F489952
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1095 | 242 | 2190 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100147850|Ga0068857_1001478502 |
| Length | 252 |
| Sequence | MDDDVTQQFAQDFAPGDRGRCSLYLISPQEVGGSFPDRLKAALEPGLATAFQLRVKDVGEHDLARLAEPLQRICADADVAFILNDSVALAKRLGADGVHLGQSDGDIKGARALLGPSAQIGKTCHDSRHFAMEAGEAGADYVAFGAFYPTTTKPSNYRADPSILTWWSALFEIPCVAIGGITPENSKPLVDAGADFLAVCQSVWGKDDPPPRSKPSRTCSPWHLPDHRPQGLGVVESVAEHVVVEIAPDRSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 172 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 189 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 190 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 191 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 192 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 193 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 194 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 233 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 239 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 240 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 241 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 242 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0.09 |
| Isolates | 0.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0 |
| Rhizoplane | 4.84 |
| Rhizosphere | 94.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068857_100147850 | 3300005577 | Bacteria | 2127 |
| 2 | JGI24736J21556_1009844 | 3300001904 | Bacteria | 1570 |
| 3 | JGI24752J21851_1007336 | 3300001976 | Bacteria | 1437 |
| 4 | JGI24739J22299_10001332 | 3300001989 | Bacteria | 9274 |
| 5 | JGI24739J22299_10041960 | 3300001989 | Bacteria | 1519 |
| 6 | JGI24739J22299_10055262 | 3300001989 | Bacteria | 1270 |
| 7 | JGI24737J22298_10001804 | 3300001990 | Bacteria | 7671 |
| 8 | JGI24737J22298_10003009 | 3300001990 | Bacteria | 5979 |
| 9 | JGI24737J22298_10006391 | 3300001990 | Bacteria | 4026 |
| 10 | JGI24735J21928_10003671 | 3300002067 | Bacteria | 5204 |
| 11 | JGI24735J21928_10047793 | 3300002067 | Bacteria | 1240 |
| 12 | JGI24738J21930_10000384 | 3300002075 | Bacteria | 12294 |
| 13 | Ga0065715_10002351 | 3300005293 | Bacteria | 6275 |
| 14 | Ga0070658_10000966 | 3300005327 | Bacteria | 24638 |
| 15 | Ga0070658_10016048 | 3300005327 | Bacteria | 5991 |
| 16 | Ga0070658_10018492 | 3300005327 | Bacteria | 5579 |
| 17 | Ga0070658_10021625 | 3300005327 | Bacteria | 5155 |
| 18 | Ga0070658_10032391 | 3300005327 | Bacteria | 4201 |
| 19 | Ga0070658_10049985 | 3300005327 | Bacteria | 3388 |
| 20 | Ga0070658_10067824 | 3300005327 | Bacteria | 2915 |
| 21 | Ga0070658_10069527 | 3300005327 | Bacteria | 2881 |
| 22 | Ga0070658_10081021 | 3300005327 | Bacteria | 2666 |
| 23 | Ga0070658_10090155 | 3300005327 | Bacteria | 2526 |
| 24 | Ga0070658_10101361 | 3300005327 | Bacteria | 2380 |
| 25 | Ga0070658_10193841 | 3300005327 | Bacteria | 1713 |
| 26 | Ga0070676_10149163 | 3300005328 | Bacteria | 1495 |
| 27 | Ga0070683_100001903 | 3300005329 | Bacteria | 16330 |
| 28 | Ga0070683_100003603 | 3300005329 | Bacteria | 12613 |
| 29 | Ga0070683_100017099 | 3300005329 | Bacteria | 6402 |
| 30 | Ga0070683_100058349 | 3300005329 | Bacteria | 3586 |
| 31 | Ga0070683_100122797 | 3300005329 | Bacteria | 2453 |
| 32 | Ga0070683_100200594 | 3300005329 | Bacteria | 1894 |
| 33 | Ga0070683_100348741 | 3300005329 | Bacteria | 1410 |
| 34 | Ga0070690_100007364 | 3300005330 | Bacteria | 6301 |
| 35 | Ga0070670_100006822 | 3300005331 | Bacteria | 9672 |
| 36 | Ga0070670_100012231 | 3300005331 | Bacteria | 7341 |
| 37 | Ga0070670_100019827 | 3300005331 | Bacteria | 5773 |
| 38 | Ga0070670_100154360 | 3300005331 | Bacteria | 1988 |
| 39 | Ga0070670_100839423 | 3300005331 | Bacteria | 831 |
| 40 | Ga0068869_100093149 | 3300005334 | Bacteria | 2269 |
| 41 | Ga0070666_10001933 | 3300005335 | Bacteria | 12609 |
| 42 | Ga0070666_10002231 | 3300005335 | Bacteria | 11721 |
| 43 | Ga0070666_10002277 | 3300005335 | Bacteria | 11602 |
| 44 | Ga0070666_10015714 | 3300005335 | Bacteria | 4832 |
| 45 | Ga0070666_10038078 | 3300005335 | Bacteria | 3199 |
| 46 | Ga0070666_10095513 | 3300005335 | Bacteria | 2046 |
| 47 | Ga0070680_100006579 | 3300005336 | Bacteria | 8837 |
| 48 | Ga0070680_100009398 | 3300005336 | Bacteria | 7511 |
| 49 | Ga0070680_100014317 | 3300005336 | Bacteria | 6194 |
| 50 | Ga0070680_100061942 | 3300005336 | Bacteria | 3063 |
| 51 | Ga0070680_100068654 | 3300005336 | Bacteria | 2910 |
| 52 | Ga0070680_100427096 | 3300005336 | Bacteria | 1131 |
| 53 | Ga0070682_100213892 | 3300005337 | Bacteria | 1368 |
| 54 | Ga0070682_100338054 | 3300005337 | Bacteria | 1118 |
| 55 | Ga0068868_100014578 | 3300005338 | Bacteria | 5796 |
| 56 | Ga0068868_100032573 | 3300005338 | Bacteria | 4011 |
| 57 | Ga0068868_100036311 | 3300005338 | Bacteria | 3814 |
| 58 | Ga0068868_100111437 | 3300005338 | Bacteria | 2224 |
| 59 | Ga0068868_100557540 | 3300005338 | Bacteria | 1010 |
| 60 | Ga0070660_100000585 | 3300005339 | Bacteria | 24415 |
| 61 | Ga0070660_100001998 | 3300005339 | Bacteria | 14057 |
| 62 | Ga0070660_100002041 | 3300005339 | Bacteria | 13932 |
| 63 | Ga0070660_100049682 | 3300005339 | Bacteria | 3225 |
| 64 | Ga0070660_100052643 | 3300005339 | Bacteria | 3138 |
| 65 | Ga0070660_100183727 | 3300005339 | Bacteria | 1693 |
| 66 | Ga0070660_100393965 | 3300005339 | Bacteria | 1144 |
| 67 | Ga0070660_100466606 | 3300005339 | Bacteria | 1048 |
| 68 | Ga0070660_100526960 | 3300005339 | Bacteria | 984 |
| 69 | Ga0070687_100246222 | 3300005343 | Bacteria | 1108 |
| 70 | Ga0070661_100000696 | 3300005344 | Bacteria | 24644 |
| 71 | Ga0070661_100046784 | 3300005344 | Bacteria | 3165 |
| 72 | Ga0070661_100052863 | 3300005344 | Bacteria | 2972 |
| 73 | Ga0070661_100083697 | 3300005344 | Bacteria | 2357 |
| 74 | Ga0070661_100290303 | 3300005344 | Bacteria | 1271 |
| 75 | Ga0070692_10001977 | 3300005345 | Bacteria | 7761 |
| 76 | Ga0070692_10016202 | 3300005345 | Bacteria | 3543 |
| 77 | Ga0070692_10341830 | 3300005345 | Bacteria | 927 |
| 78 | Ga0070668_100000262 | 3300005347 | Bacteria | 34868 |
| 79 | Ga0070668_100836492 | 3300005347 | Bacteria | 820 |
| 80 | Ga0070669_100014430 | 3300005353 | Bacteria | 5623 |
| 81 | Ga0070669_100037502 | 3300005353 | Bacteria | 3516 |
| 82 | Ga0070669_100145322 | 3300005353 | Bacteria | 1832 |
| 83 | Ga0070669_100244961 | 3300005353 | Bacteria | 1425 |
| 84 | Ga0070675_100466629 | 3300005354 | Bacteria | 1134 |
| 85 | Ga0070671_100004086 | 3300005355 | Bacteria | 11519 |
| 86 | Ga0070671_100007236 | 3300005355 | Bacteria | 8874 |
| 87 | Ga0070671_100015654 | 3300005355 | Bacteria | 6129 |
| 88 | Ga0070671_100019304 | 3300005355 | Bacteria | 5546 |
| 89 | Ga0070671_100024813 | 3300005355 | Bacteria | 4912 |
| 90 | Ga0070671_100064523 | 3300005355 | Bacteria | 3050 |
| 91 | Ga0070671_100120184 | 3300005355 | Bacteria | 2210 |
| 92 | Ga0070671_100125432 | 3300005355 | Bacteria | 2161 |
| 93 | Ga0070671_100156054 | 3300005355 | Bacteria | 1928 |
| 94 | Ga0070671_100380111 | 3300005355 | Bacteria | 1207 |
| 95 | Ga0070671_100756803 | 3300005355 | Bacteria | 844 |
| 96 | Ga0070674_100003696 | 3300005356 | Bacteria | 8621 |
| 97 | Ga0070674_100121614 | 3300005356 | Bacteria | 1933 |
| 98 | Ga0070674_100295678 | 3300005356 | Bacteria | 1289 |
| 99 | Ga0070673_100004341 | 3300005364 | Bacteria | 8954 |
| 100 | Ga0070673_100039328 | 3300005364 | Bacteria | 3618 |
| 101 | Ga0070673_100080709 | 3300005364 | Bacteria | 2636 |
| 102 | Ga0070673_100095077 | 3300005364 | Bacteria | 2444 |
| 103 | Ga0070673_100184845 | 3300005364 | Bacteria | 1786 |
| 104 | Ga0070673_100380020 | 3300005364 | Bacteria | 1259 |
| 105 | Ga0070673_100707310 | 3300005364 | Bacteria | 925 |
| 106 | Ga0070688_100145334 | 3300005365 | Bacteria | 1615 |
| 107 | Ga0070659_100002265 | 3300005366 | Bacteria | 13712 |
| 108 | Ga0070659_100007395 | 3300005366 | Bacteria | 7980 |
| 109 | Ga0070659_100026260 | 3300005366 | Bacteria | 4479 |
| 110 | Ga0070659_100042887 | 3300005366 | Bacteria | 3537 |
| 111 | Ga0070659_100046732 | 3300005366 | Bacteria | 3393 |
| 112 | Ga0070659_100061918 | 3300005366 | Bacteria | 2957 |
| 113 | Ga0070659_100063461 | 3300005366 | Bacteria | 2922 |
| 114 | Ga0070659_100071755 | 3300005366 | Bacteria | 2754 |
| 115 | Ga0070659_100072381 | 3300005366 | Bacteria | 2742 |
| 116 | Ga0070659_100076443 | 3300005366 | Bacteria | 2670 |
| 117 | Ga0070659_100217543 | 3300005366 | Bacteria | 1576 |
| 118 | Ga0070659_100359144 | 3300005366 | Bacteria | 1223 |
| 119 | Ga0070659_100607268 | 3300005366 | Bacteria | 940 |
| 120 | Ga0070659_100753905 | 3300005366 | Bacteria | 844 |
| 121 | Ga0070667_100016730 | 3300005367 | Bacteria | 6070 |
| 122 | Ga0070667_100018702 | 3300005367 | Bacteria | 5747 |
| 123 | Ga0070667_100028334 | 3300005367 | Bacteria | 4662 |
| 124 | Ga0070667_100067527 | 3300005367 | Bacteria | 3040 |
| 125 | Ga0070667_100126935 | 3300005367 | Bacteria | 2223 |
| 126 | Ga0070667_100364950 | 3300005367 | Bacteria | 1309 |
| 127 | Ga0070667_100520366 | 3300005367 | Bacteria | 1092 |
| 128 | Ga0070667_100664150 | 3300005367 | Bacteria | 963 |
| 129 | Ga0070714_100052478 | 3300005435 | Bacteria | 3477 |
| 130 | Ga0070714_100151411 | 3300005435 | Bacteria | 2091 |
| 131 | Ga0070714_100232687 | 3300005435 | Bacteria | 1698 |
| 132 | Ga0070713_100099176 | 3300005436 | Bacteria | 2520 |
| 133 | Ga0070713_100208854 | 3300005436 | Bacteria | 1766 |
| 134 | Ga0070663_100010481 | 3300005455 | Bacteria | 5776 |
| 135 | Ga0070663_100016600 | 3300005455 | Bacteria | 4788 |
| 136 | Ga0070663_100019716 | 3300005455 | Bacteria | 4453 |
| 137 | Ga0070663_100025965 | 3300005455 | Bacteria | 3961 |
| 138 | Ga0070663_100046228 | 3300005455 | Bacteria | 3079 |
| 139 | Ga0070663_100058195 | 3300005455 | Bacteria | 2775 |
| 140 | Ga0070663_100058868 | 3300005455 | Bacteria | 2760 |
| 141 | Ga0070663_100071953 | 3300005455 | Bacteria | 2517 |
| 142 | Ga0070663_100198168 | 3300005455 | Bacteria | 1566 |
| 143 | Ga0070678_100001675 | 3300005456 | Bacteria | 11874 |
| 144 | Ga0070678_100003048 | 3300005456 | Bacteria | 9284 |
| 145 | Ga0070678_100014022 | 3300005456 | Bacteria | 5040 |
| 146 | Ga0070678_100485300 | 3300005456 | Bacteria | 1088 |
| 147 | Ga0070662_100000024 | 3300005457 | Bacteria | 91042 |
| 148 | Ga0070662_100002872 | 3300005457 | Bacteria | 10690 |
| 149 | Ga0070662_100003498 | 3300005457 | Bacteria | 9794 |
| 150 | Ga0070662_100010408 | 3300005457 | Bacteria | 6100 |
| 151 | Ga0070662_100013108 | 3300005457 | Bacteria | 5510 |
| 152 | Ga0070662_100104077 | 3300005457 | Bacteria | 2153 |
| 153 | Ga0070662_100112592 | 3300005457 | Bacteria | 2075 |
| 154 | Ga0070662_100117364 | 3300005457 | Bacteria | 2035 |
| 155 | Ga0070662_100162463 | 3300005457 | Bacteria | 1748 |
| 156 | Ga0070662_100467078 | 3300005457 | Bacteria | 1049 |
| 157 | Ga0070681_10026279 | 3300005458 | Bacteria | 5851 |
| 158 | Ga0070681_10051860 | 3300005458 | Bacteria | 4091 |
| 159 | Ga0070681_10102348 | 3300005458 | Bacteria | 2809 |
| 160 | Ga0070681_10567645 | 3300005458 | Bacteria | 1048 |
| 161 | Ga0068867_100040403 | 3300005459 | Bacteria | 3405 |
| 162 | Ga0068867_100054568 | 3300005459 | Bacteria | 2952 |
| 163 | Ga0068867_100265997 | 3300005459 | Bacteria | 1400 |
| 164 | Ga0068867_100417319 | 3300005459 | Bacteria | 1136 |
| 165 | Ga0068867_100669660 | 3300005459 | Bacteria | 912 |
| 166 | Ga0070679_100015421 | 3300005530 | Bacteria | 7345 |
| 167 | Ga0070679_100025101 | 3300005530 | Bacteria | 5845 |
| 168 | Ga0070679_100060816 | 3300005530 | Bacteria | 3765 |
| 169 | Ga0070679_100087589 | 3300005530 | Bacteria | 3101 |
| 170 | Ga0070679_100185740 | 3300005530 | Bacteria | 2049 |
| 171 | Ga0070679_100270753 | 3300005530 | Bacteria | 1652 |
| 172 | Ga0070679_100290743 | 3300005530 | Bacteria | 1585 |
| 173 | Ga0070679_100398370 | 3300005530 | Bacteria | 1322 |
| 174 | Ga0070679_100413721 | 3300005530 | Bacteria | 1294 |
| 175 | Ga0070679_100536611 | 3300005530 | Bacteria | 1114 |
| 176 | Ga0070679_100547271 | 3300005530 | Bacteria | 1101 |
| 177 | Ga0070684_100022302 | 3300005535 | Bacteria | 5278 |
| 178 | Ga0070684_100032851 | 3300005535 | Bacteria | 4427 |
| 179 | Ga0070684_100045690 | 3300005535 | Bacteria | 3792 |
| 180 | Ga0070684_100117632 | 3300005535 | Bacteria | 2388 |
| 181 | Ga0070684_100453685 | 3300005535 | Bacteria | 1185 |
| 182 | Ga0068853_100000033 | 3300005539 | Bacteria | 113700 |
| 183 | Ga0068853_100084017 | 3300005539 | Bacteria | 2789 |
| 184 | Ga0068853_100097898 | 3300005539 | Bacteria | 2590 |
| 185 | Ga0068853_100175729 | 3300005539 | Bacteria | 1939 |
| 186 | Ga0068853_100183853 | 3300005539 | Bacteria | 1896 |
| 187 | Ga0068853_100223357 | 3300005539 | Bacteria | 1721 |
| 188 | Ga0068853_100544730 | 3300005539 | Bacteria | 1099 |
| 189 | Ga0068853_100753075 | 3300005539 | Bacteria | 931 |
| 190 | Ga0070672_100001974 | 3300005543 | Bacteria | 12842 |
| 191 | Ga0070672_100008693 | 3300005543 | Bacteria | 6964 |
| 192 | Ga0070672_100030502 | 3300005543 | Bacteria | 4051 |
| 193 | Ga0070672_100045131 | 3300005543 | Bacteria | 3407 |
| 194 | Ga0070672_100110895 | 3300005543 | Bacteria | 2236 |
| 195 | Ga0070672_100362611 | 3300005543 | Bacteria | 1237 |
| 196 | Ga0070672_100508167 | 3300005543 | Bacteria | 1043 |
| 197 | Ga0070672_100531518 | 3300005543 | Bacteria | 1019 |
| 198 | Ga0070686_100020547 | 3300005544 | Bacteria | 3909 |
| 199 | Ga0070696_100190051 | 3300005546 | Bacteria | 1528 |
| 200 | Ga0070693_100002275 | 3300005547 | Bacteria | 8796 |
| 201 | Ga0070693_100061904 | 3300005547 | Bacteria | 2177 |
| 202 | Ga0070665_100007440 | 3300005548 | Bacteria | 11137 |
| 203 | Ga0070665_100011849 | 3300005548 | Bacteria | 8809 |
| 204 | Ga0070665_100014943 | 3300005548 | Bacteria | 7793 |
| 205 | Ga0070665_100049682 | 3300005548 | Bacteria | 4208 |
| 206 | Ga0070665_100056106 | 3300005548 | Bacteria | 3950 |
| 207 | Ga0070665_100061780 | 3300005548 | Bacteria | 3756 |
| 208 | Ga0070665_100567001 | 3300005548 | Bacteria | 1148 |
| 209 | Ga0070665_100750885 | 3300005548 | Bacteria | 989 |
| 210 | Ga0068855_100006863 | 3300005563 | Bacteria | 13811 |
| 211 | Ga0068855_100015672 | 3300005563 | Bacteria | 9120 |
| 212 | Ga0068855_100072428 | 3300005563 | Bacteria | 4005 |
| 213 | Ga0068855_100780115 | 3300005563 | Bacteria | 1017 |
| 214 | Ga0068855_101033159 | 3300005563 | Bacteria | 862 |
| 215 | Ga0070664_100000764 | 3300005564 | Bacteria | 24811 |
| 216 | Ga0070664_100001557 | 3300005564 | Bacteria | 18325 |
| 217 | Ga0070664_100007136 | 3300005564 | Bacteria | 9010 |
| 218 | Ga0070664_100011244 | 3300005564 | Bacteria | 7261 |
| 219 | Ga0070664_100023812 | 3300005564 | Bacteria | 5058 |
| 220 | Ga0070664_100065031 | 3300005564 | Bacteria | 3111 |
| 221 | Ga0070664_100088455 | 3300005564 | Bacteria | 2678 |
| 222 | Ga0070664_100162372 | 3300005564 | Bacteria | 1977 |
| 223 | Ga0070664_100197268 | 3300005564 | Bacteria | 1795 |
| 224 | Ga0068857_100009975 | 3300005577 | Bacteria | 8243 |
| 225 | Ga0068857_100025794 | 3300005577 | Bacteria | 5175 |
| 226 | Ga0068857_100031529 | 3300005577 | Bacteria | 4684 |
| 227 | Ga0068857_100201474 | 3300005577 | Bacteria | 1814 |
| 228 | Ga0068857_100533080 | 3300005577 | Bacteria | 1104 |
| 229 | Ga0068857_100603757 | 3300005577 | Bacteria | 1037 |
| 230 | Ga0068854_100005288 | 3300005578 | Bacteria | 8148 |
| 231 | Ga0068854_100006274 | 3300005578 | Bacteria | 7556 |
| 232 | Ga0068854_100010808 | 3300005578 | Bacteria | 5923 |
| 233 | Ga0068854_100047447 | 3300005578 | Bacteria | 3061 |
| 234 | Ga0068854_100091468 | 3300005578 | Bacteria | 2264 |
| 235 | Ga0068854_100100044 | 3300005578 | Bacteria | 2172 |
| 236 | Ga0068856_100000744 | 3300005614 | Bacteria | 35290 |
| 237 | Ga0068856_100062685 | 3300005614 | Bacteria | 3672 |
| 238 | Ga0068856_100122573 | 3300005614 | Bacteria | 2602 |
| 239 | Ga0068856_100177374 | 3300005614 | Bacteria | 2143 |
| 240 | Ga0068856_100753743 | 3300005614 | Bacteria | 993 |
| 241 | Ga0068852_100000973 | 3300005616 | Bacteria | 18804 |
| 242 | Ga0068852_100014898 | 3300005616 | Bacteria | 6008 |
| 243 | Ga0068852_100080870 | 3300005616 | Bacteria | 2882 |
| 244 | Ga0068852_100089703 | 3300005616 | Bacteria | 2748 |
| 245 | Ga0068852_100129614 | 3300005616 | Bacteria | 2321 |
| 246 | Ga0068852_100633144 | 3300005616 | Bacteria | 1076 |
| 247 | Ga0068852_100690709 | 3300005616 | Bacteria | 1030 |
| 248 | Ga0068859_100021326 | 3300005617 | Bacteria | 6500 |
| 249 | Ga0068859_100225537 | 3300005617 | Bacteria | 1962 |
| 250 | Ga0068859_100547737 | 3300005617 | Bacteria | 1251 |
| 251 | Ga0068864_100002620 | 3300005618 | Bacteria | 14855 |
| 252 | Ga0068864_100008310 | 3300005618 | Bacteria | 8561 |
| 253 | Ga0068864_100011993 | 3300005618 | Bacteria | 7156 |
| 254 | Ga0068864_100130806 | 3300005618 | Bacteria | 2254 |
| 255 | Ga0068864_101432960 | 3300005618 | Bacteria | 693 |
| 256 | Ga0068866_10119639 | 3300005718 | Bacteria | 1482 |
| 257 | Ga0068861_100044015 | 3300005719 | Bacteria | 3354 |
| 258 | Ga0068861_100294380 | 3300005719 | Bacteria | 1403 |
| 259 | Ga0068851_10006427 | 3300005834 | Bacteria | 5365 |
| 260 | Ga0068851_10011897 | 3300005834 | Bacteria | 4092 |
| 261 | Ga0068851_10153583 | 3300005834 | Bacteria | 1260 |
| 262 | Ga0068863_100002388 | 3300005841 | Bacteria | 18667 |
| 263 | Ga0068863_100006118 | 3300005841 | Bacteria | 11804 |
| 264 | Ga0068863_100015440 | 3300005841 | Bacteria | 7340 |
| 265 | Ga0068863_100064550 | 3300005841 | Bacteria | 3462 |
| 266 | Ga0068858_100012483 | 3300005842 | Bacteria | 8012 |
| 267 | Ga0068858_100013052 | 3300005842 | Bacteria | 7835 |
| 268 | Ga0068858_100053848 | 3300005842 | Bacteria | 3721 |
| 269 | Ga0068858_100056423 | 3300005842 | Bacteria | 3630 |
| 270 | Ga0068858_100107020 | 3300005842 | Bacteria | 2610 |
| 271 | Ga0068858_100164611 | 3300005842 | Bacteria | 2090 |
| 272 | Ga0068860_100029076 | 3300005843 | Bacteria | 5315 |
| 273 | Ga0068860_100410551 | 3300005843 | Bacteria | 1341 |
| 274 | Ga0068862_100016664 | 3300005844 | Bacteria | 6119 |
| 275 | Ga0081539_10078794 | 3300005985 | Bacteria | 1738 |
| 276 | Ga0070717_10033008 | 3300006028 | Bacteria | 4174 |
| 277 | Ga0070717_10543289 | 3300006028 | Bacteria | 1052 |
| 278 | Ga0070716_100349750 | 3300006173 | Bacteria | 1046 |
| 279 | Ga0070712_100239730 | 3300006175 | Bacteria | 1444 |
| 280 | Ga0075366_10028107 | 3300006195 | Bacteria | 3300 |
| 281 | Ga0097621_100008257 | 3300006237 | Bacteria | 7492 |
| 282 | Ga0097621_100022233 | 3300006237 | Bacteria | 4921 |
| 283 | Ga0097621_100227210 | 3300006237 | Bacteria | 1628 |
| 284 | Ga0097621_100228529 | 3300006237 | Bacteria | 1624 |
| 285 | Ga0068871_100006708 | 3300006358 | Bacteria | 8171 |
| 286 | Ga0068871_100168099 | 3300006358 | Bacteria | 1878 |
| 287 | Ga0075429_100379380 | 3300006880 | Bacteria | 1238 |
| 288 | Ga0068865_100002351 | 3300006881 | Bacteria | 11156 |
| 289 | Ga0068865_100142997 | 3300006881 | Bacteria | 1806 |
| 290 | Ga0068865_100262244 | 3300006881 | Bacteria | 1368 |
| 291 | Ga0097620_100021326 | 3300006931 | Bacteria | 6500 |
| 292 | Ga0097620_100225533 | 3300006931 | Bacteria | 1962 |
| 293 | Ga0097620_100547751 | 3300006931 | Bacteria | 1251 |
| 294 | Ga0105240_10012780 | 3300009093 | Bacteria | 11568 |
| 295 | Ga0105240_10111404 | 3300009093 | Bacteria | 3310 |
| 296 | Ga0105240_10251758 | 3300009093 | Bacteria | 2042 |
| 297 | Ga0105240_10635062 | 3300009093 | Bacteria | 1172 |
| 298 | Ga0105245_10005641 | 3300009098 | Bacteria | 10996 |
| 299 | Ga0105245_10029285 | 3300009098 | Bacteria | 4863 |
| 300 | Ga0105247_10194711 | 3300009101 | Bacteria | 1359 |
| 301 | Ga0114129_10482685 | 3300009147 | Bacteria | 1621 |
| 302 | Ga0105243_10062844 | 3300009148 | Bacteria | 2974 |
| 303 | Ga0105241_10394974 | 3300009174 | Bacteria | 1212 |
| 304 | Ga0105241_10779386 | 3300009174 | Bacteria | 879 |
| 305 | Ga0105242_10006705 | 3300009176 | Bacteria | 8883 |
| 306 | Ga0105242_10374749 | 3300009176 | Bacteria | 1321 |
| 307 | Ga0105242_10622346 | 3300009176 | Bacteria | 1046 |
| 308 | Ga0105248_10000059 | 3300009177 | Bacteria | 137176 |
| 309 | Ga0105248_10001063 | 3300009177 | Bacteria | 30382 |
| 310 | Ga0105248_10015718 | 3300009177 | Bacteria | 8342 |
| 311 | Ga0105248_10023073 | 3300009177 | Bacteria | 6910 |
| 312 | Ga0105248_10084242 | 3300009177 | Bacteria | 3576 |
| 313 | Ga0105248_10173813 | 3300009177 | Bacteria | 2428 |
| 314 | Ga0105248_10189355 | 3300009177 | Bacteria | 2318 |
| 315 | Ga0105248_10202777 | 3300009177 | Bacteria | 2235 |
| 316 | Ga0105237_10153704 | 3300009545 | Bacteria | 2297 |
| 317 | Ga0105237_11486239 | 3300009545 | Bacteria | 684 |
| 318 | Ga0105238_10009110 | 3300009551 | Bacteria | 9932 |
| 319 | Ga0105238_10050418 | 3300009551 | Bacteria | 4190 |
| 320 | Ga0105238_10184805 | 3300009551 | Bacteria | 2061 |
| 321 | Ga0105238_10307118 | 3300009551 | Bacteria | 1571 |
| 322 | Ga0105238_10329908 | 3300009551 | Bacteria | 1512 |
| 323 | Ga0105238_11552221 | 3300009551 | Bacteria | 691 |
| 324 | Ga0105249_10047133 | 3300009553 | Bacteria | 3926 |
| 325 | Ga0105239_10165072 | 3300010375 | Bacteria | 2476 |
| 326 | Ga0105239_10883362 | 3300010375 | Bacteria | 1026 |
| 327 | Ga0105246_10104267 | 3300011119 | Bacteria | 2071 |
| 328 | Ga0105246_10326534 | 3300011119 | Bacteria | 1249 |
| 329 | Ga0157373_10010767 | 3300013100 | Bacteria | 6730 |
| 330 | Ga0157373_10184998 | 3300013100 | Bacteria | 1468 |
| 331 | Ga0157373_10295024 | 3300013100 | Bacteria | 1150 |
| 332 | Ga0157373_10429006 | 3300013100 | Bacteria | 950 |
| 333 | Ga0157373_10432952 | 3300013100 | Bacteria | 945 |
| 334 | Ga0157373_10575246 | 3300013100 | Bacteria | 819 |
| 335 | Ga0157371_10003693 | 3300013102 | Bacteria | 13743 |
| 336 | Ga0157371_10008583 | 3300013102 | Bacteria | 8122 |
| 337 | Ga0157371_10033884 | 3300013102 | Bacteria | 3667 |
| 338 | Ga0157371_10055400 | 3300013102 | Bacteria | 2814 |
| 339 | Ga0157371_10057330 | 3300013102 | Bacteria | 2762 |
| 340 | Ga0157371_10074824 | 3300013102 | Bacteria | 2398 |
| 341 | Ga0157371_10109735 | 3300013102 | Bacteria | 1958 |
| 342 | Ga0157371_10128946 | 3300013102 | Bacteria | 1799 |
| 343 | Ga0157371_10132912 | 3300013102 | Bacteria | 1771 |
| 344 | Ga0157371_10223183 | 3300013102 | Bacteria | 1353 |
| 345 | Ga0157371_10299927 | 3300013102 | Bacteria | 1163 |
| 346 | Ga0157371_10319438 | 3300013102 | Bacteria | 1127 |
| 347 | Ga0157370_10001103 | 3300013104 | Bacteria | 33826 |
| 348 | Ga0157370_10044454 | 3300013104 | Bacteria | 4269 |
| 349 | Ga0157370_10095559 | 3300013104 | Bacteria | 2788 |
| 350 | Ga0157370_10341861 | 3300013104 | Bacteria | 1379 |
| 351 | Ga0157370_10359876 | 3300013104 | Bacteria | 1341 |
| 352 | Ga0157370_10643846 | 3300013104 | Bacteria | 969 |
| 353 | Ga0157369_10050251 | 3300013105 | Bacteria | 4516 |
| 354 | Ga0157369_10135770 | 3300013105 | Bacteria | 2605 |
| 355 | Ga0157369_10178800 | 3300013105 | Bacteria | 2233 |
| 356 | Ga0157369_10220804 | 3300013105 | Bacteria | 1984 |
| 357 | Ga0157369_10517774 | 3300013105 | Bacteria | 1234 |
| 358 | Ga0157369_10675719 | 3300013105 | Bacteria | 1064 |
| 359 | Ga0157374_10028621 | 3300013296 | Bacteria | 5035 |
| 360 | Ga0157374_10029681 | 3300013296 | Bacteria | 4956 |
| 361 | Ga0157374_10076236 | 3300013296 | Bacteria | 3170 |
| 362 | Ga0157374_10109181 | 3300013296 | Bacteria | 2660 |
| 363 | Ga0157374_10116596 | 3300013296 | Bacteria | 2573 |
| 364 | Ga0157374_10182172 | 3300013296 | Bacteria | 2052 |
| 365 | Ga0157378_10583748 | 3300013297 | Bacteria | 1127 |
| 366 | Ga0163162_10013012 | 3300013306 | Bacteria | 8120 |
| 367 | Ga0163162_10028826 | 3300013306 | Bacteria | 5494 |
| 368 | Ga0163162_10359456 | 3300013306 | Bacteria | 1589 |
| 369 | Ga0163162_10967237 | 3300013306 | Bacteria | 962 |
| 370 | Ga0157372_10244667 | 3300013307 | Bacteria | 2081 |
| 371 | Ga0157372_10382616 | 3300013307 | Bacteria | 1640 |
| 372 | Ga0157375_10005156 | 3300013308 | Bacteria | 11342 |
| 373 | Ga0157375_10086625 | 3300013308 | Bacteria | 3183 |
| 374 | Ga0157375_10277723 | 3300013308 | Bacteria | 1838 |
| 375 | Ga0157375_10421870 | 3300013308 | Bacteria | 1500 |
| 376 | Ga0157375_10733527 | 3300013308 | Bacteria | 1140 |
| 377 | Ga0163163_10011444 | 3300014325 | Bacteria | 8049 |
| 378 | Ga0163163_10013075 | 3300014325 | Bacteria | 7583 |
| 379 | Ga0163163_10078530 | 3300014325 | Bacteria | 3297 |
| 380 | Ga0157380_10061892 | 3300014326 | Bacteria | 2997 |
| 381 | Ga0157380_10376898 | 3300014326 | Bacteria | 1337 |
| 382 | Ga0182008_10074135 | 3300014497 | Bacteria | 1674 |
| 383 | Ga0157379_10012547 | 3300014968 | Bacteria | 7401 |
| 384 | Ga0157379_10312346 | 3300014968 | Bacteria | 1434 |
| 385 | Ga0157376_10008170 | 3300014969 | Bacteria | 7530 |
| 386 | Ga0163161_10003147 | 3300017792 | Bacteria | 11639 |
| 387 | Ga0206353_10777765 | 3300020082 | Bacteria | 1260 |
| 388 | Ga0207656_10053738 | 3300025321 | Bacteria | 1749 |
| 389 | Ga0207656_10073626 | 3300025321 | Bacteria | 1523 |
| 390 | Ga0207656_10085835 | 3300025321 | Bacteria | 1422 |
| 391 | Ga0207656_10179936 | 3300025321 | Bacteria | 1014 |
| 392 | Ga0207682_10004900 | 3300025893 | Bacteria | 5520 |
| 393 | Ga0207682_10114545 | 3300025893 | Bacteria | 1190 |
| 394 | Ga0207710_10134999 | 3300025900 | Bacteria | 1187 |
| 395 | Ga0207688_10002334 | 3300025901 | Bacteria | 10193 |
| 396 | Ga0207680_10003208 | 3300025903 | Bacteria | 7693 |
| 397 | Ga0207680_10003571 | 3300025903 | Bacteria | 7306 |
| 398 | Ga0207680_10007362 | 3300025903 | Bacteria | 5358 |
| 399 | Ga0207680_10011823 | 3300025903 | Bacteria | 4425 |
| 400 | Ga0207680_10079708 | 3300025903 | Bacteria | 2054 |
| 401 | Ga0207647_10010223 | 3300025904 | Bacteria | 6629 |
| 402 | Ga0207647_10015256 | 3300025904 | Bacteria | 5275 |
| 403 | Ga0207647_10022636 | 3300025904 | Bacteria | 4171 |
| 404 | Ga0207647_10039099 | 3300025904 | Bacteria | 2995 |
| 405 | Ga0207647_10039161 | 3300025904 | Bacteria | 2993 |
| 406 | Ga0207647_10057243 | 3300025904 | Bacteria | 2390 |
| 407 | Ga0207647_10057611 | 3300025904 | Bacteria | 2382 |
| 408 | Ga0207699_10052806 | 3300025906 | Bacteria | 2407 |
| 409 | Ga0207645_10005776 | 3300025907 | Bacteria | 8925 |
| 410 | Ga0207645_10015690 | 3300025907 | Bacteria | 5025 |
| 411 | Ga0207645_10029120 | 3300025907 | Bacteria | 3560 |
| 412 | Ga0207645_10084547 | 3300025907 | Bacteria | 2036 |
| 413 | Ga0207643_10039898 | 3300025908 | Bacteria | 2641 |
| 414 | Ga0207705_10000062 | 3300025909 | Bacteria | 149432 |
| 415 | Ga0207705_10000722 | 3300025909 | Bacteria | 27211 |
| 416 | Ga0207705_10007460 | 3300025909 | Bacteria | 8041 |
| 417 | Ga0207705_10031274 | 3300025909 | Bacteria | 3797 |
| 418 | Ga0207705_10035422 | 3300025909 | Bacteria | 3570 |
| 419 | Ga0207705_10048183 | 3300025909 | Bacteria | 3064 |
| 420 | Ga0207705_10076434 | 3300025909 | Bacteria | 2434 |
| 421 | Ga0207705_10089909 | 3300025909 | Bacteria | 2247 |
| 422 | Ga0207705_10097484 | 3300025909 | Bacteria | 2159 |
| 423 | Ga0207705_10101827 | 3300025909 | Bacteria | 2113 |
| 424 | Ga0207705_10142542 | 3300025909 | Bacteria | 1790 |
| 425 | Ga0207705_10149894 | 3300025909 | Bacteria | 1747 |
| 426 | Ga0207705_10226055 | 3300025909 | Bacteria | 1422 |
| 427 | Ga0207705_10287558 | 3300025909 | Bacteria | 1259 |
| 428 | Ga0207705_10326477 | 3300025909 | Bacteria | 1180 |
| 429 | Ga0207705_10339282 | 3300025909 | Bacteria | 1156 |
| 430 | Ga0207654_10052597 | 3300025911 | Bacteria | 2348 |
| 431 | Ga0207707_10066825 | 3300025912 | Bacteria | 3131 |
| 432 | Ga0207707_10128345 | 3300025912 | Bacteria | 2217 |
| 433 | Ga0207707_10154190 | 3300025912 | Bacteria | 2009 |
| 434 | Ga0207695_10002670 | 3300025913 | Bacteria | 26052 |
| 435 | Ga0207695_10007729 | 3300025913 | Bacteria | 13618 |
| 436 | Ga0207695_10289722 | 3300025913 | Bacteria | 1530 |
| 437 | Ga0207660_10000049 | 3300025917 | Bacteria | 59933 |
| 438 | Ga0207660_10003095 | 3300025917 | Bacteria | 10871 |
| 439 | Ga0207660_10012414 | 3300025917 | Bacteria | 5574 |
| 440 | Ga0207660_10048258 | 3300025917 | Bacteria | 3012 |
| 441 | Ga0207660_10142575 | 3300025917 | Bacteria | 1833 |
| 442 | Ga0207662_10151265 | 3300025918 | Bacteria | 1476 |
| 443 | Ga0207657_10000806 | 3300025919 | Bacteria | 33100 |
| 444 | Ga0207657_10005141 | 3300025919 | Bacteria | 13714 |
| 445 | Ga0207657_10005538 | 3300025919 | Bacteria | 13183 |
| 446 | Ga0207657_10007384 | 3300025919 | Bacteria | 11273 |
| 447 | Ga0207657_10010408 | 3300025919 | Bacteria | 9285 |
| 448 | Ga0207657_10013626 | 3300025919 | Bacteria | 7972 |
| 449 | Ga0207657_10018453 | 3300025919 | Bacteria | 6657 |
| 450 | Ga0207657_10022074 | 3300025919 | Bacteria | 5974 |
| 451 | Ga0207657_10079643 | 3300025919 | Bacteria | 2756 |
| 452 | Ga0207657_10115693 | 3300025919 | Bacteria | 2210 |
| 453 | Ga0207657_10150904 | 3300025919 | Bacteria | 1893 |
| 454 | Ga0207657_10201027 | 3300025919 | Bacteria | 1603 |
| 455 | Ga0207657_10208382 | 3300025919 | Bacteria | 1570 |
| 456 | Ga0207657_10284950 | 3300025919 | Bacteria | 1311 |
| 457 | Ga0207657_10346308 | 3300025919 | Bacteria | 1172 |
| 458 | Ga0207657_10481219 | 3300025919 | Bacteria | 973 |
| 459 | Ga0207649_10000248 | 3300025920 | Bacteria | 43782 |
| 460 | Ga0207649_10000298 | 3300025920 | Bacteria | 38460 |
| 461 | Ga0207649_10057721 | 3300025920 | Bacteria | 2428 |
| 462 | Ga0207649_10058814 | 3300025920 | Bacteria | 2409 |
| 463 | Ga0207649_10066241 | 3300025920 | Bacteria | 2289 |
| 464 | Ga0207649_10177363 | 3300025920 | Bacteria | 1489 |
| 465 | Ga0207649_10322653 | 3300025920 | Bacteria | 1135 |
| 466 | Ga0207649_10332541 | 3300025920 | Bacteria | 1119 |
| 467 | Ga0207649_10371909 | 3300025920 | Bacteria | 1063 |
| 468 | Ga0207649_10442982 | 3300025920 | Bacteria | 979 |
| 469 | Ga0207652_10001278 | 3300025921 | Bacteria | 22417 |
| 470 | Ga0207652_10012466 | 3300025921 | Bacteria | 6870 |
| 471 | Ga0207652_10360631 | 3300025921 | Bacteria | 1312 |
| 472 | Ga0207652_10445171 | 3300025921 | Bacteria | 1168 |
| 473 | Ga0207681_10092476 | 3300025923 | Bacteria | 2162 |
| 474 | Ga0207681_10257407 | 3300025923 | Bacteria | 1365 |
| 475 | Ga0207681_10487724 | 3300025923 | Bacteria | 1007 |
| 476 | Ga0207681_10563542 | 3300025923 | Bacteria | 938 |
| 477 | Ga0207694_10027796 | 3300025924 | Bacteria | 4309 |
| 478 | Ga0207694_10031695 | 3300025924 | Bacteria | 4040 |
| 479 | Ga0207650_10003932 | 3300025925 | Bacteria | 10168 |
| 480 | Ga0207650_10075636 | 3300025925 | Bacteria | 2542 |
| 481 | Ga0207650_10257537 | 3300025925 | Bacteria | 1414 |
| 482 | Ga0207650_10344686 | 3300025925 | Bacteria | 1224 |
| 483 | Ga0207650_10448604 | 3300025925 | Bacteria | 1073 |
| 484 | Ga0207650_10464613 | 3300025925 | Bacteria | 1054 |
| 485 | Ga0207650_10655301 | 3300025925 | Bacteria | 885 |
| 486 | Ga0207659_10002573 | 3300025926 | Bacteria | 10802 |
| 487 | Ga0207659_10224158 | 3300025926 | Bacteria | 1513 |
| 488 | Ga0207687_10050146 | 3300025927 | Bacteria | 2904 |
| 489 | Ga0207687_10066297 | 3300025927 | Bacteria | 2566 |
| 490 | Ga0207700_10328233 | 3300025928 | Bacteria | 1327 |
| 491 | Ga0207664_10707144 | 3300025929 | Bacteria | 906 |
| 492 | Ga0207644_10000480 | 3300025931 | Bacteria | 25749 |
| 493 | Ga0207644_10000602 | 3300025931 | Bacteria | 22923 |
| 494 | Ga0207644_10002193 | 3300025931 | Bacteria | 12661 |
| 495 | Ga0207644_10005323 | 3300025931 | Bacteria | 8398 |
| 496 | Ga0207644_10006566 | 3300025931 | Bacteria | 7578 |
| 497 | Ga0207644_10010023 | 3300025931 | Bacteria | 6237 |
| 498 | Ga0207644_10028746 | 3300025931 | Bacteria | 3852 |
| 499 | Ga0207644_10028869 | 3300025931 | Bacteria | 3845 |
| 500 | Ga0207644_10065258 | 3300025931 | Bacteria | 2647 |
| 501 | Ga0207644_10094432 | 3300025931 | Bacteria | 2234 |
| 502 | Ga0207644_10606080 | 3300025931 | Bacteria | 909 |
| 503 | Ga0207690_10000032 | 3300025932 | Bacteria | 152479 |
| 504 | Ga0207690_10004826 | 3300025932 | Bacteria | 7956 |
| 505 | Ga0207690_10021827 | 3300025932 | Bacteria | 3976 |
| 506 | Ga0207690_10036780 | 3300025932 | Bacteria | 3173 |
| 507 | Ga0207690_10075371 | 3300025932 | Bacteria | 2339 |
| 508 | Ga0207690_10098394 | 3300025932 | Bacteria | 2084 |
| 509 | Ga0207690_10163117 | 3300025932 | Bacteria | 1663 |
| 510 | Ga0207690_10198999 | 3300025932 | Bacteria | 1520 |
| 511 | Ga0207690_10275220 | 3300025932 | Bacteria | 1309 |
| 512 | Ga0207690_10293878 | 3300025932 | Bacteria | 1269 |
| 513 | Ga0207690_10417128 | 3300025932 | Bacteria | 1073 |
| 514 | Ga0207706_10004111 | 3300025933 | Bacteria | 13734 |
| 515 | Ga0207706_10006526 | 3300025933 | Bacteria | 10815 |
| 516 | Ga0207706_10011139 | 3300025933 | Bacteria | 8195 |
| 517 | Ga0207706_10022657 | 3300025933 | Bacteria | 5637 |
| 518 | Ga0207706_10022965 | 3300025933 | Bacteria | 5601 |
| 519 | Ga0207706_10039069 | 3300025933 | Bacteria | 4208 |
| 520 | Ga0207706_10042336 | 3300025933 | Bacteria | 4037 |
| 521 | Ga0207706_10062892 | 3300025933 | Bacteria | 3268 |
| 522 | Ga0207706_10078440 | 3300025933 | Bacteria | 2905 |
| 523 | Ga0207706_10184133 | 3300025933 | Bacteria | 1834 |
| 524 | Ga0207706_10383983 | 3300025933 | Bacteria | 1219 |
| 525 | Ga0207706_10617582 | 3300025933 | Bacteria | 930 |
| 526 | Ga0207709_10115945 | 3300025935 | Bacteria | 1800 |
| 527 | Ga0207709_10170202 | 3300025935 | Bacteria | 1528 |
| 528 | Ga0207669_10054600 | 3300025937 | Bacteria | 2414 |
| 529 | Ga0207669_10126214 | 3300025937 | Bacteria | 1748 |
| 530 | Ga0207704_10079706 | 3300025938 | Bacteria | 2111 |
| 531 | Ga0207704_10110822 | 3300025938 | Bacteria | 1855 |
| 532 | Ga0207704_10300793 | 3300025938 | Bacteria | 1229 |
| 533 | Ga0207704_10346839 | 3300025938 | Bacteria | 1155 |
| 534 | Ga0207704_10749630 | 3300025938 | Bacteria | 812 |
| 535 | Ga0207665_10061039 | 3300025939 | Bacteria | 2554 |
| 536 | Ga0207691_10004948 | 3300025940 | Bacteria | 12851 |
| 537 | Ga0207691_10022216 | 3300025940 | Bacteria | 5985 |
| 538 | Ga0207691_10052844 | 3300025940 | Bacteria | 3710 |
| 539 | Ga0207691_10189904 | 3300025940 | Bacteria | 1792 |
| 540 | Ga0207691_10257969 | 3300025940 | Bacteria | 1503 |
| 541 | Ga0207711_10001111 | 3300025941 | Bacteria | 25714 |
| 542 | Ga0207711_10001774 | 3300025941 | Bacteria | 19758 |
| 543 | Ga0207711_10002373 | 3300025941 | Bacteria | 16857 |
| 544 | Ga0207711_10003731 | 3300025941 | Bacteria | 13137 |
| 545 | Ga0207711_10007179 | 3300025941 | Bacteria | 9335 |
| 546 | Ga0207711_10289866 | 3300025941 | Bacteria | 1508 |
| 547 | Ga0207711_10836198 | 3300025941 | Bacteria | 857 |
| 548 | Ga0207689_10015644 | 3300025942 | Bacteria | 6425 |
| 549 | Ga0207689_10049684 | 3300025942 | Bacteria | 3460 |
| 550 | Ga0207689_10078000 | 3300025942 | Bacteria | 2722 |
| 551 | Ga0207661_10006645 | 3300025944 | Bacteria | 8176 |
| 552 | Ga0207661_10010419 | 3300025944 | Bacteria | 6691 |
| 553 | Ga0207661_10015311 | 3300025944 | Bacteria | 5641 |
| 554 | Ga0207661_10018520 | 3300025944 | Bacteria | 5174 |
| 555 | Ga0207679_10001017 | 3300025945 | Bacteria | 17920 |
| 556 | Ga0207679_10005065 | 3300025945 | Bacteria | 8237 |
| 557 | Ga0207679_10027244 | 3300025945 | Bacteria | 3950 |
| 558 | Ga0207679_10039503 | 3300025945 | Bacteria | 3370 |
| 559 | Ga0207679_10096322 | 3300025945 | Bacteria | 2302 |
| 560 | Ga0207679_10105751 | 3300025945 | Bacteria | 2211 |
| 561 | Ga0207679_10134468 | 3300025945 | Bacteria | 1989 |
| 562 | Ga0207679_10160551 | 3300025945 | Bacteria | 1840 |
| 563 | Ga0207679_10177466 | 3300025945 | Bacteria | 1759 |
| 564 | Ga0207679_10255037 | 3300025945 | Bacteria | 1493 |
| 565 | Ga0207679_10490965 | 3300025945 | Bacteria | 1094 |
| 566 | Ga0207679_10825137 | 3300025945 | Bacteria | 846 |
| 567 | Ga0207667_10005986 | 3300025949 | Bacteria | 14797 |
| 568 | Ga0207667_10023457 | 3300025949 | Bacteria | 6793 |
| 569 | Ga0207667_10045478 | 3300025949 | Bacteria | 4649 |
| 570 | Ga0207667_10062532 | 3300025949 | Bacteria | 3892 |
| 571 | Ga0207667_10082296 | 3300025949 | Bacteria | 3335 |
| 572 | Ga0207667_10116413 | 3300025949 | Bacteria | 2754 |
| 573 | Ga0207667_10204843 | 3300025949 | Bacteria | 2023 |
| 574 | Ga0207667_10308751 | 3300025949 | Bacteria | 1616 |
| 575 | Ga0207667_10750414 | 3300025949 | Bacteria | 975 |
| 576 | Ga0207667_10945997 | 3300025949 | Bacteria | 851 |
| 577 | Ga0207651_10004134 | 3300025960 | Bacteria | 7251 |
| 578 | Ga0207651_10012315 | 3300025960 | Bacteria | 4835 |
| 579 | Ga0207651_10026798 | 3300025960 | Bacteria | 3608 |
| 580 | Ga0207651_10048464 | 3300025960 | Bacteria | 2872 |
| 581 | Ga0207651_10093822 | 3300025960 | Bacteria | 2205 |
| 582 | Ga0207651_10234881 | 3300025960 | Bacteria | 1491 |
| 583 | Ga0207651_10317045 | 3300025960 | Bacteria | 1302 |
| 584 | Ga0207651_10446280 | 3300025960 | Bacteria | 1109 |
| 585 | Ga0207712_10007278 | 3300025961 | Bacteria | 6978 |
| 586 | Ga0207668_10000060 | 3300025972 | Bacteria | 89732 |
| 587 | Ga0207668_10000305 | 3300025972 | Bacteria | 32148 |
| 588 | Ga0207668_10226440 | 3300025972 | Bacteria | 1505 |
| 589 | Ga0207640_10004572 | 3300025981 | Bacteria | 7507 |
| 590 | Ga0207640_10006745 | 3300025981 | Bacteria | 6313 |
| 591 | Ga0207640_10036599 | 3300025981 | Bacteria | 3083 |
| 592 | Ga0207640_10045258 | 3300025981 | Bacteria | 2825 |
| 593 | Ga0207640_10198687 | 3300025981 | Bacteria | 1518 |
| 594 | Ga0207658_10011213 | 3300025986 | Bacteria | 6106 |
| 595 | Ga0207658_10015501 | 3300025986 | Bacteria | 5228 |
| 596 | Ga0207658_10021158 | 3300025986 | Bacteria | 4511 |
| 597 | Ga0207658_10065316 | 3300025986 | Bacteria | 2732 |
| 598 | Ga0207658_10113867 | 3300025986 | Bacteria | 2144 |
| 599 | Ga0207658_10126658 | 3300025986 | Bacteria | 2045 |
| 600 | Ga0207658_10143983 | 3300025986 | Bacteria | 1933 |
| 601 | Ga0207658_10388677 | 3300025986 | Bacteria | 1224 |
| 602 | Ga0207677_10003757 | 3300026023 | Bacteria | 8055 |
| 603 | Ga0207677_10005316 | 3300026023 | Bacteria | 6980 |
| 604 | Ga0207677_10018683 | 3300026023 | Bacteria | 4165 |
| 605 | Ga0207677_10032197 | 3300026023 | Bacteria | 3368 |
| 606 | Ga0207677_10085699 | 3300026023 | Bacteria | 2275 |
| 607 | Ga0207703_10005779 | 3300026035 | Bacteria | 9917 |
| 608 | Ga0207703_10012097 | 3300026035 | Bacteria | 6723 |
| 609 | Ga0207703_10032873 | 3300026035 | Bacteria | 4109 |
| 610 | Ga0207703_10073207 | 3300026035 | Bacteria | 2834 |
| 611 | Ga0207703_10247434 | 3300026035 | Bacteria | 1605 |
| 612 | Ga0207639_10003922 | 3300026041 | Bacteria | 10041 |
| 613 | Ga0207639_10138525 | 3300026041 | Bacteria | 2025 |
| 614 | Ga0207639_10164986 | 3300026041 | Bacteria | 1870 |
| 615 | Ga0207639_10169247 | 3300026041 | Bacteria | 1849 |
| 616 | Ga0207639_10175205 | 3300026041 | Bacteria | 1820 |
| 617 | Ga0207639_10336024 | 3300026041 | Bacteria | 1345 |
| 618 | Ga0207639_10620804 | 3300026041 | Bacteria | 998 |
| 619 | Ga0207639_10717674 | 3300026041 | Bacteria | 928 |
| 620 | Ga0207639_10773293 | 3300026041 | Bacteria | 894 |
| 621 | Ga0207678_10002886 | 3300026067 | Bacteria | 15603 |
| 622 | Ga0207678_10008182 | 3300026067 | Bacteria | 9223 |
| 623 | Ga0207678_10015624 | 3300026067 | Bacteria | 6674 |
| 624 | Ga0207678_10015932 | 3300026067 | Bacteria | 6602 |
| 625 | Ga0207678_10022734 | 3300026067 | Bacteria | 5491 |
| 626 | Ga0207678_10022829 | 3300026067 | Bacteria | 5478 |
| 627 | Ga0207678_10027098 | 3300026067 | Bacteria | 4998 |
| 628 | Ga0207678_10028009 | 3300026067 | Bacteria | 4920 |
| 629 | Ga0207678_10055859 | 3300026067 | Bacteria | 3400 |
| 630 | Ga0207678_10075210 | 3300026067 | Bacteria | 2893 |
| 631 | Ga0207678_10191921 | 3300026067 | Bacteria | 1746 |
| 632 | Ga0207678_10753513 | 3300026067 | Bacteria | 858 |
| 633 | Ga0207702_10001312 | 3300026078 | Bacteria | 24920 |
| 634 | Ga0207702_10004503 | 3300026078 | Bacteria | 12363 |
| 635 | Ga0207702_10030048 | 3300026078 | Bacteria | 4526 |
| 636 | Ga0207702_10090179 | 3300026078 | Bacteria | 2682 |
| 637 | Ga0207702_10525706 | 3300026078 | Bacteria | 1155 |
| 638 | Ga0207702_10623068 | 3300026078 | Bacteria | 1060 |
| 639 | Ga0207641_10017731 | 3300026088 | Bacteria | 5832 |
| 640 | Ga0207641_10030638 | 3300026088 | Bacteria | 4456 |
| 641 | Ga0207641_10041909 | 3300026088 | Bacteria | 3839 |
| 642 | Ga0207641_10112829 | 3300026088 | Bacteria | 2412 |
| 643 | Ga0207641_10140221 | 3300026088 | Bacteria | 2180 |
| 644 | Ga0207641_10142882 | 3300026088 | Bacteria | 2162 |
| 645 | Ga0207641_10366370 | 3300026088 | Bacteria | 1377 |
| 646 | Ga0207641_10523622 | 3300026088 | Bacteria | 1153 |
| 647 | Ga0207648_10004358 | 3300026089 | Bacteria | 14561 |
| 648 | Ga0207648_10012777 | 3300026089 | Bacteria | 7845 |
| 649 | Ga0207648_10017845 | 3300026089 | Bacteria | 6440 |
| 650 | Ga0207648_10036608 | 3300026089 | Bacteria | 4323 |
| 651 | Ga0207648_10103199 | 3300026089 | Bacteria | 2500 |
| 652 | Ga0207648_10317307 | 3300026089 | Bacteria | 1400 |
| 653 | Ga0207648_10326835 | 3300026089 | Bacteria | 1379 |
| 654 | Ga0207648_10493140 | 3300026089 | Bacteria | 1120 |
| 655 | Ga0207676_10028584 | 3300026095 | Bacteria | 4166 |
| 656 | Ga0207676_10034898 | 3300026095 | Bacteria | 3811 |
| 657 | Ga0207676_10106307 | 3300026095 | Bacteria | 2338 |
| 658 | Ga0207676_10436462 | 3300026095 | Bacteria | 1231 |
| 659 | Ga0207674_10006197 | 3300026116 | Bacteria | 14098 |
| 660 | Ga0207674_10008333 | 3300026116 | Bacteria | 11993 |
| 661 | Ga0207674_10030489 | 3300026116 | Bacteria | 5668 |
| 662 | Ga0207674_10094734 | 3300026116 | Bacteria | 2972 |
| 663 | Ga0207674_10576464 | 3300026116 | Bacteria | 1087 |
| 664 | Ga0207675_100141788 | 3300026118 | Bacteria | 2283 |
| 665 | Ga0207683_10003116 | 3300026121 | Bacteria | 14485 |
| 666 | Ga0207683_10003428 | 3300026121 | Bacteria | 13817 |
| 667 | Ga0207683_10064322 | 3300026121 | Bacteria | 3232 |
| 668 | Ga0207683_10276818 | 3300026121 | Bacteria | 1533 |
| 669 | Ga0207683_10352177 | 3300026121 | Bacteria | 1351 |
| 670 | Ga0207698_10000847 | 3300026142 | Bacteria | 17770 |
| 671 | Ga0207698_10009031 | 3300026142 | Bacteria | 6330 |
| 672 | Ga0207698_10009495 | 3300026142 | Bacteria | 6206 |
| 673 | Ga0207698_10024453 | 3300026142 | Bacteria | 4239 |
| 674 | Ga0207698_10031114 | 3300026142 | Bacteria | 3848 |
| 675 | Ga0207698_10034678 | 3300026142 | Bacteria | 3681 |
| 676 | Ga0207698_10070622 | 3300026142 | Bacteria | 2767 |
| 677 | Ga0207698_10080539 | 3300026142 | Bacteria | 2624 |
| 678 | Ga0207698_10139011 | 3300026142 | Bacteria | 2089 |
| 679 | Ga0207698_10159401 | 3300026142 | Bacteria | 1971 |
| 680 | Ga0207698_10245670 | 3300026142 | Bacteria | 1634 |
| 681 | Ga0207698_10531707 | 3300026142 | Bacteria | 1149 |
| 682 | Ga0207698_10533459 | 3300026142 | Bacteria | 1147 |
| 683 | Ga0210002_1027579 | 3300027617 | Bacteria | 935 |
| 684 | Ga0268266_10002716 | 3300028379 | Bacteria | 18550 |
| 685 | Ga0268266_10004790 | 3300028379 | Bacteria | 12854 |
| 686 | Ga0268266_10066149 | 3300028379 | Bacteria | 3125 |
| 687 | Ga0268266_10075978 | 3300028379 | Bacteria | 2918 |
| 688 | Ga0268266_10102112 | 3300028379 | Bacteria | 2529 |
| 689 | Ga0268266_10195370 | 3300028379 | Bacteria | 1849 |
| 690 | Ga0268266_10205022 | 3300028379 | Bacteria | 1806 |
| 691 | Ga0268266_10428080 | 3300028379 | Bacteria | 1255 |
| 692 | Ga0268265_10034782 | 3300028380 | Bacteria | 3676 |
| 693 | Ga0268265_10038097 | 3300028380 | Bacteria | 3534 |
| 694 | Ga0268265_10200897 | 3300028380 | Bacteria | 1729 |
| 695 | Ga0268265_10880478 | 3300028380 | Bacteria | 878 |
| 696 | Ga0268264_10018908 | 3300028381 | Bacteria | 5633 |
| 697 | Ga0268264_10032269 | 3300028381 | Bacteria | 4296 |
| 698 | Ga0268264_10334089 | 3300028381 | Bacteria | 1437 |
| 699 | Ga0268264_10346927 | 3300028381 | Bacteria | 1412 |
| 700 | Ga0268264_10919743 | 3300028381 | Bacteria | 879 |
| 701 | Ga0307408_100192679 | 3300031548 | Bacteria | 1643 |
| 702 | Ga0307408_100205461 | 3300031548 | Bacteria | 1597 |
| 703 | Ga0307408_100214542 | 3300031548 | Bacteria | 1566 |
| 704 | Ga0307408_100533961 | 3300031548 | Bacteria | 1032 |
| 705 | Ga0307405_10023645 | 3300031731 | Bacteria | 3496 |
| 706 | Ga0307405_10047398 | 3300031731 | Bacteria | 2646 |
| 707 | Ga0307405_10064982 | 3300031731 | Bacteria | 2321 |
| 708 | Ga0307405_10111284 | 3300031731 | Bacteria | 1856 |
| 709 | Ga0307405_10159375 | 3300031731 | Bacteria | 1596 |
| 710 | Ga0307405_10309183 | 3300031731 | Bacteria | 1202 |
| 711 | Ga0307405_10415405 | 3300031731 | Bacteria | 1057 |
| 712 | Ga0307413_10047032 | 3300031824 | Bacteria | 2570 |
| 713 | Ga0307413_10052914 | 3300031824 | Bacteria | 2455 |
| 714 | Ga0307413_10056763 | 3300031824 | Bacteria | 2390 |
| 715 | Ga0307413_10075440 | 3300031824 | Bacteria | 2140 |
| 716 | Ga0307413_10165362 | 3300031824 | Bacteria | 1559 |
| 717 | Ga0307413_10289007 | 3300031824 | Bacteria | 1237 |
| 718 | Ga0307413_10877435 | 3300031824 | Bacteria | 760 |
| 719 | Ga0307410_10030062 | 3300031852 | Bacteria | 3467 |
| 720 | Ga0307410_10035812 | 3300031852 | Bacteria | 3227 |
| 721 | Ga0307410_10038213 | 3300031852 | Bacteria | 3142 |
| 722 | Ga0307410_10089150 | 3300031852 | Bacteria | 2185 |
| 723 | Ga0307410_10156109 | 3300031852 | Bacteria | 1704 |
| 724 | Ga0307410_10356005 | 3300031852 | Bacteria | 1171 |
| 725 | Ga0307410_10390274 | 3300031852 | Bacteria | 1122 |
| 726 | Ga0307406_10051031 | 3300031901 | Bacteria | 2624 |
| 727 | Ga0307406_10126107 | 3300031901 | Bacteria | 1789 |
| 728 | Ga0307406_10171953 | 3300031901 | Bacteria | 1569 |
| 729 | Ga0307406_10300077 | 3300031901 | Bacteria | 1234 |
| 730 | Ga0307406_10444751 | 3300031901 | Bacteria | 1038 |
| 731 | Ga0307406_10511443 | 3300031901 | Bacteria | 975 |
| 732 | Ga0307406_10696438 | 3300031901 | Bacteria | 848 |
| 733 | Ga0307407_10001616 | 3300031903 | Bacteria | 8325 |
| 734 | Ga0307407_10003255 | 3300031903 | Bacteria | 6610 |
| 735 | Ga0307407_10015119 | 3300031903 | Bacteria | 3803 |
| 736 | Ga0307407_10022827 | 3300031903 | Bacteria | 3254 |
| 737 | Ga0307407_10074589 | 3300031903 | Bacteria | 2030 |
| 738 | Ga0307407_10102594 | 3300031903 | Bacteria | 1779 |
| 739 | Ga0307407_10122798 | 3300031903 | Bacteria | 1649 |
| 740 | Ga0307412_10038423 | 3300031911 | Bacteria | 3082 |
| 741 | Ga0307412_10066464 | 3300031911 | Bacteria | 2444 |
| 742 | Ga0307412_10074980 | 3300031911 | Bacteria | 2319 |
| 743 | Ga0307412_10115716 | 3300031911 | Bacteria | 1922 |
| 744 | Ga0307412_10251406 | 3300031911 | Bacteria | 1372 |
| 745 | Ga0307412_10322196 | 3300031911 | Bacteria | 1230 |
| 746 | Ga0307412_10514225 | 3300031911 | Bacteria | 999 |
| 747 | Ga0307412_10814908 | 3300031911 | Bacteria | 811 |
| 748 | Ga0307409_100017127 | 3300031995 | Bacteria | 4819 |
| 749 | Ga0307409_100019418 | 3300031995 | Bacteria | 4602 |
| 750 | Ga0307409_100025563 | 3300031995 | Bacteria | 4144 |
| 751 | Ga0307409_100034226 | 3300031995 | Bacteria | 3707 |
| 752 | Ga0307409_100040485 | 3300031995 | Bacteria | 3470 |
| 753 | Ga0307409_100078235 | 3300031995 | Bacteria | 2660 |
| 754 | Ga0307409_100089141 | 3300031995 | Bacteria | 2520 |
| 755 | Ga0307409_100121384 | 3300031995 | Bacteria | 2214 |
| 756 | Ga0307409_100141775 | 3300031995 | Bacteria | 2072 |
| 757 | Ga0307409_100147686 | 3300031995 | Bacteria | 2036 |
| 758 | Ga0307409_100270771 | 3300031995 | Bacteria | 1564 |
| 759 | Ga0307409_100271372 | 3300031995 | Bacteria | 1562 |
| 760 | Ga0307409_100335037 | 3300031995 | Bacteria | 1421 |
| 761 | Ga0307409_100898750 | 3300031995 | Bacteria | 899 |
| 762 | Ga0307416_100032356 | 3300032002 | Bacteria | 3950 |
| 763 | Ga0307416_100100348 | 3300032002 | Bacteria | 2517 |
| 764 | Ga0307416_100388659 | 3300032002 | Bacteria | 1428 |
| 765 | Ga0307416_100478789 | 3300032002 | Bacteria | 1304 |
| 766 | Ga0307416_100768336 | 3300032002 | Bacteria | 1057 |
| 767 | Ga0307416_100855629 | 3300032002 | Bacteria | 1007 |
| 768 | Ga0307414_10007915 | 3300032004 | Bacteria | 5999 |
| 769 | Ga0307414_10038599 | 3300032004 | Bacteria | 3209 |
| 770 | Ga0307414_10076948 | 3300032004 | Bacteria | 2426 |
| 771 | Ga0307414_10111397 | 3300032004 | Bacteria | 2084 |
| 772 | Ga0307414_10143299 | 3300032004 | Bacteria | 1874 |
| 773 | Ga0307414_10183851 | 3300032004 | Bacteria | 1684 |
| 774 | Ga0307414_10294309 | 3300032004 | Bacteria | 1370 |
| 775 | Ga0307414_10349892 | 3300032004 | Bacteria | 1268 |
| 776 | Ga0307414_10385874 | 3300032004 | Bacteria | 1212 |
| 777 | Ga0307414_10427802 | 3300032004 | Bacteria | 1156 |
| 778 | Ga0307414_10560412 | 3300032004 | Bacteria | 1019 |
| 779 | Ga0307411_10005280 | 3300032005 | Bacteria | 6325 |
| 780 | Ga0307411_10024959 | 3300032005 | Bacteria | 3572 |
| 781 | Ga0307411_10025392 | 3300032005 | Bacteria | 3549 |
| 782 | Ga0307411_10045546 | 3300032005 | Bacteria | 2822 |
| 783 | Ga0307411_10052282 | 3300032005 | Bacteria | 2670 |
| 784 | Ga0307411_10063273 | 3300032005 | Bacteria | 2472 |
| 785 | Ga0307411_10159932 | 3300032005 | Bacteria | 1685 |
| 786 | Ga0307415_100025016 | 3300032126 | Bacteria | 3739 |
| 787 | Ga0307415_100030873 | 3300032126 | Bacteria | 3446 |
| 788 | Ga0307415_100062967 | 3300032126 | Bacteria | 2575 |
| 789 | Ga0307415_100098717 | 3300032126 | Bacteria | 2135 |
| 790 | Ga0307415_100217783 | 3300032126 | Bacteria | 1528 |
| 791 | Ga0307415_100275009 | 3300032126 | Bacteria | 1382 |
| 792 | Ga0307415_100386110 | 3300032126 | Bacteria | 1191 |
| 793 | Ga0307415_100631562 | 3300032126 | Bacteria | 957 |
| 794 | Ga0373958_0027312 | 3300034819 | Bacteria | 1098 |
| 795 | Ga0373959_0014065 | 3300034820 | Bacteria | 1452 |
| 796 | Ga0373960_0099009 | 3300035121 | Bacteria | 942 |
| 797 | Ga0373943_0003828 | 3300035170 | Bacteria | 6840 |
| 798 | Ga0373946_0221459 | 3300035171 | Bacteria | 914 |
| 799 | Ga0373955_0010585 | 3300035172 | Bacteria | 4361 |
| 800 | Ga0373931_0005873 | 3300035691 | Bacteria | 5711 |
| 801 | Ga0373931_0097862 | 3300035691 | Bacteria | 1646 |
| 802 | Ga0373935_0051818 | 3300035692 | Bacteria | 2607 |
| 803 | Ga0373935_0386460 | 3300035692 | Bacteria | 1003 |
| 804 | Ga0373927_0408220 | 3300035695 | Bacteria | 896 |
| 805 | Ga0373925_0058308 | 3300037068 | Bacteria | 2895 |
| 806 | Ga0395899_0000225 | 3300037312 | Bacteria | 76673 |
| 807 | Ga0395899_0000287 | 3300037312 | Bacteria | 64885 |
| 808 | Ga0395899_0012312 | 3300037312 | Bacteria | 6553 |
| 809 | Ga0395899_0012355 | 3300037312 | Bacteria | 6539 |
| 810 | Ga0395899_0022188 | 3300037312 | Bacteria | 4813 |
| 811 | Ga0395899_0034518 | 3300037312 | Bacteria | 3799 |
| 812 | Ga0395899_0034858 | 3300037312 | Bacteria | 3779 |
| 813 | Ga0395899_0051115 | 3300037312 | Bacteria | 3068 |
| 814 | Ga0395899_0055067 | 3300037312 | Bacteria | 2942 |
| 815 | Ga0395899_0056903 | 3300037312 | Bacteria | 2888 |
| 816 | Ga0395899_0069775 | 3300037312 | Bacteria | 2573 |
| 817 | Ga0395899_0081391 | 3300037312 | Bacteria | 2356 |
| 818 | Ga0395899_0162166 | 3300037312 | Bacteria | 1579 |
| 819 | Ga0395899_0374317 | 3300037312 | Bacteria | 948 |
| 820 | Ga0395900_0000031 | 3300037418 | Bacteria | 262393 |
| 821 | Ga0395900_0000667 | 3300037418 | Bacteria | 45770 |
| 822 | Ga0395900_0000995 | 3300037418 | Bacteria | 36856 |
| 823 | Ga0395900_0004654 | 3300037418 | Bacteria | 14475 |
| 824 | Ga0395900_0006620 | 3300037418 | Bacteria | 12055 |
| 825 | Ga0395900_0007890 | 3300037418 | Bacteria | 10964 |
| 826 | Ga0395900_0008681 | 3300037418 | Bacteria | 10439 |
| 827 | Ga0395900_0012095 | 3300037418 | Bacteria | 8820 |
| 828 | Ga0395900_0018339 | 3300037418 | Bacteria | 7139 |
| 829 | Ga0395900_0020548 | 3300037418 | Bacteria | 6742 |
| 830 | Ga0395900_0021986 | 3300037418 | Bacteria | 6521 |
| 831 | Ga0395900_0035598 | 3300037418 | Bacteria | 5128 |
| 832 | Ga0395900_0049751 | 3300037418 | Bacteria | 4318 |
| 833 | Ga0395900_0059906 | 3300037418 | Bacteria | 3918 |
| 834 | Ga0395900_0060674 | 3300037418 | Bacteria | 3891 |
| 835 | Ga0395900_0064625 | 3300037418 | Bacteria | 3759 |
| 836 | Ga0395900_0083518 | 3300037418 | Bacteria | 3281 |
| 837 | Ga0395900_0092202 | 3300037418 | Bacteria | 3112 |
| 838 | Ga0395900_0092610 | 3300037418 | Bacteria | 3105 |
| 839 | Ga0395900_0113487 | 3300037418 | Bacteria | 2781 |
| 840 | Ga0395900_0142196 | 3300037418 | Bacteria | 2456 |
| 841 | Ga0395900_0142428 | 3300037418 | Bacteria | 2454 |
| 842 | Ga0395900_0181443 | 3300037418 | Bacteria | 2139 |
| 843 | Ga0395900_0200004 | 3300037418 | Bacteria | 2022 |
| 844 | Ga0395900_0255063 | 3300037418 | Bacteria | 1754 |
| 845 | Ga0395900_0255629 | 3300037418 | Bacteria | 1751 |
| 846 | Ga0395900_0270463 | 3300037418 | Bacteria | 1694 |
| 847 | Ga0395900_0296762 | 3300037418 | Bacteria | 1603 |
| 848 | Ga0395900_0347605 | 3300037418 | Bacteria | 1457 |
| 849 | Ga0395900_0365089 | 3300037418 | Bacteria | 1414 |
| 850 | Ga0395900_0524073 | 3300037418 | Bacteria | 1132 |
| 851 | Ga0395900_0641575 | 3300037418 | Bacteria | 999 |
| 852 | Ga0395900_0700463 | 3300037418 | Bacteria | 946 |
| 853 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 854 | Ga0395898_0001423 | 3300037466 | Bacteria | 34055 |
| 855 | Ga0395898_0010117 | 3300037466 | Bacteria | 9873 |
| 856 | Ga0395898_0013926 | 3300037466 | Bacteria | 8264 |
| 857 | Ga0395898_0016596 | 3300037466 | Bacteria | 7528 |
| 858 | Ga0395898_0018316 | 3300037466 | Bacteria | 7141 |
| 859 | Ga0395898_0022708 | 3300037466 | Bacteria | 6350 |
| 860 | Ga0395898_0026773 | 3300037466 | Bacteria | 5796 |
| 861 | Ga0395898_0027964 | 3300037466 | Bacteria | 5655 |
| 862 | Ga0395898_0040539 | 3300037466 | Bacteria | 4604 |
| 863 | Ga0395898_0045213 | 3300037466 | Bacteria | 4329 |
| 864 | Ga0395898_0076532 | 3300037466 | Bacteria | 3231 |
| 865 | Ga0395898_0078629 | 3300037466 | Bacteria | 3182 |
| 866 | Ga0395898_0091730 | 3300037466 | Bacteria | 2922 |
| 867 | Ga0395898_0093201 | 3300037466 | Bacteria | 2895 |
| 868 | Ga0395898_0165953 | 3300037466 | Bacteria | 2112 |
| 869 | Ga0395898_0300795 | 3300037466 | Bacteria | 1530 |
| 870 | Ga0395898_0300830 | 3300037466 | Bacteria | 1530 |
| 871 | Ga0395898_0324192 | 3300037466 | Bacteria | 1469 |
| 872 | Ga0395898_0440601 | 3300037466 | Bacteria | 1241 |
| 873 | Ga0395898_0539478 | 3300037466 | Bacteria | 1108 |
| 874 | Ga0395898_0541075 | 3300037466 | Bacteria | 1106 |
| 875 | Ga0395898_0629501 | 3300037466 | Bacteria | 1015 |
| 876 | Ga0395898_0634218 | 3300037466 | Bacteria | 1011 |
| 877 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 878 | Ga0395905_0000458 | 3300037471 | Bacteria | 57029 |
| 879 | Ga0395905_0000546 | 3300037471 | Bacteria | 51378 |
| 880 | Ga0395905_0004550 | 3300037471 | Bacteria | 14359 |
| 881 | Ga0395905_0005759 | 3300037471 | Bacteria | 12594 |
| 882 | Ga0395905_0006041 | 3300037471 | Bacteria | 12262 |
| 883 | Ga0395905_0008628 | 3300037471 | Bacteria | 10041 |
| 884 | Ga0395905_0008982 | 3300037471 | Bacteria | 9808 |
| 885 | Ga0395905_0010507 | 3300037471 | Bacteria | 8999 |
| 886 | Ga0395905_0017874 | 3300037471 | Bacteria | 6737 |
| 887 | Ga0395905_0019288 | 3300037471 | Bacteria | 6465 |
| 888 | Ga0395905_0025738 | 3300037471 | Bacteria | 5547 |
| 889 | Ga0395905_0036984 | 3300037471 | Bacteria | 4586 |
| 890 | Ga0395905_0038210 | 3300037471 | Bacteria | 4503 |
| 891 | Ga0395905_0044340 | 3300037471 | Bacteria | 4174 |
| 892 | Ga0395905_0047816 | 3300037471 | Bacteria | 4008 |
| 893 | Ga0395905_0056951 | 3300037471 | Bacteria | 3656 |
| 894 | Ga0395905_0070887 | 3300037471 | Bacteria | 3266 |
| 895 | Ga0395905_0081917 | 3300037471 | Bacteria | 3024 |
| 896 | Ga0395905_0104770 | 3300037471 | Bacteria | 2655 |
| 897 | Ga0395905_0111297 | 3300037471 | Bacteria | 2571 |
| 898 | Ga0395905_0132965 | 3300037471 | Bacteria | 2340 |
| 899 | Ga0395905_0133826 | 3300037471 | Bacteria | 2332 |
| 900 | Ga0395905_0144749 | 3300037471 | Bacteria | 2236 |
| 901 | Ga0395905_0191104 | 3300037471 | Bacteria | 1920 |
| 902 | Ga0395905_0198649 | 3300037471 | Bacteria | 1880 |
| 903 | Ga0395905_0234274 | 3300037471 | Bacteria | 1716 |
| 904 | Ga0395905_0252745 | 3300037471 | Bacteria | 1646 |
| 905 | Ga0395905_0254130 | 3300037471 | Bacteria | 1641 |
| 906 | Ga0395905_0282510 | 3300037471 | Bacteria | 1546 |
| 907 | Ga0395905_0292858 | 3300037471 | Bacteria | 1514 |
| 908 | Ga0395905_0347717 | 3300037471 | Bacteria | 1374 |
| 909 | Ga0395905_0404902 | 3300037471 | Bacteria | 1259 |
| 910 | Ga0395905_0937749 | 3300037471 | Bacteria | 768 |
| 911 | Ga0395901_0000035 | 3300038443 | Bacteria | 223888 |
| 912 | Ga0395901_0000329 | 3300038443 | Bacteria | 58460 |
| 913 | Ga0395901_0000447 | 3300038443 | Bacteria | 47979 |
| 914 | Ga0395901_0002236 | 3300038443 | Bacteria | 19743 |
| 915 | Ga0395901_0011667 | 3300038443 | Bacteria | 8901 |
| 916 | Ga0395901_0014220 | 3300038443 | Bacteria | 8103 |
| 917 | Ga0395901_0016878 | 3300038443 | Bacteria | 7442 |
| 918 | Ga0395901_0017691 | 3300038443 | Bacteria | 7275 |
| 919 | Ga0395901_0018937 | 3300038443 | Bacteria | 7039 |
| 920 | Ga0395901_0022077 | 3300038443 | Bacteria | 6521 |
| 921 | Ga0395901_0033936 | 3300038443 | Bacteria | 5269 |
| 922 | Ga0395901_0042408 | 3300038443 | Bacteria | 4717 |
| 923 | Ga0395901_0061277 | 3300038443 | Bacteria | 3915 |
| 924 | Ga0395901_0063581 | 3300038443 | Bacteria | 3841 |
| 925 | Ga0395901_0074050 | 3300038443 | Bacteria | 3553 |
| 926 | Ga0395901_0077844 | 3300038443 | Bacteria | 3461 |
| 927 | Ga0395901_0096410 | 3300038443 | Bacteria | 3099 |
| 928 | Ga0395901_0096711 | 3300038443 | Bacteria | 3094 |
| 929 | Ga0395901_0100630 | 3300038443 | Bacteria | 3032 |
| 930 | Ga0395901_0114576 | 3300038443 | Bacteria | 2831 |
| 931 | Ga0395901_0123717 | 3300038443 | Bacteria | 2718 |
| 932 | Ga0395901_0126761 | 3300038443 | Bacteria | 2682 |
| 933 | Ga0395901_0130361 | 3300038443 | Bacteria | 2642 |
| 934 | Ga0395901_0159826 | 3300038443 | Bacteria | 2366 |
| 935 | Ga0395901_0180874 | 3300038443 | Bacteria | 2211 |
| 936 | Ga0395901_0205808 | 3300038443 | Bacteria | 2061 |
| 937 | Ga0395901_0214178 | 3300038443 | Bacteria | 2015 |
| 938 | Ga0395901_0237910 | 3300038443 | Bacteria | 1900 |
| 939 | Ga0395901_0243581 | 3300038443 | Bacteria | 1874 |
| 940 | Ga0395901_0268702 | 3300038443 | Bacteria | 1774 |
| 941 | Ga0395901_0302354 | 3300038443 | Bacteria | 1659 |
| 942 | Ga0395901_0315448 | 3300038443 | Bacteria | 1618 |
| 943 | Ga0395901_0315789 | 3300038443 | Bacteria | 1617 |
| 944 | Ga0395901_0334247 | 3300038443 | Bacteria | 1566 |
| 945 | Ga0395901_0483093 | 3300038443 | Bacteria | 1263 |
| 946 | Ga0395901_0580785 | 3300038443 | Bacteria | 1132 |
| 947 | Ga0439465_0059432 | 3300041413 | Bacteria | 1265 |
| 948 | Ga0451853_4013415 | 3300041512 | Bacteria | 1823 |
| 949 | Ga0439445_0000682 | 3300042004 | Bacteria | 7053 |
| 950 | Ga0439455_0008389 | 3300042012 | Bacteria | 2214 |
| 951 | Ga0439462_0000649 | 3300042015 | Bacteria | 7011 |
| 952 | Ga0439458_0000869 | 3300042157 | Bacteria | 7824 |
| 953 | Ga0439458_0002129 | 3300042157 | Bacteria | 4895 |
| 954 | Ga0439434_0053432 | 3300042435 | Bacteria | 1255 |
| 955 | Ga0439434_0130592 | 3300042435 | Bacteria | 824 |
| 956 | Ga0466969_0026198 | 3300044656 | Bacteria | 2992 |
| 957 | Ga0466969_0030177 | 3300044656 | Bacteria | 2763 |
| 958 | Ga0466969_0141247 | 3300044656 | Bacteria | 1113 |
| 959 | Ga0466972_0189958 | 3300044658 | Bacteria | 963 |
| 960 | Ga0466966_0000003 | 3300044684 | Bacteria | 233677 |
| 961 | Ga0466966_0000732 | 3300044684 | Bacteria | 20858 |
| 962 | Ga0466966_0008925 | 3300044684 | Bacteria | 6644 |
| 963 | Ga0466966_0087410 | 3300044684 | Bacteria | 1937 |
| 964 | Ga0466961_0003019 | 3300044693 | Bacteria | 10439 |
| 965 | Ga0466961_0011172 | 3300044693 | Bacteria | 5740 |
| 966 | Ga0466961_0026828 | 3300044693 | Bacteria | 3704 |
| 967 | Ga0466961_0033166 | 3300044693 | Bacteria | 3318 |
| 968 | Ga0466961_0043582 | 3300044693 | Bacteria | 2873 |
| 969 | Ga0466961_0047897 | 3300044693 | Bacteria | 2732 |
| 970 | Ga0466961_0450189 | 3300044693 | Bacteria | 779 |
| 971 | Ga0466963_0007609 | 3300044694 | Bacteria | 6467 |
| 972 | Ga0466963_0098731 | 3300044694 | Bacteria | 1996 |
| 973 | Ga0466963_0126435 | 3300044694 | Bacteria | 1762 |
| 974 | Ga0466963_0188863 | 3300044694 | Bacteria | 1439 |
| 975 | Ga0466963_0216643 | 3300044694 | Bacteria | 1340 |
| 976 | Ga0466963_0668430 | 3300044694 | Bacteria | 733 |
| 977 | Ga0466964_0007088 | 3300044706 | Bacteria | 4193 |
| 978 | Ga0466964_0099491 | 3300044706 | Bacteria | 1280 |
| 979 | Ga0466964_0183598 | 3300044706 | Bacteria | 993 |
| 980 | Ga0466964_0242980 | 3300044706 | Bacteria | 884 |
| 981 | Ga0466971_0003492 | 3300044719 | Bacteria | 6712 |
| 982 | Ga0466971_0045623 | 3300044719 | Bacteria | 1968 |
| 983 | Ga0466971_0131104 | 3300044719 | Bacteria | 1164 |
| 984 | Ga0466970_0003584 | 3300044765 | Bacteria | 7569 |
| 985 | Ga0466970_0026024 | 3300044765 | Bacteria | 3066 |
| 986 | Ga0466970_0079950 | 3300044765 | Bacteria | 1766 |
| 987 | Ga0466957_0000953 | 3300044842 | Bacteria | 14840 |
| 988 | Ga0466957_0001732 | 3300044842 | Bacteria | 11487 |
| 989 | Ga0466957_0016312 | 3300044842 | Bacteria | 4344 |
| 990 | Ga0466957_0039882 | 3300044842 | Bacteria | 2834 |
| 991 | Ga0466960_0099025 | 3300044901 | Bacteria | 1498 |
| 992 | Ga0466959_0039343 | 3300045049 | Bacteria | 3494 |
| 993 | Ga0466959_0084300 | 3300045049 | Bacteria | 2287 |
| 994 | Ga0466959_0102461 | 3300045049 | Bacteria | 2049 |
| 995 | Ga0466958_0001680 | 3300045836 | Bacteria | 10676 |
| 996 | Ga0466958_0007909 | 3300045836 | Bacteria | 5877 |
| 997 | Ga0466958_0008167 | 3300045836 | Bacteria | 5793 |
| 998 | Ga0466958_0035552 | 3300045836 | Bacteria | 2977 |
| 999 | Ga0466958_0042248 | 3300045836 | Bacteria | 2745 |
| 1000 | Ga0466958_0209355 | 3300045836 | Bacteria | 1242 |
| 1001 | Ga0466958_0263707 | 3300045836 | Bacteria | 1103 |
| 1002 | Ga0466967_0000053 | 3300045976 | Bacteria | 41252 |
| 1003 | Ga0466967_0014039 | 3300045976 | Bacteria | 6221 |
| 1004 | Ga0466967_0043312 | 3300045976 | Bacteria | 3897 |
| 1005 | Ga0466967_0052615 | 3300045976 | Bacteria | 3575 |
| 1006 | Ga0466967_0077397 | 3300045976 | Bacteria | 2994 |
| 1007 | Ga0466967_0097591 | 3300045976 | Bacteria | 2682 |
| 1008 | Ga0466967_0167230 | 3300045976 | Bacteria | 2067 |
| 1009 | Ga0466967_0196732 | 3300045976 | Bacteria | 1907 |
| 1010 | Ga0466967_0400376 | 3300045976 | Bacteria | 1335 |
| 1011 | Ga0466967_0746592 | 3300045976 | Bacteria | 970 |
| 1012 | Ga0495638_0000123 | 3300046460 | Bacteria | 125420 |
| 1013 | Ga0495583_0009841 | 3300046506 | Bacteria | 5662 |
| 1014 | Ga0495663_0013943 | 3300046525 | Bacteria | 2249 |
| 1015 | Ga0495621_0143538 | 3300046539 | Bacteria | 935 |
| 1016 | Ga0495668_0035028 | 3300046616 | Bacteria | 2814 |
| 1017 | Ga0495669_0001119 | 3300046684 | Bacteria | 11116 |
| 1018 | Ga0495669_0001213 | 3300046684 | Bacteria | 10727 |
| 1019 | Ga0495669_0002528 | 3300046684 | Bacteria | 7471 |
| 1020 | Ga0495669_0027073 | 3300046684 | Bacteria | 2507 |
| 1021 | Ga0495669_0037666 | 3300046684 | Bacteria | 2141 |
| 1022 | Ga0495669_0117076 | 3300046684 | Bacteria | 1247 |
| 1023 | Ga0495669_0201291 | 3300046684 | Bacteria | 952 |
| 1024 | Ga0495677_0001629 | 3300047445 | Bacteria | 9021 |
| 1025 | Ga0496100_0001680 | 3300048903 | Bacteria | 10989 |
| 1026 | Ga0496100_0198083 | 3300048903 | Bacteria | 1462 |
| 1027 | Ga0496101_0010039 | 3300048904 | Bacteria | 6238 |
| 1028 | Ga0496101_0010994 | 3300048904 | Bacteria | 5996 |
| 1029 | Ga0496101_0023192 | 3300048904 | Bacteria | 4284 |
| 1030 | Ga0496102_0116015 | 3300048905 | Bacteria | 2499 |
| 1031 | Ga0496102_0137704 | 3300048905 | Bacteria | 2288 |
| 1032 | Ga0496102_0659658 | 3300048905 | Bacteria | 969 |
| 1033 | Ga0496102_0865333 | 3300048905 | Bacteria | 826 |
| 1034 | Ga0496103_0140036 | 3300048906 | Bacteria | 1547 |
| 1035 | Ga0496105_0023454 | 3300048908 | Bacteria | 5005 |
| 1036 | Ga0496105_0502488 | 3300048908 | Bacteria | 952 |
| 1037 | Ga0496106_0002579 | 3300048909 | Bacteria | 13494 |
| 1038 | Ga0496106_0018487 | 3300048909 | Bacteria | 5154 |
| 1039 | Ga0496107_0007063 | 3300048910 | Bacteria | 7736 |
| 1040 | Ga0496107_0022709 | 3300048910 | Bacteria | 4435 |
| 1041 | Ga0496107_0029644 | 3300048910 | Bacteria | 3895 |
| 1042 | Ga0496107_0048610 | 3300048910 | Bacteria | 3057 |
| 1043 | Ga0496107_0057006 | 3300048910 | Bacteria | 2824 |
| 1044 | Ga0496108_0089031 | 3300048911 | Bacteria | 2623 |
| 1045 | Ga0496108_0386798 | 3300048911 | Bacteria | 1221 |
| 1046 | Ga0496108_0431851 | 3300048911 | Bacteria | 1150 |
| 1047 | Ga0496109_0008457 | 3300048912 | Bacteria | 8748 |
| 1048 | Ga0496109_0038142 | 3300048912 | Bacteria | 4343 |
| 1049 | Ga0496109_0104251 | 3300048912 | Bacteria | 2633 |
| 1050 | Ga0496109_0203283 | 3300048912 | Bacteria | 1862 |
| 1051 | Ga0496109_0242174 | 3300048912 | Bacteria | 1697 |
| 1052 | Ga0496109_0247349 | 3300048912 | Bacteria | 1679 |
| 1053 | Ga0496109_0256120 | 3300048912 | Bacteria | 1648 |
| 1054 | Ga0496109_0604084 | 3300048912 | Bacteria | 1033 |
| 1055 | Ga0496109_0783540 | 3300048912 | Bacteria | 891 |
| 1056 | Ga0496110_0009035 | 3300048913 | Bacteria | 8043 |
| 1057 | Ga0496110_0011554 | 3300048913 | Bacteria | 7236 |
| 1058 | Ga0496110_0024535 | 3300048913 | Bacteria | 5139 |
| 1059 | Ga0496110_0075381 | 3300048913 | Bacteria | 2997 |
| 1060 | Ga0496111_0063568 | 3300048914 | Bacteria | 2676 |
| 1061 | Ga0496111_0090686 | 3300048914 | Bacteria | 2239 |
| 1062 | Ga0496111_0474250 | 3300048914 | Bacteria | 922 |
| 1063 | Ga0496112_0002124 | 3300048915 | Bacteria | 15738 |
| 1064 | Ga0496112_0055046 | 3300048915 | Bacteria | 3910 |
| 1065 | Ga0496112_0472855 | 3300048915 | Bacteria | 1190 |
| 1066 | Ga0496112_0675530 | 3300048915 | Bacteria | 961 |
| 1067 | Ga0496112_0949316 | 3300048915 | Bacteria | 781 |
| 1068 | Ga0496113_0014228 | 3300048916 | Bacteria | 5422 |
| 1069 | Ga0496113_0041800 | 3300048916 | Bacteria | 3385 |
| 1070 | Ga0496113_0078194 | 3300048916 | Bacteria | 2531 |
| 1071 | Ga0496113_0149728 | 3300048916 | Bacteria | 1840 |
| 1072 | Ga0496113_0445850 | 3300048916 | Bacteria | 1040 |
| 1073 | Ga0496114_0000131 | 3300048917 | Bacteria | 54315 |
| 1074 | Ga0496114_0054991 | 3300048917 | Bacteria | 3319 |
| 1075 | Ga0496114_0107963 | 3300048917 | Bacteria | 2382 |
| 1076 | Ga0496115_0000571 | 3300048918 | Bacteria | 28486 |
| 1077 | Ga0496115_0118450 | 3300048918 | Bacteria | 2178 |
| 1078 | Ga0501067_0074895 | 3300049583 | Bacteria | 1876 |
| 1079 | Ga0501068_0295739 | 3300049584 | Bacteria | 1036 |
| 1080 | Ga0501069_0183647 | 3300049585 | Bacteria | 1209 |
| 1081 | Ga0501080_0121137 | 3300049742 | Bacteria | 2424 |
| 1082 | Ga0501268_029376 | 3300049765 | Bacteria | 987 |
| 1083 | nmdc:mga0k408_136293_c1 | 3300050493 | Bacteria | 1458 |
| 1084 | nmdc:mga05p37_479373_c1 | 3300050507 | Bacteria | 1433 |
| 1085 | nmdc:mga09592_446196_c1 | 3300050508 | Bacteria | 1116 |
| 1086 | Ga0495612_0061294 | 3300053078 | Bacteria | 1558 |
| 1087 | Ga0495655_0004094 | 3300053083 | Bacteria | 2468 |
| 1088 | Ga0500658_0004662 | 3300053134 | Bacteria | 5115 |
| 1089 | Ga0466962_0003081 | 3300061719 | Bacteria | 7934 |
| 1090 | Ga0466962_0015638 | 3300061719 | Bacteria | 3658 |
| 1091 | Ga0466962_0017588 | 3300061719 | Bacteria | 3441 |
| 1092 | Ga0466962_0114780 | 3300061719 | Bacteria | 1297 |
| 1093 | 2848299793 | 2848297114 | Bacteria | 3608511 |
| 1094 | 2852655217 | 2852653556 | Bacteria | 4050083 |
| 1095 | 2882807948 | 2882806704 | Bacteria | 3007728 |
| 1096 | Ga0068857_100147850 | |||
| 1097 | JGI24736J21556_1009844 | |||
| 1098 | JGI24752J21851_1007336 | |||
| 1099 | JGI24739J22299_10001332 | |||
| 1100 | JGI24739J22299_10041960 | |||
| 1101 | JGI24739J22299_10055262 | |||
| 1102 | JGI24737J22298_10001804 | |||
| 1103 | JGI24737J22298_10003009 | |||
| 1104 | JGI24737J22298_10006391 | |||
| 1105 | JGI24735J21928_10003671 | |||
| 1106 | JGI24735J21928_10047793 | |||
| 1107 | JGI24738J21930_10000384 | |||
| 1108 | Ga0065715_10002351 | |||
| 1109 | Ga0070658_10000966 | |||
| 1110 | Ga0070658_10016048 | |||
| 1111 | Ga0070658_10018492 | |||
| 1112 | Ga0070658_10021625 | |||
| 1113 | Ga0070658_10032391 | |||
| 1114 | Ga0070658_10049985 | |||
| 1115 | Ga0070658_10067824 | |||
| 1116 | Ga0070658_10069527 | |||
| 1117 | Ga0070658_10081021 | |||
| 1118 | Ga0070658_10090155 | |||
| 1119 | Ga0070658_10101361 | |||
| 1120 | Ga0070658_10193841 | |||
| 1121 | Ga0070676_10149163 | |||
| 1122 | Ga0070683_100001903 | |||
| 1123 | Ga0070683_100003603 | |||
| 1124 | Ga0070683_100017099 | |||
| 1125 | Ga0070683_100058349 | |||
| 1126 | Ga0070683_100122797 | |||
| 1127 | Ga0070683_100200594 | |||
| 1128 | Ga0070683_100348741 | |||
| 1129 | Ga0070690_100007364 | |||
| 1130 | Ga0070670_100006822 | |||
| 1131 | Ga0070670_100012231 | |||
| 1132 | Ga0070670_100019827 | |||
| 1133 | Ga0070670_100154360 | |||
| 1134 | Ga0070670_100839423 | |||
| 1135 | Ga0068869_100093149 | |||
| 1136 | Ga0070666_10001933 | |||
| 1137 | Ga0070666_10002231 | |||
| 1138 | Ga0070666_10002277 | |||
| 1139 | Ga0070666_10015714 | |||
| 1140 | Ga0070666_10038078 | |||
| 1141 | Ga0070666_10095513 | |||
| 1142 | Ga0070680_100006579 | |||
| 1143 | Ga0070680_100009398 | |||
| 1144 | Ga0070680_100014317 | |||
| 1145 | Ga0070680_100061942 | |||
| 1146 | Ga0070680_100068654 | |||
| 1147 | Ga0070680_100427096 | |||
| 1148 | Ga0070682_100213892 | |||
| 1149 | Ga0070682_100338054 | |||
| 1150 | Ga0068868_100014578 | |||
| 1151 | Ga0068868_100032573 | |||
| 1152 | Ga0068868_100036311 | |||
| 1153 | Ga0068868_100111437 | |||
| 1154 | Ga0068868_100557540 | |||
| 1155 | Ga0070660_100000585 | |||
| 1156 | Ga0070660_100001998 | |||
| 1157 | Ga0070660_100002041 | |||
| 1158 | Ga0070660_100049682 | |||
| 1159 | Ga0070660_100052643 | |||
| 1160 | Ga0070660_100183727 | |||
| 1161 | Ga0070660_100393965 | |||
| 1162 | Ga0070660_100466606 | |||
| 1163 | Ga0070660_100526960 | |||
| 1164 | Ga0070687_100246222 | |||
| 1165 | Ga0070661_100000696 | |||
| 1166 | Ga0070661_100046784 | |||
| 1167 | Ga0070661_100052863 | |||
| 1168 | Ga0070661_100083697 | |||
| 1169 | Ga0070661_100290303 | |||
| 1170 | Ga0070692_10001977 | |||
| 1171 | Ga0070692_10016202 | |||
| 1172 | Ga0070692_10341830 | |||
| 1173 | Ga0070668_100000262 | |||
| 1174 | Ga0070668_100836492 | |||
| 1175 | Ga0070669_100014430 | |||
| 1176 | Ga0070669_100037502 | |||
| 1177 | Ga0070669_100145322 | |||
| 1178 | Ga0070669_100244961 | |||
| 1179 | Ga0070675_100466629 | |||
| 1180 | Ga0070671_100004086 | |||
| 1181 | Ga0070671_100007236 | |||
| 1182 | Ga0070671_100015654 | |||
| 1183 | Ga0070671_100019304 | |||
| 1184 | Ga0070671_100024813 | |||
| 1185 | Ga0070671_100064523 | |||
| 1186 | Ga0070671_100120184 | |||
| 1187 | Ga0070671_100125432 | |||
| 1188 | Ga0070671_100156054 | |||
| 1189 | Ga0070671_100380111 | |||
| 1190 | Ga0070671_100756803 | |||
| 1191 | Ga0070674_100003696 | |||
| 1192 | Ga0070674_100121614 | |||
| 1193 | Ga0070674_100295678 | |||
| 1194 | Ga0070673_100004341 | |||
| 1195 | Ga0070673_100039328 | |||
| 1196 | Ga0070673_100080709 | |||
| 1197 | Ga0070673_100095077 | |||
| 1198 | Ga0070673_100184845 | |||
| 1199 | Ga0070673_100380020 | |||
| 1200 | Ga0070673_100707310 | |||
| 1201 | Ga0070688_100145334 | |||
| 1202 | Ga0070659_100002265 | |||
| 1203 | Ga0070659_100007395 | |||
| 1204 | Ga0070659_100026260 | |||
| 1205 | Ga0070659_100042887 | |||
| 1206 | Ga0070659_100046732 | |||
| 1207 | Ga0070659_100061918 | |||
| 1208 | Ga0070659_100063461 | |||
| 1209 | Ga0070659_100071755 | |||
| 1210 | Ga0070659_100072381 | |||
| 1211 | Ga0070659_100076443 | |||
| 1212 | Ga0070659_100217543 | |||
| 1213 | Ga0070659_100359144 | |||
| 1214 | Ga0070659_100607268 | |||
| 1215 | Ga0070659_100753905 | |||
| 1216 | Ga0070667_100016730 | |||
| 1217 | Ga0070667_100018702 | |||
| 1218 | Ga0070667_100028334 | |||
| 1219 | Ga0070667_100067527 | |||
| 1220 | Ga0070667_100126935 | |||
| 1221 | Ga0070667_100364950 | |||
| 1222 | Ga0070667_100520366 | |||
| 1223 | Ga0070667_100664150 | |||
| 1224 | Ga0070714_100052478 | |||
| 1225 | Ga0070714_100151411 | |||
| 1226 | Ga0070714_100232687 | |||
| 1227 | Ga0070713_100099176 | |||
| 1228 | Ga0070713_100208854 | |||
| 1229 | Ga0070663_100010481 | |||
| 1230 | Ga0070663_100016600 | |||
| 1231 | Ga0070663_100019716 | |||
| 1232 | Ga0070663_100025965 | |||
| 1233 | Ga0070663_100046228 | |||
| 1234 | Ga0070663_100058195 | |||
| 1235 | Ga0070663_100058868 | |||
| 1236 | Ga0070663_100071953 | |||
| 1237 | Ga0070663_100198168 | |||
| 1238 | Ga0070678_100001675 | |||
| 1239 | Ga0070678_100003048 | |||
| 1240 | Ga0070678_100014022 | |||
| 1241 | Ga0070678_100485300 | |||
| 1242 | Ga0070662_100000024 | |||
| 1243 | Ga0070662_100002872 | |||
| 1244 | Ga0070662_100003498 | |||
| 1245 | Ga0070662_100010408 | |||
| 1246 | Ga0070662_100013108 | |||
| 1247 | Ga0070662_100104077 | |||
| 1248 | Ga0070662_100112592 | |||
| 1249 | Ga0070662_100117364 | |||
| 1250 | Ga0070662_100162463 | |||
| 1251 | Ga0070662_100467078 | |||
| 1252 | Ga0070681_10026279 | |||
| 1253 | Ga0070681_10051860 | |||
| 1254 | Ga0070681_10102348 | |||
| 1255 | Ga0070681_10567645 | |||
| 1256 | Ga0068867_100040403 | |||
| 1257 | Ga0068867_100054568 | |||
| 1258 | Ga0068867_100265997 | |||
| 1259 | Ga0068867_100417319 | |||
| 1260 | Ga0068867_100669660 | |||
| 1261 | Ga0070679_100015421 | |||
| 1262 | Ga0070679_100025101 | |||
| 1263 | Ga0070679_100060816 | |||
| 1264 | Ga0070679_100087589 | |||
| 1265 | Ga0070679_100185740 | |||
| 1266 | Ga0070679_100270753 | |||
| 1267 | Ga0070679_100290743 | |||
| 1268 | Ga0070679_100398370 | |||
| 1269 | Ga0070679_100413721 | |||
| 1270 | Ga0070679_100536611 | |||
| 1271 | Ga0070679_100547271 | |||
| 1272 | Ga0070684_100022302 | |||
| 1273 | Ga0070684_100032851 | |||
| 1274 | Ga0070684_100045690 | |||
| 1275 | Ga0070684_100117632 | |||
| 1276 | Ga0070684_100453685 | |||
| 1277 | Ga0068853_100000033 | |||
| 1278 | Ga0068853_100084017 | |||
| 1279 | Ga0068853_100097898 | |||
| 1280 | Ga0068853_100175729 | |||
| 1281 | Ga0068853_100183853 | |||
| 1282 | Ga0068853_100223357 | |||
| 1283 | Ga0068853_100544730 | |||
| 1284 | Ga0068853_100753075 | |||
| 1285 | Ga0070672_100001974 | |||
| 1286 | Ga0070672_100008693 | |||
| 1287 | Ga0070672_100030502 | |||
| 1288 | Ga0070672_100045131 | |||
| 1289 | Ga0070672_100110895 | |||
| 1290 | Ga0070672_100362611 | |||
| 1291 | Ga0070672_100508167 | |||
| 1292 | Ga0070672_100531518 | |||
| 1293 | Ga0070686_100020547 | |||
| 1294 | Ga0070696_100190051 | |||
| 1295 | Ga0070693_100002275 | |||
| 1296 | Ga0070693_100061904 | |||
| 1297 | Ga0070665_100007440 | |||
| 1298 | Ga0070665_100011849 | |||
| 1299 | Ga0070665_100014943 | |||
| 1300 | Ga0070665_100049682 | |||
| 1301 | Ga0070665_100056106 | |||
| 1302 | Ga0070665_100061780 | |||
| 1303 | Ga0070665_100567001 | |||
| 1304 | Ga0070665_100750885 | |||
| 1305 | Ga0068855_100006863 | |||
| 1306 | Ga0068855_100015672 | |||
| 1307 | Ga0068855_100072428 | |||
| 1308 | Ga0068855_100780115 | |||
| 1309 | Ga0068855_101033159 | |||
| 1310 | Ga0070664_100000764 | |||
| 1311 | Ga0070664_100001557 | |||
| 1312 | Ga0070664_100007136 | |||
| 1313 | Ga0070664_100011244 | |||
| 1314 | Ga0070664_100023812 | |||
| 1315 | Ga0070664_100065031 | |||
| 1316 | Ga0070664_100088455 | |||
| 1317 | Ga0070664_100162372 | |||
| 1318 | Ga0070664_100197268 | |||
| 1319 | Ga0068857_100009975 | |||
| 1320 | Ga0068857_100025794 | |||
| 1321 | Ga0068857_100031529 | |||
| 1322 | Ga0068857_100201474 | |||
| 1323 | Ga0068857_100533080 | |||
| 1324 | Ga0068857_100603757 | |||
| 1325 | Ga0068854_100005288 | |||
| 1326 | Ga0068854_100006274 | |||
| 1327 | Ga0068854_100010808 | |||
| 1328 | Ga0068854_100047447 | |||
| 1329 | Ga0068854_100091468 | |||
| 1330 | Ga0068854_100100044 | |||
| 1331 | Ga0068856_100000744 | |||
| 1332 | Ga0068856_100062685 | |||
| 1333 | Ga0068856_100122573 | |||
| 1334 | Ga0068856_100177374 | |||
| 1335 | Ga0068856_100753743 | |||
| 1336 | Ga0068852_100000973 | |||
| 1337 | Ga0068852_100014898 | |||
| 1338 | Ga0068852_100080870 | |||
| 1339 | Ga0068852_100089703 | |||
| 1340 | Ga0068852_100129614 | |||
| 1341 | Ga0068852_100633144 | |||
| 1342 | Ga0068852_100690709 | |||
| 1343 | Ga0068859_100021326 | |||
| 1344 | Ga0068859_100225537 | |||
| 1345 | Ga0068859_100547737 | |||
| 1346 | Ga0068864_100002620 | |||
| 1347 | Ga0068864_100008310 | |||
| 1348 | Ga0068864_100011993 | |||
| 1349 | Ga0068864_100130806 | |||
| 1350 | Ga0068864_101432960 | |||
| 1351 | Ga0068866_10119639 | |||
| 1352 | Ga0068861_100044015 | |||
| 1353 | Ga0068861_100294380 | |||
| 1354 | Ga0068851_10006427 | |||
| 1355 | Ga0068851_10011897 | |||
| 1356 | Ga0068851_10153583 | |||
| 1357 | Ga0068863_100002388 | |||
| 1358 | Ga0068863_100006118 | |||
| 1359 | Ga0068863_100015440 | |||
| 1360 | Ga0068863_100064550 | |||
| 1361 | Ga0068858_100012483 | |||
| 1362 | Ga0068858_100013052 | |||
| 1363 | Ga0068858_100053848 | |||
| 1364 | Ga0068858_100056423 | |||
| 1365 | Ga0068858_100107020 | |||
| 1366 | Ga0068858_100164611 | |||
| 1367 | Ga0068860_100029076 | |||
| 1368 | Ga0068860_100410551 | |||
| 1369 | Ga0068862_100016664 | |||
| 1370 | Ga0081539_10078794 | |||
| 1371 | Ga0070717_10033008 | |||
| 1372 | Ga0070717_10543289 | |||
| 1373 | Ga0070716_100349750 | |||
| 1374 | Ga0070712_100239730 | |||
| 1375 | Ga0075366_10028107 | |||
| 1376 | Ga0097621_100008257 | |||
| 1377 | Ga0097621_100022233 | |||
| 1378 | Ga0097621_100227210 | |||
| 1379 | Ga0097621_100228529 | |||
| 1380 | Ga0068871_100006708 | |||
| 1381 | Ga0068871_100168099 | |||
| 1382 | Ga0075429_100379380 | |||
| 1383 | Ga0068865_100002351 | |||
| 1384 | Ga0068865_100142997 | |||
| 1385 | Ga0068865_100262244 | |||
| 1386 | Ga0097620_100021326 | |||
| 1387 | Ga0097620_100225533 | |||
| 1388 | Ga0097620_100547751 | |||
| 1389 | Ga0105240_10012780 | |||
| 1390 | Ga0105240_10111404 | |||
| 1391 | Ga0105240_10251758 | |||
| 1392 | Ga0105240_10635062 | |||
| 1393 | Ga0105245_10005641 | |||
| 1394 | Ga0105245_10029285 | |||
| 1395 | Ga0105247_10194711 | |||
| 1396 | Ga0114129_10482685 | |||
| 1397 | Ga0105243_10062844 | |||
| 1398 | Ga0105241_10394974 | |||
| 1399 | Ga0105241_10779386 | |||
| 1400 | Ga0105242_10006705 | |||
| 1401 | Ga0105242_10374749 | |||
| 1402 | Ga0105242_10622346 | |||
| 1403 | Ga0105248_10000059 | |||
| 1404 | Ga0105248_10001063 | |||
| 1405 | Ga0105248_10015718 | |||
| 1406 | Ga0105248_10023073 | |||
| 1407 | Ga0105248_10084242 | |||
| 1408 | Ga0105248_10173813 | |||
| 1409 | Ga0105248_10189355 | |||
| 1410 | Ga0105248_10202777 | |||
| 1411 | Ga0105237_10153704 | |||
| 1412 | Ga0105237_11486239 | |||
| 1413 | Ga0105238_10009110 | |||
| 1414 | Ga0105238_10050418 | |||
| 1415 | Ga0105238_10184805 | |||
| 1416 | Ga0105238_10307118 | |||
| 1417 | Ga0105238_10329908 | |||
| 1418 | Ga0105238_11552221 | |||
| 1419 | Ga0105249_10047133 | |||
| 1420 | Ga0105239_10165072 | |||
| 1421 | Ga0105239_10883362 | |||
| 1422 | Ga0105246_10104267 | |||
| 1423 | Ga0105246_10326534 | |||
| 1424 | Ga0157373_10010767 | |||
| 1425 | Ga0157373_10184998 | |||
| 1426 | Ga0157373_10295024 | |||
| 1427 | Ga0157373_10429006 | |||
| 1428 | Ga0157373_10432952 | |||
| 1429 | Ga0157373_10575246 | |||
| 1430 | Ga0157371_10003693 | |||
| 1431 | Ga0157371_10008583 | |||
| 1432 | Ga0157371_10033884 | |||
| 1433 | Ga0157371_10055400 | |||
| 1434 | Ga0157371_10057330 | |||
| 1435 | Ga0157371_10074824 | |||
| 1436 | Ga0157371_10109735 | |||
| 1437 | Ga0157371_10128946 | |||
| 1438 | Ga0157371_10132912 | |||
| 1439 | Ga0157371_10223183 | |||
| 1440 | Ga0157371_10299927 | |||
| 1441 | Ga0157371_10319438 | |||
| 1442 | Ga0157370_10001103 | |||
| 1443 | Ga0157370_10044454 | |||
| 1444 | Ga0157370_10095559 | |||
| 1445 | Ga0157370_10341861 | |||
| 1446 | Ga0157370_10359876 | |||
| 1447 | Ga0157370_10643846 | |||
| 1448 | Ga0157369_10050251 | |||
| 1449 | Ga0157369_10135770 | |||
| 1450 | Ga0157369_10178800 | |||
| 1451 | Ga0157369_10220804 | |||
| 1452 | Ga0157369_10517774 | |||
| 1453 | Ga0157369_10675719 | |||
| 1454 | Ga0157374_10028621 | |||
| 1455 | Ga0157374_10029681 | |||
| 1456 | Ga0157374_10076236 | |||
| 1457 | Ga0157374_10109181 | |||
| 1458 | Ga0157374_10116596 | |||
| 1459 | Ga0157374_10182172 | |||
| 1460 | Ga0157378_10583748 | |||
| 1461 | Ga0163162_10013012 | |||
| 1462 | Ga0163162_10028826 | |||
| 1463 | Ga0163162_10359456 | |||
| 1464 | Ga0163162_10967237 | |||
| 1465 | Ga0157372_10244667 | |||
| 1466 | Ga0157372_10382616 | |||
| 1467 | Ga0157375_10005156 | |||
| 1468 | Ga0157375_10086625 | |||
| 1469 | Ga0157375_10277723 | |||
| 1470 | Ga0157375_10421870 | |||
| 1471 | Ga0157375_10733527 | |||
| 1472 | Ga0163163_10011444 | |||
| 1473 | Ga0163163_10013075 | |||
| 1474 | Ga0163163_10078530 | |||
| 1475 | Ga0157380_10061892 | |||
| 1476 | Ga0157380_10376898 | |||
| 1477 | Ga0182008_10074135 | |||
| 1478 | Ga0157379_10012547 | |||
| 1479 | Ga0157379_10312346 | |||
| 1480 | Ga0157376_10008170 | |||
| 1481 | Ga0163161_10003147 | |||
| 1482 | Ga0206353_10777765 | |||
| 1483 | Ga0207656_10053738 | |||
| 1484 | Ga0207656_10073626 | |||
| 1485 | Ga0207656_10085835 | |||
| 1486 | Ga0207656_10179936 | |||
| 1487 | Ga0207682_10004900 | |||
| 1488 | Ga0207682_10114545 | |||
| 1489 | Ga0207710_10134999 | |||
| 1490 | Ga0207688_10002334 | |||
| 1491 | Ga0207680_10003208 | |||
| 1492 | Ga0207680_10003571 | |||
| 1493 | Ga0207680_10007362 | |||
| 1494 | Ga0207680_10011823 | |||
| 1495 | Ga0207680_10079708 | |||
| 1496 | Ga0207647_10010223 | |||
| 1497 | Ga0207647_10015256 | |||
| 1498 | Ga0207647_10022636 | |||
| 1499 | Ga0207647_10039099 | |||
| 1500 | Ga0207647_10039161 | |||
| 1501 | Ga0207647_10057243 | |||
| 1502 | Ga0207647_10057611 | |||
| 1503 | Ga0207699_10052806 | |||
| 1504 | Ga0207645_10005776 | |||
| 1505 | Ga0207645_10015690 | |||
| 1506 | Ga0207645_10029120 | |||
| 1507 | Ga0207645_10084547 | |||
| 1508 | Ga0207643_10039898 | |||
| 1509 | Ga0207705_10000062 | |||
| 1510 | Ga0207705_10000722 | |||
| 1511 | Ga0207705_10007460 | |||
| 1512 | Ga0207705_10031274 | |||
| 1513 | Ga0207705_10035422 | |||
| 1514 | Ga0207705_10048183 | |||
| 1515 | Ga0207705_10076434 | |||
| 1516 | Ga0207705_10089909 | |||
| 1517 | Ga0207705_10097484 | |||
| 1518 | Ga0207705_10101827 | |||
| 1519 | Ga0207705_10142542 | |||
| 1520 | Ga0207705_10149894 | |||
| 1521 | Ga0207705_10226055 | |||
| 1522 | Ga0207705_10287558 | |||
| 1523 | Ga0207705_10326477 | |||
| 1524 | Ga0207705_10339282 | |||
| 1525 | Ga0207654_10052597 | |||
| 1526 | Ga0207707_10066825 | |||
| 1527 | Ga0207707_10128345 | |||
| 1528 | Ga0207707_10154190 | |||
| 1529 | Ga0207695_10002670 | |||
| 1530 | Ga0207695_10007729 | |||
| 1531 | Ga0207695_10289722 | |||
| 1532 | Ga0207660_10000049 | |||
| 1533 | Ga0207660_10003095 | |||
| 1534 | Ga0207660_10012414 | |||
| 1535 | Ga0207660_10048258 | |||
| 1536 | Ga0207660_10142575 | |||
| 1537 | Ga0207662_10151265 | |||
| 1538 | Ga0207657_10000806 | |||
| 1539 | Ga0207657_10005141 | |||
| 1540 | Ga0207657_10005538 | |||
| 1541 | Ga0207657_10007384 | |||
| 1542 | Ga0207657_10010408 | |||
| 1543 | Ga0207657_10013626 | |||
| 1544 | Ga0207657_10018453 | |||
| 1545 | Ga0207657_10022074 | |||
| 1546 | Ga0207657_10079643 | |||
| 1547 | Ga0207657_10115693 | |||
| 1548 | Ga0207657_10150904 | |||
| 1549 | Ga0207657_10201027 | |||
| 1550 | Ga0207657_10208382 | |||
| 1551 | Ga0207657_10284950 | |||
| 1552 | Ga0207657_10346308 | |||
| 1553 | Ga0207657_10481219 | |||
| 1554 | Ga0207649_10000248 | |||
| 1555 | Ga0207649_10000298 | |||
| 1556 | Ga0207649_10057721 | |||
| 1557 | Ga0207649_10058814 | |||
| 1558 | Ga0207649_10066241 | |||
| 1559 | Ga0207649_10177363 | |||
| 1560 | Ga0207649_10322653 | |||
| 1561 | Ga0207649_10332541 | |||
| 1562 | Ga0207649_10371909 | |||
| 1563 | Ga0207649_10442982 | |||
| 1564 | Ga0207652_10001278 | |||
| 1565 | Ga0207652_10012466 | |||
| 1566 | Ga0207652_10360631 | |||
| 1567 | Ga0207652_10445171 | |||
| 1568 | Ga0207681_10092476 | |||
| 1569 | Ga0207681_10257407 | |||
| 1570 | Ga0207681_10487724 | |||
| 1571 | Ga0207681_10563542 | |||
| 1572 | Ga0207694_10027796 | |||
| 1573 | Ga0207694_10031695 | |||
| 1574 | Ga0207650_10003932 | |||
| 1575 | Ga0207650_10075636 | |||
| 1576 | Ga0207650_10257537 | |||
| 1577 | Ga0207650_10344686 | |||
| 1578 | Ga0207650_10448604 | |||
| 1579 | Ga0207650_10464613 | |||
| 1580 | Ga0207650_10655301 | |||
| 1581 | Ga0207659_10002573 | |||
| 1582 | Ga0207659_10224158 | |||
| 1583 | Ga0207687_10050146 | |||
| 1584 | Ga0207687_10066297 | |||
| 1585 | Ga0207700_10328233 | |||
| 1586 | Ga0207664_10707144 | |||
| 1587 | Ga0207644_10000480 | |||
| 1588 | Ga0207644_10000602 | |||
| 1589 | Ga0207644_10002193 | |||
| 1590 | Ga0207644_10005323 | |||
| 1591 | Ga0207644_10006566 | |||
| 1592 | Ga0207644_10010023 | |||
| 1593 | Ga0207644_10028746 | |||
| 1594 | Ga0207644_10028869 | |||
| 1595 | Ga0207644_10065258 | |||
| 1596 | Ga0207644_10094432 | |||
| 1597 | Ga0207644_10606080 | |||
| 1598 | Ga0207690_10000032 | |||
| 1599 | Ga0207690_10004826 | |||
| 1600 | Ga0207690_10021827 | |||
| 1601 | Ga0207690_10036780 | |||
| 1602 | Ga0207690_10075371 | |||
| 1603 | Ga0207690_10098394 | |||
| 1604 | Ga0207690_10163117 | |||
| 1605 | Ga0207690_10198999 | |||
| 1606 | Ga0207690_10275220 | |||
| 1607 | Ga0207690_10293878 | |||
| 1608 | Ga0207690_10417128 | |||
| 1609 | Ga0207706_10004111 | |||
| 1610 | Ga0207706_10006526 | |||
| 1611 | Ga0207706_10011139 | |||
| 1612 | Ga0207706_10022657 | |||
| 1613 | Ga0207706_10022965 | |||
| 1614 | Ga0207706_10039069 | |||
| 1615 | Ga0207706_10042336 | |||
| 1616 | Ga0207706_10062892 | |||
| 1617 | Ga0207706_10078440 | |||
| 1618 | Ga0207706_10184133 | |||
| 1619 | Ga0207706_10383983 | |||
| 1620 | Ga0207706_10617582 | |||
| 1621 | Ga0207709_10115945 | |||
| 1622 | Ga0207709_10170202 | |||
| 1623 | Ga0207669_10054600 | |||
| 1624 | Ga0207669_10126214 | |||
| 1625 | Ga0207704_10079706 | |||
| 1626 | Ga0207704_10110822 | |||
| 1627 | Ga0207704_10300793 | |||
| 1628 | Ga0207704_10346839 | |||
| 1629 | Ga0207704_10749630 | |||
| 1630 | Ga0207665_10061039 | |||
| 1631 | Ga0207691_10004948 | |||
| 1632 | Ga0207691_10022216 | |||
| 1633 | Ga0207691_10052844 | |||
| 1634 | Ga0207691_10189904 | |||
| 1635 | Ga0207691_10257969 | |||
| 1636 | Ga0207711_10001111 | |||
| 1637 | Ga0207711_10001774 | |||
| 1638 | Ga0207711_10002373 | |||
| 1639 | Ga0207711_10003731 | |||
| 1640 | Ga0207711_10007179 | |||
| 1641 | Ga0207711_10289866 | |||
| 1642 | Ga0207711_10836198 | |||
| 1643 | Ga0207689_10015644 | |||
| 1644 | Ga0207689_10049684 | |||
| 1645 | Ga0207689_10078000 | |||
| 1646 | Ga0207661_10006645 | |||
| 1647 | Ga0207661_10010419 | |||
| 1648 | Ga0207661_10015311 | |||
| 1649 | Ga0207661_10018520 | |||
| 1650 | Ga0207679_10001017 | |||
| 1651 | Ga0207679_10005065 | |||
| 1652 | Ga0207679_10027244 | |||
| 1653 | Ga0207679_10039503 | |||
| 1654 | Ga0207679_10096322 | |||
| 1655 | Ga0207679_10105751 | |||
| 1656 | Ga0207679_10134468 | |||
| 1657 | Ga0207679_10160551 | |||
| 1658 | Ga0207679_10177466 | |||
| 1659 | Ga0207679_10255037 | |||
| 1660 | Ga0207679_10490965 | |||
| 1661 | Ga0207679_10825137 | |||
| 1662 | Ga0207667_10005986 | |||
| 1663 | Ga0207667_10023457 | |||
| 1664 | Ga0207667_10045478 | |||
| 1665 | Ga0207667_10062532 | |||
| 1666 | Ga0207667_10082296 | |||
| 1667 | Ga0207667_10116413 | |||
| 1668 | Ga0207667_10204843 | |||
| 1669 | Ga0207667_10308751 | |||
| 1670 | Ga0207667_10750414 | |||
| 1671 | Ga0207667_10945997 | |||
| 1672 | Ga0207651_10004134 | |||
| 1673 | Ga0207651_10012315 | |||
| 1674 | Ga0207651_10026798 | |||
| 1675 | Ga0207651_10048464 | |||
| 1676 | Ga0207651_10093822 | |||
| 1677 | Ga0207651_10234881 | |||
| 1678 | Ga0207651_10317045 | |||
| 1679 | Ga0207651_10446280 | |||
| 1680 | Ga0207712_10007278 | |||
| 1681 | Ga0207668_10000060 | |||
| 1682 | Ga0207668_10000305 | |||
| 1683 | Ga0207668_10226440 | |||
| 1684 | Ga0207640_10004572 | |||
| 1685 | Ga0207640_10006745 | |||
| 1686 | Ga0207640_10036599 | |||
| 1687 | Ga0207640_10045258 | |||
| 1688 | Ga0207640_10198687 | |||
| 1689 | Ga0207658_10011213 | |||
| 1690 | Ga0207658_10015501 | |||
| 1691 | Ga0207658_10021158 | |||
| 1692 | Ga0207658_10065316 | |||
| 1693 | Ga0207658_10113867 | |||
| 1694 | Ga0207658_10126658 | |||
| 1695 | Ga0207658_10143983 | |||
| 1696 | Ga0207658_10388677 | |||
| 1697 | Ga0207677_10003757 | |||
| 1698 | Ga0207677_10005316 | |||
| 1699 | Ga0207677_10018683 | |||
| 1700 | Ga0207677_10032197 | |||
| 1701 | Ga0207677_10085699 | |||
| 1702 | Ga0207703_10005779 | |||
| 1703 | Ga0207703_10012097 | |||
| 1704 | Ga0207703_10032873 | |||
| 1705 | Ga0207703_10073207 | |||
| 1706 | Ga0207703_10247434 | |||
| 1707 | Ga0207639_10003922 | |||
| 1708 | Ga0207639_10138525 | |||
| 1709 | Ga0207639_10164986 | |||
| 1710 | Ga0207639_10169247 | |||
| 1711 | Ga0207639_10175205 | |||
| 1712 | Ga0207639_10336024 | |||
| 1713 | Ga0207639_10620804 | |||
| 1714 | Ga0207639_10717674 | |||
| 1715 | Ga0207639_10773293 | |||
| 1716 | Ga0207678_10002886 | |||
| 1717 | Ga0207678_10008182 | |||
| 1718 | Ga0207678_10015624 | |||
| 1719 | Ga0207678_10015932 | |||
| 1720 | Ga0207678_10022734 | |||
| 1721 | Ga0207678_10022829 | |||
| 1722 | Ga0207678_10027098 | |||
| 1723 | Ga0207678_10028009 | |||
| 1724 | Ga0207678_10055859 | |||
| 1725 | Ga0207678_10075210 | |||
| 1726 | Ga0207678_10191921 | |||
| 1727 | Ga0207678_10753513 | |||
| 1728 | Ga0207702_10001312 | |||
| 1729 | Ga0207702_10004503 | |||
| 1730 | Ga0207702_10030048 | |||
| 1731 | Ga0207702_10090179 | |||
| 1732 | Ga0207702_10525706 | |||
| 1733 | Ga0207702_10623068 | |||
| 1734 | Ga0207641_10017731 | |||
| 1735 | Ga0207641_10030638 | |||
| 1736 | Ga0207641_10041909 | |||
| 1737 | Ga0207641_10112829 | |||
| 1738 | Ga0207641_10140221 | |||
| 1739 | Ga0207641_10142882 | |||
| 1740 | Ga0207641_10366370 | |||
| 1741 | Ga0207641_10523622 | |||
| 1742 | Ga0207648_10004358 | |||
| 1743 | Ga0207648_10012777 | |||
| 1744 | Ga0207648_10017845 | |||
| 1745 | Ga0207648_10036608 | |||
| 1746 | Ga0207648_10103199 | |||
| 1747 | Ga0207648_10317307 | |||
| 1748 | Ga0207648_10326835 | |||
| 1749 | Ga0207648_10493140 | |||
| 1750 | Ga0207676_10028584 | |||
| 1751 | Ga0207676_10034898 | |||
| 1752 | Ga0207676_10106307 | |||
| 1753 | Ga0207676_10436462 | |||
| 1754 | Ga0207674_10006197 | |||
| 1755 | Ga0207674_10008333 | |||
| 1756 | Ga0207674_10030489 | |||
| 1757 | Ga0207674_10094734 | |||
| 1758 | Ga0207674_10576464 | |||
| 1759 | Ga0207675_100141788 | |||
| 1760 | Ga0207683_10003116 | |||
| 1761 | Ga0207683_10003428 | |||
| 1762 | Ga0207683_10064322 | |||
| 1763 | Ga0207683_10276818 | |||
| 1764 | Ga0207683_10352177 | |||
| 1765 | Ga0207698_10000847 | |||
| 1766 | Ga0207698_10009031 | |||
| 1767 | Ga0207698_10009495 | |||
| 1768 | Ga0207698_10024453 | |||
| 1769 | Ga0207698_10031114 | |||
| 1770 | Ga0207698_10034678 | |||
| 1771 | Ga0207698_10070622 | |||
| 1772 | Ga0207698_10080539 | |||
| 1773 | Ga0207698_10139011 | |||
| 1774 | Ga0207698_10159401 | |||
| 1775 | Ga0207698_10245670 | |||
| 1776 | Ga0207698_10531707 | |||
| 1777 | Ga0207698_10533459 | |||
| 1778 | Ga0210002_1027579 | |||
| 1779 | Ga0268266_10002716 | |||
| 1780 | Ga0268266_10004790 | |||
| 1781 | Ga0268266_10066149 | |||
| 1782 | Ga0268266_10075978 | |||
| 1783 | Ga0268266_10102112 | |||
| 1784 | Ga0268266_10195370 | |||
| 1785 | Ga0268266_10205022 | |||
| 1786 | Ga0268266_10428080 | |||
| 1787 | Ga0268265_10034782 | |||
| 1788 | Ga0268265_10038097 | |||
| 1789 | Ga0268265_10200897 | |||
| 1790 | Ga0268265_10880478 | |||
| 1791 | Ga0268264_10018908 | |||
| 1792 | Ga0268264_10032269 | |||
| 1793 | Ga0268264_10334089 | |||
| 1794 | Ga0268264_10346927 | |||
| 1795 | Ga0268264_10919743 | |||
| 1796 | Ga0307408_100192679 | |||
| 1797 | Ga0307408_100205461 | |||
| 1798 | Ga0307408_100214542 | |||
| 1799 | Ga0307408_100533961 | |||
| 1800 | Ga0307405_10023645 | |||
| 1801 | Ga0307405_10047398 | |||
| 1802 | Ga0307405_10064982 | |||
| 1803 | Ga0307405_10111284 | |||
| 1804 | Ga0307405_10159375 | |||
| 1805 | Ga0307405_10309183 | |||
| 1806 | Ga0307405_10415405 | |||
| 1807 | Ga0307413_10047032 | |||
| 1808 | Ga0307413_10052914 | |||
| 1809 | Ga0307413_10056763 | |||
| 1810 | Ga0307413_10075440 | |||
| 1811 | Ga0307413_10165362 | |||
| 1812 | Ga0307413_10289007 | |||
| 1813 | Ga0307413_10877435 | |||
| 1814 | Ga0307410_10030062 | |||
| 1815 | Ga0307410_10035812 | |||
| 1816 | Ga0307410_10038213 | |||
| 1817 | Ga0307410_10089150 | |||
| 1818 | Ga0307410_10156109 | |||
| 1819 | Ga0307410_10356005 | |||
| 1820 | Ga0307410_10390274 | |||
| 1821 | Ga0307406_10051031 | |||
| 1822 | Ga0307406_10126107 | |||
| 1823 | Ga0307406_10171953 | |||
| 1824 | Ga0307406_10300077 | |||
| 1825 | Ga0307406_10444751 | |||
| 1826 | Ga0307406_10511443 | |||
| 1827 | Ga0307406_10696438 | |||
| 1828 | Ga0307407_10001616 | |||
| 1829 | Ga0307407_10003255 | |||
| 1830 | Ga0307407_10015119 | |||
| 1831 | Ga0307407_10022827 | |||
| 1832 | Ga0307407_10074589 | |||
| 1833 | Ga0307407_10102594 | |||
| 1834 | Ga0307407_10122798 | |||
| 1835 | Ga0307412_10038423 | |||
| 1836 | Ga0307412_10066464 | |||
| 1837 | Ga0307412_10074980 | |||
| 1838 | Ga0307412_10115716 | |||
| 1839 | Ga0307412_10251406 | |||
| 1840 | Ga0307412_10322196 | |||
| 1841 | Ga0307412_10514225 | |||
| 1842 | Ga0307412_10814908 | |||
| 1843 | Ga0307409_100017127 | |||
| 1844 | Ga0307409_100019418 | |||
| 1845 | Ga0307409_100025563 | |||
| 1846 | Ga0307409_100034226 | |||
| 1847 | Ga0307409_100040485 | |||
| 1848 | Ga0307409_100078235 | |||
| 1849 | Ga0307409_100089141 | |||
| 1850 | Ga0307409_100121384 | |||
| 1851 | Ga0307409_100141775 | |||
| 1852 | Ga0307409_100147686 | |||
| 1853 | Ga0307409_100270771 | |||
| 1854 | Ga0307409_100271372 | |||
| 1855 | Ga0307409_100335037 | |||
| 1856 | Ga0307409_100898750 | |||
| 1857 | Ga0307416_100032356 | |||
| 1858 | Ga0307416_100100348 | |||
| 1859 | Ga0307416_100388659 | |||
| 1860 | Ga0307416_100478789 | |||
| 1861 | Ga0307416_100768336 | |||
| 1862 | Ga0307416_100855629 | |||
| 1863 | Ga0307414_10007915 | |||
| 1864 | Ga0307414_10038599 | |||
| 1865 | Ga0307414_10076948 | |||
| 1866 | Ga0307414_10111397 | |||
| 1867 | Ga0307414_10143299 | |||
| 1868 | Ga0307414_10183851 | |||
| 1869 | Ga0307414_10294309 | |||
| 1870 | Ga0307414_10349892 | |||
| 1871 | Ga0307414_10385874 | |||
| 1872 | Ga0307414_10427802 | |||
| 1873 | Ga0307414_10560412 | |||
| 1874 | Ga0307411_10005280 | |||
| 1875 | Ga0307411_10024959 | |||
| 1876 | Ga0307411_10025392 | |||
| 1877 | Ga0307411_10045546 | |||
| 1878 | Ga0307411_10052282 | |||
| 1879 | Ga0307411_10063273 | |||
| 1880 | Ga0307411_10159932 | |||
| 1881 | Ga0307415_100025016 | |||
| 1882 | Ga0307415_100030873 | |||
| 1883 | Ga0307415_100062967 | |||
| 1884 | Ga0307415_100098717 | |||
| 1885 | Ga0307415_100217783 | |||
| 1886 | Ga0307415_100275009 | |||
| 1887 | Ga0307415_100386110 | |||
| 1888 | Ga0307415_100631562 | |||
| 1889 | Ga0373958_0027312 | |||
| 1890 | Ga0373959_0014065 | |||
| 1891 | Ga0373960_0099009 | |||
| 1892 | Ga0373943_0003828 | |||
| 1893 | Ga0373946_0221459 | |||
| 1894 | Ga0373955_0010585 | |||
| 1895 | Ga0373931_0005873 | |||
| 1896 | Ga0373931_0097862 | |||
| 1897 | Ga0373935_0051818 | |||
| 1898 | Ga0373935_0386460 | |||
| 1899 | Ga0373927_0408220 | |||
| 1900 | Ga0373925_0058308 | |||
| 1901 | Ga0395899_0000225 | |||
| 1902 | Ga0395899_0000287 | |||
| 1903 | Ga0395899_0012312 | |||
| 1904 | Ga0395899_0012355 | |||
| 1905 | Ga0395899_0022188 | |||
| 1906 | Ga0395899_0034518 | |||
| 1907 | Ga0395899_0034858 | |||
| 1908 | Ga0395899_0051115 | |||
| 1909 | Ga0395899_0055067 | |||
| 1910 | Ga0395899_0056903 | |||
| 1911 | Ga0395899_0069775 | |||
| 1912 | Ga0395899_0081391 | |||
| 1913 | Ga0395899_0162166 | |||
| 1914 | Ga0395899_0374317 | |||
| 1915 | Ga0395900_0000031 | |||
| 1916 | Ga0395900_0000667 | |||
| 1917 | Ga0395900_0000995 | |||
| 1918 | Ga0395900_0004654 | |||
| 1919 | Ga0395900_0006620 | |||
| 1920 | Ga0395900_0007890 | |||
| 1921 | Ga0395900_0008681 | |||
| 1922 | Ga0395900_0012095 | |||
| 1923 | Ga0395900_0018339 | |||
| 1924 | Ga0395900_0020548 | |||
| 1925 | Ga0395900_0021986 | |||
| 1926 | Ga0395900_0035598 | |||
| 1927 | Ga0395900_0049751 | |||
| 1928 | Ga0395900_0059906 | |||
| 1929 | Ga0395900_0060674 | |||
| 1930 | Ga0395900_0064625 | |||
| 1931 | Ga0395900_0083518 | |||
| 1932 | Ga0395900_0092202 | |||
| 1933 | Ga0395900_0092610 | |||
| 1934 | Ga0395900_0113487 | |||
| 1935 | Ga0395900_0142196 | |||
| 1936 | Ga0395900_0142428 | |||
| 1937 | Ga0395900_0181443 | |||
| 1938 | Ga0395900_0200004 | |||
| 1939 | Ga0395900_0255063 | |||
| 1940 | Ga0395900_0255629 | |||
| 1941 | Ga0395900_0270463 | |||
| 1942 | Ga0395900_0296762 | |||
| 1943 | Ga0395900_0347605 | |||
| 1944 | Ga0395900_0365089 | |||
| 1945 | Ga0395900_0524073 | |||
| 1946 | Ga0395900_0641575 | |||
| 1947 | Ga0395900_0700463 | |||
| 1948 | Ga0395898_0000021 | |||
| 1949 | Ga0395898_0001423 | |||
| 1950 | Ga0395898_0010117 | |||
| 1951 | Ga0395898_0013926 | |||
| 1952 | Ga0395898_0016596 | |||
| 1953 | Ga0395898_0018316 | |||
| 1954 | Ga0395898_0022708 | |||
| 1955 | Ga0395898_0026773 | |||
| 1956 | Ga0395898_0027964 | |||
| 1957 | Ga0395898_0040539 | |||
| 1958 | Ga0395898_0045213 | |||
| 1959 | Ga0395898_0076532 | |||
| 1960 | Ga0395898_0078629 | |||
| 1961 | Ga0395898_0091730 | |||
| 1962 | Ga0395898_0093201 | |||
| 1963 | Ga0395898_0165953 | |||
| 1964 | Ga0395898_0300795 | |||
| 1965 | Ga0395898_0300830 | |||
| 1966 | Ga0395898_0324192 | |||
| 1967 | Ga0395898_0440601 | |||
| 1968 | Ga0395898_0539478 | |||
| 1969 | Ga0395898_0541075 | |||
| 1970 | Ga0395898_0629501 | |||
| 1971 | Ga0395898_0634218 | |||
| 1972 | Ga0395905_0000006 | |||
| 1973 | Ga0395905_0000458 | |||
| 1974 | Ga0395905_0000546 | |||
| 1975 | Ga0395905_0004550 | |||
| 1976 | Ga0395905_0005759 | |||
| 1977 | Ga0395905_0006041 | |||
| 1978 | Ga0395905_0008628 | |||
| 1979 | Ga0395905_0008982 | |||
| 1980 | Ga0395905_0010507 | |||
| 1981 | Ga0395905_0017874 | |||
| 1982 | Ga0395905_0019288 | |||
| 1983 | Ga0395905_0025738 | |||
| 1984 | Ga0395905_0036984 | |||
| 1985 | Ga0395905_0038210 | |||
| 1986 | Ga0395905_0044340 | |||
| 1987 | Ga0395905_0047816 | |||
| 1988 | Ga0395905_0056951 | |||
| 1989 | Ga0395905_0070887 | |||
| 1990 | Ga0395905_0081917 | |||
| 1991 | Ga0395905_0104770 | |||
| 1992 | Ga0395905_0111297 | |||
| 1993 | Ga0395905_0132965 | |||
| 1994 | Ga0395905_0133826 | |||
| 1995 | Ga0395905_0144749 | |||
| 1996 | Ga0395905_0191104 | |||
| 1997 | Ga0395905_0198649 | |||
| 1998 | Ga0395905_0234274 | |||
| 1999 | Ga0395905_0252745 | |||
| 2000 | Ga0395905_0254130 | |||
| 2001 | Ga0395905_0282510 | |||
| 2002 | Ga0395905_0292858 | |||
| 2003 | Ga0395905_0347717 | |||
| 2004 | Ga0395905_0404902 | |||
| 2005 | Ga0395905_0937749 | |||
| 2006 | Ga0395901_0000035 | |||
| 2007 | Ga0395901_0000329 | |||
| 2008 | Ga0395901_0000447 | |||
| 2009 | Ga0395901_0002236 | |||
| 2010 | Ga0395901_0011667 | |||
| 2011 | Ga0395901_0014220 | |||
| 2012 | Ga0395901_0016878 | |||
| 2013 | Ga0395901_0017691 | |||
| 2014 | Ga0395901_0018937 | |||
| 2015 | Ga0395901_0022077 | |||
| 2016 | Ga0395901_0033936 | |||
| 2017 | Ga0395901_0042408 | |||
| 2018 | Ga0395901_0061277 | |||
| 2019 | Ga0395901_0063581 | |||
| 2020 | Ga0395901_0074050 | |||
| 2021 | Ga0395901_0077844 | |||
| 2022 | Ga0395901_0096410 | |||
| 2023 | Ga0395901_0096711 | |||
| 2024 | Ga0395901_0100630 | |||
| 2025 | Ga0395901_0114576 | |||
| 2026 | Ga0395901_0123717 | |||
| 2027 | Ga0395901_0126761 | |||
| 2028 | Ga0395901_0130361 | |||
| 2029 | Ga0395901_0159826 | |||
| 2030 | Ga0395901_0180874 | |||
| 2031 | Ga0395901_0205808 | |||
| 2032 | Ga0395901_0214178 | |||
| 2033 | Ga0395901_0237910 | |||
| 2034 | Ga0395901_0243581 | |||
| 2035 | Ga0395901_0268702 | |||
| 2036 | Ga0395901_0302354 | |||
| 2037 | Ga0395901_0315448 | |||
| 2038 | Ga0395901_0315789 | |||
| 2039 | Ga0395901_0334247 | |||
| 2040 | Ga0395901_0483093 | |||
| 2041 | Ga0395901_0580785 | |||
| 2042 | Ga0439465_0059432 | |||
| 2043 | Ga0451853_4013415 | |||
| 2044 | Ga0439445_0000682 | |||
| 2045 | Ga0439455_0008389 | |||
| 2046 | Ga0439462_0000649 | |||
| 2047 | Ga0439458_0000869 | |||
| 2048 | Ga0439458_0002129 | |||
| 2049 | Ga0439434_0053432 | |||
| 2050 | Ga0439434_0130592 | |||
| 2051 | Ga0466969_0026198 | |||
| 2052 | Ga0466969_0030177 | |||
| 2053 | Ga0466969_0141247 | |||
| 2054 | Ga0466972_0189958 | |||
| 2055 | Ga0466966_0000003 | |||
| 2056 | Ga0466966_0000732 | |||
| 2057 | Ga0466966_0008925 | |||
| 2058 | Ga0466966_0087410 | |||
| 2059 | Ga0466961_0003019 | |||
| 2060 | Ga0466961_0011172 | |||
| 2061 | Ga0466961_0026828 | |||
| 2062 | Ga0466961_0033166 | |||
| 2063 | Ga0466961_0043582 | |||
| 2064 | Ga0466961_0047897 | |||
| 2065 | Ga0466961_0450189 | |||
| 2066 | Ga0466963_0007609 | |||
| 2067 | Ga0466963_0098731 | |||
| 2068 | Ga0466963_0126435 | |||
| 2069 | Ga0466963_0188863 | |||
| 2070 | Ga0466963_0216643 | |||
| 2071 | Ga0466963_0668430 | |||
| 2072 | Ga0466964_0007088 | |||
| 2073 | Ga0466964_0099491 | |||
| 2074 | Ga0466964_0183598 | |||
| 2075 | Ga0466964_0242980 | |||
| 2076 | Ga0466971_0003492 | |||
| 2077 | Ga0466971_0045623 | |||
| 2078 | Ga0466971_0131104 | |||
| 2079 | Ga0466970_0003584 | |||
| 2080 | Ga0466970_0026024 | |||
| 2081 | Ga0466970_0079950 | |||
| 2082 | Ga0466957_0000953 | |||
| 2083 | Ga0466957_0001732 | |||
| 2084 | Ga0466957_0016312 | |||
| 2085 | Ga0466957_0039882 | |||
| 2086 | Ga0466960_0099025 | |||
| 2087 | Ga0466959_0039343 | |||
| 2088 | Ga0466959_0084300 | |||
| 2089 | Ga0466959_0102461 | |||
| 2090 | Ga0466958_0001680 | |||
| 2091 | Ga0466958_0007909 | |||
| 2092 | Ga0466958_0008167 | |||
| 2093 | Ga0466958_0035552 | |||
| 2094 | Ga0466958_0042248 | |||
| 2095 | Ga0466958_0209355 | |||
| 2096 | Ga0466958_0263707 | |||
| 2097 | Ga0466967_0000053 | |||
| 2098 | Ga0466967_0014039 | |||
| 2099 | Ga0466967_0043312 | |||
| 2100 | Ga0466967_0052615 | |||
| 2101 | Ga0466967_0077397 | |||
| 2102 | Ga0466967_0097591 | |||
| 2103 | Ga0466967_0167230 | |||
| 2104 | Ga0466967_0196732 | |||
| 2105 | Ga0466967_0400376 | |||
| 2106 | Ga0466967_0746592 | |||
| 2107 | Ga0495638_0000123 | |||
| 2108 | Ga0495583_0009841 | |||
| 2109 | Ga0495663_0013943 | |||
| 2110 | Ga0495621_0143538 | |||
| 2111 | Ga0495668_0035028 | |||
| 2112 | Ga0495669_0001119 | |||
| 2113 | Ga0495669_0001213 | |||
| 2114 | Ga0495669_0002528 | |||
| 2115 | Ga0495669_0027073 | |||
| 2116 | Ga0495669_0037666 | |||
| 2117 | Ga0495669_0117076 | |||
| 2118 | Ga0495669_0201291 | |||
| 2119 | Ga0495677_0001629 | |||
| 2120 | Ga0496100_0001680 | |||
| 2121 | Ga0496100_0198083 | |||
| 2122 | Ga0496101_0010039 | |||
| 2123 | Ga0496101_0010994 | |||
| 2124 | Ga0496101_0023192 | |||
| 2125 | Ga0496102_0116015 | |||
| 2126 | Ga0496102_0137704 | |||
| 2127 | Ga0496102_0659658 | |||
| 2128 | Ga0496102_0865333 | |||
| 2129 | Ga0496103_0140036 | |||
| 2130 | Ga0496105_0023454 | |||
| 2131 | Ga0496105_0502488 | |||
| 2132 | Ga0496106_0002579 | |||
| 2133 | Ga0496106_0018487 | |||
| 2134 | Ga0496107_0007063 | |||
| 2135 | Ga0496107_0022709 | |||
| 2136 | Ga0496107_0029644 | |||
| 2137 | Ga0496107_0048610 | |||
| 2138 | Ga0496107_0057006 | |||
| 2139 | Ga0496108_0089031 | |||
| 2140 | Ga0496108_0386798 | |||
| 2141 | Ga0496108_0431851 | |||
| 2142 | Ga0496109_0008457 | |||
| 2143 | Ga0496109_0038142 | |||
| 2144 | Ga0496109_0104251 | |||
| 2145 | Ga0496109_0203283 | |||
| 2146 | Ga0496109_0242174 | |||
| 2147 | Ga0496109_0247349 | |||
| 2148 | Ga0496109_0256120 | |||
| 2149 | Ga0496109_0604084 | |||
| 2150 | Ga0496109_0783540 | |||
| 2151 | Ga0496110_0009035 | |||
| 2152 | Ga0496110_0011554 | |||
| 2153 | Ga0496110_0024535 | |||
| 2154 | Ga0496110_0075381 | |||
| 2155 | Ga0496111_0063568 | |||
| 2156 | Ga0496111_0090686 | |||
| 2157 | Ga0496111_0474250 | |||
| 2158 | Ga0496112_0002124 | |||
| 2159 | Ga0496112_0055046 | |||
| 2160 | Ga0496112_0472855 | |||
| 2161 | Ga0496112_0675530 | |||
| 2162 | Ga0496112_0949316 | |||
| 2163 | Ga0496113_0014228 | |||
| 2164 | Ga0496113_0041800 | |||
| 2165 | Ga0496113_0078194 | |||
| 2166 | Ga0496113_0149728 | |||
| 2167 | Ga0496113_0445850 | |||
| 2168 | Ga0496114_0000131 | |||
| 2169 | Ga0496114_0054991 | |||
| 2170 | Ga0496114_0107963 | |||
| 2171 | Ga0496115_0000571 | |||
| 2172 | Ga0496115_0118450 | |||
| 2173 | Ga0501067_0074895 | |||
| 2174 | Ga0501068_0295739 | |||
| 2175 | Ga0501069_0183647 | |||
| 2176 | Ga0501080_0121137 | |||
| 2177 | Ga0501268_029376 | |||
| 2178 | nmdc:mga0k408_136293_c1 | |||
| 2179 | nmdc:mga05p37_479373_c1 | |||
| 2180 | nmdc:mga09592_446196_c1 | |||
| 2181 | Ga0495612_0061294 | |||
| 2182 | Ga0495655_0004094 | |||
| 2183 | Ga0500658_0004662 | |||
| 2184 | Ga0466962_0003081 | |||
| 2185 | Ga0466962_0015638 | |||
| 2186 | Ga0466962_0017588 | |||
| 2187 | Ga0466962_0114780 | |||
| 2188 | 2848299793 | |||
| 2189 | 2852655217 | |||
| 2190 | 2882807948 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xi3-assembly1.cif.gz_B | thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 | 0.9121 | 22 | 220 |
| 3nm1-assembly1.cif.gz_F | the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes | 0.885 | 20 | 221 |
| 3nl6-assembly1.cif.gz_B-2 | the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes | 0.8845 | 20 | 219 |
| 3nm3-assembly1.cif.gz_D | the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes | 0.8819 | 22 | 220 |
| 3nm3-assembly1.cif.gz_A | the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes | 0.8812 | 22 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6MYJ2_339_548_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.915 | 22 | 220 | 3.20.20.70 |
| 1xi3B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9121 | 22 | 220 | 3.20.20.70 |
| af_P40386_1_220_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9121 | 18 | 221 | 3.20.20.70 |
| af_Q2FWG3_1_212_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.91 | 21 | 221 | 3.20.20.70 |
| af_A0A1D6M361_73_204_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8893 | 22 | 146 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P0DT70-F1-model_v4 | deleted | 0.9913 | 21 | 220 |
|
| AF-A0A5P6NBW4-F1-model_v4 | Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) | 0.9894 | 21 | 220 |
GO:0000287
GO:0004789 GO:0005737 GO:0009228 GO:0009229 |
| AF-A0A520WW14-F1-model_v4 | Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) | 0.9846 | 21 | 220 |
GO:0000287
GO:0004789 GO:0005737 GO:0009228 GO:0009229 |
| AF-A0A5C6UBD2-F1-model_v4 | Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) | 0.9832 | 14 | 220 |
GO:0000287
GO:0004789 GO:0005737 GO:0009228 GO:0009229 |
| AF-A0A6I4TLC4-F1-model_v4 | Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) | 0.9825 | 17 | 222 |
GO:0000287
GO:0004789 GO:0005737 GO:0009228 GO:0009229 |