 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 566 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 567 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 568 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 569 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 570 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 571 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 572 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 573 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 574 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 575 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 576 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 577 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 578 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 579 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 580 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 581 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 582 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 583 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 584 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 585 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 586 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 587 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 588 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 589 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 590 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 591 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 592 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 593 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 594 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 595 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 596 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 597 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 598 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 599 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 600 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 601 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 602 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 603 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 604 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 605 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 606 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 607 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 608 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 609 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 610 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 618 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 620 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 622 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 623 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 624 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 625 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 626 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 627 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 628 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 629 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 630 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 631 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 632 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 633 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 634 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 635 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 636 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 637 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 638 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 639 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 640 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 641 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 642 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 643 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 644 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 645 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 646 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 647 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 648 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 685 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 686 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 687 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 688 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 689 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 690 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 691 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 692 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 693 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 694 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 695 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 696 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 697 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 698 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 699 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 700 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 701 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 704 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 705 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 706 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 707 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 708 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 709 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 710 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 711 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 712 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 713 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 714 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 715 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 716 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 717 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 718 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 719 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 720 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 721 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 722 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 723 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 724 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 725 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 726 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 727 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 728 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 729 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 730 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 731 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 732 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 734 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 735 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 736 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 737 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 738 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 739 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 740 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 741 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 742 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 743 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 744 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 745 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 746 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 747 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 748 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 749 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 750 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 751 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 752 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 753 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 754 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 755 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 756 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 757 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 758 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 759 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 760 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 761 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 762 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 763 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 764 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 765 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 766 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 767 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 768 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 769 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 770 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 771 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 772 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 773 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 774 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 775 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 776 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 777 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 778 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 779 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 780 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 781 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 782 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 783 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 784 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 785 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 786 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 787 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 788 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 789 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 790 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 791 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 792 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 793 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 794 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 795 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 796 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 797 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 798 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 799 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 800 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 801 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 802 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 803 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 804 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 48.26 |
| Metatranscriptomes | 0.09 |
| Isolates | 51.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.46 |
| Bulb | 0 |
| Endosphere | 17.46 |
| Nodule | 41.22 |
| Rhizoplane | 1.37 |
| Rhizosphere | 21.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000006 | 3300002704 | Bacteria | 244109 |
| 2 | JGI25156J39149_1000019 | 3300002705 | Bacteria | 160845 |
| 3 | JGI25162J39368_1001875 | 3300002737 | Bacteria | 9673 |
| 4 | JGI25162J39368_1002018 | 3300002737 | Bacteria | 9003 |
| 5 | JGI25154J39366_1000365 | 3300002738 | Bacteria | 25282 |
| 6 | JGI25157J39369_1000024 | 3300002741 | Bacteria | 160844 |
| 7 | JGI25152J39213_1001364 | 3300002773 | Bacteria | 10668 |
| 8 | JGI25152J39213_1001530 | 3300002773 | Bacteria | 9828 |
| 9 | JGI25152J39213_1015277 | 3300002773 | Bacteria | 1519 |
| 10 | JGI25152J39213_1016284 | 3300002773 | Bacteria | 1439 |
| 11 | JGI25150J39212_1000042 | 3300002774 | Bacteria | 84513 |
| 12 | JGI25159J45721_1000021 | 3300002987 | Bacteria | 119754 |
| 13 | JGI25151J46595_10000099 | 3300003187 | Bacteria | 117428 |
| 14 | JGI25151J46595_10001860 | 3300003187 | Bacteria | 13545 |
| 15 | JGI25151J46595_10009087 | 3300003187 | Bacteria | 4734 |
| 16 | JGI25165J46597_1001938 | 3300003214 | Bacteria | 8158 |
| 17 | JGI25165J46597_1002939 | 3300003214 | Bacteria | 4777 |
| 18 | JGI25165J46597_1004195 | 3300003214 | Bacteria | 3185 |
| 19 | JGI25153J46596_10000761 | 3300003215 | Bacteria | 19707 |
| 20 | JGI25153J46596_10049148 | 3300003215 | Bacteria | 1226 |
| 21 | JGI25153J46596_10051263 | 3300003215 | Bacteria | 1183 |
| 22 | rootH1_10044780 | 3300003316 | Bacteria | 1651 |
| 23 | rootH1_10104610 | 3300003316 | Bacteria | 1593 |
| 24 | rootH2_10120526 | 3300003320 | Bacteria | 2003 |
| 25 | rootH2_10256542 | 3300003320 | Bacteria | 1589 |
| 26 | rootL2_10115041 | 3300003322 | Bacteria | 3629 |
| 27 | rootH1_10035118 | 3300003323 | Bacteria | 3269 |
| 28 | rootH1_10105424 | 3300003323 | Bacteria | 1715 |
| 29 | rootH1_10178534 | 3300003323 | Bacteria | 1068 |
| 30 | rootH1_10209197 | 3300003323 | Bacteria | 1041 |
| 31 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 32 | JGI25160J50197_1000261 | 3300003354 | Bacteria | 39695 |
| 33 | JGI25160J50197_1001976 | 3300003354 | Bacteria | 9776 |
| 34 | JGI25160J50197_1008147 | 3300003354 | Bacteria | 4022 |
| 35 | JGI25160J50197_1031131 | 3300003354 | Bacteria | 1379 |
| 36 | JGI25161J50226_1000195 | 3300003374 | Bacteria | 39695 |
| 37 | JGI25161J50226_1001106 | 3300003374 | Bacteria | 9087 |
| 38 | JGI25161J50226_1001515 | 3300003374 | Bacteria | 6868 |
| 39 | Ga0055526_1001512 | 3300003771 | Bacteria | 16479 |
| 40 | Ga0055526_1010009 | 3300003771 | Bacteria | 4473 |
| 41 | Ga0055526_1019591 | 3300003771 | Bacteria | 2458 |
| 42 | Ga0055526_1025637 | 3300003771 | Bacteria | 1885 |
| 43 | Ga0055524_1001469 | 3300003775 | Bacteria | 13450 |
| 44 | Ga0055524_1004697 | 3300003775 | Bacteria | 6261 |
| 45 | Ga0055524_1010290 | 3300003775 | Bacteria | 3736 |
| 46 | Ga0055524_1022698 | 3300003775 | Bacteria | 2042 |
| 47 | Ga0055524_1025794 | 3300003775 | Bacteria | 1832 |
| 48 | Ga0055524_1031336 | 3300003775 | Bacteria | 1531 |
| 49 | Ga0055536_1011977 | 3300003781 | Bacteria | 3263 |
| 50 | Ga0055528_1000263 | 3300003790 | Bacteria | 44623 |
| 51 | Ga0055528_1007710 | 3300003790 | Bacteria | 4718 |
| 52 | Ga0055528_1010543 | 3300003790 | Bacteria | 3748 |
| 53 | Ga0055528_1011212 | 3300003790 | Bacteria | 3581 |
| 54 | Ga0055528_1016523 | 3300003790 | Bacteria | 2604 |
| 55 | Ga0055540_1035773 | 3300003792 | Bacteria | 1107 |
| 56 | Ga0055531_10007471 | 3300003794 | Bacteria | 5956 |
| 57 | Ga0058692_1005505 | 3300003856 | Bacteria | 3604 |
| 58 | Ga0058692_1006931 | 3300003856 | Bacteria | 3055 |
| 59 | Ga0055543_1000010 | 3300004625 | Bacteria | 198371 |
| 60 | Ga0055543_1000215 | 3300004625 | Bacteria | 46312 |
| 61 | Ga0055543_1000358 | 3300004625 | Bacteria | 30677 |
| 62 | Ga0055543_1000923 | 3300004625 | Bacteria | 13689 |
| 63 | Ga0065165_1000004 | 3300005262 | Bacteria | 377081 |
| 64 | Ga0065165_1002152 | 3300005262 | Bacteria | 17826 |
| 65 | Ga0065165_1009542 | 3300005262 | Bacteria | 4334 |
| 66 | Ga0065165_1012112 | 3300005262 | Bacteria | 3534 |
| 67 | Ga0065165_1027611 | 3300005262 | Bacteria | 1846 |
| 68 | Ga0065165_1035815 | 3300005262 | Bacteria | 1520 |
| 69 | Ga0070670_100000811 | 3300005331 | Bacteria | 24347 |
| 70 | Ga0070666_10013250 | 3300005335 | Bacteria | 5228 |
| 71 | Ga0070671_100024251 | 3300005355 | Bacteria | 4965 |
| 72 | Ga0070667_100456539 | 3300005367 | Bacteria | 1168 |
| 73 | Ga0070665_100050865 | 3300005548 | Bacteria | 4158 |
| 74 | Ga0070665_100053285 | 3300005548 | Bacteria | 4057 |
| 75 | Ga0070665_100189572 | 3300005548 | Bacteria | 2057 |
| 76 | Ga0068855_100154182 | 3300005563 | Bacteria | 2611 |
| 77 | Ga0068856_100162434 | 3300005614 | Bacteria | 2245 |
| 78 | Ga0068852_100026503 | 3300005616 | Bacteria | 4713 |
| 79 | Ga0081455_10084454 | 3300005937 | Bacteria | 2591 |
| 80 | Ga0075365_10000341 | 3300006038 | Bacteria | 16645 |
| 81 | Ga0075365_10067790 | 3300006038 | Bacteria | 2396 |
| 82 | Ga0075365_10113509 | 3300006038 | Bacteria | 1864 |
| 83 | Ga0075363_100147911 | 3300006048 | Bacteria | 1325 |
| 84 | Ga0075364_10087839 | 3300006051 | Bacteria | 2061 |
| 85 | Ga0075362_10007439 | 3300006177 | Bacteria | 4148 |
| 86 | Ga0075367_10017298 | 3300006178 | Bacteria | 3955 |
| 87 | Ga0075367_10042032 | 3300006178 | Bacteria | 2673 |
| 88 | Ga0075369_10001103 | 3300006186 | Bacteria | 9069 |
| 89 | Ga0075369_10019551 | 3300006186 | Bacteria | 2766 |
| 90 | Ga0075366_10003971 | 3300006195 | Bacteria | 7897 |
| 91 | Ga0075370_10016276 | 3300006353 | Bacteria | 4000 |
| 92 | Ga0079104_1000210 | 3300006946 | Bacteria | 81817 |
| 93 | Ga0099826_10003316 | 3300006948 | Bacteria | 10869 |
| 94 | Ga0105251_10020730 | 3300009011 | Bacteria | 3448 |
| 95 | Ga0105244_10110060 | 3300009036 | Bacteria | 1341 |
| 96 | Ga0105250_10019885 | 3300009092 | Bacteria | 2715 |
| 97 | Ga0105240_10000027 | 3300009093 | Bacteria | 348486 |
| 98 | Ga0105243_10091152 | 3300009148 | Bacteria | 2510 |
| 99 | Ga0105237_10000508 | 3300009545 | Bacteria | 54970 |
| 100 | Ga0123340_1046711 | 3300009763 | Bacteria | 1739 |
| 101 | Ga0123340_1046783 | 3300009763 | Bacteria | 1735 |
| 102 | Ga0123341_1000027 | 3300009765 | Bacteria | 69241 |
| 103 | Ga0123341_1049686 | 3300009765 | Bacteria | 2405 |
| 104 | Ga0123341_1050067 | 3300009765 | Bacteria | 2384 |
| 105 | Ga0123342_1023186 | 3300009766 | Bacteria | 4075 |
| 106 | Ga0105239_10002593 | 3300010375 | Bacteria | 22866 |
| 107 | Ga0105239_10320270 | 3300010375 | Bacteria | 1748 |
| 108 | Ga0105246_10096120 | 3300011119 | Bacteria | 2146 |
| 109 | Ga0157373_10014166 | 3300013100 | Bacteria | 5847 |
| 110 | Ga0157371_10000058 | 3300013102 | Bacteria | 171756 |
| 111 | Ga0157370_10000048 | 3300013104 | Bacteria | 124683 |
| 112 | Ga0157370_10000792 | 3300013104 | Bacteria | 39754 |
| 113 | Ga0157369_10185945 | 3300013105 | Bacteria | 2185 |
| 114 | Ga0157369_10326090 | 3300013105 | Bacteria | 1596 |
| 115 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 116 | Ga0163163_10405133 | 3300014325 | Bacteria | 1422 |
| 117 | Ga0182007_10001900 | 3300015262 | Bacteria | 10892 |
| 118 | Ga0183363_1067 | 3300015690 | Bacteria | 32305 |
| 119 | Ga0214544_1000008 | 3300021320 | Bacteria | 326027 |
| 120 | Ga0214542_1000010 | 3300021321 | Bacteria | 262816 |
| 121 | Ga0214542_1029774 | 3300021321 | Bacteria | 2195 |
| 122 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 123 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 124 | Ga0228710_1000031 | 3300022740 | Bacteria | 95534 |
| 125 | Ga0209435_100011 | 3300025206 | Bacteria | 413027 |
| 126 | Ga0209436_102216 | 3300025208 | Bacteria | 6038 |
| 127 | Ga0209563_101762 | 3300025230 | Bacteria | 5444 |
| 128 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 129 | Ga0209437_100086 | 3300025233 | Bacteria | 254578 |
| 130 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 131 | Ga0207425_1004757 | 3300025245 | Bacteria | 3999 |
| 132 | Ga0207425_1010289 | 3300025245 | Bacteria | 2283 |
| 133 | Ga0207425_1028887 | 3300025245 | Bacteria | 1121 |
| 134 | Ga0209646_1000024 | 3300025246 | Bacteria | 413027 |
| 135 | Ga0209026_1000030 | 3300025250 | Bacteria | 329811 |
| 136 | Ga0209677_100177 | 3300025253 | Bacteria | 54158 |
| 137 | Ga0209148_1009921 | 3300025254 | Bacteria | 1828 |
| 138 | Ga0209759_1000011 | 3300025256 | Bacteria | 413027 |
| 139 | Ga0209129_1000086 | 3300025258 | Bacteria | 181543 |
| 140 | Ga0209129_1000965 | 3300025258 | Bacteria | 17284 |
| 141 | Ga0209129_1001065 | 3300025258 | Bacteria | 16216 |
| 142 | Ga0209129_1001501 | 3300025258 | Bacteria | 12969 |
| 143 | Ga0209129_1003602 | 3300025258 | Bacteria | 6626 |
| 144 | Ga0209129_1003829 | 3300025258 | Bacteria | 6284 |
| 145 | Ga0209129_1013324 | 3300025258 | Bacteria | 1819 |
| 146 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 147 | Ga0209233_1000110 | 3300025261 | Bacteria | 260825 |
| 148 | Ga0209233_1000640 | 3300025261 | Bacteria | 17399 |
| 149 | Ga0209565_1017396 | 3300025263 | Bacteria | 1577 |
| 150 | Ga0209455_1003068 | 3300025272 | Bacteria | 6101 |
| 151 | Ga0209673_1000091 | 3300025273 | Bacteria | 201875 |
| 152 | Ga0209673_1000122 | 3300025273 | Bacteria | 170443 |
| 153 | Ga0209673_1001847 | 3300025273 | Bacteria | 17281 |
| 154 | Ga0209673_1002257 | 3300025273 | Bacteria | 13890 |
| 155 | Ga0209673_1003203 | 3300025273 | Bacteria | 9917 |
| 156 | Ga0209673_1003816 | 3300025273 | Bacteria | 8536 |
| 157 | Ga0209673_1007275 | 3300025273 | Bacteria | 5141 |
| 158 | Ga0209673_1027782 | 3300025273 | Bacteria | 1834 |
| 159 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 160 | Ga0209130_1000013 | 3300025284 | Bacteria | 412810 |
| 161 | Ga0209130_1000015 | 3300025284 | Bacteria | 409631 |
| 162 | Ga0209130_1006718 | 3300025284 | Bacteria | 3683 |
| 163 | Ga0209675_1011574 | 3300025291 | Bacteria | 2917 |
| 164 | Ga0209676_1007603 | 3300025292 | Bacteria | 5035 |
| 165 | Ga0209676_1023318 | 3300025292 | Bacteria | 2028 |
| 166 | Ga0209676_1044134 | 3300025292 | Bacteria | 1225 |
| 167 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 168 | Ga0209025_1000118 | 3300025294 | Bacteria | 214009 |
| 169 | Ga0209025_1000425 | 3300025294 | Bacteria | 83943 |
| 170 | Ga0209025_1000549 | 3300025294 | Bacteria | 70203 |
| 171 | Ga0209025_1002239 | 3300025294 | Bacteria | 21292 |
| 172 | Ga0209025_1003170 | 3300025294 | Bacteria | 15999 |
| 173 | Ga0209025_1005506 | 3300025294 | Bacteria | 10292 |
| 174 | Ga0209025_1009578 | 3300025294 | Bacteria | 6721 |
| 175 | Ga0209025_1029753 | 3300025294 | Bacteria | 2633 |
| 176 | Ga0209025_1035146 | 3300025294 | Bacteria | 2270 |
| 177 | Ga0209025_1050792 | 3300025294 | Bacteria | 1654 |
| 178 | Ga0209025_1065985 | 3300025294 | Bacteria | 1318 |
| 179 | Ga0209564_1000091 | 3300025295 | Bacteria | 249103 |
| 180 | Ga0209564_1000398 | 3300025295 | Bacteria | 77724 |
| 181 | Ga0209564_1001660 | 3300025295 | Bacteria | 21392 |
| 182 | Ga0209564_1001988 | 3300025295 | Bacteria | 17897 |
| 183 | Ga0209564_1025910 | 3300025295 | Bacteria | 1955 |
| 184 | Ga0209564_1049257 | 3300025295 | Bacteria | 1044 |
| 185 | Ga0209758_1000046 | 3300025297 | Bacteria | 364931 |
| 186 | Ga0209758_1000325 | 3300025297 | Bacteria | 91078 |
| 187 | Ga0209758_1001314 | 3300025297 | Bacteria | 30234 |
| 188 | Ga0209758_1001929 | 3300025297 | Bacteria | 22554 |
| 189 | Ga0209758_1003374 | 3300025297 | Bacteria | 14624 |
| 190 | Ga0209758_1007852 | 3300025297 | Bacteria | 7107 |
| 191 | Ga0209758_1019346 | 3300025297 | Bacteria | 3286 |
| 192 | Ga0209050_1013538 | 3300025298 | Bacteria | 3612 |
| 193 | Ga0209050_1026838 | 3300025298 | Bacteria | 1915 |
| 194 | Ga0209256_1000169 | 3300025299 | Bacteria | 131077 |
| 195 | Ga0209256_1001378 | 3300025299 | Bacteria | 25439 |
| 196 | Ga0209256_1001486 | 3300025299 | Bacteria | 23935 |
| 197 | Ga0209256_1003791 | 3300025299 | Bacteria | 10162 |
| 198 | Ga0209256_1004334 | 3300025299 | Bacteria | 9011 |
| 199 | Ga0209256_1005505 | 3300025299 | Bacteria | 7245 |
| 200 | Ga0209256_1031006 | 3300025299 | Bacteria | 1469 |
| 201 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 202 | Ga0207426_1000063 | 3300025302 | Bacteria | 358920 |
| 203 | Ga0207426_1000081 | 3300025302 | Bacteria | 304502 |
| 204 | Ga0207426_1000144 | 3300025302 | Bacteria | 191590 |
| 205 | Ga0209051_1000205 | 3300025303 | Bacteria | 104781 |
| 206 | Ga0209051_1014627 | 3300025303 | Bacteria | 3650 |
| 207 | Ga0209051_1017189 | 3300025303 | Bacteria | 3240 |
| 208 | Ga0209051_1051502 | 3300025303 | Bacteria | 1368 |
| 209 | Ga0209257_1003359 | 3300025304 | Bacteria | 13832 |
| 210 | Ga0209257_1006311 | 3300025304 | Bacteria | 7727 |
| 211 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 212 | Ga0207671_10000176 | 3300025914 | Bacteria | 98289 |
| 213 | Ga0207650_10017791 | 3300025925 | Bacteria | 4978 |
| 214 | Ga0207644_10042355 | 3300025931 | Bacteria | 3226 |
| 215 | Ga0207667_10468185 | 3300025949 | Bacteria | 1280 |
| 216 | Ga0207668_10031723 | 3300025972 | Bacteria | 3484 |
| 217 | Ga0207702_10120780 | 3300026078 | Bacteria | 2345 |
| 218 | Ga0209281_1000155 | 3300027111 | Bacteria | 164423 |
| 219 | Ga0209281_1000253 | 3300027111 | Bacteria | 105600 |
| 220 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 221 | Ga0209371_1001205 | 3300027312 | Bacteria | 18688 |
| 222 | Ga0209371_1003770 | 3300027312 | Bacteria | 7067 |
| 223 | Ga0209282_1000025 | 3300027666 | Bacteria | 168676 |
| 224 | Ga0209282_1001877 | 3300027666 | Bacteria | 11838 |
| 225 | Ga0268266_10015167 | 3300028379 | Bacteria | 6616 |
| 226 | Ga0268266_10038826 | 3300028379 | Bacteria | 4053 |
| 227 | Ga0268266_10081239 | 3300028379 | Bacteria | 2826 |
| 228 | Ga0268266_10151290 | 3300028379 | Bacteria | 2092 |
| 229 | Ga0307515_10000154 | 3300028794 | Bacteria | 166582 |
| 230 | Ga0307515_10003734 | 3300028794 | Bacteria | 31935 |
| 231 | Ga0307515_10073935 | 3300028794 | Bacteria | 4569 |
| 232 | Ga0307515_10218934 | 3300028794 | Bacteria | 1727 |
| 233 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 234 | Ga0268256_1004527 | 3300030500 | Bacteria | 5739 |
| 235 | Ga0268256_1012512 | 3300030500 | Bacteria | 2621 |
| 236 | Ga0307513_10001432 | 3300031456 | Bacteria | 34296 |
| 237 | Ga0307513_10291229 | 3300031456 | Bacteria | 1404 |
| 238 | Ga0307408_100287610 | 3300031548 | Bacteria | 1371 |
| 239 | Ga0307410_10023710 | 3300031852 | Bacteria | 3821 |
| 240 | Ga0307412_10002253 | 3300031911 | Bacteria | 10684 |
| 241 | Ga0307412_10052489 | 3300031911 | Bacteria | 2700 |
| 242 | Ga0307412_10518148 | 3300031911 | Bacteria | 996 |
| 243 | Ga0315914_1000020 | 3300031967 | Bacteria | 121647 |
| 244 | Ga0307409_100157597 | 3300031995 | Bacteria | 1981 |
| 245 | Ga0307416_100169679 | 3300032002 | Bacteria | 2029 |
| 246 | Ga0307416_100616168 | 3300032002 | Bacteria | 1167 |
| 247 | Ga0315913_1000013 | 3300033430 | Bacteria | 121559 |
| 248 | Ga0315915_1000015 | 3300033464 | Bacteria | 168491 |
| 249 | Ga0373927_0000146 | 3300035695 | Bacteria | 55573 |
| 250 | Ga0373925_0001219 | 3300037068 | Bacteria | 22707 |
| 251 | Ga0395900_0256769 | 3300037418 | Bacteria | 1747 |
| 252 | Ga0395900_0612283 | 3300037418 | Bacteria | 1029 |
| 253 | Ga0395905_0000441 | 3300037471 | Bacteria | 58119 |
| 254 | Ga0395905_0006786 | 3300037471 | Bacteria | 11473 |
| 255 | Ga0395905_0093616 | 3300037471 | Bacteria | 2818 |
| 256 | Ga0395901_0197637 | 3300038443 | Bacteria | 2108 |
| 257 | Ga0395901_0510383 | 3300038443 | Bacteria | 1223 |
| 258 | Ga0439466_0026155 | 3300041411 | Bacteria | 2032 |
| 259 | Ga0439466_0062999 | 3300041411 | Bacteria | 1191 |
| 260 | Ga0439466_0068082 | 3300041411 | Bacteria | 1138 |
| 261 | Ga0439465_0006140 | 3300041413 | Bacteria | 3820 |
| 262 | Ga0451795_0368178 | 3300041456 | Bacteria | 826 |
| 263 | Ga0451837_0118587 | 3300041494 | Bacteria | 1977 |
| 264 | Ga0451845_0963136 | 3300041501 | Bacteria | 1189 |
| 265 | Ga0451846_65766 | 3300041502 | Bacteria | 1998 |
| 266 | Ga0451847_0686743 | 3300041503 | Bacteria | 871 |
| 267 | Ga0451849_0734293 | 3300041505 | Bacteria | 1521 |
| 268 | Ga0451853_1619242 | 3300041512 | Bacteria | 3052 |
| 269 | Ga0439449_0004953 | 3300042007 | Bacteria | 5125 |
| 270 | Ga0439449_0050015 | 3300042007 | Bacteria | 1546 |
| 271 | Ga0450918_016128 | 3300042531 | Bacteria | 1297 |
| 272 | Ga0495629_0011919 | 3300046459 | Bacteria | 6305 |
| 273 | Ga0495638_0009816 | 3300046460 | Bacteria | 6684 |
| 274 | Ga0495638_0018504 | 3300046460 | Bacteria | 4625 |
| 275 | Ga0495638_0044368 | 3300046460 | Bacteria | 2801 |
| 276 | Ga0495638_0228824 | 3300046460 | Bacteria | 1035 |
| 277 | Ga0495651_0245225 | 3300046462 | Bacteria | 1226 |
| 278 | Ga0495605_0001233 | 3300046474 | Bacteria | 17043 |
| 279 | Ga0495664_0077397 | 3300046477 | Bacteria | 1992 |
| 280 | Ga0495585_0013373 | 3300046492 | Bacteria | 4807 |
| 281 | Ga0495596_0075528 | 3300046500 | Bacteria | 1309 |
| 282 | Ga0495607_0138632 | 3300046501 | Bacteria | 1257 |
| 283 | Ga0495583_0099712 | 3300046506 | Bacteria | 1241 |
| 284 | Ga0495606_0000762 | 3300046507 | Bacteria | 49554 |
| 285 | Ga0495606_0015417 | 3300046507 | Bacteria | 5888 |
| 286 | Ga0495606_0093901 | 3300046507 | Bacteria | 1839 |
| 287 | Ga0495616_0133966 | 3300046513 | Bacteria | 1133 |
| 288 | Ga0495631_0001700 | 3300046518 | Bacteria | 13071 |
| 289 | Ga0495631_0108924 | 3300046518 | Bacteria | 1191 |
| 290 | Ga0495632_0051996 | 3300046519 | Bacteria | 2015 |
| 291 | Ga0495643_0022226 | 3300046522 | Bacteria | 3622 |
| 292 | Ga0495648_0035378 | 3300046524 | Bacteria | 3238 |
| 293 | Ga0495654_0054914 | 3300046530 | Bacteria | 1930 |
| 294 | Ga0495640_0085525 | 3300046533 | Bacteria | 2090 |
| 295 | Ga0495609_0090957 | 3300046538 | Bacteria | 1327 |
| 296 | Ga0495609_0182422 | 3300046538 | Bacteria | 883 |
| 297 | Ga0495597_0029144 | 3300046542 | Bacteria | 2522 |
| 298 | Ga0495597_0103002 | 3300046542 | Bacteria | 1202 |
| 299 | Ga0495622_0008297 | 3300046557 | Bacteria | 4812 |
| 300 | Ga0495633_0014552 | 3300046558 | Bacteria | 4108 |
| 301 | Ga0495633_0081037 | 3300046558 | Bacteria | 1510 |
| 302 | Ga0495633_0163417 | 3300046558 | Bacteria | 1027 |
| 303 | Ga0495668_0002936 | 3300046616 | Bacteria | 13453 |
| 304 | Ga0495625_0001444 | 3300046660 | Bacteria | 28890 |
| 305 | Ga0495625_0224084 | 3300046660 | Bacteria | 1230 |
| 306 | Ga0495635_0147235 | 3300046663 | Bacteria | 1603 |
| 307 | Ga0495588_0003056 | 3300046674 | Bacteria | 7239 |
| 308 | Ga0495671_0085144 | 3300046692 | Bacteria | 1549 |
| 309 | Ga0495671_0220420 | 3300046692 | Bacteria | 918 |
| 310 | Ga0495600_0055009 | 3300046809 | Bacteria | 2599 |
| 311 | Ga0495660_0080247 | 3300046810 | Bacteria | 1712 |
| 312 | Ga0495604_0108265 | 3300047317 | Bacteria | 2030 |
| 313 | Ga0495672_0058787 | 3300047320 | Bacteria | 2227 |
| 314 | Ga0495676_0416192 | 3300047321 | Bacteria | 890 |
| 315 | Ga0495683_0100170 | 3300047323 | Bacteria | 1394 |
| 316 | Ga0495687_045326 | 3300047443 | Bacteria | 1905 |
| 317 | Ga0495687_085869 | 3300047443 | Bacteria | 1218 |
| 318 | Ga0495685_041743 | 3300047447 | Bacteria | 1567 |
| 319 | Ga0495681_0001172 | 3300047470 | Bacteria | 19925 |
| 320 | Ga0495686_0004080 | 3300047472 | Bacteria | 12188 |
| 321 | Ga0495686_0013054 | 3300047472 | Bacteria | 5784 |
| 322 | Ga0495686_0196045 | 3300047472 | Bacteria | 1161 |
| 323 | Ga0495686_0285578 | 3300047472 | Bacteria | 916 |
| 324 | Ga0496102_0189529 | 3300048905 | Bacteria | 1937 |
| 325 | Ga0496104_0177728 | 3300048907 | Bacteria | 2039 |
| 326 | Ga0496106_0000912 | 3300048909 | Bacteria | 21488 |
| 327 | Ga0496107_0445023 | 3300048910 | Bacteria | 963 |
| 328 | Ga0496111_0020904 | 3300048914 | Bacteria | 4563 |
| 329 | Ga0496113_0194609 | 3300048916 | Bacteria | 1610 |
| 330 | Ga0496116_0000080 | 3300048919 | Bacteria | 224530 |
| 331 | Ga0496116_0001841 | 3300048919 | Bacteria | 22929 |
| 332 | Ga0496116_0002642 | 3300048919 | Bacteria | 18565 |
| 333 | Ga0496116_0022408 | 3300048919 | Bacteria | 4733 |
| 334 | Ga0496116_0026286 | 3300048919 | Bacteria | 4261 |
| 335 | Ga0496116_0044309 | 3300048919 | Bacteria | 3023 |
| 336 | Ga0496116_0055957 | 3300048919 | Bacteria | 2588 |
| 337 | Ga0496116_0064080 | 3300048919 | Bacteria | 2363 |
| 338 | Ga0496116_0084830 | 3300048919 | Bacteria | 1949 |
| 339 | Ga0496116_0108639 | 3300048919 | Bacteria | 1637 |
| 340 | Ga0496116_0160653 | 3300048919 | Bacteria | 1233 |
| 341 | Ga0496116_0166109 | 3300048919 | Bacteria | 1203 |
| 342 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 343 | Ga0496117_0002297 | 3300048920 | Bacteria | 24621 |
| 344 | Ga0496117_0004972 | 3300048920 | Bacteria | 14264 |
| 345 | Ga0496117_0006068 | 3300048920 | Bacteria | 12398 |
| 346 | Ga0496117_0148187 | 3300048920 | Bacteria | 1393 |
| 347 | Ga0496117_0159038 | 3300048920 | Bacteria | 1326 |
| 348 | Ga0496117_0191029 | 3300048920 | Bacteria | 1166 |
| 349 | Ga0496118_0000233 | 3300048921 | Bacteria | 97731 |
| 350 | Ga0496118_0001988 | 3300048921 | Bacteria | 29035 |
| 351 | Ga0496118_0033033 | 3300048921 | Bacteria | 4253 |
| 352 | Ga0496118_0034316 | 3300048921 | Bacteria | 4142 |
| 353 | Ga0496118_0093832 | 3300048921 | Bacteria | 2054 |
| 354 | Ga0496119_0015134 | 3300048922 | Bacteria | 5970 |
| 355 | Ga0496119_0034935 | 3300048922 | Bacteria | 3300 |
| 356 | Ga0496119_0038975 | 3300048922 | Bacteria | 3060 |
| 357 | Ga0496119_0055869 | 3300048922 | Bacteria | 2395 |
| 358 | Ga0496119_0097245 | 3300048922 | Bacteria | 1660 |
| 359 | Ga0496120_0000021 | 3300048923 | Bacteria | 250966 |
| 360 | Ga0496120_0023198 | 3300048923 | Bacteria | 3887 |
| 361 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 362 | Ga0496121_0003778 | 3300048924 | Bacteria | 21151 |
| 363 | Ga0496121_0009317 | 3300048924 | Bacteria | 11323 |
| 364 | Ga0496121_0012314 | 3300048924 | Bacteria | 9354 |
| 365 | Ga0496121_0027647 | 3300048924 | Bacteria | 5302 |
| 366 | Ga0496121_0039218 | 3300048924 | Bacteria | 4179 |
| 367 | Ga0496121_0041822 | 3300048924 | Bacteria | 3998 |
| 368 | Ga0496121_0120880 | 3300048924 | Bacteria | 1978 |
| 369 | Ga0496121_0150076 | 3300048924 | Bacteria | 1716 |
| 370 | Ga0496121_0191521 | 3300048924 | Bacteria | 1466 |
| 371 | Ga0496121_0237434 | 3300048924 | Bacteria | 1273 |
| 372 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 373 | Ga0496122_0000009 | 3300048925 | Bacteria | 584024 |
| 374 | Ga0496122_0000247 | 3300048925 | Bacteria | 121291 |
| 375 | Ga0496122_0007204 | 3300048925 | Bacteria | 12452 |
| 376 | Ga0496122_0027734 | 3300048925 | Bacteria | 4831 |
| 377 | Ga0496122_0030322 | 3300048925 | Bacteria | 4534 |
| 378 | Ga0496122_0031911 | 3300048925 | Bacteria | 4369 |
| 379 | Ga0496122_0071891 | 3300048925 | Bacteria | 2462 |
| 380 | Ga0496122_0163531 | 3300048925 | Bacteria | 1353 |
| 381 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 382 | Ga0496123_0000020 | 3300048926 | Bacteria | 388748 |
| 383 | Ga0496123_0000222 | 3300048926 | Bacteria | 115482 |
| 384 | Ga0496123_0006783 | 3300048926 | Bacteria | 11002 |
| 385 | Ga0496123_0017248 | 3300048926 | Bacteria | 5820 |
| 386 | Ga0496123_0028989 | 3300048926 | Bacteria | 4086 |
| 387 | Ga0496123_0095500 | 3300048926 | Bacteria | 1748 |
| 388 | Ga0496123_0095833 | 3300048926 | Bacteria | 1744 |
| 389 | Ga0496123_0105073 | 3300048926 | Bacteria | 1631 |
| 390 | Ga0496123_0188965 | 3300048926 | Bacteria | 1067 |
| 391 | Ga0496124_0000592 | 3300048927 | Bacteria | 61048 |
| 392 | Ga0496124_0002069 | 3300048927 | Bacteria | 27175 |
| 393 | Ga0496124_0004006 | 3300048927 | Bacteria | 17528 |
| 394 | Ga0496124_0020386 | 3300048927 | Bacteria | 6127 |
| 395 | Ga0496124_0045313 | 3300048927 | Bacteria | 3770 |
| 396 | Ga0496124_0068688 | 3300048927 | Bacteria | 2944 |
| 397 | Ga0496124_0076212 | 3300048927 | Bacteria | 2769 |
| 398 | Ga0496124_0101742 | 3300048927 | Bacteria | 2327 |
| 399 | Ga0496124_0110214 | 3300048927 | Bacteria | 2216 |
| 400 | Ga0496124_0113414 | 3300048927 | Bacteria | 2178 |
| 401 | Ga0496124_0232644 | 3300048927 | Bacteria | 1376 |
| 402 | Ga0496124_0253941 | 3300048927 | Bacteria | 1298 |
| 403 | Ga0496124_0388177 | 3300048927 | Bacteria | 973 |
| 404 | Ga0496124_0388213 | 3300048927 | Bacteria | 973 |
| 405 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 406 | Ga0496125_0000557 | 3300048928 | Bacteria | 64217 |
| 407 | Ga0496125_0002964 | 3300048928 | Bacteria | 21337 |
| 408 | Ga0496125_0016086 | 3300048928 | Bacteria | 7201 |
| 409 | Ga0496125_0028713 | 3300048928 | Bacteria | 5016 |
| 410 | Ga0496125_0123285 | 3300048928 | Bacteria | 1842 |
| 411 | Ga0496126_0000438 | 3300048929 | Bacteria | 83060 |
| 412 | Ga0496126_0000747 | 3300048929 | Bacteria | 58936 |
| 413 | Ga0496126_0033716 | 3300048929 | Bacteria | 4816 |
| 414 | Ga0496126_0322360 | 3300048929 | Bacteria | 1269 |
| 415 | Ga0496126_0430874 | 3300048929 | Bacteria | 1064 |
| 416 | Ga0496126_0493741 | 3300048929 | Bacteria | 979 |
| 417 | Ga0495678_024016 | 3300049459 | Bacteria | 2639 |
| 418 | Ga0495678_057422 | 3300049459 | Bacteria | 1475 |
| 419 | Ga0495682_0056764 | 3300049460 | Bacteria | 1419 |
| 420 | Ga0501031_0000015 | 3300049568 | Bacteria | 113809 |
| 421 | Ga0501031_0030172 | 3300049568 | Bacteria | 3536 |
| 422 | Ga0501031_0060236 | 3300049568 | Bacteria | 2474 |
| 423 | Ga0501031_0073596 | 3300049568 | Bacteria | 2224 |
| 424 | Ga0501032_0000008 | 3300049569 | Bacteria | 240313 |
| 425 | Ga0501032_0029169 | 3300049569 | Bacteria | 3788 |
| 426 | Ga0501032_0089354 | 3300049569 | Bacteria | 2045 |
| 427 | Ga0501032_0165083 | 3300049569 | Bacteria | 1453 |
| 428 | Ga0501033_0000012 | 3300049570 | Bacteria | 241599 |
| 429 | Ga0501033_0000171 | 3300049570 | Bacteria | 61888 |
| 430 | Ga0501033_0022307 | 3300049570 | Bacteria | 4776 |
| 431 | Ga0501033_0029429 | 3300049570 | Bacteria | 4127 |
| 432 | Ga0501033_0210965 | 3300049570 | Bacteria | 1385 |
| 433 | Ga0501033_0220972 | 3300049570 | Bacteria | 1348 |
| 434 | Ga0501033_0342566 | 3300049570 | Bacteria | 1048 |
| 435 | Ga0501034_0000035 | 3300049571 | Bacteria | 241623 |
| 436 | Ga0501034_0020260 | 3300049571 | Bacteria | 6792 |
| 437 | Ga0501034_0034706 | 3300049571 | Bacteria | 5114 |
| 438 | Ga0501034_0221040 | 3300049571 | Bacteria | 1846 |
| 439 | Ga0501036_0000006 | 3300049572 | Bacteria | 241623 |
| 440 | Ga0501036_0023150 | 3300049572 | Bacteria | 5229 |
| 441 | Ga0501036_0092032 | 3300049572 | Bacteria | 2561 |
| 442 | Ga0501036_0245676 | 3300049572 | Bacteria | 1500 |
| 443 | Ga0501036_0623167 | 3300049572 | Bacteria | 894 |
| 444 | Ga0501037_0000115 | 3300049573 | Bacteria | 74932 |
| 445 | Ga0501038_0000007 | 3300049574 | Bacteria | 210775 |
| 446 | Ga0501038_0057841 | 3300049574 | Bacteria | 3327 |
| 447 | Ga0501039_0000012 | 3300049575 | Bacteria | 241623 |
| 448 | Ga0501039_0190999 | 3300049575 | Bacteria | 1610 |
| 449 | Ga0501039_0216351 | 3300049575 | Bacteria | 1506 |
| 450 | Ga0501039_0223360 | 3300049575 | Bacteria | 1480 |
| 451 | Ga0501040_0049079 | 3300049576 | Bacteria | 2885 |
| 452 | Ga0501040_0197566 | 3300049576 | Bacteria | 1428 |
| 453 | Ga0501043_0000432 | 3300049579 | Bacteria | 37703 |
| 454 | Ga0501043_0047378 | 3300049579 | Bacteria | 3379 |
| 455 | Ga0501043_0082467 | 3300049579 | Bacteria | 2527 |
| 456 | Ga0501043_0164230 | 3300049579 | Bacteria | 1734 |
| 457 | Ga0501043_0188005 | 3300049579 | Bacteria | 1607 |
| 458 | Ga0501046_0076549 | 3300049580 | Bacteria | 2592 |
| 459 | Ga0501046_0195178 | 3300049580 | Bacteria | 1508 |
| 460 | Ga0501046_0246984 | 3300049580 | Bacteria | 1315 |
| 461 | Ga0501046_0407173 | 3300049580 | Bacteria | 982 |
| 462 | Ga0501047_0001526 | 3300049581 | Bacteria | 22616 |
| 463 | Ga0501047_0301289 | 3300049581 | Bacteria | 1445 |
| 464 | Ga0501067_0139334 | 3300049583 | Bacteria | 1351 |
| 465 | Ga0501070_0005611 | 3300049586 | Bacteria | 10704 |
| 466 | Ga0501070_0096215 | 3300049586 | Bacteria | 2450 |
| 467 | Ga0501070_0333597 | 3300049586 | Bacteria | 1232 |
| 468 | Ga0501072_0367681 | 3300049588 | Bacteria | 1142 |
| 469 | Ga0501073_0152578 | 3300049589 | Bacteria | 1601 |
| 470 | Ga0501074_0162779 | 3300049590 | Bacteria | 1593 |
| 471 | Ga0501080_0038118 | 3300049742 | Bacteria | 4489 |
| 472 | Ga0501080_0662977 | 3300049742 | Bacteria | 922 |
| 473 | Ga0501083_0184099 | 3300049744 | Bacteria | 1363 |
| 474 | Ga0501035_0000192 | 3300049822 | Bacteria | 74834 |
| 475 | Ga0501035_0000841 | 3300049822 | Bacteria | 32800 |
| 476 | Ga0501035_0075661 | 3300049822 | Bacteria | 2977 |
| 477 | Ga0501035_0099965 | 3300049822 | Bacteria | 2546 |
| 478 | Ga0501035_0134546 | 3300049822 | Bacteria | 2153 |
| 479 | Ga0501044_0000015 | 3300049823 | Bacteria | 241623 |
| 480 | Ga0501044_0114298 | 3300049823 | Bacteria | 2705 |
| 481 | Ga0501044_0199922 | 3300049823 | Bacteria | 1957 |
| 482 | Ga0501044_0330327 | 3300049823 | Bacteria | 1448 |
| 483 | Ga0501045_0255171 | 3300049824 | Bacteria | 1305 |
| 484 | nmdc:mga03683_15312_c1 | 3300050489 | Bacteria | 2860 |
| 485 | nmdc:mga03n38_281521_c1 | 3300050490 | Bacteria | 888 |
| 486 | nmdc:mga00v17_72_c1 | 3300050491 | Bacteria | 60922 |
| 487 | nmdc:mga00v17_81455_c1 | 3300050491 | Bacteria | 2022 |
| 488 | nmdc:mga00v17_91675_c1 | 3300050491 | Bacteria | 1909 |
| 489 | nmdc:mga00v17_92_c1 | 3300050491 | Bacteria | 53037 |
| 490 | nmdc:mga0yw44_169441_c1 | 3300050492 | Bacteria | 1433 |
| 491 | nmdc:mga0yw44_201641_c1 | 3300050492 | Bacteria | 1314 |
| 492 | nmdc:mga0yw44_4716_c1 | 3300050492 | Bacteria | 6309 |
| 493 | nmdc:mga04h51_112683_c1 | 3300050495 | Bacteria | 1005 |
| 494 | nmdc:mga0sz30_107529_c1 | 3300050516 | Bacteria | 1221 |
| 495 | Ga0500610_0078634 | 3300053079 | Bacteria | 1718 |
| 496 | Ga0495619_0026578 | 3300053085 | Bacteria | 3724 |
| 497 | Ga0500578_0090956 | 3300053086 | Bacteria | 1936 |
| 498 | Ga0500560_000887 | 3300053107 | Bacteria | 4687 |
| 499 | Ga0500560_010826 | 3300053107 | Bacteria | 2301 |
| 500 | Ga0500594_0003405 | 3300053118 | Bacteria | 3489 |
| 501 | Ga0500608_024673 | 3300053122 | Bacteria | 2809 |
| 502 | Ga0500614_017776 | 3300053123 | Bacteria | 1611 |
| 503 | Ga0500618_003524 | 3300053125 | Bacteria | 5331 |
| 504 | Ga0500618_005292 | 3300053125 | Bacteria | 3954 |
| 505 | Ga0500618_019728 | 3300053125 | Bacteria | 1657 |
| 506 | Ga0500628_006907 | 3300053129 | Bacteria | 1932 |
| 507 | Ga0500642_0085535 | 3300053130 | Bacteria | 1453 |
| 508 | Ga0500658_0046732 | 3300053134 | Bacteria | 1754 |
| 509 | Ga0500559_0017768 | 3300053136 | Bacteria | 3006 |
| 510 | Ga0500561_0003433 | 3300053137 | Bacteria | 2773 |
| 511 | Ga0500568_0002068 | 3300053139 | Bacteria | 12164 |
| 512 | Ga0500568_0011657 | 3300053139 | Bacteria | 4066 |
| 513 | Ga0500568_0085599 | 3300053139 | Bacteria | 1193 |
| 514 | Ga0500573_0016700 | 3300053140 | Bacteria | 4169 |
| 515 | Ga0500573_0049037 | 3300053140 | Bacteria | 2430 |
| 516 | Ga0500590_000811 | 3300053148 | Bacteria | 11687 |
| 517 | Ga0500604_0026364 | 3300053151 | Bacteria | 1676 |
| 518 | Ga0500616_0003108 | 3300053153 | Bacteria | 12998 |
| 519 | Ga0500616_0062258 | 3300053153 | Bacteria | 1928 |
| 520 | Ga0500616_0151485 | 3300053153 | Bacteria | 1073 |
| 521 | Ga0500622_0000342 | 3300053156 | Bacteria | 45708 |
| 522 | Ga0500622_0003075 | 3300053156 | Bacteria | 11504 |
| 523 | Ga0500624_000370 | 3300053157 | Bacteria | 14500 |
| 524 | Ga0500627_0018742 | 3300053158 | Bacteria | 2745 |
| 525 | Ga0500627_0144869 | 3300053158 | Bacteria | 1073 |
| 526 | Ga0500634_0009996 | 3300053161 | Bacteria | 4830 |
| 527 | Ga0500636_0000023 | 3300053177 | Bacteria | 89900 |
| 528 | Ga0500636_0001609 | 3300053177 | Bacteria | 12311 |
| 529 | Ga0501082_0136746 | 3300060353 | Bacteria | 2126 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047472 | Ga0495686_0285578 | Ga0495686_0285578_253_900 | 199 |
| 2 | 3300053153 | Ga0500616_0151485 | Ga0500616_0151485_45_773 | 219 |
| 3 | 3300038443 | Ga0395901_0510383 | Ga0395901_0510383_510_1196 | 221 |
| 4 | 3300053122 | Ga0500608_024673 | Ga0500608_024673_1919_2746 | 223 |
| 5 | 3300013105 | Ga0157369_10185945 | Ga0157369_101859452 | 228 |
| 6 | 3300041456 | Ga0451795_0368178 | Ga0451795_0368178_19_744 | 228 |
| 7 | 3300041501 | Ga0451845_0963136 | Ga0451845_0963136_471_1157 | 228 |
| 8 | 3300041503 | Ga0451847_0686743 | Ga0451847_0686743_153_839 | 228 |
| 9 | 3300046507 | Ga0495606_0000762 | Ga0495606_0000762_11611_12303 | 228 |
| 10 | 3300046538 | Ga0495609_0182422 | Ga0495609_0182422_47_733 | 228 |
| 11 | 3300047472 | Ga0495686_0196045 | Ga0495686_0196045_130_822 | 228 |
| 12 | 3300048919 | Ga0496116_0000080 | Ga0496116_0000080_121102_121812 | 228 |
| 13 | 3300048919 | Ga0496116_0166109 | Ga0496116_0166109_471_1181 | 228 |
| 14 | 3300048922 | Ga0496119_0097245 | Ga0496119_0097245_169_879 | 228 |
| 15 | 3300048924 | Ga0496121_0039218 | Ga0496121_0039218_2702_3394 | 228 |
| 16 | 3300048927 | Ga0496124_0253941 | Ga0496124_0253941_320_1030 | 228 |
| 17 | 3300048928 | Ga0496125_0016086 | Ga0496125_0016086_81_791 | 228 |
| 18 | 3300048929 | Ga0496126_0000747 | Ga0496126_0000747_39551_40261 | 228 |
| 19 | 3300050489 | nmdc:mga03683_15312_c1 | nmdc:mga03683_15312_c1_2138_2848 | 228 |
| 20 | 3300050495 | nmdc:mga04h51_112683_c1 | nmdc:mga04h51_112683_c1_240_950 | 228 |
| 21 | 3300053177 | Ga0500636_0000023 | Ga0500636_0000023_86650_87369 | 228 |
| 22 | 3300031852 | Ga0307410_10023710 | Ga0307410_100237104 | 231 |
| 23 | 3300041413 | Ga0439465_0006140 | Ga0439465_0006140_481_1200 | 232 |
| 24 | 3300049572 | Ga0501036_0623167 | Ga0501036_0623167_99_878 | 232 |
| 25 | 3300005937 | Ga0081455_10084454 | Ga0081455_100844543 | 233 |
| 26 | 3300032002 | Ga0307416_100169679 | Ga0307416_1001696792 | 233 |
| 27 | 3300042007 | Ga0439449_0004953 | Ga0439449_0004953_2962_3798 | 233 |
| 28 | 3300005548 | Ga0070665_100189572 | Ga0070665_1001895723 | 241 |
| 29 | 3300028379 | Ga0268266_10151290 | Ga0268266_101512903 | 241 |
| 30 | 3300048920 | Ga0496117_0004972 | Ga0496117_0004972_354_1133 | 241 |
| 31 | 3300048924 | Ga0496121_0012314 | Ga0496121_0012314_282_1115 | 241 |
| 32 | 3300046460 | Ga0495638_0018504 | Ga0495638_0018504_939_1766 | 245 |
| 33 | 3300035695 | Ga0373927_0000146 | Ga0373927_0000146_43083_43853 | 246 |
| 34 | 3300037068 | Ga0373925_0001219 | Ga0373925_0001219_20475_21245 | 246 |
| 35 | 3300037471 | Ga0395905_0000441 | Ga0395905_0000441_37332_38153 | 246 |
| 36 | 3300010375 | Ga0105239_10320270 | Ga0105239_103202702 | 247 |
| 37 | 3300028794 | Ga0307515_10073935 | Ga0307515_100739352 | 247 |
| 38 | 3300037471 | Ga0395905_0006786 | Ga0395905_0006786_3922_4773 | 247 |
| 39 | 3300049570 | Ga0501033_0029429 | Ga0501033_0029429_1032_1808 | 248 |
| 40 | 3300053136 | Ga0500559_0017768 | Ga0500559_0017768_316_1137 | 248 |
| 41 | 3300053156 | Ga0500622_0003075 | Ga0500622_0003075_8413_9228 | 248 |
| 42 | 3300053139 | Ga0500568_0085599 | Ga0500568_0085599_381_1181 | 249 |
| 43 | 3300005262 | Ga0065165_1027611 | Ga0065165_10276112 | 250 |
| 44 | 3300037471 | Ga0395905_0093616 | Ga0395905_0093616_594_1406 | 250 |
| 45 | 3300049576 | Ga0501040_0049079 | Ga0501040_0049079_32_784 | 250 |
| 46 | iso_pu_bacteria | 2508501122 | 2509107231 | 250 |
| 47 | iso_pu_bacteria | 2509276019 | 2509374803 | 250 |
| 48 | iso_pu_bacteria | 2643221558 | 2643810421 | 250 |
| 49 | iso_pu_bacteria | 2850079185 | 2850080167 | 250 |
| 50 | iso_pu_bacteria | 2919100787 | 2919101208 | 250 |
| 51 | iso_pu_bacteria | 8056875544 | 8056879255 | 250 |
| 52 | 3300053140 | Ga0500573_0016700 | Ga0500573_0016700_366_1145 | 251 |
| 53 | iso_pu_bacteria | 2558860983 | 2561467310 | 251 |
| 54 | iso_pu_bacteria | 2643221568 | 2643856242 | 251 |
| 55 | iso_pu_bacteria | 2643221688 | 2644493722 | 251 |
| 56 | iso_pu_bacteria | 2919166419 | 2919166992 | 251 |
| 57 | iso_pu_bacteria | 2978969890 | 2978973410 | 251 |
| 58 | iso_pu_bacteria | 2984587000 | 2984591693 | 251 |
| 59 | 3300003775 | Ga0055524_1004697 | Ga0055524_10046974 | 252 |
| 60 | 3300003790 | Ga0055528_1000263 | Ga0055528_100026336 | 252 |
| 61 | 3300003856 | Ga0058692_1006931 | Ga0058692_10069312 | 252 |
| 62 | 3300025273 | Ga0209673_1000122 | Ga0209673_100012263 | 252 |
| 63 | 3300025292 | Ga0209676_1044134 | Ga0209676_10441342 | 252 |
| 64 | 3300025295 | Ga0209564_1025910 | Ga0209564_10259102 | 252 |
| 65 | 3300025299 | Ga0209256_1001378 | Ga0209256_100137815 | 252 |
| 66 | 3300027312 | Ga0209371_1003770 | Ga0209371_10037702 | 252 |
| 67 | 3300030500 | Ga0268256_1012512 | Ga0268256_10125122 | 252 |
| 68 | 3300046674 | Ga0495588_0003056 | Ga0495588_0003056_4939_5739 | 252 |
| 69 | 3300046692 | Ga0495671_0220420 | Ga0495671_0220420_74_874 | 252 |
| 70 | 3300047470 | Ga0495681_0001172 | Ga0495681_0001172_625_1425 | 252 |
| 71 | 3300053107 | Ga0500560_000887 | Ga0500560_000887_3353_4153 | 252 |
| 72 | iso_pu_bacteria | 2510065019 | 2510131626 | 252 |
| 73 | iso_pu_bacteria | 2510065057 | 2510304931 | 252 |
| 74 | iso_pu_bacteria | 2511231052 | 2511500721 | 252 |
| 75 | iso_pu_bacteria | 2512047086 | 2512532139 | 252 |
| 76 | iso_pu_bacteria | 2512875026 | 2512972527 | 252 |
| 77 | iso_pu_bacteria | 2513237084 | 2513571203 | 252 |
| 78 | iso_pu_bacteria | 2513237086 | 2513585715 | 252 |
| 79 | iso_pu_bacteria | 2513237089 | 2513605549 | 252 |
| 80 | iso_pu_bacteria | 2513237091 | 2513616786 | 252 |
| 81 | iso_pu_bacteria | 2513237093 | 2513632298 | 252 |
| 82 | iso_pu_bacteria | 2513237103 | 2513711624 | 252 |
| 83 | iso_pu_bacteria | 2513237140 | 2513880800 | 252 |
| 84 | iso_pu_bacteria | 2513237143 | 2513903794 | 252 |
| 85 | iso_pu_bacteria | 2513237156 | 2513986106 | 252 |
| 86 | iso_pu_bacteria | 2513237160 | 2514007523 | 252 |
| 87 | iso_pu_bacteria | 2515075009 | 2515110548 | 252 |
| 88 | iso_pu_bacteria | 2515154107 | 2515607854 | 252 |
| 89 | iso_pu_bacteria | 2516653046 | 2516891996 | 252 |
| 90 | iso_pu_bacteria | 2516653077 | 2517039249 | 252 |
| 91 | iso_pu_bacteria | 2517093000 | 2517093439 | 252 |
| 92 | iso_pu_bacteria | 2517487022 | 2517568809 | 252 |
| 93 | iso_pu_bacteria | 2524023207 | 2524450047 | 252 |
| 94 | iso_pu_bacteria | 2551306084 | 2551675938 | 252 |
| 95 | iso_pu_bacteria | 2551306085 | 2551686888 | 252 |
| 96 | iso_pu_bacteria | 2551306086 | 2551695248 | 252 |
| 97 | iso_pu_bacteria | 2551306089 | 2551708765 | 252 |
| 98 | iso_pu_bacteria | 2551306090 | 2551717568 | 252 |
| 99 | iso_pu_bacteria | 2551306092 | 2551733347 | 252 |
| 100 | iso_pu_bacteria | 2551306093 | 2551741730 | 252 |
| 101 | iso_pu_bacteria | 2643221557 | 2643807554 | 252 |
| 102 | iso_pu_bacteria | 2643221610 | 2644069965 | 252 |
| 103 | iso_pu_bacteria | 2643221637 | 2644206555 | 252 |
| 104 | iso_pu_bacteria | 2643221668 | 2644380937 | 252 |
| 105 | iso_pu_bacteria | 2643221675 | 2644414842 | 252 |
| 106 | iso_pu_bacteria | 2643221680 | 2644448499 | 252 |
| 107 | iso_pu_bacteria | 2643221718 | 2644650202 | 252 |
| 108 | iso_pu_bacteria | 2643221726 | 2644689194 | 252 |
| 109 | iso_pu_bacteria | 2724679232 | 2725950100 | 252 |
| 110 | iso_pu_bacteria | 2802428858 | 2802717451 | 252 |
| 111 | iso_pu_bacteria | 2802428859 | 2802723621 | 252 |
| 112 | iso_pu_bacteria | 2802428860 | 2802730930 | 252 |
| 113 | iso_pu_bacteria | 2802428861 | 2802735936 | 252 |
| 114 | iso_pu_bacteria | 2802428862 | 2802743855 | 252 |
| 115 | iso_pu_bacteria | 2802428863 | 2802752928 | 252 |
| 116 | iso_pu_bacteria | 2842110456 | 2842112351 | 252 |
| 117 | iso_pu_bacteria | 2842217011 | 2842218647 | 252 |
| 118 | iso_pu_bacteria | 2855825444 | 2855831916 | 252 |
| 119 | iso_pu_bacteria | 2855839649 | 2855840200 | 252 |
| 120 | iso_pu_bacteria | 2857516855 | 2857522233 | 252 |
| 121 | iso_pu_bacteria | 2858800743 | 2858804107 | 252 |
| 122 | iso_pu_bacteria | 2915980308 | 2915982289 | 252 |
| 123 | iso_pu_bacteria | 2915986958 | 2915991433 | 252 |
| 124 | iso_pu_bacteria | 2915993759 | 2915995773 | 252 |
| 125 | iso_pu_bacteria | 2916000859 | 2916006838 | 252 |
| 126 | iso_pu_bacteria | 2916007675 | 2916010989 | 252 |
| 127 | iso_pu_bacteria | 2916014648 | 2916021036 | 252 |
| 128 | iso_pu_bacteria | 2916021584 | 2916024629 | 252 |
| 129 | iso_pu_bacteria | 2916028427 | 2916032662 | 252 |
| 130 | iso_pu_bacteria | 2916035215 | 2916036073 | 252 |
| 131 | iso_pu_bacteria | 2916041962 | 2916045932 | 252 |
| 132 | iso_pu_bacteria | 2916048683 | 2916051604 | 252 |
| 133 | iso_pu_bacteria | 2916055098 | 2916059376 | 252 |
| 134 | iso_pu_bacteria | 2916061851 | 2916062625 | 252 |
| 135 | iso_pu_bacteria | 2916068649 | 2916071367 | 252 |
| 136 | iso_pu_bacteria | 2916076590 | 2916081936 | 252 |
| 137 | iso_pu_bacteria | 2921201388 | 2921204134 | 252 |
| 138 | iso_pu_bacteria | 2921208531 | 2921213142 | 252 |
| 139 | iso_pu_bacteria | 2921237296 | 2921239228 | 252 |
| 140 | iso_pu_bacteria | 2921244191 | 2921247579 | 252 |
| 141 | iso_pu_bacteria | 2921250672 | 2921250714 | 252 |
| 142 | iso_pu_bacteria | 2921257292 | 2921261912 | 252 |
| 143 | iso_pu_bacteria | 2921263974 | 2921268358 | 252 |
| 144 | iso_pu_bacteria | 2921282425 | 2921286950 | 252 |
| 145 | iso_pu_bacteria | 2921289301 | 2921291216 | 252 |
| 146 | iso_pu_bacteria | 2921296804 | 2921301002 | 252 |
| 147 | iso_pu_bacteria | 2924144063 | 2924149257 | 252 |
| 148 | iso_pu_bacteria | 2924150972 | 2924155780 | 252 |
| 149 | iso_pu_bacteria | 2924158325 | 2924161392 | 252 |
| 150 | iso_pu_bacteria | 2924165586 | 2924169588 | 252 |
| 151 | iso_pu_bacteria | 2924172951 | 2924177039 | 252 |
| 152 | iso_pu_bacteria | 2924179722 | 2924184701 | 252 |
| 153 | iso_pu_bacteria | 2924186466 | 2924190560 | 252 |
| 154 | iso_pu_bacteria | 2924193448 | 2924198299 | 252 |
| 155 | iso_pu_bacteria | 2924200457 | 2924205052 | 252 |
| 156 | iso_pu_bacteria | 2924207177 | 2924211915 | 252 |
| 157 | iso_pu_bacteria | 2924214083 | 2924218658 | 252 |
| 158 | iso_pu_bacteria | 2924221636 | 2924225484 | 252 |
| 159 | iso_pu_bacteria | 2924228884 | 2924234129 | 252 |
| 160 | iso_pu_bacteria | 2933586486 | 2933587680 | 252 |
| 161 | iso_pu_bacteria | 2936367885 | 2936368776 | 252 |
| 162 | iso_pu_bacteria | 2936375103 | 2936377146 | 252 |
| 163 | iso_pu_bacteria | 2936996657 | 2936999323 | 252 |
| 164 | iso_pu_bacteria | 2937002841 | 2937008075 | 252 |
| 165 | iso_pu_bacteria | 2937009748 | 2937014544 | 252 |
| 166 | iso_pu_bacteria | 2937016420 | 2937021471 | 252 |
| 167 | iso_pu_bacteria | 2937023124 | 2937026844 | 252 |
| 168 | iso_pu_bacteria | 2937029754 | 2937030109 | 252 |
| 169 | iso_pu_bacteria | 2937036028 | 2937037899 | 252 |
| 170 | iso_pu_bacteria | 2937042894 | 2937048909 | 252 |
| 171 | iso_pu_bacteria | 2937049772 | 2937053769 | 252 |
| 172 | iso_pu_bacteria | 2937056579 | 2937060939 | 252 |
| 173 | iso_pu_bacteria | 2937063883 | 2937070358 | 252 |
| 174 | iso_pu_bacteria | 2937071275 | 2937076481 | 252 |
| 175 | iso_pu_bacteria | 2937078374 | 2937080184 | 252 |
| 176 | iso_pu_bacteria | 2937084907 | 2937090471 | 252 |
| 177 | iso_pu_bacteria | 2937091812 | 2937094670 | 252 |
| 178 | iso_pu_bacteria | 2937098957 | 2937102077 | 252 |
| 179 | iso_pu_bacteria | 2937106411 | 2937109609 | 252 |
| 180 | iso_pu_bacteria | 2937113482 | 2937116978 | 252 |
| 181 | iso_pu_bacteria | 2937119839 | 2937124307 | 252 |
| 182 | iso_pu_bacteria | 2937126314 | 2937131236 | 252 |
| 183 | iso_pu_bacteria | 2957375807 | 2957377446 | 252 |
| 184 | iso_pu_bacteria | 2957382221 | 2957387158 | 252 |
| 185 | iso_pu_bacteria | 2957388812 | 2957392578 | 252 |
| 186 | iso_pu_bacteria | 2957395598 | 2957398535 | 252 |
| 187 | iso_pu_bacteria | 2957402308 | 2957407177 | 252 |
| 188 | iso_pu_bacteria | 2957408893 | 2957413281 | 252 |
| 189 | iso_pu_bacteria | 2957415311 | 2957420785 | 252 |
| 190 | iso_pu_bacteria | 2957422303 | 2957424283 | 252 |
| 191 | iso_pu_bacteria | 2957430029 | 2957433845 | 252 |
| 192 | iso_pu_bacteria | 2957437181 | 2957443149 | 252 |
| 193 | iso_pu_bacteria | 2957443900 | 2957446431 | 252 |
| 194 | iso_pu_bacteria | 2957450854 | 2957455725 | 252 |
| 195 | iso_pu_bacteria | 2957457609 | 2957462996 | 252 |
| 196 | iso_pu_bacteria | 2957464669 | 2957469460 | 252 |
| 197 | iso_pu_bacteria | 2957471148 | 2957474821 | 252 |
| 198 | iso_pu_bacteria | 2957478035 | 2957483459 | 252 |
| 199 | iso_pu_bacteria | 2957484790 | 2957488426 | 252 |
| 200 | iso_pu_bacteria | 2957491536 | 2957495420 | 252 |
| 201 | iso_pu_bacteria | 2957498199 | 2957502280 | 252 |
| 202 | iso_pu_bacteria | 2957505466 | 2957509369 | 252 |
| 203 | iso_pu_bacteria | 2960584000 | 2960588838 | 252 |
| 204 | iso_pu_bacteria | 2960591022 | 2960593727 | 252 |
| 205 | iso_pu_bacteria | 2960597568 | 2960601639 | 252 |
| 206 | iso_pu_bacteria | 2960603979 | 2960609553 | 252 |
| 207 | iso_pu_bacteria | 2960610863 | 2960614907 | 252 |
| 208 | iso_pu_bacteria | 2960617483 | 2960621068 | 252 |
| 209 | iso_pu_bacteria | 2960624210 | 2960628533 | 252 |
| 210 | iso_pu_bacteria | 2960631154 | 2960632963 | 252 |
| 211 | iso_pu_bacteria | 2960637947 | 2960640082 | 252 |
| 212 | iso_pu_bacteria | 2960645483 | 2960650311 | 252 |
| 213 | iso_pu_bacteria | 2960652885 | 2960653682 | 252 |
| 214 | iso_pu_bacteria | 2960660292 | 2960664757 | 252 |
| 215 | iso_pu_bacteria | 2960667422 | 2960672476 | 252 |
| 216 | iso_pu_bacteria | 2960674078 | 2960679130 | 252 |
| 217 | iso_pu_bacteria | 2960680706 | 2960685600 | 252 |
| 218 | iso_pu_bacteria | 2960687367 | 2960687972 | 252 |
| 219 | iso_pu_bacteria | 2960693952 | 2960695613 | 252 |
| 220 | iso_pu_bacteria | 2964607997 | 2964609790 | 252 |
| 221 | iso_pu_bacteria | 2964615318 | 2964619529 | 252 |
| 222 | iso_pu_bacteria | 2964621998 | 2964626800 | 252 |
| 223 | iso_pu_bacteria | 2964628898 | 2964630139 | 252 |
| 224 | iso_pu_bacteria | 2964636051 | 2964637458 | 252 |
| 225 | iso_pu_bacteria | 2964643177 | 2964647784 | 252 |
| 226 | iso_pu_bacteria | 2964649959 | 2964653582 | 252 |
| 227 | iso_pu_bacteria | 2964656573 | 2964661786 | 252 |
| 228 | iso_pu_bacteria | 2964663802 | 2964668960 | 252 |
| 229 | iso_pu_bacteria | 2964670856 | 2964672116 | 252 |
| 230 | iso_pu_bacteria | 2964678106 | 2964681324 | 252 |
| 231 | iso_pu_bacteria | 2964685014 | 2964689907 | 252 |
| 232 | iso_pu_bacteria | 2964691889 | 2964696853 | 252 |
| 233 | iso_pu_bacteria | 2964698721 | 2964699308 | 252 |
| 234 | iso_pu_bacteria | 2964705432 | 2964711059 | 252 |
| 235 | iso_pu_bacteria | 2964712639 | 2964715757 | 252 |
| 236 | iso_pu_bacteria | 2964719344 | 2964721524 | 252 |
| 237 | iso_pu_bacteria | 2967664464 | 2967670701 | 252 |
| 238 | iso_pu_bacteria | 2967671571 | 2967677708 | 252 |
| 239 | iso_pu_bacteria | 2967678726 | 2967680833 | 252 |
| 240 | iso_pu_bacteria | 2967693043 | 2967696658 | 252 |
| 241 | iso_pu_bacteria | 2967699805 | 2967701263 | 252 |
| 242 | iso_pu_bacteria | 2967706974 | 2967708772 | 252 |
| 243 | iso_pu_bacteria | 2967714385 | 2967718150 | 252 |
| 244 | iso_pu_bacteria | 2967721400 | 2967725952 | 252 |
| 245 | iso_pu_bacteria | 2967728569 | 2967729857 | 252 |
| 246 | iso_pu_bacteria | 2967735183 | 2967738254 | 252 |
| 247 | iso_pu_bacteria | 2967742019 | 2967744949 | 252 |
| 248 | iso_pu_bacteria | 2967748971 | 2967754104 | 252 |
| 249 | iso_pu_bacteria | 2967755722 | 2967756646 | 252 |
| 250 | iso_pu_bacteria | 2967762386 | 2967763067 | 252 |
| 251 | iso_pu_bacteria | 2967769361 | 2967774191 | 252 |
| 252 | iso_pu_bacteria | 2967775926 | 2967781523 | 252 |
| 253 | iso_pu_bacteria | 2970019648 | 2970020725 | 252 |
| 254 | iso_pu_bacteria | 2970026789 | 2970032536 | 252 |
| 255 | iso_pu_bacteria | 2970033650 | 2970037571 | 252 |
| 256 | iso_pu_bacteria | 2970040964 | 2970045241 | 252 |
| 257 | iso_pu_bacteria | 2970047711 | 2970053555 | 252 |
| 258 | iso_pu_bacteria | 2970054988 | 2970058744 | 252 |
| 259 | iso_pu_bacteria | 2970061556 | 2970065016 | 252 |
| 260 | iso_pu_bacteria | 2970068827 | 2970072757 | 252 |
| 261 | iso_pu_bacteria | 2970076120 | 2970081628 | 252 |
| 262 | iso_pu_bacteria | 2970082768 | 2970086202 | 252 |
| 263 | iso_pu_bacteria | 2970088815 | 2970094026 | 252 |
| 264 | iso_pu_bacteria | 2970095765 | 2970100814 | 252 |
| 265 | iso_pu_bacteria | 2970102677 | 2970106341 | 252 |
| 266 | iso_pu_bacteria | 2970109326 | 2970113612 | 252 |
| 267 | iso_pu_bacteria | 2970116247 | 2970120273 | 252 |
| 268 | iso_pu_bacteria | 2970122695 | 2970123769 | 252 |
| 269 | iso_pu_bacteria | 2970129317 | 2970132864 | 252 |
| 270 | iso_pu_bacteria | 2970136068 | 2970139901 | 252 |
| 271 | iso_pu_bacteria | 2970143518 | 2970145621 | 252 |
| 272 | iso_pu_bacteria | 2970149975 | 2970153663 | 252 |
| 273 | iso_pu_bacteria | 2970156795 | 2970158608 | 252 |
| 274 | iso_pu_bacteria | 2970164137 | 2970169281 | 252 |
| 275 | iso_pu_bacteria | 2970170962 | 2970177777 | 252 |
| 276 | iso_pu_bacteria | 2970177841 | 2970181483 | 252 |
| 277 | iso_pu_bacteria | 2970184632 | 2970191329 | 252 |
| 278 | iso_pu_bacteria | 2970191845 | 2970195812 | 252 |
| 279 | iso_pu_bacteria | 2977523885 | 2977529211 | 252 |
| 280 | iso_pu_bacteria | 2977530762 | 2977537595 | 252 |
| 281 | iso_pu_bacteria | 2977537788 | 2977540612 | 252 |
| 282 | iso_pu_bacteria | 2977544691 | 2977551727 | 252 |
| 283 | iso_pu_bacteria | 2977551784 | 2977555684 | 252 |
| 284 | iso_pu_bacteria | 2977558990 | 2977564017 | 252 |
| 285 | iso_pu_bacteria | 2977565890 | 2977570930 | 252 |
| 286 | iso_pu_bacteria | 2977572785 | 2977573324 | 252 |
| 287 | iso_pu_bacteria | 2977579622 | 2977584008 | 252 |
| 288 | iso_pu_bacteria | 2989349275 | 2989355375 | 252 |
| 289 | iso_pu_bacteria | 639633055 | 639646821 | 252 |
| 290 | iso_pu_bacteria | 648276728 | 648740238 | 252 |
| 291 | iso_pu_bacteria | 8003992118 | 8003992615 | 252 |
| 292 | iso_pu_bacteria | 8003999396 | 8003999935 | 252 |
| 293 | iso_pu_bacteria | 8005376324 | 8005377281 | 252 |
| 294 | iso_pu_bacteria | 8005460587 | 8005461189 | 252 |
| 295 | iso_pu_bacteria | 8005556819 | 8005560788 | 252 |
| 296 | iso_pu_bacteria | 8005563573 | 8005569771 | 252 |
| 297 | iso_pu_bacteria | 8018163183 | 8018167740 | 252 |
| 298 | iso_pu_bacteria | 8024479707 | 8024480444 | 252 |
| 299 | iso_pu_bacteria | 8057874678 | 8057881074 | 252 |
| 300 | 3300002773 | JGI25152J39213_1015277 | JGI25152J39213_10152772 | 253 |
| 301 | 3300002773 | JGI25152J39213_1016284 | JGI25152J39213_10162843 | 253 |
| 302 | 3300003187 | JGI25151J46595_10009087 | JGI25151J46595_100090873 | 253 |
| 303 | 3300005262 | Ga0065165_1009542 | Ga0065165_10095427 | 253 |
| 304 | 3300025258 | Ga0209129_1000965 | Ga0209129_100096510 | 253 |
| 305 | 3300025294 | Ga0209025_1002239 | Ga0209025_100223915 | 253 |
| 306 | 3300025294 | Ga0209025_1029753 | Ga0209025_10297532 | 253 |
| 307 | 3300053140 | Ga0500573_0049037 | Ga0500573_0049037_169_954 | 253 |
| 308 | iso_pu_bacteria | 2513237144 | 2513907953 | 253 |
| 309 | iso_pu_bacteria | 2513237146 | 2513927610 | 253 |
| 310 | iso_pu_bacteria | 2558860100 | 2558863795 | 253 |
| 311 | iso_pu_bacteria | 2599185170 | 2599419041 | 253 |
| 312 | iso_pu_bacteria | 2599185236 | 2599719426 | 253 |
| 313 | iso_pu_bacteria | 2838035591 | 2838037272 | 253 |
| 314 | iso_pu_bacteria | 2838074704 | 2838075509 | 253 |
| 315 | iso_pu_bacteria | 2838661181 | 2838663540 | 253 |
| 316 | iso_pu_bacteria | 2896384573 | 2896385397 | 253 |
| 317 | iso_pu_bacteria | 2913295892 | 2913297849 | 253 |
| 318 | iso_pu_bacteria | 2920760137 | 2920763187 | 253 |
| 319 | iso_pu_bacteria | 2920822456 | 2920823516 | 253 |
| 320 | iso_pu_bacteria | 2933016740 | 2933022353 | 253 |
| 321 | iso_pu_bacteria | 3005409236 | 3005411361 | 253 |
| 322 | iso_pu_bacteria | 643692032 | 643824668 | 253 |
| 323 | iso_pu_bacteria | 8024486573 | 8024489397 | 253 |
| 324 | 3300021321 | Ga0214542_1029774 | Ga0214542_10297742 | 254 |
| 325 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003167 | 254 |
| 326 | 3300025245 | Ga0207425_1004757 | Ga0207425_10047572 | 254 |
| 327 | 3300025294 | Ga0209025_1035146 | Ga0209025_10351462 | 254 |
| 328 | 3300025297 | Ga0209758_1001314 | Ga0209758_100131421 | 254 |
| 329 | iso_pu_bacteria | 2509276021 | 2509388275 | 254 |
| 330 | iso_pu_bacteria | 2509276033 | 2509443842 | 254 |
| 331 | iso_pu_bacteria | 2510461076 | 2510897919 | 254 |
| 332 | iso_pu_bacteria | 2510917022 | 2511134537 | 254 |
| 333 | iso_pu_bacteria | 2510917030 | 2511194473 | 254 |
| 334 | iso_pu_bacteria | 2513237085 | 2513579256 | 254 |
| 335 | iso_pu_bacteria | 2513237088 | 2513598516 | 254 |
| 336 | iso_pu_bacteria | 2513237138 | 2513866338 | 254 |
| 337 | iso_pu_bacteria | 2513237159 | 2513999888 | 254 |
| 338 | iso_pu_bacteria | 2513237162 | 2514020875 | 254 |
| 339 | iso_pu_bacteria | 2515154113 | 2515639014 | 254 |
| 340 | iso_pu_bacteria | 2515154114 | 2515645257 | 254 |
| 341 | iso_pu_bacteria | 2515154116 | 2515659470 | 254 |
| 342 | iso_pu_bacteria | 2515154134 | 2515742946 | 254 |
| 343 | iso_pu_bacteria | 2516653085 | 2517079493 | 254 |
| 344 | iso_pu_bacteria | 2517287029 | 2517405138 | 254 |
| 345 | iso_pu_bacteria | 2524023209 | 2524457646 | 254 |
| 346 | iso_pu_bacteria | 2529292951 | 2530647661 | 254 |
| 347 | iso_pu_bacteria | 2534681796 | 2535515229 | 254 |
| 348 | iso_pu_bacteria | 2537561587 | 2537872858 | 254 |
| 349 | iso_pu_bacteria | 2554235003 | 2554246661 | 254 |
| 350 | iso_pu_bacteria | 2558860242 | 2559293889 | 254 |
| 351 | iso_pu_bacteria | 2582581283 | 2585165149 | 254 |
| 352 | iso_pu_bacteria | 2582581294 | 2585204005 | 254 |
| 353 | iso_pu_bacteria | 2582581298 | 2585225731 | 254 |
| 354 | iso_pu_bacteria | 2582581299 | 2585229120 | 254 |
| 355 | iso_pu_bacteria | 2582581307 | 2585275311 | 254 |
| 356 | iso_pu_bacteria | 2582581308 | 2585281948 | 254 |
| 357 | iso_pu_bacteria | 2582581315 | 2585325849 | 254 |
| 358 | iso_pu_bacteria | 2582581316 | 2585330020 | 254 |
| 359 | iso_pu_bacteria | 2582581867 | 2585398417 | 254 |
| 360 | iso_pu_bacteria | 2585427526 | 2585528445 | 254 |
| 361 | iso_pu_bacteria | 2585427527 | 2585536446 | 254 |
| 362 | iso_pu_bacteria | 2585427528 | 2585539838 | 254 |
| 363 | iso_pu_bacteria | 2585427529 | 2585547994 | 254 |
| 364 | iso_pu_bacteria | 2585427530 | 2585556883 | 254 |
| 365 | iso_pu_bacteria | 2585427531 | 2585560246 | 254 |
| 366 | iso_pu_bacteria | 2585427590 | 2585819436 | 254 |
| 367 | iso_pu_bacteria | 2585427593 | 2585837819 | 254 |
| 368 | iso_pu_bacteria | 2585427608 | 2585901487 | 254 |
| 369 | iso_pu_bacteria | 2585427609 | 2585905572 | 254 |
| 370 | iso_pu_bacteria | 2585428125 | 2587979312 | 254 |
| 371 | iso_pu_bacteria | 2599185210 | 2599605440 | 254 |
| 372 | iso_pu_bacteria | 2600255279 | 2601609136 | 254 |
| 373 | iso_pu_bacteria | 2600255308 | 2601745911 | 254 |
| 374 | iso_pu_bacteria | 2615840624 | 2616295810 | 254 |
| 375 | iso_pu_bacteria | 2615840626 | 2616306193 | 254 |
| 376 | iso_pu_bacteria | 2615840698 | 2616553546 | 254 |
| 377 | iso_pu_bacteria | 2617270742 | 2617382602 | 254 |
| 378 | iso_pu_bacteria | 2643221582 | 2643921124 | 254 |
| 379 | iso_pu_bacteria | 2643221607 | 2644046994 | 254 |
| 380 | iso_pu_bacteria | 2643221618 | 2644103045 | 254 |
| 381 | iso_pu_bacteria | 2643221626 | 2644152026 | 254 |
| 382 | iso_pu_bacteria | 2643221634 | 2644190732 | 254 |
| 383 | iso_pu_bacteria | 2643221636 | 2644203567 | 254 |
| 384 | iso_pu_bacteria | 2643221643 | 2644241416 | 254 |
| 385 | iso_pu_bacteria | 2643221655 | 2644305972 | 254 |
| 386 | iso_pu_bacteria | 2643221659 | 2644330274 | 254 |
| 387 | iso_pu_bacteria | 2643221686 | 2644479783 | 254 |
| 388 | iso_pu_bacteria | 2643221693 | 2644519197 | 254 |
| 389 | iso_pu_bacteria | 2643221698 | 2644542973 | 254 |
| 390 | iso_pu_bacteria | 2643221712 | 2644619077 | 254 |
| 391 | iso_pu_bacteria | 2657244999 | 2657682028 | 254 |
| 392 | iso_pu_bacteria | 2667528174 | 2671112499 | 254 |
| 393 | iso_pu_bacteria | 2718217927 | 2719384319 | 254 |
| 394 | iso_pu_bacteria | 2718217997 | 2719664056 | 254 |
| 395 | iso_pu_bacteria | 2718218009 | 2719730376 | 254 |
| 396 | iso_pu_bacteria | 2718218199 | 2720490475 | 254 |
| 397 | iso_pu_bacteria | 2718218232 | 2720611856 | 254 |
| 398 | iso_pu_bacteria | 2718218233 | 2720618710 | 254 |
| 399 | iso_pu_bacteria | 2718218235 | 2720630110 | 254 |
| 400 | iso_pu_bacteria | 2718218269 | 2720773805 | 254 |
| 401 | iso_pu_bacteria | 2718218363 | 2721145799 | 254 |
| 402 | iso_pu_bacteria | 2718218365 | 2721157332 | 254 |
| 403 | iso_pu_bacteria | 2718218366 | 2721162678 | 254 |
| 404 | iso_pu_bacteria | 2718218423 | 2721398033 | 254 |
| 405 | iso_pu_bacteria | 2721755514 | 2722838848 | 254 |
| 406 | iso_pu_bacteria | 2721755556 | 2723025475 | 254 |
| 407 | iso_pu_bacteria | 2721755684 | 2723559058 | 254 |
| 408 | iso_pu_bacteria | 2721755685 | 2723565665 | 254 |
| 409 | iso_pu_bacteria | 2721755809 | 2724036843 | 254 |
| 410 | iso_pu_bacteria | 2721755810 | 2724043132 | 254 |
| 411 | iso_pu_bacteria | 2721755819 | 2724088412 | 254 |
| 412 | iso_pu_bacteria | 2721755822 | 2724102930 | 254 |
| 413 | iso_pu_bacteria | 2721755823 | 2724108793 | 254 |
| 414 | iso_pu_bacteria | 2728369352 | 2730106411 | 254 |
| 415 | iso_pu_bacteria | 2728369365 | 2730162943 | 254 |
| 416 | iso_pu_bacteria | 2728369397 | 2730296964 | 254 |
| 417 | iso_pu_bacteria | 2738541333 | 2739034695 | 254 |
| 418 | iso_pu_bacteria | 2775507266 | 2778174300 | 254 |
| 419 | iso_pu_bacteria | 2791355256 | 2793295075 | 254 |
| 420 | iso_pu_bacteria | 2791355259 | 2793315284 | 254 |
| 421 | iso_pu_bacteria | 2791355260 | 2793320144 | 254 |
| 422 | iso_pu_bacteria | 2791355261 | 2793328229 | 254 |
| 423 | iso_pu_bacteria | 2791355262 | 2793332571 | 254 |
| 424 | iso_pu_bacteria | 2791355263 | 2793343191 | 254 |
| 425 | iso_pu_bacteria | 2791355264 | 2793350722 | 254 |
| 426 | iso_pu_bacteria | 2791355265 | 2793353243 | 254 |
| 427 | iso_pu_bacteria | 2791355266 | 2793361037 | 254 |
| 428 | iso_pu_bacteria | 2791355267 | 2793364822 | 254 |
| 429 | iso_pu_bacteria | 2802429268 | 2804751046 | 254 |
| 430 | iso_pu_bacteria | 2802429605 | 2805927442 | 254 |
| 431 | iso_pu_bacteria | 2802429633 | 2806043994 | 254 |
| 432 | iso_pu_bacteria | 2802429634 | 2806052188 | 254 |
| 433 | iso_pu_bacteria | 2802429635 | 2806058489 | 254 |
| 434 | iso_pu_bacteria | 2802429636 | 2806066987 | 254 |
| 435 | iso_pu_bacteria | 2802429637 | 2806074730 | 254 |
| 436 | iso_pu_bacteria | 2808606387 | 2808986335 | 254 |
| 437 | iso_pu_bacteria | 2818991439 | 2819556467 | 254 |
| 438 | iso_pu_bacteria | 2818991448 | 2819608274 | 254 |
| 439 | iso_pu_bacteria | 2818991453 | 2819643460 | 254 |
| 440 | iso_pu_bacteria | 2838016132 | 2838022093 | 254 |
| 441 | iso_pu_bacteria | 2838022645 | 2838028984 | 254 |
| 442 | iso_pu_bacteria | 2838029111 | 2838029163 | 254 |
| 443 | iso_pu_bacteria | 2838042994 | 2838047238 | 254 |
| 444 | iso_pu_bacteria | 2838048938 | 2838053947 | 254 |
| 445 | iso_pu_bacteria | 2838061910 | 2838066718 | 254 |
| 446 | iso_pu_bacteria | 2838068647 | 2838073775 | 254 |
| 447 | iso_pu_bacteria | 2838668709 | 2838673205 | 254 |
| 448 | iso_pu_bacteria | 2838675328 | 2838677196 | 254 |
| 449 | iso_pu_bacteria | 2838680041 | 2838680737 | 254 |
| 450 | iso_pu_bacteria | 2838686498 | 2838692603 | 254 |
| 451 | iso_pu_bacteria | 2838694306 | 2838695230 | 254 |
| 452 | iso_pu_bacteria | 2838701080 | 2838704007 | 254 |
| 453 | iso_pu_bacteria | 2838707686 | 2838708606 | 254 |
| 454 | iso_pu_bacteria | 2838714209 | 2838716084 | 254 |
| 455 | iso_pu_bacteria | 2838719591 | 2838720116 | 254 |
| 456 | iso_pu_bacteria | 2838724970 | 2838726836 | 254 |
| 457 | iso_pu_bacteria | 2838729681 | 2838732675 | 254 |
| 458 | iso_pu_bacteria | 2838742623 | 2838745570 | 254 |
| 459 | iso_pu_bacteria | 2841846520 | 2841847050 | 254 |
| 460 | iso_pu_bacteria | 2841851746 | 2841855214 | 254 |
| 461 | iso_pu_bacteria | 2841864319 | 2841866665 | 254 |
| 462 | iso_pu_bacteria | 2842077413 | 2842080159 | 254 |
| 463 | iso_pu_bacteria | 2842118031 | 2842120779 | 254 |
| 464 | iso_pu_bacteria | 2842124991 | 2842126921 | 254 |
| 465 | iso_pu_bacteria | 2842130223 | 2842132089 | 254 |
| 466 | iso_pu_bacteria | 2842146304 | 2842148201 | 254 |
| 467 | iso_pu_bacteria | 2842152218 | 2842152742 | 254 |
| 468 | iso_pu_bacteria | 2842156927 | 2842161756 | 254 |
| 469 | iso_pu_bacteria | 2842163707 | 2842170155 | 254 |
| 470 | iso_pu_bacteria | 2842170452 | 2842172329 | 254 |
| 471 | iso_pu_bacteria | 2842175837 | 2842176361 | 254 |
| 472 | iso_pu_bacteria | 2842180545 | 2842185373 | 254 |
| 473 | iso_pu_bacteria | 2842187318 | 2842189191 | 254 |
| 474 | iso_pu_bacteria | 2842192696 | 2842193046 | 254 |
| 475 | iso_pu_bacteria | 2842198810 | 2842205087 | 254 |
| 476 | iso_pu_bacteria | 2842205361 | 2842206792 | 254 |
| 477 | iso_pu_bacteria | 2842211629 | 2842213505 | 254 |
| 478 | iso_pu_bacteria | 2842224351 | 2842224877 | 254 |
| 479 | iso_pu_bacteria | 2842229732 | 2842233311 | 254 |
| 480 | iso_pu_bacteria | 2842237096 | 2842238018 | 254 |
| 481 | iso_pu_bacteria | 2842243621 | 2842248685 | 254 |
| 482 | iso_pu_bacteria | 2842250916 | 2842253267 | 254 |
| 483 | iso_pu_bacteria | 2842257432 | 2842261828 | 254 |
| 484 | iso_pu_bacteria | 2842264693 | 2842267302 | 254 |
| 485 | iso_pu_bacteria | 2842271015 | 2842277108 | 254 |
| 486 | iso_pu_bacteria | 2842278818 | 2842280515 | 254 |
| 487 | iso_pu_bacteria | 2842285085 | 2842289466 | 254 |
| 488 | iso_pu_bacteria | 2842291075 | 2842293819 | 254 |
| 489 | iso_pu_bacteria | 2842298080 | 2842300739 | 254 |
| 490 | iso_pu_bacteria | 2842304105 | 2842306334 | 254 |
| 491 | iso_pu_bacteria | 2842311132 | 2842312481 | 254 |
| 492 | iso_pu_bacteria | 2842317721 | 2842322372 | 254 |
| 493 | iso_pu_bacteria | 2842341865 | 2842342929 | 254 |
| 494 | iso_pu_bacteria | 2842357229 | 2842358142 | 254 |
| 495 | iso_pu_bacteria | 2842363717 | 2842369916 | 254 |
| 496 | iso_pu_bacteria | 2842370503 | 2842371200 | 254 |
| 497 | iso_pu_bacteria | 2842377471 | 2842380215 | 254 |
| 498 | iso_pu_bacteria | 2842384541 | 2842387287 | 254 |
| 499 | iso_pu_bacteria | 2842395702 | 2842400706 | 254 |
| 500 | iso_pu_bacteria | 2842402390 | 2842406814 | 254 |
| 501 | iso_pu_bacteria | 2842409023 | 2842413689 | 254 |
| 502 | iso_pu_bacteria | 2842415677 | 2842420348 | 254 |
| 503 | iso_pu_bacteria | 2842422224 | 2842427223 | 254 |
| 504 | iso_pu_bacteria | 2842428310 | 2842431446 | 254 |
| 505 | iso_pu_bacteria | 2842434925 | 2842437781 | 254 |
| 506 | iso_pu_bacteria | 2842441272 | 2842444596 | 254 |
| 507 | iso_pu_bacteria | 2842447887 | 2842450349 | 254 |
| 508 | iso_pu_bacteria | 2842462802 | 2842465576 | 254 |
| 509 | iso_pu_bacteria | 2842469257 | 2842472386 | 254 |
| 510 | iso_pu_bacteria | 2842475841 | 2842476407 | 254 |
| 511 | iso_pu_bacteria | 2842482326 | 2842482481 | 254 |
| 512 | iso_pu_bacteria | 2842489311 | 2842495043 | 254 |
| 513 | iso_pu_bacteria | 2842495871 | 2842500952 | 254 |
| 514 | iso_pu_bacteria | 2842502639 | 2842502691 | 254 |
| 515 | iso_pu_bacteria | 2842509118 | 2842509335 | 254 |
| 516 | iso_pu_bacteria | 2842515876 | 2842517206 | 254 |
| 517 | iso_pu_bacteria | 2842521101 | 2842526461 | 254 |
| 518 | iso_pu_bacteria | 2844454524 | 2844455829 | 254 |
| 519 | iso_pu_bacteria | 2847670302 | 2847672145 | 254 |
| 520 | iso_pu_bacteria | 2847686936 | 2847688490 | 254 |
| 521 | iso_pu_bacteria | 2852387548 | 2852388627 | 254 |
| 522 | iso_pu_bacteria | 2856314179 | 2856317062 | 254 |
| 523 | iso_pu_bacteria | 2871444079 | 2871450318 | 254 |
| 524 | iso_pu_bacteria | 2878035449 | 2878037303 | 254 |
| 525 | iso_pu_bacteria | 2878760144 | 2878761632 | 254 |
| 526 | iso_pu_bacteria | 2878767105 | 2878768599 | 254 |
| 527 | iso_pu_bacteria | 2881147464 | 2881154101 | 254 |
| 528 | iso_pu_bacteria | 2889790730 | 2889791247 | 254 |
| 529 | iso_pu_bacteria | 2889914905 | 2889920290 | 254 |
| 530 | iso_pu_bacteria | 2891048133 | 2891048191 | 254 |
| 531 | iso_pu_bacteria | 2899792073 | 2899792486 | 254 |
| 532 | iso_pu_bacteria | 2899845264 | 2899847924 | 254 |
| 533 | iso_pu_bacteria | 2903540706 | 2903542209 | 254 |
| 534 | iso_pu_bacteria | 2906328253 | 2906331652 | 254 |
| 535 | iso_pu_bacteria | 2906414383 | 2906417122 | 254 |
| 536 | iso_pu_bacteria | 2919114240 | 2919116287 | 254 |
| 537 | iso_pu_bacteria | 2919408235 | 2919408932 | 254 |
| 538 | iso_pu_bacteria | 2922158528 | 2922162372 | 254 |
| 539 | iso_pu_bacteria | 2923556063 | 2923557328 | 254 |
| 540 | iso_pu_bacteria | 2924726620 | 2924729823 | 254 |
| 541 | iso_pu_bacteria | 2926754445 | 2926757241 | 254 |
| 542 | iso_pu_bacteria | 2926760298 | 2926761455 | 254 |
| 543 | iso_pu_bacteria | 2929138655 | 2929139081 | 254 |
| 544 | iso_pu_bacteria | 2933006813 | 2933007387 | 254 |
| 545 | iso_pu_bacteria | 2933011516 | 2933012151 | 254 |
| 546 | iso_pu_bacteria | 2933570622 | 2933573403 | 254 |
| 547 | iso_pu_bacteria | 2933594066 | 2933594599 | 254 |
| 548 | iso_pu_bacteria | 2933599457 | 2933604203 | 254 |
| 549 | iso_pu_bacteria | 2935894831 | 2935895753 | 254 |
| 550 | iso_pu_bacteria | 2935901341 | 2935907794 | 254 |
| 551 | iso_pu_bacteria | 2936381700 | 2936387319 | 254 |
| 552 | iso_pu_bacteria | 2937891427 | 2937896788 | 254 |
| 553 | iso_pu_bacteria | 2937994558 | 2937996062 | 254 |
| 554 | iso_pu_bacteria | 2958115193 | 2958115817 | 254 |
| 555 | iso_pu_bacteria | 2958165035 | 2958166534 | 254 |
| 556 | iso_pu_bacteria | 2961163497 | 2961164999 | 254 |
| 557 | iso_pu_bacteria | 2965018300 | 2965019824 | 254 |
| 558 | iso_pu_bacteria | 2965062239 | 2965064051 | 254 |
| 559 | iso_pu_bacteria | 2968091066 | 2968095550 | 254 |
| 560 | iso_pu_bacteria | 2968097103 | 2968103349 | 254 |
| 561 | iso_pu_bacteria | 2968128360 | 2968132314 | 254 |
| 562 | iso_pu_bacteria | 2968171901 | 2968173399 | 254 |
| 563 | iso_pu_bacteria | 2970554993 | 2970556488 | 254 |
| 564 | iso_pu_bacteria | 2977858184 | 2977860811 | 254 |
| 565 | iso_pu_bacteria | 2979089926 | 2979093259 | 254 |
| 566 | iso_pu_bacteria | 2979095461 | 2979099356 | 254 |
| 567 | iso_pu_bacteria | 2979100975 | 2979105227 | 254 |
| 568 | iso_pu_bacteria | 2979779861 | 2979781985 | 254 |
| 569 | iso_pu_bacteria | 2984509177 | 2984512917 | 254 |
| 570 | iso_pu_bacteria | 2984518228 | 2984520719 | 254 |
| 571 | iso_pu_bacteria | 2984537506 | 2984540012 | 254 |
| 572 | iso_pu_bacteria | 2984601300 | 2984602202 | 254 |
| 573 | iso_pu_bacteria | 2987659509 | 2987661006 | 254 |
| 574 | iso_pu_bacteria | 2996341866 | 2996342400 | 254 |
| 575 | iso_pu_bacteria | 2996887358 | 2996892051 | 254 |
| 576 | iso_pu_bacteria | 2996893221 | 2996893596 | 254 |
| 577 | iso_pu_bacteria | 3004188549 | 3004190056 | 254 |
| 578 | iso_pu_bacteria | 3005416602 | 3005422679 | 254 |
| 579 | iso_pu_bacteria | 3005445848 | 3005446310 | 254 |
| 580 | iso_pu_bacteria | 650716007 | 650739080 | 254 |
| 581 | iso_pu_bacteria | 8003570095 | 8003572712 | 254 |
| 582 | iso_pu_bacteria | 8004445564 | 8004446911 | 254 |
| 583 | iso_pu_bacteria | 8004703790 | 8004704056 | 254 |
| 584 | iso_pu_bacteria | 8005258706 | 8005263623 | 254 |
| 585 | iso_pu_bacteria | 8005275841 | 8005279034 | 254 |
| 586 | iso_pu_bacteria | 8005282627 | 8005283723 | 254 |
| 587 | iso_pu_bacteria | 8005289223 | 8005291855 | 254 |
| 588 | iso_pu_bacteria | 8005301065 | 8005303988 | 254 |
| 589 | iso_pu_bacteria | 8005307578 | 8005308807 | 254 |
| 590 | iso_pu_bacteria | 8005314921 | 8005321785 | 254 |
| 591 | iso_pu_bacteria | 8005321885 | 8005326578 | 254 |
| 592 | iso_pu_bacteria | 8005382845 | 8005387150 | 254 |
| 593 | iso_pu_bacteria | 8005395548 | 8005401910 | 254 |
| 594 | iso_pu_bacteria | 8005430974 | 8005433072 | 254 |
| 595 | iso_pu_bacteria | 8005497431 | 8005498799 | 254 |
| 596 | iso_pu_bacteria | 8005542996 | 8005543907 | 254 |
| 597 | iso_pu_bacteria | 8005570704 | 8005577071 | 254 |
| 598 | iso_pu_bacteria | 8005619151 | 8005619992 | 254 |
| 599 | iso_pu_bacteria | 8005626139 | 8005628591 | 254 |
| 600 | iso_pu_bacteria | 8005645114 | 8005646605 | 254 |
| 601 | iso_pu_bacteria | 8005668836 | 8005670210 | 254 |
| 602 | iso_pu_bacteria | 8005682033 | 8005684984 | 254 |
| 603 | iso_pu_bacteria | 8005688590 | 8005690414 | 254 |
| 604 | iso_pu_bacteria | 8005695170 | 8005697950 | 254 |
| 605 | iso_pu_bacteria | 8018127388 | 8018133269 | 254 |
| 606 | iso_pu_bacteria | 8018176218 | 8018181227 | 254 |
| 607 | iso_pu_bacteria | 8023680758 | 8023684065 | 254 |
| 608 | iso_pu_bacteria | 8024501048 | 8024503535 | 254 |
| 609 | iso_pu_bacteria | 8046767195 | 8046771037 | 254 |
| 610 | iso_pu_bacteria | 8054460903 | 8054461408 | 254 |
| 611 | iso_pu_bacteria | 8056375014 | 8056375779 | 254 |
| 612 | iso_pu_bacteria | 8056382006 | 8056386096 | 254 |
| 613 | iso_pu_bacteria | 8057575449 | 8057579801 | 254 |
| 614 | 3300003323 | rootH1_10105424 | rootH1_101054242 | 255 |
| 615 | 3300025230 | Ga0209563_101762 | Ga0209563_1017625 | 255 |
| 616 | 3300031911 | Ga0307412_10052489 | Ga0307412_100524894 | 255 |
| 617 | 3300031911 | Ga0307412_10518148 | Ga0307412_105181482 | 255 |
| 618 | 3300037418 | Ga0395900_0256769 | Ga0395900_0256769_45_839 | 255 |
| 619 | 3300037418 | Ga0395900_0612283 | Ga0395900_0612283_187_978 | 255 |
| 620 | 3300038443 | Ga0395901_0197637 | Ga0395901_0197637_190_984 | 255 |
| 621 | 3300048925 | Ga0496122_0000009 | Ga0496122_0000009_393631_394419 | 255 |
| 622 | 3300048926 | Ga0496123_0000020 | Ga0496123_0000020_198083_198871 | 255 |
| 623 | 3300048927 | Ga0496124_0020386 | Ga0496124_0020386_4067_4855 | 255 |
| 624 | 3300049568 | Ga0501031_0060236 | Ga0501031_0060236_1237_2013 | 255 |
| 625 | 3300049569 | Ga0501032_0165083 | Ga0501032_0165083_516_1304 | 255 |
| 626 | 3300049570 | Ga0501033_0000171 | Ga0501033_0000171_48352_49140 | 255 |
| 627 | 3300049575 | Ga0501039_0216351 | Ga0501039_0216351_59_835 | 255 |
| 628 | 3300049822 | Ga0501035_0000841 | Ga0501035_0000841_12750_13538 | 255 |
| 629 | 3300053125 | Ga0500618_003524 | Ga0500618_003524_2866_3684 | 255 |
| 630 | iso_pu_bacteria | 2510461069 | 2510839893 | 255 |
| 631 | iso_pu_bacteria | 2599185156 | 2599333175 | 255 |
| 632 | iso_pu_bacteria | 2738541317 | 2738945726 | 255 |
| 633 | iso_pu_bacteria | 2821123053 | 2821123767 | 255 |
| 634 | iso_pu_bacteria | 2838736955 | 2838739203 | 255 |
| 635 | iso_pu_bacteria | 2841840854 | 2841843101 | 255 |
| 636 | iso_pu_bacteria | 2842140634 | 2842142883 | 255 |
| 637 | iso_pu_bacteria | 2857531043 | 2857531329 | 255 |
| 638 | iso_pu_bacteria | 2891373044 | 2891376293 | 255 |
| 639 | iso_pu_bacteria | 2913308742 | 2913310592 | 255 |
| 640 | 3300003775 | Ga0055524_1001469 | Ga0055524_100146914 | 256 |
| 641 | 3300022740 | Ga0228710_1000031 | Ga0228710_100003153 | 256 |
| 642 | 3300025294 | Ga0209025_1065985 | Ga0209025_10659852 | 256 |
| 643 | 3300025299 | Ga0209256_1000169 | Ga0209256_100016968 | 256 |
| 644 | 3300027111 | Ga0209281_1000155 | Ga0209281_100015554 | 256 |
| 645 | 3300027666 | Ga0209282_1000025 | Ga0209282_1000025110 | 256 |
| 646 | 3300031967 | Ga0315914_1000020 | Ga0315914_1000020109 | 256 |
| 647 | 3300033430 | Ga0315913_1000013 | Ga0315913_100001312 | 256 |
| 648 | 3300033464 | Ga0315915_1000015 | Ga0315915_100001553 | 256 |
| 649 | 3300041411 | Ga0439466_0068082 | Ga0439466_0068082_279_1052 | 256 |
| 650 | 3300041494 | Ga0451837_0118587 | Ga0451837_0118587_166_936 | 256 |
| 651 | 3300049568 | Ga0501031_0000015 | Ga0501031_0000015_30635_31432 | 256 |
| 652 | 3300049569 | Ga0501032_0000008 | Ga0501032_0000008_176428_177225 | 256 |
| 653 | 3300049570 | Ga0501033_0000012 | Ga0501033_0000012_64400_65197 | 256 |
| 654 | 3300049571 | Ga0501034_0000035 | Ga0501034_0000035_64399_65196 | 256 |
| 655 | 3300049572 | Ga0501036_0000006 | Ga0501036_0000006_64399_65196 | 256 |
| 656 | 3300049573 | Ga0501037_0000115 | Ga0501037_0000115_9742_10539 | 256 |
| 657 | 3300049574 | Ga0501038_0000007 | Ga0501038_0000007_176428_177225 | 256 |
| 658 | 3300049575 | Ga0501039_0000012 | Ga0501039_0000012_64399_65196 | 256 |
| 659 | 3300049579 | Ga0501043_0000432 | Ga0501043_0000432_23232_24029 | 256 |
| 660 | 3300049580 | Ga0501046_0076549 | Ga0501046_0076549_356_1153 | 256 |
| 661 | 3300049581 | Ga0501047_0001526 | Ga0501047_0001526_12194_12991 | 256 |
| 662 | 3300049586 | Ga0501070_0005611 | Ga0501070_0005611_1970_2767 | 256 |
| 663 | 3300049822 | Ga0501035_0000192 | Ga0501035_0000192_64399_65196 | 256 |
| 664 | 3300049823 | Ga0501044_0000015 | Ga0501044_0000015_176428_177225 | 256 |
| 665 | iso_pu_bacteria | 2791355091 | 2792622319 | 256 |
| 666 | iso_pu_bacteria | 2791355092 | 2792628115 | 256 |
| 667 | 3300002987 | JGI25159J45721_1000021 | JGI25159J45721_100002151 | 257 |
| 668 | 3300003354 | JGI25160J50197_1000002 | JGI25160J50197_1000002346 | 257 |
| 669 | 3300003374 | JGI25161J50226_1001106 | JGI25161J50226_10011069 | 257 |
| 670 | 3300003771 | Ga0055526_1001512 | Ga0055526_100151215 | 257 |
| 671 | 3300003781 | Ga0055536_1011977 | Ga0055536_10119773 | 257 |
| 672 | 3300003794 | Ga0055531_10007471 | Ga0055531_100074715 | 257 |
| 673 | 3300004625 | Ga0055543_1000010 | Ga0055543_100001037 | 257 |
| 674 | 3300005262 | Ga0065165_1000004 | Ga0065165_100000432 | 257 |
| 675 | 3300005331 | Ga0070670_100000811 | Ga0070670_10000081114 | 257 |
| 676 | 3300013249 | Ga0171463_1001 | Ga0171463_1001560 | 257 |
| 677 | 3300015690 | Ga0183363_1067 | Ga0183363_10678 | 257 |
| 678 | 3300025208 | Ga0209436_102216 | Ga0209436_1022165 | 257 |
| 679 | 3300025284 | Ga0209130_1000008 | Ga0209130_1000008198 | 257 |
| 680 | 3300025292 | Ga0209676_1007603 | Ga0209676_10076032 | 257 |
| 681 | 3300025294 | Ga0209025_1000425 | Ga0209025_100042516 | 257 |
| 682 | 3300025295 | Ga0209564_1000091 | Ga0209564_100009135 | 257 |
| 683 | 3300025298 | Ga0209050_1026838 | Ga0209050_10268382 | 257 |
| 684 | 3300025299 | Ga0209256_1004334 | Ga0209256_10043342 | 257 |
| 685 | 3300025302 | Ga0207426_1000016 | Ga0207426_1000016363 | 257 |
| 686 | 3300025303 | Ga0209051_1051502 | Ga0209051_10515022 | 257 |
| 687 | 3300025304 | Ga0209257_1006311 | Ga0209257_10063115 | 257 |
| 688 | 3300025925 | Ga0207650_10017791 | Ga0207650_100177913 | 257 |
| 689 | 3300028794 | Ga0307515_10003734 | Ga0307515_100037346 | 257 |
| 690 | 3300046459 | Ga0495629_0011919 | Ga0495629_0011919_1610_2383 | 257 |
| 691 | 3300046462 | Ga0495651_0245225 | Ga0495651_0245225_409_1182 | 257 |
| 692 | 3300046477 | Ga0495664_0077397 | Ga0495664_0077397_781_1554 | 257 |
| 693 | 3300046507 | Ga0495606_0015417 | Ga0495606_0015417_524_1297 | 257 |
| 694 | 3300046533 | Ga0495640_0085525 | Ga0495640_0085525_877_1650 | 257 |
| 695 | 3300046557 | Ga0495622_0008297 | Ga0495622_0008297_1258_2031 | 257 |
| 696 | 3300046663 | Ga0495635_0147235 | Ga0495635_0147235_115_888 | 257 |
| 697 | 3300046809 | Ga0495600_0055009 | Ga0495600_0055009_349_1122 | 257 |
| 698 | 3300047317 | Ga0495604_0108265 | Ga0495604_0108265_506_1279 | 257 |
| 699 | 3300047321 | Ga0495676_0416192 | Ga0495676_0416192_61_834 | 257 |
| 700 | 3300047472 | Ga0495686_0004080 | Ga0495686_0004080_8504_9277 | 257 |
| 701 | 3300047472 | Ga0495686_0013054 | Ga0495686_0013054_4634_5407 | 257 |
| 702 | 3300048914 | Ga0496111_0020904 | Ga0496111_0020904_1131_1925 | 257 |
| 703 | 3300048924 | Ga0496121_0191521 | Ga0496121_0191521_13_786 | 257 |
| 704 | 3300048926 | Ga0496123_0006783 | Ga0496123_0006783_7415_8209 | 257 |
| 705 | 3300048927 | Ga0496124_0076212 | Ga0496124_0076212_1824_2618 | 257 |
| 706 | 3300049568 | Ga0501031_0030172 | Ga0501031_0030172_233_1027 | 257 |
| 707 | 3300049568 | Ga0501031_0073596 | Ga0501031_0073596_1198_1992 | 257 |
| 708 | 3300049569 | Ga0501032_0029169 | Ga0501032_0029169_76_870 | 257 |
| 709 | 3300049570 | Ga0501033_0022307 | Ga0501033_0022307_2367_3164 | 257 |
| 710 | 3300049570 | Ga0501033_0210965 | Ga0501033_0210965_463_1272 | 257 |
| 711 | 3300049570 | Ga0501033_0220972 | Ga0501033_0220972_489_1283 | 257 |
| 712 | 3300049570 | Ga0501033_0342566 | Ga0501033_0342566_198_1007 | 257 |
| 713 | 3300049571 | Ga0501034_0034706 | Ga0501034_0034706_200_994 | 257 |
| 714 | 3300049571 | Ga0501034_0221040 | Ga0501034_0221040_429_1223 | 257 |
| 715 | 3300049572 | Ga0501036_0023150 | Ga0501036_0023150_2749_3543 | 257 |
| 716 | 3300049572 | Ga0501036_0092032 | Ga0501036_0092032_82_876 | 257 |
| 717 | 3300049572 | Ga0501036_0245676 | Ga0501036_0245676_208_981 | 257 |
| 718 | 3300049574 | Ga0501038_0057841 | Ga0501038_0057841_1695_2489 | 257 |
| 719 | 3300049575 | Ga0501039_0190999 | Ga0501039_0190999_233_1027 | 257 |
| 720 | 3300049575 | Ga0501039_0223360 | Ga0501039_0223360_233_1027 | 257 |
| 721 | 3300049576 | Ga0501040_0197566 | Ga0501040_0197566_420_1214 | 257 |
| 722 | 3300049579 | Ga0501043_0047378 | Ga0501043_0047378_1344_2138 | 257 |
| 723 | 3300049579 | Ga0501043_0082467 | Ga0501043_0082467_1273_2067 | 257 |
| 724 | 3300049579 | Ga0501043_0164230 | Ga0501043_0164230_189_962 | 257 |
| 725 | 3300049580 | Ga0501046_0195178 | Ga0501046_0195178_534_1328 | 257 |
| 726 | 3300049580 | Ga0501046_0246984 | Ga0501046_0246984_370_1143 | 257 |
| 727 | 3300049586 | Ga0501070_0096215 | Ga0501070_0096215_756_1550 | 257 |
| 728 | 3300049586 | Ga0501070_0333597 | Ga0501070_0333597_137_931 | 257 |
| 729 | 3300049589 | Ga0501073_0152578 | Ga0501073_0152578_233_1006 | 257 |
| 730 | 3300049590 | Ga0501074_0162779 | Ga0501074_0162779_672_1466 | 257 |
| 731 | 3300049742 | Ga0501080_0038118 | Ga0501080_0038118_2513_3286 | 257 |
| 732 | 3300049742 | Ga0501080_0662977 | Ga0501080_0662977_91_885 | 257 |
| 733 | 3300049744 | Ga0501083_0184099 | Ga0501083_0184099_289_1062 | 257 |
| 734 | 3300049822 | Ga0501035_0075661 | Ga0501035_0075661_1695_2489 | 257 |
| 735 | 3300049822 | Ga0501035_0099965 | Ga0501035_0099965_66_860 | 257 |
| 736 | 3300049822 | Ga0501035_0134546 | Ga0501035_0134546_552_1325 | 257 |
| 737 | 3300049823 | Ga0501044_0114298 | Ga0501044_0114298_629_1423 | 257 |
| 738 | 3300049823 | Ga0501044_0199922 | Ga0501044_0199922_197_970 | 257 |
| 739 | 3300049824 | Ga0501045_0255171 | Ga0501045_0255171_281_1075 | 257 |
| 740 | 3300053085 | Ga0495619_0026578 | Ga0495619_0026578_315_1088 | 257 |
| 741 | 3300053123 | Ga0500614_017776 | Ga0500614_017776_496_1269 | 257 |
| 742 | 3300053125 | Ga0500618_019728 | Ga0500618_019728_449_1222 | 257 |
| 743 | 3300053148 | Ga0500590_000811 | Ga0500590_000811_338_1111 | 257 |
| 744 | 3300053158 | Ga0500627_0018742 | Ga0500627_0018742_1208_2008 | 257 |
| 745 | iso_pu_bacteria | 2599185352 | 2600191595 | 257 |
| 746 | iso_pu_bacteria | 2643221723 | 2644673892 | 257 |
| 747 | iso_pu_bacteria | 8049293176 | 8049293622 | 257 |
| 748 | 3300002704 | JGI25155J39150_1000006 | JGI25155J39150_1000006194 | 258 |
| 749 | 3300002705 | JGI25156J39149_1000019 | JGI25156J39149_100001953 | 258 |
| 750 | 3300002737 | JGI25162J39368_1001875 | JGI25162J39368_10018759 | 258 |
| 751 | 3300002737 | JGI25162J39368_1002018 | JGI25162J39368_10020188 | 258 |
| 752 | 3300002738 | JGI25154J39366_1000365 | JGI25154J39366_100036514 | 258 |
| 753 | 3300002741 | JGI25157J39369_1000024 | JGI25157J39369_1000024111 | 258 |
| 754 | 3300002773 | JGI25152J39213_1001364 | JGI25152J39213_10013649 | 258 |
| 755 | 3300002773 | JGI25152J39213_1001530 | JGI25152J39213_10015304 | 258 |
| 756 | 3300002774 | JGI25150J39212_1000042 | JGI25150J39212_100004219 | 258 |
| 757 | 3300003187 | JGI25151J46595_10000099 | JGI25151J46595_1000009960 | 258 |
| 758 | 3300003187 | JGI25151J46595_10001860 | JGI25151J46595_100018605 | 258 |
| 759 | 3300003214 | JGI25165J46597_1001938 | JGI25165J46597_10019382 | 258 |
| 760 | 3300003214 | JGI25165J46597_1002939 | JGI25165J46597_10029393 | 258 |
| 761 | 3300003214 | JGI25165J46597_1004195 | JGI25165J46597_10041954 | 258 |
| 762 | 3300003215 | JGI25153J46596_10000761 | JGI25153J46596_1000076114 | 258 |
| 763 | 3300003215 | JGI25153J46596_10049148 | JGI25153J46596_100491482 | 258 |
| 764 | 3300003215 | JGI25153J46596_10051263 | JGI25153J46596_100512632 | 258 |
| 765 | 3300003316 | rootH1_10044780 | rootH1_100447803 | 258 |
| 766 | 3300003316 | rootH1_10104610 | rootH1_101046102 | 258 |
| 767 | 3300003320 | rootH2_10120526 | rootH2_101205262 | 258 |
| 768 | 3300003320 | rootH2_10256542 | rootH2_102565422 | 258 |
| 769 | 3300003322 | rootL2_10115041 | rootL2_101150416 | 258 |
| 770 | 3300003323 | rootH1_10035118 | rootH1_100351182 | 258 |
| 771 | 3300003323 | rootH1_10178534 | rootH1_101785341 | 258 |
| 772 | 3300003323 | rootH1_10209197 | rootH1_102091971 | 258 |
| 773 | 3300003354 | JGI25160J50197_1000261 | JGI25160J50197_100026130 | 258 |
| 774 | 3300003354 | JGI25160J50197_1001976 | JGI25160J50197_10019764 | 258 |
| 775 | 3300003354 | JGI25160J50197_1008147 | JGI25160J50197_10081474 | 258 |
| 776 | 3300003354 | JGI25160J50197_1031131 | JGI25160J50197_10311312 | 258 |
| 777 | 3300003374 | JGI25161J50226_1000195 | JGI25161J50226_100019530 | 258 |
| 778 | 3300003374 | JGI25161J50226_1001515 | JGI25161J50226_10015153 | 258 |
| 779 | 3300003771 | Ga0055526_1010009 | Ga0055526_10100092 | 258 |
| 780 | 3300003771 | Ga0055526_1019591 | Ga0055526_10195912 | 258 |
| 781 | 3300003771 | Ga0055526_1025637 | Ga0055526_10256373 | 258 |
| 782 | 3300003775 | Ga0055524_1010290 | Ga0055524_10102902 | 258 |
| 783 | 3300003775 | Ga0055524_1022698 | Ga0055524_10226982 | 258 |
| 784 | 3300003775 | Ga0055524_1025794 | Ga0055524_10257943 | 258 |
| 785 | 3300003775 | Ga0055524_1031336 | Ga0055524_10313362 | 258 |
| 786 | 3300003790 | Ga0055528_1007710 | Ga0055528_10077104 | 258 |
| 787 | 3300003790 | Ga0055528_1010543 | Ga0055528_10105434 | 258 |
| 788 | 3300003790 | Ga0055528_1011212 | Ga0055528_10112123 | 258 |
| 789 | 3300003790 | Ga0055528_1016523 | Ga0055528_10165231 | 258 |
| 790 | 3300003792 | Ga0055540_1035773 | Ga0055540_10357732 | 258 |
| 791 | 3300003856 | Ga0058692_1005505 | Ga0058692_10055052 | 258 |
| 792 | 3300004625 | Ga0055543_1000215 | Ga0055543_100021540 | 258 |
| 793 | 3300004625 | Ga0055543_1000358 | Ga0055543_100035819 | 258 |
| 794 | 3300004625 | Ga0055543_1000923 | Ga0055543_100092313 | 258 |
| 795 | 3300005262 | Ga0065165_1002152 | Ga0065165_10021524 | 258 |
| 796 | 3300005262 | Ga0065165_1012112 | Ga0065165_10121123 | 258 |
| 797 | 3300005262 | Ga0065165_1035815 | Ga0065165_10358152 | 258 |
| 798 | 3300005335 | Ga0070666_10013250 | Ga0070666_100132503 | 258 |
| 799 | 3300005355 | Ga0070671_100024251 | Ga0070671_1000242514 | 258 |
| 800 | 3300005367 | Ga0070667_100456539 | Ga0070667_1004565392 | 258 |
| 801 | 3300005548 | Ga0070665_100050865 | Ga0070665_1000508655 | 258 |
| 802 | 3300005548 | Ga0070665_100053285 | Ga0070665_1000532853 | 258 |
| 803 | 3300005563 | Ga0068855_100154182 | Ga0068855_1001541822 | 258 |
| 804 | 3300005614 | Ga0068856_100162434 | Ga0068856_1001624343 | 258 |
| 805 | 3300005616 | Ga0068852_100026503 | Ga0068852_1000265032 | 258 |
| 806 | 3300006038 | Ga0075365_10000341 | Ga0075365_100003419 | 258 |
| 807 | 3300006038 | Ga0075365_10067790 | Ga0075365_100677903 | 258 |
| 808 | 3300006038 | Ga0075365_10113509 | Ga0075365_101135093 | 258 |
| 809 | 3300006048 | Ga0075363_100147911 | Ga0075363_1001479111 | 258 |
| 810 | 3300006051 | Ga0075364_10087839 | Ga0075364_100878392 | 258 |
| 811 | 3300006177 | Ga0075362_10007439 | Ga0075362_100074392 | 258 |
| 812 | 3300006178 | Ga0075367_10017298 | Ga0075367_100172982 | 258 |
| 813 | 3300006178 | Ga0075367_10042032 | Ga0075367_100420322 | 258 |
| 814 | 3300006186 | Ga0075369_10001103 | Ga0075369_100011033 | 258 |
| 815 | 3300006186 | Ga0075369_10019551 | Ga0075369_100195514 | 258 |
| 816 | 3300006195 | Ga0075366_10003971 | Ga0075366_100039715 | 258 |
| 817 | 3300006353 | Ga0075370_10016276 | Ga0075370_100162763 | 258 |
| 818 | 3300006946 | Ga0079104_1000210 | Ga0079104_100021023 | 258 |
| 819 | 3300006948 | Ga0099826_10003316 | Ga0099826_1000331610 | 258 |
| 820 | 3300009011 | Ga0105251_10020730 | Ga0105251_100207303 | 258 |
| 821 | 3300009036 | Ga0105244_10110060 | Ga0105244_101100601 | 258 |
| 822 | 3300009092 | Ga0105250_10019885 | Ga0105250_100198853 | 258 |
| 823 | 3300009093 | Ga0105240_10000027 | Ga0105240_1000002733 | 258 |
| 824 | 3300009148 | Ga0105243_10091152 | Ga0105243_100911524 | 258 |
| 825 | 3300009545 | Ga0105237_10000508 | Ga0105237_1000050821 | 258 |
| 826 | 3300009763 | Ga0123340_1046711 | Ga0123340_10467112 | 258 |
| 827 | 3300009763 | Ga0123340_1046783 | Ga0123340_10467832 | 258 |
| 828 | 3300009765 | Ga0123341_1000027 | Ga0123341_100002737 | 258 |
| 829 | 3300009765 | Ga0123341_1049686 | Ga0123341_10496862 | 258 |
| 830 | 3300009765 | Ga0123341_1050067 | Ga0123341_10500672 | 258 |
| 831 | 3300009766 | Ga0123342_1023186 | Ga0123342_10231864 | 258 |
| 832 | 3300010375 | Ga0105239_10002593 | Ga0105239_100025935 | 258 |
| 833 | 3300011119 | Ga0105246_10096120 | Ga0105246_100961203 | 258 |
| 834 | 3300013100 | Ga0157373_10014166 | Ga0157373_100141662 | 258 |
| 835 | 3300013102 | Ga0157371_10000058 | Ga0157371_1000005834 | 258 |
| 836 | 3300013104 | Ga0157370_10000048 | Ga0157370_1000004814 | 258 |
| 837 | 3300013104 | Ga0157370_10000792 | Ga0157370_100007925 | 258 |
| 838 | 3300013105 | Ga0157369_10326090 | Ga0157369_103260902 | 258 |
| 839 | 3300014325 | Ga0163163_10405133 | Ga0163163_104051332 | 258 |
| 840 | 3300015262 | Ga0182007_10001900 | Ga0182007_100019003 | 258 |
| 841 | 3300021320 | Ga0214544_1000008 | Ga0214544_1000008229 | 258 |
| 842 | 3300021321 | Ga0214542_1000010 | Ga0214542_1000010186 | 258 |
| 843 | 3300021327 | Ga0214543_1000004 | Ga0214543_1000004208 | 258 |
| 844 | 3300025206 | Ga0209435_100011 | Ga0209435_100011191 | 258 |
| 845 | 3300025233 | Ga0209437_100036 | Ga0209437_100036159 | 258 |
| 846 | 3300025233 | Ga0209437_100086 | Ga0209437_10008689 | 258 |
| 847 | 3300025245 | Ga0207425_1000012 | Ga0207425_1000012481 | 258 |
| 848 | 3300025245 | Ga0207425_1010289 | Ga0207425_10102893 | 258 |
| 849 | 3300025245 | Ga0207425_1028887 | Ga0207425_10288871 | 258 |
| 850 | 3300025246 | Ga0209646_1000024 | Ga0209646_1000024220 | 258 |
| 851 | 3300025250 | Ga0209026_1000030 | Ga0209026_1000030220 | 258 |
| 852 | 3300025253 | Ga0209677_100177 | Ga0209677_10017726 | 258 |
| 853 | 3300025254 | Ga0209148_1009921 | Ga0209148_10099211 | 258 |
| 854 | 3300025256 | Ga0209759_1000011 | Ga0209759_1000011191 | 258 |
| 855 | 3300025258 | Ga0209129_1000086 | Ga0209129_100008661 | 258 |
| 856 | 3300025258 | Ga0209129_1001065 | Ga0209129_100106515 | 258 |
| 857 | 3300025258 | Ga0209129_1001501 | Ga0209129_10015014 | 258 |
| 858 | 3300025258 | Ga0209129_1003602 | Ga0209129_10036029 | 258 |
| 859 | 3300025258 | Ga0209129_1003829 | Ga0209129_10038292 | 258 |
| 860 | 3300025258 | Ga0209129_1013324 | Ga0209129_10133242 | 258 |
| 861 | 3300025261 | Ga0209233_1000056 | Ga0209233_1000056433 | 258 |
| 862 | 3300025261 | Ga0209233_1000110 | Ga0209233_1000110159 | 258 |
| 863 | 3300025261 | Ga0209233_1000640 | Ga0209233_100064014 | 258 |
| 864 | 3300025263 | Ga0209565_1017396 | Ga0209565_10173962 | 258 |
| 865 | 3300025272 | Ga0209455_1003068 | Ga0209455_10030686 | 258 |
| 866 | 3300025273 | Ga0209673_1000091 | Ga0209673_100009197 | 258 |
| 867 | 3300025273 | Ga0209673_1001847 | Ga0209673_10018476 | 258 |
| 868 | 3300025273 | Ga0209673_1002257 | Ga0209673_100225710 | 258 |
| 869 | 3300025273 | Ga0209673_1003203 | Ga0209673_10032037 | 258 |
| 870 | 3300025273 | Ga0209673_1003816 | Ga0209673_10038165 | 258 |
| 871 | 3300025273 | Ga0209673_1007275 | Ga0209673_10072756 | 258 |
| 872 | 3300025273 | Ga0209673_1027782 | Ga0209673_10277822 | 258 |
| 873 | 3300025284 | Ga0209130_1000013 | Ga0209130_100001329 | 258 |
| 874 | 3300025284 | Ga0209130_1000015 | Ga0209130_1000015335 | 258 |
| 875 | 3300025284 | Ga0209130_1006718 | Ga0209130_10067185 | 258 |
| 876 | 3300025291 | Ga0209675_1011574 | Ga0209675_10115744 | 258 |
| 877 | 3300025292 | Ga0209676_1023318 | Ga0209676_10233181 | 258 |
| 878 | 3300025294 | Ga0209025_1000024 | Ga0209025_1000024481 | 258 |
| 879 | 3300025294 | Ga0209025_1000118 | Ga0209025_100011852 | 258 |
| 880 | 3300025294 | Ga0209025_1000549 | Ga0209025_100054923 | 258 |
| 881 | 3300025294 | Ga0209025_1003170 | Ga0209025_10031708 | 258 |
| 882 | 3300025294 | Ga0209025_1005506 | Ga0209025_10055069 | 258 |
| 883 | 3300025294 | Ga0209025_1009578 | Ga0209025_10095784 | 258 |
| 884 | 3300025294 | Ga0209025_1050792 | Ga0209025_10507922 | 258 |
| 885 | 3300025295 | Ga0209564_1000398 | Ga0209564_100039813 | 258 |
| 886 | 3300025295 | Ga0209564_1001660 | Ga0209564_100166013 | 258 |
| 887 | 3300025295 | Ga0209564_1001988 | Ga0209564_10019889 | 258 |
| 888 | 3300025295 | Ga0209564_1049257 | Ga0209564_10492572 | 258 |
| 889 | 3300025297 | Ga0209758_1000046 | Ga0209758_100004661 | 258 |
| 890 | 3300025297 | Ga0209758_1000325 | Ga0209758_100032535 | 258 |
| 891 | 3300025297 | Ga0209758_1001929 | Ga0209758_100192913 | 258 |
| 892 | 3300025297 | Ga0209758_1003374 | Ga0209758_100337411 | 258 |
| 893 | 3300025297 | Ga0209758_1007852 | Ga0209758_10078523 | 258 |
| 894 | 3300025297 | Ga0209758_1019346 | Ga0209758_10193465 | 258 |
| 895 | 3300025298 | Ga0209050_1013538 | Ga0209050_10135382 | 258 |
| 896 | 3300025299 | Ga0209256_1001486 | Ga0209256_10014869 | 258 |
| 897 | 3300025299 | Ga0209256_1003791 | Ga0209256_100379111 | 258 |
| 898 | 3300025299 | Ga0209256_1005505 | Ga0209256_10055055 | 258 |
| 899 | 3300025299 | Ga0209256_1031006 | Ga0209256_10310063 | 258 |
| 900 | 3300025302 | Ga0207426_1000063 | Ga0207426_100006371 | 258 |
| 901 | 3300025302 | Ga0207426_1000081 | Ga0207426_100008129 | 258 |
| 902 | 3300025302 | Ga0207426_1000144 | Ga0207426_1000144105 | 258 |
| 903 | 3300025303 | Ga0209051_1000205 | Ga0209051_100020583 | 258 |
| 904 | 3300025303 | Ga0209051_1014627 | Ga0209051_10146274 | 258 |
| 905 | 3300025303 | Ga0209051_1017189 | Ga0209051_10171893 | 258 |
| 906 | 3300025304 | Ga0209257_1003359 | Ga0209257_10033595 | 258 |
| 907 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024597 | 258 |
| 908 | 3300025914 | Ga0207671_10000176 | Ga0207671_1000017673 | 258 |
| 909 | 3300025931 | Ga0207644_10042355 | Ga0207644_100423553 | 258 |
| 910 | 3300025949 | Ga0207667_10468185 | Ga0207667_104681852 | 258 |
| 911 | 3300025972 | Ga0207668_10031723 | Ga0207668_100317232 | 258 |
| 912 | 3300026078 | Ga0207702_10120780 | Ga0207702_101207803 | 258 |
| 913 | 3300027111 | Ga0209281_1000253 | Ga0209281_100025346 | 258 |
| 914 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009409 | 258 |
| 915 | 3300027312 | Ga0209371_1001205 | Ga0209371_100120519 | 258 |
| 916 | 3300027666 | Ga0209282_1001877 | Ga0209282_10018778 | 258 |
| 917 | 3300028379 | Ga0268266_10015167 | Ga0268266_100151676 | 258 |
| 918 | 3300028379 | Ga0268266_10038826 | Ga0268266_100388263 | 258 |
| 919 | 3300028379 | Ga0268266_10081239 | Ga0268266_100812393 | 258 |
| 920 | 3300028794 | Ga0307515_10000154 | Ga0307515_10000154119 | 258 |
| 921 | 3300028794 | Ga0307515_10218934 | Ga0307515_102189342 | 258 |
| 922 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010408 | 258 |
| 923 | 3300030500 | Ga0268256_1004527 | Ga0268256_10045274 | 258 |
| 924 | 3300031456 | Ga0307513_10001432 | Ga0307513_1000143228 | 258 |
| 925 | 3300031456 | Ga0307513_10291229 | Ga0307513_102912292 | 258 |
| 926 | 3300031548 | Ga0307408_100287610 | Ga0307408_1002876101 | 258 |
| 927 | 3300031911 | Ga0307412_10002253 | Ga0307412_100022537 | 258 |
| 928 | 3300031995 | Ga0307409_100157597 | Ga0307409_1001575972 | 258 |
| 929 | 3300032002 | Ga0307416_100616168 | Ga0307416_1006161682 | 258 |
| 930 | 3300041411 | Ga0439466_0026155 | Ga0439466_0026155_641_1438 | 258 |
| 931 | 3300041411 | Ga0439466_0062999 | Ga0439466_0062999_145_924 | 258 |
| 932 | 3300041502 | Ga0451846_65766 | Ga0451846_65766_332_1108 | 258 |
| 933 | 3300041505 | Ga0451849_0734293 | Ga0451849_0734293_251_1027 | 258 |
| 934 | 3300041512 | Ga0451853_1619242 | Ga0451853_1619242_166_942 | 258 |
| 935 | 3300042007 | Ga0439449_0050015 | Ga0439449_0050015_537_1334 | 258 |
| 936 | 3300042531 | Ga0450918_016128 | Ga0450918_016128_44_823 | 258 |
| 937 | 3300046460 | Ga0495638_0009816 | Ga0495638_0009816_1653_2537 | 258 |
| 938 | 3300046460 | Ga0495638_0044368 | Ga0495638_0044368_1700_2476 | 258 |
| 939 | 3300046460 | Ga0495638_0228824 | Ga0495638_0228824_114_983 | 258 |
| 940 | 3300046474 | Ga0495605_0001233 | Ga0495605_0001233_15214_16011 | 258 |
| 941 | 3300046492 | Ga0495585_0013373 | Ga0495585_0013373_3914_4711 | 258 |
| 942 | 3300046500 | Ga0495596_0075528 | Ga0495596_0075528_212_988 | 258 |
| 943 | 3300046501 | Ga0495607_0138632 | Ga0495607_0138632_245_1021 | 258 |
| 944 | 3300046506 | Ga0495583_0099712 | Ga0495583_0099712_157_933 | 258 |
| 945 | 3300046507 | Ga0495606_0093901 | Ga0495606_0093901_104_880 | 258 |
| 946 | 3300046513 | Ga0495616_0133966 | Ga0495616_0133966_274_1071 | 258 |
| 947 | 3300046518 | Ga0495631_0001700 | Ga0495631_0001700_2796_3593 | 258 |
| 948 | 3300046518 | Ga0495631_0108924 | Ga0495631_0108924_248_1024 | 258 |
| 949 | 3300046519 | Ga0495632_0051996 | Ga0495632_0051996_795_1592 | 258 |
| 950 | 3300046522 | Ga0495643_0022226 | Ga0495643_0022226_2772_3548 | 258 |
| 951 | 3300046524 | Ga0495648_0035378 | Ga0495648_0035378_742_1518 | 258 |
| 952 | 3300046530 | Ga0495654_0054914 | Ga0495654_0054914_326_1102 | 258 |
| 953 | 3300046538 | Ga0495609_0090957 | Ga0495609_0090957_77_874 | 258 |
| 954 | 3300046542 | Ga0495597_0029144 | Ga0495597_0029144_1147_1923 | 258 |
| 955 | 3300046542 | Ga0495597_0103002 | Ga0495597_0103002_349_1146 | 258 |
| 956 | 3300046558 | Ga0495633_0014552 | Ga0495633_0014552_819_1595 | 258 |
| 957 | 3300046558 | Ga0495633_0081037 | Ga0495633_0081037_456_1232 | 258 |
| 958 | 3300046558 | Ga0495633_0163417 | Ga0495633_0163417_196_996 | 258 |
| 959 | 3300046616 | Ga0495668_0002936 | Ga0495668_0002936_435_1232 | 258 |
| 960 | 3300046660 | Ga0495625_0001444 | Ga0495625_0001444_12138_12935 | 258 |
| 961 | 3300046660 | Ga0495625_0224084 | Ga0495625_0224084_326_1102 | 258 |
| 962 | 3300046692 | Ga0495671_0085144 | Ga0495671_0085144_158_934 | 258 |
| 963 | 3300046810 | Ga0495660_0080247 | Ga0495660_0080247_389_1186 | 258 |
| 964 | 3300047320 | Ga0495672_0058787 | Ga0495672_0058787_993_1790 | 258 |
| 965 | 3300047323 | Ga0495683_0100170 | Ga0495683_0100170_143_919 | 258 |
| 966 | 3300047443 | Ga0495687_045326 | Ga0495687_045326_790_1566 | 258 |
| 967 | 3300047443 | Ga0495687_085869 | Ga0495687_085869_250_1026 | 258 |
| 968 | 3300047447 | Ga0495685_041743 | Ga0495685_041743_212_988 | 258 |
| 969 | 3300048905 | Ga0496102_0189529 | Ga0496102_0189529_485_1261 | 258 |
| 970 | 3300048907 | Ga0496104_0177728 | Ga0496104_0177728_1121_1921 | 258 |
| 971 | 3300048909 | Ga0496106_0000912 | Ga0496106_0000912_4546_5322 | 258 |
| 972 | 3300048910 | Ga0496107_0445023 | Ga0496107_0445023_164_940 | 258 |
| 973 | 3300048916 | Ga0496113_0194609 | Ga0496113_0194609_201_1001 | 258 |
| 974 | 3300048919 | Ga0496116_0001841 | Ga0496116_0001841_21933_22730 | 258 |
| 975 | 3300048919 | Ga0496116_0002642 | Ga0496116_0002642_9757_10563 | 258 |
| 976 | 3300048919 | Ga0496116_0022408 | Ga0496116_0022408_3409_4185 | 258 |
| 977 | 3300048919 | Ga0496116_0026286 | Ga0496116_0026286_3366_4142 | 258 |
| 978 | 3300048919 | Ga0496116_0044309 | Ga0496116_0044309_428_1213 | 258 |
| 979 | 3300048919 | Ga0496116_0055957 | Ga0496116_0055957_489_1289 | 258 |
| 980 | 3300048919 | Ga0496116_0064080 | Ga0496116_0064080_200_1006 | 258 |
| 981 | 3300048919 | Ga0496116_0084830 | Ga0496116_0084830_884_1690 | 258 |
| 982 | 3300048919 | Ga0496116_0108639 | Ga0496116_0108639_275_1081 | 258 |
| 983 | 3300048919 | Ga0496116_0160653 | Ga0496116_0160653_224_1000 | 258 |
| 984 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1934151_1934951 | 258 |
| 985 | 3300048920 | Ga0496117_0002297 | Ga0496117_0002297_16660_17436 | 258 |
| 986 | 3300048920 | Ga0496117_0006068 | Ga0496117_0006068_11042_11839 | 258 |
| 987 | 3300048920 | Ga0496117_0148187 | Ga0496117_0148187_317_1102 | 258 |
| 988 | 3300048920 | Ga0496117_0159038 | Ga0496117_0159038_41_841 | 258 |
| 989 | 3300048920 | Ga0496117_0191029 | Ga0496117_0191029_93_884 | 258 |
| 990 | 3300048921 | Ga0496118_0000233 | Ga0496118_0000233_75153_75953 | 258 |
| 991 | 3300048921 | Ga0496118_0001988 | Ga0496118_0001988_13728_14504 | 258 |
| 992 | 3300048921 | Ga0496118_0033033 | Ga0496118_0033033_433_1209 | 258 |
| 993 | 3300048921 | Ga0496118_0034316 | Ga0496118_0034316_2732_3529 | 258 |
| 994 | 3300048921 | Ga0496118_0093832 | Ga0496118_0093832_290_1066 | 258 |
| 995 | 3300048922 | Ga0496119_0015134 | Ga0496119_0015134_1801_2577 | 258 |
| 996 | 3300048922 | Ga0496119_0034935 | Ga0496119_0034935_957_1757 | 258 |
| 997 | 3300048922 | Ga0496119_0038975 | Ga0496119_0038975_461_1261 | 258 |
| 998 | 3300048922 | Ga0496119_0055869 | Ga0496119_0055869_1327_2103 | 258 |
| 999 | 3300048923 | Ga0496120_0000021 | Ga0496120_0000021_131624_132424 | 258 |
| 1000 | 3300048923 | Ga0496120_0023198 | Ga0496120_0023198_1214_1990 | 258 |
| 1001 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_536960_537751 | 258 |
| 1002 | 3300048924 | Ga0496121_0003778 | Ga0496121_0003778_13685_14461 | 258 |
| 1003 | 3300048924 | Ga0496121_0009317 | Ga0496121_0009317_148_945 | 258 |
| 1004 | 3300048924 | Ga0496121_0027647 | Ga0496121_0027647_1541_2317 | 258 |
| 1005 | 3300048924 | Ga0496121_0041822 | Ga0496121_0041822_1235_2041 | 258 |
| 1006 | 3300048924 | Ga0496121_0120880 | Ga0496121_0120880_995_1771 | 258 |
| 1007 | 3300048924 | Ga0496121_0150076 | Ga0496121_0150076_858_1634 | 258 |
| 1008 | 3300048924 | Ga0496121_0237434 | Ga0496121_0237434_287_1072 | 258 |
| 1009 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1304941_1305741 | 258 |
| 1010 | 3300048925 | Ga0496122_0000247 | Ga0496122_0000247_99753_100559 | 258 |
| 1011 | 3300048925 | Ga0496122_0007204 | Ga0496122_0007204_305_1102 | 258 |
| 1012 | 3300048925 | Ga0496122_0027734 | Ga0496122_0027734_408_1184 | 258 |
| 1013 | 3300048925 | Ga0496122_0030322 | Ga0496122_0030322_3428_4234 | 258 |
| 1014 | 3300048925 | Ga0496122_0031911 | Ga0496122_0031911_1769_2545 | 258 |
| 1015 | 3300048925 | Ga0496122_0071891 | Ga0496122_0071891_1361_2146 | 258 |
| 1016 | 3300048925 | Ga0496122_0163531 | Ga0496122_0163531_125_901 | 258 |
| 1017 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1308672_1309472 | 258 |
| 1018 | 3300048926 | Ga0496123_0000222 | Ga0496123_0000222_99414_100220 | 258 |
| 1019 | 3300048926 | Ga0496123_0017248 | Ga0496123_0017248_200_997 | 258 |
| 1020 | 3300048926 | Ga0496123_0028989 | Ga0496123_0028989_435_1211 | 258 |
| 1021 | 3300048926 | Ga0496123_0095500 | Ga0496123_0095500_893_1684 | 258 |
| 1022 | 3300048926 | Ga0496123_0095833 | Ga0496123_0095833_393_1169 | 258 |
| 1023 | 3300048926 | Ga0496123_0105073 | Ga0496123_0105073_626_1420 | 258 |
| 1024 | 3300048926 | Ga0496123_0188965 | Ga0496123_0188965_99_884 | 258 |
| 1025 | 3300048927 | Ga0496124_0000592 | Ga0496124_0000592_15154_15960 | 258 |
| 1026 | 3300048927 | Ga0496124_0002069 | Ga0496124_0002069_8649_9434 | 258 |
| 1027 | 3300048927 | Ga0496124_0004006 | Ga0496124_0004006_5290_6090 | 258 |
| 1028 | 3300048927 | Ga0496124_0045313 | Ga0496124_0045313_1587_2384 | 258 |
| 1029 | 3300048927 | Ga0496124_0068688 | Ga0496124_0068688_1851_2627 | 258 |
| 1030 | 3300048927 | Ga0496124_0101742 | Ga0496124_0101742_1387_2181 | 258 |
| 1031 | 3300048927 | Ga0496124_0110214 | Ga0496124_0110214_70_846 | 258 |
| 1032 | 3300048927 | Ga0496124_0113414 | Ga0496124_0113414_796_1572 | 258 |
| 1033 | 3300048927 | Ga0496124_0232644 | Ga0496124_0232644_190_996 | 258 |
| 1034 | 3300048927 | Ga0496124_0388177 | Ga0496124_0388177_113_904 | 258 |
| 1035 | 3300048927 | Ga0496124_0388213 | Ga0496124_0388213_113_904 | 258 |
| 1036 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_649043_649834 | 258 |
| 1037 | 3300048928 | Ga0496125_0000557 | Ga0496125_0000557_14978_15784 | 258 |
| 1038 | 3300048928 | Ga0496125_0002964 | Ga0496125_0002964_9453_10250 | 258 |
| 1039 | 3300048928 | Ga0496125_0028713 | Ga0496125_0028713_674_1450 | 258 |
| 1040 | 3300048928 | Ga0496125_0123285 | Ga0496125_0123285_943_1743 | 258 |
| 1041 | 3300048929 | Ga0496126_0000438 | Ga0496126_0000438_37202_38008 | 258 |
| 1042 | 3300048929 | Ga0496126_0033716 | Ga0496126_0033716_3629_4426 | 258 |
| 1043 | 3300048929 | Ga0496126_0322360 | Ga0496126_0322360_75_875 | 258 |
| 1044 | 3300048929 | Ga0496126_0430874 | Ga0496126_0430874_163_939 | 258 |
| 1045 | 3300048929 | Ga0496126_0493741 | Ga0496126_0493741_193_969 | 258 |
| 1046 | 3300049459 | Ga0495678_024016 | Ga0495678_024016_167_964 | 258 |
| 1047 | 3300049459 | Ga0495678_057422 | Ga0495678_057422_188_964 | 258 |
| 1048 | 3300049460 | Ga0495682_0056764 | Ga0495682_0056764_208_1005 | 258 |
| 1049 | 3300049569 | Ga0501032_0089354 | Ga0501032_0089354_466_1242 | 258 |
| 1050 | 3300049571 | Ga0501034_0020260 | Ga0501034_0020260_2612_3403 | 258 |
| 1051 | 3300049579 | Ga0501043_0188005 | Ga0501043_0188005_178_954 | 258 |
| 1052 | 3300049580 | Ga0501046_0407173 | Ga0501046_0407173_162_938 | 258 |
| 1053 | 3300049581 | Ga0501047_0301289 | Ga0501047_0301289_580_1356 | 258 |
| 1054 | 3300049583 | Ga0501067_0139334 | Ga0501067_0139334_57_833 | 258 |
| 1055 | 3300049588 | Ga0501072_0367681 | Ga0501072_0367681_294_1070 | 258 |
| 1056 | 3300049823 | Ga0501044_0330327 | Ga0501044_0330327_224_1000 | 258 |
| 1057 | 3300050490 | nmdc:mga03n38_281521_c1 | nmdc:mga03n38_281521_c1_38_838 | 258 |
| 1058 | 3300050491 | nmdc:mga00v17_72_c1 | nmdc:mga00v17_72_c1_68_868 | 258 |
| 1059 | 3300050491 | nmdc:mga00v17_81455_c1 | nmdc:mga00v17_81455_c1_309_1100 | 258 |
| 1060 | 3300050491 | nmdc:mga00v17_91675_c1 | nmdc:mga00v17_91675_c1_1013_1813 | 258 |
| 1061 | 3300050491 | nmdc:mga00v17_92_c1 | nmdc:mga00v17_92_c1_44599_45417 | 258 |
| 1062 | 3300050492 | nmdc:mga0yw44_169441_c1 | nmdc:mga0yw44_169441_c1_356_1138 | 258 |
| 1063 | 3300050492 | nmdc:mga0yw44_201641_c1 | nmdc:mga0yw44_201641_c1_465_1265 | 258 |
| 1064 | 3300050492 | nmdc:mga0yw44_4716_c1 | nmdc:mga0yw44_4716_c1_1749_2549 | 258 |
| 1065 | 3300050516 | nmdc:mga0sz30_107529_c1 | nmdc:mga0sz30_107529_c1_134_934 | 258 |
| 1066 | 3300053079 | Ga0500610_0078634 | Ga0500610_0078634_277_1074 | 258 |
| 1067 | 3300053086 | Ga0500578_0090956 | Ga0500578_0090956_951_1727 | 258 |
| 1068 | 3300053107 | Ga0500560_010826 | Ga0500560_010826_248_1048 | 258 |
| 1069 | 3300053118 | Ga0500594_0003405 | Ga0500594_0003405_2423_3220 | 258 |
| 1070 | 3300053125 | Ga0500618_005292 | Ga0500618_005292_157_933 | 258 |
| 1071 | 3300053129 | Ga0500628_006907 | Ga0500628_006907_798_1574 | 258 |
| 1072 | 3300053130 | Ga0500642_0085535 | Ga0500642_0085535_325_1122 | 258 |
| 1073 | 3300053134 | Ga0500658_0046732 | Ga0500658_0046732_762_1538 | 258 |
| 1074 | 3300053137 | Ga0500561_0003433 | Ga0500561_0003433_749_1549 | 258 |
| 1075 | 3300053139 | Ga0500568_0002068 | Ga0500568_0002068_9245_10042 | 258 |
| 1076 | 3300053139 | Ga0500568_0011657 | Ga0500568_0011657_421_1197 | 258 |
| 1077 | 3300053151 | Ga0500604_0026364 | Ga0500604_0026364_364_1146 | 258 |
| 1078 | 3300053153 | Ga0500616_0003108 | Ga0500616_0003108_5054_5851 | 258 |
| 1079 | 3300053153 | Ga0500616_0062258 | Ga0500616_0062258_122_898 | 258 |
| 1080 | 3300053156 | Ga0500622_0000342 | Ga0500622_0000342_36685_37461 | 258 |
| 1081 | 3300053157 | Ga0500624_000370 | Ga0500624_000370_9262_10062 | 258 |
| 1082 | 3300053158 | Ga0500627_0144869 | Ga0500627_0144869_153_950 | 258 |
| 1083 | 3300053161 | Ga0500634_0009996 | Ga0500634_0009996_806_1615 | 258 |
| 1084 | 3300053177 | Ga0500636_0001609 | Ga0500636_0001609_3854_4648 | 258 |
| 1085 | 3300060353 | Ga0501082_0136746 | Ga0501082_0136746_1101_1877 | 258 |
| 1086 | iso_pu_bacteria | 2582581304 | 2585257066 | 258 |
| 1087 | iso_pu_bacteria | 2585427594 | 2585844509 | 258 |
| 1088 | iso_pu_bacteria | 2643221599 | 2644007478 | 258 |
| 1089 | iso_pu_bacteria | 2738541293 | 2738803694 | 258 |
| 1090 | iso_pu_bacteria | 2775507049 | 2776912283 | 258 |
| 1091 | iso_pu_bacteria | 2842922631 | 2842923478 | 258 |
| 1092 | iso_pu_bacteria | 2844163670 | 2844170604 | 258 |
| 1093 | iso_pu_bacteria | 2941499720 | 2941500578 | 258 |
| 1094 | iso_pu_bacteria | 8055431914 | 8055433354 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ozv-assembly1.cif.gz_A | crystal structure of a predicted o-methyltransferase, protein atu636 from agrobacterium tumefaciens. | 0.9846 | 32 | 257 |
| 2ozv-assembly1.cif.gz_A | crystal structure of a predicted o-methyltransferase, protein atu636 from agrobacterium tumefaciens. | 0.9659 | 32 | 257 |
| 3lpm-assembly1.cif.gz_B | crystal structure of putative methyltransferase small domain protein from listeria monocytogenes | 0.8824 | 1 | 250 |
| 7wm5-assembly1.cif.gz_A-2 | crystal structure of apo trmm from mycoplasma capricolum | 0.8822 | 30 | 249 |
| 3lpm-assembly1.cif.gz_B | crystal structure of putative methyltransferase small domain protein from listeria monocytogenes | 0.8714 | 1 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ozvB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9813 | 34 | 249 | 3.40.50.150 |
| 2ozvB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9661 | 34 | 249 | 3.40.50.150 |
| af_Q67VB2_1_103_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9205 | 46 | 103 | 3.40.50.150 |
| 3lpmB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8987 | 7 | 250 | 3.40.50.150 |
| 3lpmB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8908 | 7 | 250 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349XXR1-F1-model_v4 | Methyltransferase | 0.9962 | 162 | 258 |
GO:0008168
GO:0032259 |
| AF-D7H1X2-F1-model_v4 | deleted | 0.974 | 54 | 253 |
|
| AF-D6LMM7-F1-model_v4 | deleted | 0.9739 | 32 | 254 |
|
| AF-A0A7Z1USI1-F1-model_v4 | deleted | 0.9737 | 35 | 254 |
|
| AF-A0A7I0JQL3-F1-model_v4 | Methyltransferase | 0.972 | 160 | 253 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar