F489953

General Info

Members Datasets Scaffolds Average Seq Length
1095 481 1079 129

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10555050|Ga0105248_105550501
Length 149
Sequence VELPEHFAYGGADIEQRNSMAKTETTRVRRKERKNITSGVAHVNASFNNTMITITDVQGNTISWSSSGVMGFKGSRKSTPYAAQVAAEDAAKKAQEHGMKTLEVEVRGPGSGRESALRALQAAGFNVTSIRDVTSIPHNGCRPRKRRRV

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2643221580 Devosia sp. Root635 Isolate Unclassified
3 2643221591 Devosia sp. Root685 Isolate Unclassified
4 2643221629 Devosia sp. Root105 Isolate Unclassified
5 2643221662 Devosia sp. Root413D1 Isolate Unclassified
6 2643221674 Devosia sp. Root436 Isolate Unclassified
7 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
8 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
9 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
10 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
11 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
12 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
13 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
14 2932401849 Devosia sp. 2618 Isolate Rhizosphere
15 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
102 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
122 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
197 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
198 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
215 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
219 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
220 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
239 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
240 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
241 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
242 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
243 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
251 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
252 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
259 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
267 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
268 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
269 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
270 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
271 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
272 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
273 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
274 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
279 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
280 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
281 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
282 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
283 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
284 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
285 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
286 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
287 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
288 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
289 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
290 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
291 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
292 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
293 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
294 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
295 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
296 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
297 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
298 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
299 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
300 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
301 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
302 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
303 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
304 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
305 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
306 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
307 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
308 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
309 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
310 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
311 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
312 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
313 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
314 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
315 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
316 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
317 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
318 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
319 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
322 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
325 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
377 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
378 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
381 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
387 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
388 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
394 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
397 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
402 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
403 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
404 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
405 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
406 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
412 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
413 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
414 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
415 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
416 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
419 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
420 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
421 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
422 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
423 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
424 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
425 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
428 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
429 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
430 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
431 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
479 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
480 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
481 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.47
Metatranscriptomes 15.07
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.31
Nodule 0.09
Rhizoplane 1.92
Rhizosphere 83.93
Stem 0
Stem Tuber 0.09
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10036215 3300001979 Bacteria 1535
2 JGI24745J21846_1003022 3300002073 Bacteria 1742
3 JGI25165J46597_1000961 3300003214 Bacteria 19619
4 Ga0055536_1016175 3300003781 Bacteria 2508
5 Ga0058862_10049717 3300004803 Bacteria 698
6 Ga0058862_12821384 3300004803 Bacteria 961
7 Ga0070658_10034257 3300005327 Bacteria 4086
8 Ga0070658_10236536 3300005327 Bacteria 1548
9 Ga0070658_10483582 3300005327 Bacteria 1068
10 Ga0070658_10774137 3300005327 Bacteria 833
11 Ga0070676_10322091 3300005328 Bacteria 1054
12 Ga0070683_100081257 3300005329 Bacteria 3034
13 Ga0070683_100931522 3300005329 Bacteria 834
14 Ga0070666_10543561 3300005335 Bacteria 845
15 Ga0070680_100825801 3300005336 Bacteria 799
16 Ga0070682_100178640 3300005337 Bacteria 1481
17 Ga0068868_100125269 3300005338 Bacteria 2098
18 Ga0070660_100004846 3300005339 Bacteria 9293
19 Ga0070660_100070020 3300005339 Bacteria 2737
20 Ga0070660_100158975 3300005339 Bacteria 1820
21 Ga0070660_100173896 3300005339 Bacteria 1740
22 Ga0070660_101397473 3300005339 Bacteria 595
23 Ga0070689_100196042 3300005340 Bacteria 1647
24 Ga0070691_10560979 3300005341 Bacteria 669
25 Ga0070687_100352816 3300005343 Bacteria 950
26 Ga0070661_100001887 3300005344 Bacteria 14515
27 Ga0070661_100381304 3300005344 Bacteria 1111
28 Ga0070661_100971558 3300005344 Bacteria 703
29 Ga0070668_100092896 3300005347 Bacteria 2381
30 Ga0070668_100341616 3300005347 Bacteria 1265
31 Ga0070668_101254259 3300005347 Bacteria 673
32 Ga0070675_100065182 3300005354 Bacteria 3011
33 Ga0070674_100013740 3300005356 Bacteria 5011
34 Ga0070673_100089902 3300005364 Bacteria 2508
35 Ga0070673_100695057 3300005364 Bacteria 934
36 Ga0070673_101731876 3300005364 Bacteria 592
37 Ga0070659_100017338 3300005366 Bacteria 5417
38 Ga0070659_100133943 3300005366 Bacteria 2014
39 Ga0070667_101559602 3300005367 Bacteria 621
40 Ga0070713_100178759 3300005436 Bacteria 1905
41 Ga0070711_100426424 3300005439 Bacteria 1082
42 Ga0070708_100278752 3300005445 Bacteria 1573
43 Ga0070663_100164203 3300005455 Bacteria 1711
44 Ga0070663_100223410 3300005455 Bacteria 1479
45 Ga0070663_101316873 3300005455 Bacteria 638
46 Ga0070678_100090091 3300005456 Bacteria 2350
47 Ga0070662_100298211 3300005457 Bacteria 1309
48 Ga0070681_10001062 3300005458 Bacteria 23407
49 Ga0070681_10009391 3300005458 Bacteria 9625
50 Ga0070681_10197259 3300005458 Bacteria 1931
51 Ga0070681_10197413 3300005458 Bacteria 1931
52 Ga0070681_10487401 3300005458 Bacteria 1146
53 Ga0068867_100332252 3300005459 Bacteria 1263
54 Ga0070706_100100584 3300005467 Bacteria 2686
55 Ga0070707_101039777 3300005468 Bacteria 785
56 Ga0070698_100001015 3300005471 Bacteria 30868
57 Ga0070698_100525376 3300005471 Bacteria 1122
58 Ga0070699_100441013 3300005518 Bacteria 1180
59 Ga0070679_100007538 3300005530 Bacteria 10174
60 Ga0070679_100010304 3300005530 Bacteria 8860
61 Ga0070679_100113062 3300005530 Bacteria 2701
62 Ga0070679_100753323 3300005530 Bacteria 917
63 Ga0070697_100081984 3300005536 Bacteria 2658
64 Ga0068853_100000888 3300005539 Bacteria 20812
65 Ga0068853_100007192 3300005539 Bacteria 8911
66 Ga0068853_100018646 3300005539 Bacteria 5744
67 Ga0068853_101001024 3300005539 Bacteria 804
68 Ga0068853_101193400 3300005539 Bacteria 735
69 Ga0070672_100347782 3300005543 Bacteria 1263
70 Ga0070672_101170313 3300005543 Bacteria 684
71 Ga0070693_100354020 3300005547 Bacteria 1006
72 Ga0070665_100050199 3300005548 Bacteria 4186
73 Ga0070665_100323781 3300005548 Bacteria 1546
74 Ga0070665_100823091 3300005548 Bacteria 941
75 Ga0070665_101598780 3300005548 Bacteria 660
76 Ga0068855_100075649 3300005563 Bacteria 3909
77 Ga0068855_100323488 3300005563 Bacteria 1704
78 Ga0068855_100367187 3300005563 Bacteria 1583
79 Ga0068855_100404497 3300005563 Bacteria 1495
80 Ga0068855_100514510 3300005563 Bacteria 1299
81 Ga0068855_100827425 3300005563 Bacteria 982
82 Ga0068855_101969227 3300005563 Bacteria 591
83 Ga0068855_102172949 3300005563 Bacteria 558
84 Ga0070664_100028105 3300005564 Bacteria 4677
85 Ga0070664_100688593 3300005564 Bacteria 952
86 Ga0068857_100165278 3300005577 Bacteria 2009
87 Ga0068857_100260674 3300005577 Bacteria 1591
88 Ga0068857_100402067 3300005577 Bacteria 1274
89 Ga0068857_100519616 3300005577 Bacteria 1119
90 Ga0068857_100845518 3300005577 Bacteria 876
91 Ga0068854_100157239 3300005578 Bacteria 1757
92 Ga0068854_100159518 3300005578 Bacteria 1745
93 Ga0068854_100362416 3300005578 Bacteria 1190
94 Ga0068854_100561517 3300005578 Bacteria 970
95 Ga0068854_100592850 3300005578 Bacteria 945
96 Ga0068856_100009374 3300005614 Bacteria 9508
97 Ga0068856_100028895 3300005614 Bacteria 5417
98 Ga0068856_100059597 3300005614 Bacteria 3770
99 Ga0068856_100193379 3300005614 Bacteria 2048
100 Ga0068856_100370182 3300005614 Bacteria 1452
101 Ga0068852_100031702 3300005616 Bacteria 4367
102 Ga0068852_100323807 3300005616 Bacteria 1498
103 Ga0068852_100324806 3300005616 Bacteria 1495
104 Ga0068852_100757434 3300005616 Bacteria 983
105 Ga0068859_100894715 3300005617 Bacteria 973
106 Ga0068859_101482758 3300005617 Bacteria 749
107 Ga0068864_100927981 3300005618 Bacteria 861
108 Ga0068864_101511055 3300005618 Bacteria 675
109 Ga0068861_100513425 3300005719 Bacteria 1085
110 Ga0068851_10002106 3300005834 Bacteria 8757
111 Ga0068851_10030591 3300005834 Bacteria 2670
112 Ga0068858_101166860 3300005842 Bacteria 757
113 Ga0068860_100307341 3300005843 Bacteria 1554
114 Ga0068862_100218768 3300005844 Bacteria 1723
115 Ga0081455_10000156 3300005937 Bacteria 82406
116 Ga0081455_10019943 3300005937 Bacteria 6329
117 Ga0081455_10043697 3300005937 Bacteria 3916
118 Ga0081538_10003741 3300005981 Bacteria 14245
119 Ga0081538_10005275 3300005981 Bacteria 11664
120 Ga0081538_10105083 3300005981 Bacteria 1406
121 Ga0081539_10006788 3300005985 Bacteria 10739
122 Ga0075365_10268947 3300006038 Bacteria 1199
123 Ga0075365_10394540 3300006038 Bacteria 976
124 Ga0075365_10955654 3300006038 Bacteria 604
125 Ga0075368_10033501 3300006042 Bacteria 1998
126 Ga0075368_10224016 3300006042 Bacteria 799
127 Ga0075368_10347243 3300006042 Bacteria 646
128 Ga0075363_100016090 3300006048 Bacteria 3690
129 Ga0075363_100682371 3300006048 Bacteria 619
130 Ga0075364_10014487 3300006051 Bacteria 4873
131 Ga0075364_10050081 3300006051 Bacteria 2726
132 Ga0075364_10724124 3300006051 Bacteria 679
133 Ga0075364_10907606 3300006051 Bacteria 600
134 Ga0070716_101271575 3300006173 Bacteria 594
135 Ga0070712_100304500 3300006175 Bacteria 1291
136 Ga0075362_10010585 3300006177 Bacteria 3606
137 Ga0075362_10140013 3300006177 Bacteria 1156
138 Ga0075362_10307659 3300006177 Bacteria 787
139 Ga0075362_10374474 3300006177 Bacteria 715
140 Ga0075367_10338736 3300006178 Bacteria 949
141 Ga0075367_11045896 3300006178 Bacteria 522
142 Ga0075369_10167594 3300006186 Bacteria 1008
143 Ga0075369_10493729 3300006186 Bacteria 581
144 Ga0075366_10059905 3300006195 Bacteria 2261
145 Ga0075366_10227727 3300006195 Bacteria 1136
146 Ga0075366_10325152 3300006195 Bacteria 942
147 Ga0097621_100590092 3300006237 Bacteria 1015
148 Ga0097621_100872233 3300006237 Bacteria 837
149 Ga0097621_101270847 3300006237 Bacteria 695
150 Ga0075370_10032179 3300006353 Bacteria 2930
151 Ga0075370_10147741 3300006353 Bacteria 1377
152 Ga0075370_10170889 3300006353 Bacteria 1277
153 Ga0075370_10226593 3300006353 Bacteria 1105
154 Ga0068871_100902851 3300006358 Bacteria 819
155 Ga0075430_100156687 3300006846 Bacteria 1896
156 Ga0075433_10335429 3300006852 Bacteria 1337
157 Ga0075433_10776333 3300006852 Bacteria 838
158 Ga0075434_100811425 3300006871 Bacteria 952
159 Ga0068865_100118650 3300006881 Bacteria 1963
160 Ga0075436_100693895 3300006914 Bacteria 754
161 Ga0075436_100881198 3300006914 Bacteria 669
162 Ga0097620_100894723 3300006931 Bacteria 973
163 Ga0097620_101482874 3300006931 Bacteria 749
164 Ga0099795_10033771 3300007788 Bacteria 1779
165 Ga0105240_10075852 3300009093 Bacteria 4146
166 Ga0105240_10804272 3300009093 Bacteria 1018
167 Ga0105240_10972505 3300009093 Bacteria 909
168 Ga0105240_11245495 3300009093 Bacteria 786
169 Ga0105240_12273581 3300009093 Bacteria 562
170 Ga0105240_12560630 3300009093 Bacteria 527
171 Ga0105245_11520332 3300009098 Bacteria 720
172 Ga0105243_12061135 3300009148 Bacteria 606
173 Ga0105241_10046588 3300009174 Bacteria 3293
174 Ga0105241_11385553 3300009174 Bacteria 673
175 Ga0105242_10785706 3300009176 Bacteria 941
176 Ga0105242_10963989 3300009176 Bacteria 858
177 Ga0105248_10555050 3300009177 Bacteria 1296
178 Ga0105248_11173280 3300009177 Bacteria 868
179 Ga0105237_10002619 3300009545 Bacteria 22167
180 Ga0105237_10069626 3300009545 Bacteria 3514
181 Ga0105237_10244594 3300009545 Bacteria 1795
182 Ga0105237_10282372 3300009545 Bacteria 1663
183 Ga0105237_10311796 3300009545 Bacteria 1577
184 Ga0105237_10324209 3300009545 Bacteria 1544
185 Ga0105238_10033303 3300009551 Bacteria 5244
186 Ga0105238_10055969 3300009551 Bacteria 3958
187 Ga0105238_10188920 3300009551 Bacteria 2036
188 Ga0105238_10323701 3300009551 Bacteria 1528
189 Ga0105238_12759932 3300009551 Bacteria 528
190 Ga0105035_101729 3300009988 Bacteria 1543
191 Ga0105028_100431 3300009993 Bacteria 4482
192 Ga0099796_10469469 3300010159 Bacteria 561
193 Ga0105239_10166189 3300010375 Bacteria 2467
194 Ga0105239_10477867 3300010375 Bacteria 1416
195 Ga0105239_11564626 3300010375 Bacteria 762
196 Ga0105246_11167806 3300011119 Bacteria 707
197 Ga0157373_10518982 3300013100 Bacteria 862
198 Ga0157373_10822608 3300013100 Bacteria 686
199 Ga0157373_10877508 3300013100 Bacteria 665
200 Ga0157373_11110644 3300013100 Bacteria 593
201 Ga0157371_10294763 3300013102 Bacteria 1173
202 Ga0157371_10354604 3300013102 Bacteria 1068
203 Ga0157371_11532809 3300013102 Bacteria 520
204 Ga0157370_10001390 3300013104 Bacteria 29988
205 Ga0157370_10008540 3300013104 Bacteria 11039
206 Ga0157370_10072284 3300013104 Bacteria 3255
207 Ga0157370_10822497 3300013104 Bacteria 845
208 Ga0157370_10954247 3300013104 Bacteria 777
209 Ga0157369_10026398 3300013105 Bacteria 6442
210 Ga0157369_10140386 3300013105 Bacteria 2557
211 Ga0157369_10196070 3300013105 Bacteria 2121
212 Ga0157369_10625868 3300013105 Bacteria 1110
213 Ga0157369_10660984 3300013105 Bacteria 1077
214 Ga0157369_11700577 3300013105 Bacteria 641
215 Ga0157369_11953758 3300013105 Bacteria 595
216 Ga0157374_11020482 3300013296 Bacteria 847
217 Ga0157374_11500375 3300013296 Bacteria 697
218 Ga0157378_10605597 3300013297 Bacteria 1107
219 Ga0157378_11073281 3300013297 Bacteria 841
220 Ga0157378_12706115 3300013297 Bacteria 548
221 Ga0163162_11135741 3300013306 Bacteria 886
222 Ga0163162_11674216 3300013306 Bacteria 726
223 Ga0163162_13109394 3300013306 Bacteria 533
224 Ga0157372_10111907 3300013307 Bacteria 3128
225 Ga0157372_10324059 3300013307 Bacteria 1794
226 Ga0157372_11177110 3300013307 Bacteria 886
227 Ga0157372_11652053 3300013307 Bacteria 737
228 Ga0157372_12101897 3300013307 Bacteria 649
229 Ga0157372_12716499 3300013307 Bacteria 568
230 Ga0157375_11105737 3300013308 Bacteria 928
231 Ga0163163_10466658 3300014325 Bacteria 1323
232 Ga0163163_11694588 3300014325 Bacteria 693
233 Ga0182008_10353852 3300014497 Bacteria 779
234 Ga0182008_10876149 3300014497 Bacteria 527
235 Ga0157376_10251797 3300014969 Bacteria 1650
236 Ga0157376_10402106 3300014969 Bacteria 1325
237 Ga0184598_141942 3300019182 Bacteria 612
238 Ga0197907_10410046 3300020069 Bacteria 1244
239 Ga0206356_10510010 3300020070 Bacteria 1225
240 Ga0206356_10669629 3300020070 Bacteria 885
241 Ga0206356_11445679 3300020070 Bacteria 831
242 Ga0206356_11636321 3300020070 Bacteria 762
243 Ga0206355_1092081 3300020076 Bacteria 1467
244 Ga0206352_10440244 3300020078 Bacteria 791
245 Ga0206350_10063581 3300020080 Bacteria 1093
246 Ga0206350_10890309 3300020080 Bacteria 967
247 Ga0206353_10170206 3300020082 Bacteria 1238
248 Ga0206353_10208749 3300020082 Bacteria 959
249 Ga0206353_11578995 3300020082 Bacteria 728
250 Ga0213873_10001663 3300021358 Bacteria 3727
251 Ga0213873_10135056 3300021358 Bacteria 733
252 Ga0213873_10198427 3300021358 Bacteria 622
253 Ga0213872_10045368 3300021361 Bacteria 1999
254 Ga0213872_10060192 3300021361 Bacteria 1717
255 Ga0213872_10074275 3300021361 Bacteria 1530
256 Ga0213872_10122271 3300021361 Bacteria 1150
257 Ga0213874_10001065 3300021377 Bacteria 5640
258 Ga0213876_10001556 3300021384 Bacteria 14102
259 Ga0213876_10003867 3300021384 Bacteria 8462
260 Ga0213875_10004174 3300021388 Bacteria 7998
261 Ga0213875_10259268 3300021388 Bacteria 820
262 Ga0213871_10071071 3300021441 Bacteria 984
263 Ga0224712_10017793 3300022467 Bacteria 2363
264 Ga0224712_10203237 3300022467 Bacteria 901
265 Ga0224572_1037153 3300024225 Bacteria 922
266 Ga0207427_101221 3300025231 Bacteria 9946
267 Ga0209233_1000293 3300025261 Bacteria 63470
268 Ga0209676_1000092 3300025292 Bacteria 250453
269 Ga0209050_1007590 3300025298 Bacteria 6028
270 Ga0209051_1025622 3300025303 Bacteria 2395
271 Ga0207656_10001058 3300025321 Bacteria 9002
272 Ga0207656_10030934 3300025321 Bacteria 2214
273 Ga0207692_10308768 3300025898 Bacteria 965
274 Ga0207642_10394017 3300025899 Bacteria 827
275 Ga0207688_10037880 3300025901 Bacteria 2675
276 Ga0207647_10089449 3300025904 Bacteria 1838
277 Ga0207647_10141952 3300025904 Bacteria 1407
278 Ga0207699_11447269 3300025906 Bacteria 508
279 Ga0207645_10096200 3300025907 Bacteria 1907
280 Ga0207643_11076315 3300025908 Bacteria 519
281 Ga0207705_10020427 3300025909 Bacteria 4732
282 Ga0207705_10071391 3300025909 Bacteria 2517
283 Ga0207705_10075111 3300025909 Bacteria 2454
284 Ga0207654_10953111 3300025911 Bacteria 623
285 Ga0207707_10000624 3300025912 Bacteria 35078
286 Ga0207707_10022305 3300025912 Bacteria 5536
287 Ga0207707_10078099 3300025912 Bacteria 2890
288 Ga0207707_10119622 3300025912 Bacteria 2302
289 Ga0207695_10043881 3300025913 Bacteria 4760
290 Ga0207695_10214224 3300025913 Bacteria 1835
291 Ga0207671_10001074 3300025914 Bacteria 33173
292 Ga0207671_10150809 3300025914 Bacteria 1796
293 Ga0207671_10184945 3300025914 Bacteria 1623
294 Ga0207671_10254384 3300025914 Bacteria 1381
295 Ga0207671_10344051 3300025914 Bacteria 1182
296 Ga0207693_10474744 3300025915 Bacteria 977
297 Ga0207660_10017860 3300025917 Bacteria 4721
298 Ga0207660_10369650 3300025917 Bacteria 1151
299 Ga0207660_10512111 3300025917 Bacteria 974
300 Ga0207662_10207608 3300025918 Bacteria 1270
301 Ga0207657_10008060 3300025919 Bacteria 10742
302 Ga0207657_10044882 3300025919 Bacteria 3882
303 Ga0207657_10076211 3300025919 Bacteria 2830
304 Ga0207657_10289780 3300025919 Bacteria 1298
305 Ga0207649_10001226 3300025920 Bacteria 15405
306 Ga0207649_10093984 3300025920 Bacteria 1969
307 Ga0207649_10928663 3300025920 Bacteria 683
308 Ga0207649_11229423 3300025920 Bacteria 592
309 Ga0207652_10002587 3300025921 Bacteria 15177
310 Ga0207652_10057886 3300025921 Bacteria 3338
311 Ga0207652_10218820 3300025921 Bacteria 1716
312 Ga0207652_10462324 3300025921 Bacteria 1144
313 Ga0207652_10718760 3300025921 Bacteria 890
314 Ga0207652_11735252 3300025921 Bacteria 529
315 Ga0207652_11778783 3300025921 Bacteria 521
316 Ga0207694_10008555 3300025924 Bacteria 7728
317 Ga0207694_10172425 3300025924 Bacteria 1752
318 Ga0207694_10511921 3300025924 Bacteria 1005
319 Ga0207650_10382801 3300025925 Bacteria 1162
320 Ga0207659_10273630 3300025926 Bacteria 1378
321 Ga0207659_10851713 3300025926 Bacteria 784
322 Ga0207687_10652660 3300025927 Bacteria 890
323 Ga0207700_10360140 3300025928 Bacteria 1268
324 Ga0207690_10019639 3300025932 Bacteria 4164
325 Ga0207690_10089309 3300025932 Bacteria 2173
326 Ga0207690_10477913 3300025932 Bacteria 1005
327 Ga0207706_10171232 3300025933 Bacteria 1908
328 Ga0207706_10214453 3300025933 Bacteria 1687
329 Ga0207709_11264225 3300025935 Bacteria 609
330 Ga0207670_10273018 3300025936 Bacteria 1315
331 Ga0207669_10012602 3300025937 Bacteria 4163
332 Ga0207704_11501213 3300025938 Bacteria 578
333 Ga0207691_10455149 3300025940 Bacteria 1089
334 Ga0207711_10388325 3300025941 Bacteria 1296
335 Ga0207689_11336960 3300025942 Bacteria 602
336 Ga0207661_10380109 3300025944 Bacteria 1278
337 Ga0207679_10286228 3300025945 Bacteria 1415
338 Ga0207679_10573235 3300025945 Bacteria 1015
339 Ga0207667_10000877 3300025949 Bacteria 38435
340 Ga0207667_10002756 3300025949 Bacteria 21724
341 Ga0207667_10019501 3300025949 Bacteria 7568
342 Ga0207667_10157267 3300025949 Bacteria 2338
343 Ga0207667_10254554 3300025949 Bacteria 1796
344 Ga0207712_11648842 3300025961 Bacteria 575
345 Ga0207668_10009850 3300025972 Bacteria 5742
346 Ga0207668_10536746 3300025972 Bacteria 1011
347 Ga0207640_10009094 3300025981 Bacteria 5547
348 Ga0207640_10016034 3300025981 Bacteria 4349
349 Ga0207640_10046887 3300025981 Bacteria 2784
350 Ga0207640_10112501 3300025981 Bacteria 1933
351 Ga0207640_10426997 3300025981 Bacteria 1086
352 Ga0207640_10711524 3300025981 Bacteria 862
353 Ga0207658_11135809 3300025986 Bacteria 714
354 Ga0207658_11548342 3300025986 Bacteria 606
355 Ga0207677_10101363 3300026023 Bacteria 2120
356 Ga0207677_10962746 3300026023 Bacteria 772
357 Ga0207639_10004515 3300026041 Bacteria 9386
358 Ga0207639_10007867 3300026041 Bacteria 7280
359 Ga0207639_10029135 3300026041 Bacteria 4039
360 Ga0207639_10236751 3300026041 Bacteria 1585
361 Ga0207639_10521468 3300026041 Bacteria 1088
362 Ga0207708_11231094 3300026075 Bacteria 655
363 Ga0207702_10006196 3300026078 Bacteria 10341
364 Ga0207702_10023608 3300026078 Bacteria 5102
365 Ga0207702_10029655 3300026078 Bacteria 4554
366 Ga0207702_10459283 3300026078 Bacteria 1237
367 Ga0207702_10575395 3300026078 Bacteria 1104
368 Ga0207702_11739716 3300026078 Bacteria 616
369 Ga0207641_11069923 3300026088 Bacteria 805
370 Ga0207648_10242504 3300026089 Bacteria 1605
371 Ga0207648_10275281 3300026089 Bacteria 1504
372 Ga0207676_10792910 3300026095 Bacteria 924
373 Ga0207674_10045512 3300026116 Bacteria 4513
374 Ga0207674_10070606 3300026116 Bacteria 3511
375 Ga0207674_10150891 3300026116 Bacteria 2281
376 Ga0207674_10245498 3300026116 Bacteria 1737
377 Ga0207674_10249766 3300026116 Bacteria 1721
378 Ga0207674_10467969 3300026116 Bacteria 1218
379 Ga0207675_100405521 3300026118 Bacteria 1344
380 Ga0207683_10144767 3300026121 Bacteria 2142
381 Ga0207683_10547904 3300026121 Bacteria 1069
382 Ga0207698_10054516 3300026142 Bacteria 3077
383 Ga0207698_10140737 3300026142 Bacteria 2078
384 Ga0207698_10155782 3300026142 Bacteria 1990
385 Ga0207698_11431508 3300026142 Bacteria 706
386 Ga0210000_1063313 3300027462 Bacteria 599
387 Ga0209983_1009332 3300027665 Bacteria 2005
388 Ga0209588_1094859 3300027671 Bacteria 961
389 Ga0209813_10102649 3300027866 Bacteria 975
390 Ga0209974_10063329 3300027876 Bacteria 1254
391 Ga0207428_10929259 3300027907 Bacteria 614
392 Ga0268266_10000321 3300028379 Bacteria 75565
393 Ga0268266_11142114 3300028379 Bacteria 753
394 Ga0265334_10150039 3300028573 Bacteria 822
395 Ga0265318_10008175 3300028577 Bacteria 4675
396 Ga0265323_10180116 3300028653 Unclassified 669
397 Ga0265338_10069830 3300028800 Bacteria 3016
398 Ga0265338_10590173 3300028800 Bacteria 774
399 Ga0265324_10063838 3300029957 Bacteria 1257
400 Ga0265330_10001669 3300031235 Bacteria 12591
401 Ga0265330_10006274 3300031235 Bacteria 5877
402 Ga0265330_10120455 3300031235 Bacteria 1118
403 Ga0265330_10152004 3300031235 Bacteria 983
404 Ga0265330_10197428 3300031235 Bacteria 851
405 Ga0265332_10065930 3300031238 Bacteria 1546
406 Ga0265332_10104902 3300031238 Bacteria 1192
407 Ga0265332_10121255 3300031238 Bacteria 1098
408 Ga0265328_10074526 3300031239 Bacteria 1249
409 Ga0265328_10116335 3300031239 Bacteria 996
410 Ga0265328_10187815 3300031239 Bacteria 783
411 Ga0265320_10060485 3300031240 Bacteria 1808
412 Ga0265325_10080671 3300031241 Bacteria 1618
413 Ga0265325_10102490 3300031241 Bacteria 1399
414 Ga0265325_10139267 3300031241 Bacteria 1155
415 Ga0265329_10103667 3300031242 Bacteria 907
416 Ga0265340_10036214 3300031247 Bacteria 2447
417 Ga0265339_10013124 3300031249 Bacteria 5031
418 Ga0265339_10030849 3300031249 Bacteria 3033
419 Ga0265339_10142634 3300031249 Bacteria 1217
420 Ga0265339_10294991 3300031249 Bacteria 774
421 Ga0265331_10119834 3300031250 Bacteria 1204
422 Ga0265331_10157792 3300031250 Bacteria 1029
423 Ga0265327_10000100 3300031251 Bacteria 189591
424 Ga0265327_10050054 3300031251 Bacteria 2188
425 Ga0265316_10013594 3300031344 Bacteria 7222
426 Ga0265316_10209865 3300031344 Bacteria 1441
427 Ga0265316_10294616 3300031344 Bacteria 1183
428 Ga0265316_10486487 3300031344 Bacteria 883
429 Ga0265316_10865013 3300031344 Bacteria 632
430 Ga0307408_100739691 3300031548 Bacteria 887
431 Ga0265313_10002227 3300031595 Bacteria 17059
432 Ga0265313_10005420 3300031595 Bacteria 9398
433 Ga0265313_10283610 3300031595 Bacteria 669
434 Ga0307508_10530512 3300031616 Bacteria 774
435 Ga0316579_10460260 3300031691 Bacteria 615
436 Ga0316579_10466402 3300031691 Bacteria 611
437 Ga0265314_10016860 3300031711 Bacteria 5756
438 Ga0265314_10031281 3300031711 Bacteria 3932
439 Ga0265314_10095625 3300031711 Bacteria 1923
440 Ga0265314_10106792 3300031711 Bacteria 1787
441 Ga0265314_10119547 3300031711 Bacteria 1661
442 Ga0265314_10279521 3300031711 Bacteria 945
443 Ga0265342_10008211 3300031712 Bacteria 7520
444 Ga0265342_10030117 3300031712 Bacteria 3367
445 Ga0265342_10077955 3300031712 Bacteria 1918
446 Ga0265342_10090566 3300031712 Bacteria 1754
447 Ga0265342_10248561 3300031712 Bacteria 950
448 Ga0265342_10266813 3300031712 Bacteria 909
449 Ga0316576_10000992 3300031727 Bacteria 14602
450 Ga0316576_10001969 3300031727 Bacteria 11478
451 Ga0316576_10165433 3300031727 Bacteria 1669
452 Ga0316576_10703899 3300031727 Bacteria 732
453 Ga0316578_10478936 3300031728 Bacteria 734
454 Ga0307516_10367781 3300031730 Bacteria 1101
455 Ga0307405_10335410 3300031731 Bacteria 1160
456 Ga0307413_10162983 3300031824 Bacteria 1568
457 Ga0307413_10354841 3300031824 Bacteria 1133
458 Ga0307410_10051793 3300031852 Bacteria 2769
459 Ga0307410_10840362 3300031852 Bacteria 783
460 Ga0307410_10945600 3300031852 Bacteria 740
461 Ga0307406_10167970 3300031901 Bacteria 1585
462 Ga0307406_10240419 3300031901 Bacteria 1358
463 Ga0307406_10271008 3300031901 Bacteria 1290
464 Ga0307406_10334186 3300031901 Bacteria 1177
465 Ga0307406_10655183 3300031901 Bacteria 872
466 Ga0307407_10499792 3300031903 Bacteria 891
467 Ga0307412_10063396 3300031911 Bacteria 2493
468 Ga0307412_10241524 3300031911 Bacteria 1397
469 Ga0307412_10535596 3300031911 Bacteria 981
470 Ga0307409_100376008 3300031995 Bacteria 1349
471 Ga0307409_100387076 3300031995 Bacteria 1331
472 Ga0307409_100782482 3300031995 Bacteria 960
473 Ga0307409_100949381 3300031995 Bacteria 876
474 Ga0307414_10122495 3300032004 Bacteria 2002
475 Ga0307414_10203250 3300032004 Bacteria 1613
476 Ga0307414_10286581 3300032004 Bacteria 1386
477 Ga0307414_10365082 3300032004 Bacteria 1243
478 Ga0307414_10984833 3300032004 Bacteria 776
479 Ga0307414_11383389 3300032004 Bacteria 654
480 Ga0307414_11769193 3300032004 Bacteria 576
481 Ga0307414_11783581 3300032004 Bacteria 574
482 Ga0307414_12032744 3300032004 Bacteria 536
483 Ga0307411_10522795 3300032005 Bacteria 1007
484 Ga0307411_10826661 3300032005 Bacteria 818
485 Ga0307415_101315648 3300032126 Bacteria 685
486 Ga0307415_101343883 3300032126 Bacteria 678
487 Ga0316583_10037793 3300032133 Bacteria 1712
488 Ga0316583_10069858 3300032133 Bacteria 1229
489 Ga0316593_10012502 3300032168 Bacteria 2492
490 Ga0316593_10016899 3300032168 Bacteria 2219
491 Ga0316593_10020111 3300032168 Bacteria 2071
492 Ga0316593_10076675 3300032168 Bacteria 1162
493 Ga0316593_10086008 3300032168 Bacteria 1102
494 Ga0316593_10095295 3300032168 Bacteria 1051
495 Ga0316593_10180861 3300032168 Unclassified 775
496 Ga0316593_10186093 3300032168 Bacteria 765
497 Ga0316592_1000397 3300033524 Bacteria 5838
498 Ga0316592_1002468 3300033524 Bacteria 3201
499 Ga0316592_1024219 3300033524 Bacteria 1305
500 Ga0316586_1047442 3300033527 Bacteria 764
501 Ga0316588_1018041 3300033528 Bacteria 1577
502 Ga0316588_1021266 3300033528 Bacteria 1475
503 Ga0316588_1021863 3300033528 Unclassified 1458
504 Ga0316588_1069510 3300033528 Bacteria 864
505 Ga0316588_1091985 3300033528 Bacteria 756
506 Ga0316588_1111182 3300033528 Bacteria 689
507 Ga0316588_1145952 3300033528 Unclassified 606
508 Ga0316587_1011518 3300033529 Bacteria 1428
509 Ga0316587_1017547 3300033529 Bacteria 1200
510 Ga0316596_1000006 3300033541 Bacteria 19978
511 Ga0316596_1001245 3300033541 Bacteria 5036
512 Ga0316596_1002889 3300033541 Bacteria 3719
513 Ga0316596_1006883 3300033541 Bacteria 2663
514 Ga0316596_1014240 3300033541 Bacteria 1970
515 Ga0316596_1046657 3300033541 Bacteria 1144
516 Ga0316596_1046749 3300033541 Bacteria 1143
517 Ga0316596_1094274 3300033541 Bacteria 807
518 Ga0373930_0044054 3300034816 Bacteria 958
519 Ga0373948_0088029 3300034817 Bacteria 717
520 Ga0373950_0160311 3300034818 Bacteria 519
521 Ga0373959_0014406 3300034820 Bacteria 1439
522 Ga0373928_0016766 3300035084 Bacteria 1501
523 Ga0373928_0111875 3300035084 Bacteria 723
524 Ga0373929_0048291 3300035085 Bacteria 966
525 Ga0373949_0072876 3300035090 Bacteria 902
526 Ga0373949_0272614 3300035090 Bacteria 529
527 Ga0373952_0067472 3300035092 Bacteria 888
528 Ga0373932_0061960 3300035112 Bacteria 1139
529 Ga0373932_0095872 3300035112 Bacteria 959
530 Ga0373932_0116585 3300035112 Bacteria 886
531 Ga0373941_0172622 3300035115 Bacteria 806
532 Ga0373941_0258908 3300035115 Bacteria 682
533 Ga0373960_0074546 3300035121 Bacteria 1056
534 Ga0373943_0119908 3300035170 Bacteria 1397
535 Ga0373942_0064607 3300035207 Bacteria 1056
536 Ga0373962_0006987 3300035242 Bacteria 2751
537 Ga0316574_0063562 3300035398 Bacteria 2321
538 Ga0316574_0362033 3300035398 Bacteria 917
539 Ga0316574_0784145 3300035398 Bacteria 581
540 Ga0373931_0318912 3300035691 Bacteria 965
541 Ga0373931_0664801 3300035691 Bacteria 685
542 Ga0373935_0225634 3300035692 Bacteria 1303
543 Ga0373927_0093114 3300035695 Bacteria 1958
544 Ga0373927_0199442 3300035695 Bacteria 1314
545 Ga0373927_0280407 3300035695 Bacteria 1096
546 Ga0373927_0538286 3300035695 Bacteria 772
547 Ga0373947_0230782 3300035725 Bacteria 1219
548 Ga0373937_0273760 3300036401 Bacteria 1594
549 Ga0373937_1771358 3300036401 Bacteria 564
550 Ga0316582_0502385 3300036647 Bacteria 836
551 Ga0316582_0668648 3300036647 Bacteria 714
552 Ga0316584_0092322 3300036712 Bacteria 2267
553 Ga0316584_0335837 3300036712 Unclassified 1087
554 Ga0316584_0607749 3300036712 Bacteria 758
555 Ga0316584_0779274 3300036712 Bacteria 651
556 Ga0373925_0060365 3300037068 Bacteria 2848
557 Ga0373925_1088508 3300037068 Bacteria 658
558 Ga0395899_0034692 3300037312 Bacteria 3789
559 Ga0395899_0044661 3300037312 Bacteria 3301
560 Ga0395900_0075274 3300037418 Bacteria 3470
561 Ga0395900_0078542 3300037418 Bacteria 3391
562 Ga0395900_0308699 3300037418 Bacteria 1565
563 Ga0395900_0346946 3300037418 Bacteria 1459
564 Ga0395900_0415129 3300037418 Bacteria 1307
565 Ga0395898_0005690 3300037466 Bacteria 13432
566 Ga0395898_0045631 3300037466 Bacteria 4307
567 Ga0395898_0203092 3300037466 Bacteria 1891
568 Ga0395898_0270557 3300037466 Bacteria 1620
569 Ga0395898_1236517 3300037466 Bacteria 677
570 Ga0436364_0013783 3300037853 Bacteria 29941
571 Ga0436364_0082147 3300037853 Bacteria 4075
572 Ga0436364_0675508 3300037853 Bacteria 1246
573 Ga0436364_1463267 3300037853 Bacteria 1139
574 Ga0395901_0007619 3300038443 Bacteria 10927
575 Ga0395901_0108247 3300038443 Bacteria 2917
576 Ga0395901_0146970 3300038443 Bacteria 2477
577 Ga0395901_0166684 3300038443 Bacteria 2312
578 Ga0395901_1191589 3300038443 Bacteria 728
579 Ga0400484_12384 3300038725 Bacteria 5081
580 Ga0400490_18978 3300038726 Bacteria 41932
581 Ga0400490_19520 3300038726 Bacteria 4897
582 Ga0400490_58666 3300038726 Bacteria 1178
583 Ga0400491_29253 3300038727 Bacteria 8022
584 Ga0400485_19339 3300038735 Bacteria 2888
585 Ga0400488_57582 3300038741 Bacteria 1769
586 Ga0400488_58232 3300038741 Bacteria 2013
587 Ga0400486_32047 3300038742 Bacteria 23991
588 Ga0400483_023928 3300039062 Bacteria 5426
589 Ga0400483_042851 3300039062 Bacteria 14723
590 Ga0400483_057660 3300039062 Bacteria 5388
591 Ga0400483_094026 3300039062 Bacteria 1333
592 Ga0400483_114523 3300039062 Bacteria 3519
593 Ga0400483_137186 3300039062 Bacteria 1244
594 Ga0400483_151905 3300039062 Bacteria 1759
595 Ga0400483_198250 3300039062 Bacteria 18872
596 Ga0400483_217885 3300039062 Bacteria 12374
597 Ga0400483_278711 3300039062 Bacteria 5840
598 Ga0400483_281905 3300039062 Bacteria 2950
599 Ga0400489_41472 3300039093 Bacteria 14759
600 Ga0400489_66216 3300039093 Bacteria 19270
601 Ga0400487_19781 3300039110 Bacteria 4881
602 Ga0436365_0555060 3300039437 Bacteria 868
603 Ga0436365_0850961 3300039437 Bacteria 3131
604 Ga0436365_1136540 3300039437 Bacteria 40433
605 Ga0436365_1228764 3300039437 Bacteria 1301
606 Ga0436365_1253031 3300039437 Bacteria 47093
607 Ga0436365_1369855 3300039437 Bacteria 566
608 Ga0436360_0065948 3300039438 Bacteria 881
609 Ga0436360_0229296 3300039438 Bacteria 941
610 Ga0436360_0840585 3300039438 Bacteria 1648
611 Ga0436360_0870274 3300039438 Bacteria 1560
612 Ga0436360_1007386 3300039438 Bacteria 999
613 Ga0436360_1251640 3300039438 Bacteria 1036
614 Ga0436360_1307620 3300039438 Bacteria 1366
615 Ga0436361_0305976 3300039447 Bacteria 2290
616 Ga0436361_0425653 3300039447 Bacteria 1680
617 Ga0436361_0448350 3300039447 Bacteria 514
618 Ga0436361_0498700 3300039447 Bacteria 612
619 Ga0436361_0587648 3300039447 Bacteria 1983
620 Ga0436361_0618512 3300039447 Bacteria 1599
621 Ga0436361_0632864 3300039447 Bacteria 1504
622 Ga0436361_0834792 3300039447 Bacteria 965
623 Ga0436361_0846724 3300039447 Bacteria 2220
624 Ga0436361_0853694 3300039447 Bacteria 723
625 Ga0436361_1035119 3300039447 Bacteria 5692
626 Ga0436361_1061350 3300039447 Bacteria 899
627 Ga0436363_0121335 3300039450 Bacteria 5796
628 Ga0436363_0205355 3300039450 Bacteria 875
629 Ga0436363_0252353 3300039450 Bacteria 1038
630 Ga0436363_0746062 3300039450 Bacteria 9943
631 Ga0436363_1082032 3300039450 Bacteria 626
632 Ga0436362_0060202 3300039453 Bacteria 561
633 Ga0436362_0189083 3300039453 Bacteria 587
634 Ga0436362_0313849 3300039453 Bacteria 1168
635 Ga0436362_0437344 3300039453 Bacteria 556
636 Ga0436362_0579275 3300039453 Bacteria 788
637 Ga0436362_0608067 3300039453 Bacteria 1311
638 Ga0436362_1149838 3300039453 Bacteria 1943
639 Ga0439461_0027483 3300041410 Bacteria 1167
640 Ga0439466_0165373 3300041411 Bacteria 676
641 Ga0439465_0041213 3300041413 Bacteria 1494
642 Ga0439465_0047897 3300041413 Bacteria 1394
643 Ga0439465_0055961 3300041413 Bacteria 1299
644 Ga0439465_0060786 3300041413 Bacteria 1252
645 Ga0439465_0134278 3300041413 Bacteria 875
646 Ga0451789_0925233 3300041443 Bacteria 661
647 Ga0451792_23296 3300041445 Bacteria 696
648 Ga0451794_41389 3300041446 Bacteria 530
649 Ga0451791_1156556 3300041451 Bacteria 533
650 Ga0451793_0423706 3300041452 Bacteria 847
651 Ga0451793_0894875 3300041452 Bacteria 731
652 Ga0451797_1483980 3300041453 Bacteria 626
653 Ga0451797_1514149 3300041453 Bacteria 620
654 Ga0451797_1528640 3300041453 Bacteria 723
655 Ga0451795_1557624 3300041456 Bacteria 818
656 Ga0451800_0842399 3300041459 Bacteria 525
657 Ga0451800_1508070 3300041459 Bacteria 594
658 Ga0451837_1281237 3300041494 Bacteria 917
659 Ga0451837_1624919 3300041494 Bacteria 929
660 Ga0451841_1096970 3300041498 Bacteria 959
661 Ga0451843_0419583 3300041509 Bacteria 678
662 Ga0451853_1217462 3300041512 Bacteria 687
663 Ga0451853_1342895 3300041512 Bacteria 905
664 Ga0439431_0095136 3300041997 Bacteria 815
665 Ga0439431_0116185 3300041997 Bacteria 744
666 Ga0439433_0034999 3300041999 Bacteria 1157
667 Ga0439441_007617 3300042001 Bacteria 1750
668 Ga0439443_043477 3300042003 Bacteria 772
669 Ga0439443_069840 3300042003 Bacteria 640
670 Ga0439445_0033058 3300042004 Bacteria 1350
671 Ga0439445_0037160 3300042004 Bacteria 1284
672 Ga0439448_0014543 3300042005 Bacteria 2375
673 Ga0439432_052284 3300042006 Bacteria 1272
674 Ga0439432_164323 3300042006 Bacteria 649
675 Ga0439449_0071350 3300042007 Bacteria 1280
676 Ga0439452_044390 3300042010 Bacteria 1037
677 Ga0450890_029163 3300042127 Bacteria 779
678 Ga0450897_047122 3300042128 Bacteria 515
679 Ga0439434_0037933 3300042435 Bacteria 1476
680 Ga0439434_0094189 3300042435 Bacteria 960
681 Ga0439435_0238884 3300042436 Bacteria 609
682 Ga0439459_0204423 3300042438 Bacteria 541
683 Ga0439464_0114669 3300042439 Bacteria 827
684 Ga0451577_0030969 3300042876 Bacteria 4830
685 Ga0451577_0442387 3300042876 Bacteria 1180
686 Ga0453683_0050267 3300044673 Bacteria 2612
687 Ga0466965_0062359 3300044683 Bacteria 1865
688 Ga0466966_0207717 3300044684 Bacteria 1184
689 Ga0466966_0258704 3300044684 Bacteria 1048
690 Ga0466961_0121966 3300044693 Bacteria 1636
691 Ga0466963_0029443 3300044694 Bacteria 3535
692 Ga0466963_0294172 3300044694 Bacteria 1142
693 Ga0466963_0585595 3300044694 Bacteria 788
694 Ga0466963_0739702 3300044694 Bacteria 694
695 Ga0466964_0629683 3300044706 Bacteria 591
696 Ga0453684_0000204 3300044712 Bacteria 258105
697 Ga0453684_0001066 3300044712 Bacteria 87216
698 Ga0453684_0007136 3300044712 Bacteria 20809
699 Ga0453684_0041859 3300044712 Bacteria 6185
700 Ga0453684_0282064 3300044712 Bacteria 1894
701 Ga0453684_0386411 3300044712 Bacteria 1571
702 Ga0453684_0416986 3300044712 Bacteria 1501
703 Ga0453684_0788845 3300044712 Bacteria 1025
704 Ga0453684_1161825 3300044712 Bacteria 812
705 Ga0466971_0653608 3300044719 Bacteria 527
706 Ga0466957_0021853 3300044842 Bacteria 3772
707 Ga0466957_0768282 3300044842 Bacteria 683
708 Ga0466959_0084832 3300045049 Bacteria 2280
709 Ga0466959_0599077 3300045049 Bacteria 741
710 Ga0451576_0001012 3300045051 Bacteria 51921
711 Ga0451576_0029379 3300045051 Bacteria 5883
712 Ga0451576_0031820 3300045051 Bacteria 5623
713 Ga0451576_0059829 3300045051 Bacteria 3976
714 Ga0466958_0000676 3300045836 Bacteria 14782
715 Ga0466958_0264302 3300045836 Bacteria 1102
716 Ga0466958_0821197 3300045836 Bacteria 606
717 Ga0466967_0013435 3300045976 Bacteria 6326
718 Ga0466967_0242158 3300045976 Bacteria 1721
719 Ga0466967_0515250 3300045976 Bacteria 1175
720 Ga0466967_0547034 3300045976 Bacteria 1139
721 Ga0466967_0973100 3300045976 Bacteria 845
722 Ga0466967_2250869 3300045976 Bacteria 541
723 Ga0495592_0333617 3300046454 Bacteria 977
724 Ga0495596_0250676 3300046500 Bacteria 687
725 Ga0495630_0370866 3300046517 Bacteria 1096
726 Ga0495656_0371829 3300046615 Bacteria 744
727 Ga0495668_0439473 3300046616 Bacteria 718
728 Ga0495668_0545614 3300046616 Bacteria 640
729 Ga0495674_0887829 3300047319 Bacteria 689
730 Ga0495672_0000511 3300047320 Bacteria 44639
731 Ga0495672_0031397 3300047320 Bacteria 3316
732 Ga0495686_0047436 3300047472 Bacteria 2712
733 Ga0495602_0281167 3300048088 Bacteria 1226
734 Ga0496100_1060656 3300048903 Bacteria 638
735 Ga0496102_0668275 3300048905 Bacteria 962
736 Ga0496104_0228525 3300048907 Bacteria 1773
737 Ga0496106_0491162 3300048909 Bacteria 986
738 Ga0496109_0405595 3300048912 Bacteria 1288
739 Ga0496110_0268646 3300048913 Bacteria 1553
740 Ga0496110_0542264 3300048913 Bacteria 1057
741 Ga0496111_0364438 3300048914 Bacteria 1069
742 Ga0496112_0518153 3300048915 Bacteria 1127
743 Ga0496117_0190708 3300048920 Bacteria 1168
744 Ga0496118_0121464 3300048921 Bacteria 1702
745 Ga0496119_0441059 3300048922 Bacteria 615
746 Ga0496121_0091176 3300048924 Bacteria 2380
747 Ga0496121_0111944 3300048924 Bacteria 2080
748 Ga0496121_0533132 3300048924 Bacteria 738
749 Ga0496124_0030584 3300048927 Bacteria 4777
750 Ga0496124_0211277 3300048927 Bacteria 1468
751 Ga0496124_0297344 3300048927 Bacteria 1168
752 Ga0496125_0000815 3300048928 Bacteria 50702
753 Ga0496125_0254919 3300048928 Bacteria 1104
754 Ga0496126_0119659 3300048929 Bacteria 2285
755 Ga0496126_0135898 3300048929 Bacteria 2121
756 Ga0496126_0206650 3300048929 Bacteria 1655
757 Ga0496126_0271543 3300048929 Bacteria 1407
758 Ga0501306_004657 3300049127 Bacteria 1544
759 Ga0501306_010078 3300049127 Bacteria 1183
760 Ga0501306_014887 3300049127 Bacteria 1030
761 Ga0501306_040025 3300049127 Bacteria 724
762 Ga0501310_004086 3300049130 Bacteria 1451
763 Ga0501305_002063 3300049161 Bacteria 2105
764 Ga0501305_010380 3300049161 Bacteria 1242
765 Ga0501305_016841 3300049161 Bacteria 1046
766 Ga0501307_005955 3300049162 Bacteria 1301
767 Ga0501312_078181 3300049528 Bacteria 595
768 Ga0501313_018950 3300049529 Bacteria 839
769 Ga0501314_010050 3300049530 Bacteria 877
770 Ga0501315_058471 3300049531 Bacteria 619
771 Ga0501316_024206 3300049532 Bacteria 783
772 Ga0501317_023840 3300049533 Bacteria 847
773 Ga0501320_009962 3300049536 Bacteria 961
774 Ga0501321_022779 3300049537 Bacteria 791
775 Ga0501323_002663 3300049539 Bacteria 1754
776 Ga0501031_0046811 3300049568 Bacteria 2820
777 Ga0501031_0628297 3300049568 Bacteria 691
778 Ga0501032_0062255 3300049569 Bacteria 2500
779 Ga0501032_0156892 3300049569 Bacteria 1495
780 Ga0501032_0258239 3300049569 Bacteria 1130
781 Ga0501032_0296046 3300049569 Bacteria 1046
782 Ga0501033_0020210 3300049570 Bacteria 5033
783 Ga0501033_0089600 3300049570 Bacteria 2250
784 Ga0501033_0094339 3300049570 Bacteria 2188
785 Ga0501033_1067626 3300049570 Bacteria 538
786 Ga0501034_0000482 3300049571 Bacteria 65380
787 Ga0501034_0009019 3300049571 Bacteria 10475
788 Ga0501034_0063216 3300049571 Bacteria 3715
789 Ga0501034_0085750 3300049571 Bacteria 3150
790 Ga0501034_0102596 3300049571 Bacteria 2854
791 Ga0501034_0105047 3300049571 Bacteria 2817
792 Ga0501034_0120247 3300049571 Bacteria 2613
793 Ga0501034_0158436 3300049571 Bacteria 2236
794 Ga0501034_0311870 3300049571 Bacteria 1507
795 Ga0501034_0328774 3300049571 Bacteria 1460
796 Ga0501034_0442975 3300049571 Bacteria 1217
797 Ga0501034_0559110 3300049571 Bacteria 1053
798 Ga0501034_0632220 3300049571 Bacteria 973
799 Ga0501036_0035510 3300049572 Bacteria 4218
800 Ga0501036_0087494 3300049572 Bacteria 2633
801 Ga0501036_0138141 3300049572 Bacteria 2057
802 Ga0501036_0237253 3300049572 Bacteria 1530
803 Ga0501036_0411357 3300049572 Bacteria 1128
804 Ga0501036_0411687 3300049572 Bacteria 1127
805 Ga0501036_0996251 3300049572 Bacteria 686
806 Ga0501036_1058290 3300049572 Bacteria 663
807 Ga0501037_0017735 3300049573 Bacteria 5239
808 Ga0501037_0021388 3300049573 Bacteria 4779
809 Ga0501037_0168587 3300049573 Bacteria 1558
810 Ga0501037_0195584 3300049573 Bacteria 1430
811 Ga0501037_0206675 3300049573 Bacteria 1386
812 Ga0501037_0519538 3300049573 Bacteria 806
813 Ga0501038_0042562 3300049574 Bacteria 3955
814 Ga0501038_0180198 3300049574 Bacteria 1705
815 Ga0501038_0282354 3300049574 Bacteria 1307
816 Ga0501038_0536937 3300049574 Bacteria 891
817 Ga0501038_0906948 3300049574 Bacteria 650
818 Ga0501039_0002113 3300049575 Bacteria 14711
819 Ga0501039_0049376 3300049575 Bacteria 3252
820 Ga0501039_0308727 3300049575 Bacteria 1243
821 Ga0501039_1047509 3300049575 Bacteria 633
822 Ga0501040_0017061 3300049576 Bacteria 4816
823 Ga0501041_0017640 3300049577 Bacteria 4248
824 Ga0501042_0008704 3300049578 Bacteria 6730
825 Ga0501042_0228234 3300049578 Bacteria 1343
826 Ga0501042_0260029 3300049578 Bacteria 1253
827 Ga0501042_0288533 3300049578 Bacteria 1185
828 Ga0501043_0041509 3300049579 Bacteria 3614
829 Ga0501043_0102115 3300049579 Bacteria 2254
830 Ga0501043_0147855 3300049579 Bacteria 1839
831 Ga0501043_0346802 3300049579 Bacteria 1129
832 Ga0501043_0395431 3300049579 Bacteria 1045
833 Ga0501043_0484803 3300049579 Bacteria 925
834 Ga0501046_0014121 3300049580 Bacteria 6745
835 Ga0501046_0084362 3300049580 Bacteria 2450
836 Ga0501046_0342154 3300049580 Bacteria 1087
837 Ga0501046_0430184 3300049580 Bacteria 951
838 Ga0501046_0633474 3300049580 Bacteria 757
839 Ga0501047_0023666 3300049581 Bacteria 5896
840 Ga0501047_0072862 3300049581 Bacteria 3306
841 Ga0501047_0272848 3300049581 Bacteria 1537
842 Ga0501047_0327459 3300049581 Bacteria 1371
843 Ga0501047_0373505 3300049581 Bacteria 1261
844 Ga0501047_1010840 3300049581 Bacteria 645
845 Ga0501047_1052878 3300049581 Bacteria 627
846 Ga0501048_0010039 3300049582 Bacteria 7084
847 Ga0501048_0198057 3300049582 Bacteria 1424
848 Ga0501067_0158465 3300049583 Bacteria 1261
849 Ga0501068_0094949 3300049584 Bacteria 1843
850 Ga0501069_0612400 3300049585 Bacteria 654
851 Ga0501069_0631134 3300049585 Bacteria 644
852 Ga0501070_0048130 3300049586 Bacteria 3542
853 Ga0501070_0057104 3300049586 Bacteria 3235
854 Ga0501070_0548828 3300049586 Bacteria 925
855 Ga0501070_0809480 3300049586 Bacteria 735
856 Ga0501070_0978559 3300049586 Bacteria 657
857 Ga0501070_0996187 3300049586 Bacteria 650
858 Ga0501071_0050852 3300049587 Bacteria 2985
859 Ga0501071_0382330 3300049587 Bacteria 1074
860 Ga0501072_0001884 3300049588 Bacteria 15620
861 Ga0501072_0263164 3300049588 Bacteria 1373
862 Ga0501072_0321875 3300049588 Bacteria 1229
863 Ga0501072_0345687 3300049588 Bacteria 1181
864 Ga0501072_0503985 3300049588 Bacteria 957
865 Ga0501072_1018620 3300049588 Bacteria 645
866 Ga0501072_1138625 3300049588 Bacteria 607
867 Ga0501073_0039915 3300049589 Bacteria 3324
868 Ga0501073_0540520 3300049589 Bacteria 805
869 Ga0501073_0617429 3300049589 Bacteria 748
870 Ga0501074_0189365 3300049590 Bacteria 1467
871 Ga0501074_0219718 3300049590 Bacteria 1353
872 Ga0501074_0405920 3300049590 Bacteria 966
873 Ga0501074_0576756 3300049590 Bacteria 796
874 Ga0501074_0666831 3300049590 Bacteria 734
875 Ga0501075_0015718 3300049591 Bacteria 5438
876 Ga0501076_0018242 3300049592 Bacteria 5346
877 Ga0501076_0142095 3300049592 Bacteria 1951
878 Ga0501076_0224846 3300049592 Bacteria 1534
879 Ga0501076_0942531 3300049592 Bacteria 711
880 Ga0501077_0116244 3300049593 Bacteria 1695
881 Ga0501225_0013278 3300049705 Bacteria 2307
882 Ga0501245_081165 3300049708 Bacteria 627
883 Ga0501079_0099277 3300049741 Bacteria 2256
884 Ga0501079_0555316 3300049741 Bacteria 903
885 Ga0501079_0666962 3300049741 Bacteria 819
886 Ga0501080_0040964 3300049742 Bacteria 4318
887 Ga0501080_0043942 3300049742 Bacteria 4160
888 Ga0501080_0267426 3300049742 Bacteria 1557
889 Ga0501080_0379970 3300049742 Bacteria 1273
890 Ga0501080_0390530 3300049742 Bacteria 1253
891 Ga0501080_0461476 3300049742 Bacteria 1138
892 Ga0501080_0506927 3300049742 Bacteria 1078
893 Ga0501080_1724065 3300049742 Bacteria 528
894 Ga0501081_0115551 3300049743 Bacteria 1907
895 Ga0501081_0305799 3300049743 Bacteria 1167
896 Ga0501081_0390799 3300049743 Bacteria 1029
897 Ga0501081_0577270 3300049743 Bacteria 841
898 Ga0501083_0076712 3300049744 Bacteria 2218
899 Ga0501266_092015 3300049763 Bacteria 528
900 Ga0501035_0004418 3300049822 Bacteria 13348
901 Ga0501035_0106313 3300049822 Bacteria 2460
902 Ga0501035_0206294 3300049822 Bacteria 1683
903 Ga0501044_0151055 3300049823 Bacteria 2304
904 Ga0501044_0182883 3300049823 Bacteria 2062
905 Ga0501044_0309268 3300049823 Bacteria 1507
906 Ga0501044_0315133 3300049823 Bacteria 1490
907 Ga0501044_0389944 3300049823 Bacteria 1307
908 Ga0501044_0548368 3300049823 Bacteria 1053
909 Ga0501044_0556863 3300049823 Bacteria 1043
910 Ga0501044_0753926 3300049823 Bacteria 855
911 Ga0501044_0997315 3300049823 Bacteria 709
912 Ga0501044_1459637 3300049823 Bacteria 549
913 Ga0501045_0054331 3300049824 Bacteria 2927
914 Ga0501045_0736522 3300049824 Bacteria 727
915 Ga0501045_1249794 3300049824 Bacteria 541
916 nmdc:mga03683_15426_c1 3300050489 Bacteria 1887
917 nmdc:mga03683_33662_c1 3300050489 Bacteria 2070
918 nmdc:mga03683_4551_c1 3300050489 Bacteria 4615
919 nmdc:mga03683_56660_c1 3300050489 Bacteria 1648
920 nmdc:mga03n38_27914_c1 3300050490 Bacteria 2346
921 nmdc:mga03n38_471881_c1 3300050490 Bacteria 701
922 nmdc:mga03n38_7293_c1 3300050490 Bacteria 3906
923 nmdc:mga00v17_126638_c1 3300050491 Bacteria 1630
924 nmdc:mga00v17_170368_c1 3300050491 Bacteria 1404
925 nmdc:mga00v17_59684_c1 3300050491 Bacteria 2341
926 nmdc:mga0yw44_523446_c1 3300050492 Bacteria 805
927 nmdc:mga0k408_235620_c1 3300050493 Bacteria 1093
928 nmdc:mga0k408_24799_c1 3300050493 Bacteria 3393
929 nmdc:mga0k408_63879_c1 3300050493 Bacteria 2142
930 nmdc:mga06z11_15472_c1 3300050494 Bacteria 3406
931 nmdc:mga06z11_593224_c1 3300050494 Bacteria 674
932 nmdc:mga06z11_77218_c1 3300050494 Bacteria 1778
933 nmdc:mga06z11_777235_c1 3300050494 Bacteria 583
934 nmdc:mga07m45_256893_c1 3300050496 Bacteria 1016
935 nmdc:mga07m45_277624_c1 3300050496 Bacteria 975
936 nmdc:mga07m45_87006_c1 3300050496 Bacteria 1788
937 nmdc:mga09592_150655_c1 3300050508 Bacteria 2006
938 nmdc:mga0qj67_138207_c1 3300050509 Bacteria 1975
939 nmdc:mga06r32_1500966_c1 3300050510 Bacteria 614
940 nmdc:mga08y16_225804_c1 3300050511 Bacteria 1938
941 nmdc:mga0n895_915730_c1 3300050512 Bacteria 861
942 nmdc:mga08x19_1313589_c1 3300050514 Bacteria 512
943 nmdc:mga0a205_400896_c1 3300050515 Bacteria 1235
944 Ga0500651_0147122 3300053093 Bacteria 1417
945 Ga0500651_0749941 3300053093 Bacteria 518
946 Ga0500641_0004296 3300053096 Bacteria 5026
947 Ga0500558_169022 3300053106 Bacteria 793
948 Ga0500562_045367 3300053108 Bacteria 1171
949 Ga0500592_073790 3300053116 Bacteria 564
950 Ga0500593_000058 3300053117 Bacteria 41070
951 Ga0500595_035050 3300053119 Bacteria 1656
952 Ga0500597_424565 3300053120 Bacteria 500
953 Ga0500618_099914 3300053125 Bacteria 653
954 Ga0500642_0128563 3300053130 Bacteria 1187
955 Ga0500658_0152050 3300053134 Bacteria 1044
956 Ga0500658_0197301 3300053134 Bacteria 920
957 Ga0500559_0351656 3300053136 Bacteria 689
958 Ga0500568_0000001 3300053139 Bacteria 988705
959 Ga0500588_0026749 3300053146 Bacteria 1617
960 Ga0500604_0000294 3300053151 Bacteria 13881
961 Ga0500616_0004782 3300053153 Bacteria 9491
962 Ga0500616_0036565 3300053153 Bacteria 2665
963 Ga0500624_002765 3300053157 Bacteria 2333
964 Ga0500627_0230262 3300053158 Bacteria 825
965 Ga0500634_0000031 3300053161 Bacteria 75547
966 Ga0500609_017819 3300053731 Bacteria 966
967 Ga0500552_000085 3300053733 Bacteria 7626
968 Ga0501084_0412365 3300054114 Bacteria 1142
969 Ga0501084_0646446 3300054114 Bacteria 893
970 Ga0501084_1333973 3300054114 Bacteria 601
971 Ga0587084_003875 3300059477 Bacteria 1675
972 Ga0587084_050266 3300059477 Bacteria 736
973 Ga0587084_055003 3300059477 Bacteria 715
974 Ga0587084_083566 3300059477 Bacteria 622
975 Ga0587084_089472 3300059477 Bacteria 608
976 Ga0587093_010726 3300059478 Bacteria 1086
977 Ga0587070_051636 3300059491 Bacteria 823
978 Ga0587073_0037841 3300059492 Bacteria 1036
979 Ga0587077_001444 3300059493 Bacteria 2552
980 Ga0587077_001858 3300059493 Bacteria 2381
981 Ga0587077_002494 3300059493 Bacteria 2191
982 Ga0587077_023368 3300059493 Bacteria 1116
983 Ga0587077_034979 3300059493 Bacteria 979
984 Ga0587080_006331 3300059503 Bacteria 1627
985 Ga0587082_001421 3300059504 Bacteria 2483
986 Ga0587082_015733 3300059504 Bacteria 1172
987 Ga0587082_071053 3300059504 Bacteria 707
988 Ga0587082_105589 3300059504 Bacteria 619
989 Ga0587083_0082405 3300059505 Bacteria 769
990 Ga0587085_057305 3300059506 Bacteria 727
991 Ga0587085_096769 3300059506 Bacteria 617
992 Ga0587086_009659 3300059507 Bacteria 1152
993 Ga0587088_007703 3300059508 Bacteria 1499
994 Ga0587088_011507 3300059508 Bacteria 1319
995 Ga0587088_013341 3300059508 Bacteria 1260
996 Ga0587088_066307 3300059508 Bacteria 743
997 Ga0587088_093330 3300059508 Bacteria 662
998 Ga0587089_012097 3300059509 Bacteria 1097
999 Ga0587090_007514 3300059510 Bacteria 1433
1000 Ga0587090_037431 3300059510 Bacteria 839
1001 Ga0587090_047818 3300059510 Bacteria 775
1002 Ga0587091_037281 3300059511 Bacteria 943
1003 Ga0587091_077869 3300059511 Bacteria 738
1004 Ga0587092_045558 3300059512 Bacteria 778
1005 Ga0587094_016519 3300059513 Bacteria 1029
1006 Ga0587095_016766 3300059514 Bacteria 674
1007 Ga0587106_014372 3300059605 Bacteria 1090
1008 Ga0587106_037582 3300059605 Bacteria 807
1009 Ga0587125_004018 3300059607 Bacteria 1285
1010 Ga0587125_004288 3300059607 Bacteria 1260
1011 Ga0587125_014823 3300059607 Bacteria 858
1012 Ga0587101_000419 3300059623 Bacteria 2969
1013 Ga0587101_005367 3300059623 Bacteria 1419
1014 Ga0587101_052671 3300059623 Bacteria 705
1015 Ga0587109_008800 3300059624 Bacteria 1568
1016 Ga0587113_007243 3300059625 Bacteria 962
1017 Ga0587115_002202 3300059626 Bacteria 1904
1018 Ga0587128_022544 3300059630 Bacteria 981
1019 Ga0587128_072627 3300059630 Bacteria 673
1020 Ga0587062_000396 3300059639 Bacteria 2976
1021 Ga0587062_035592 3300059639 Bacteria 785
1022 Ga0587062_059166 3300059639 Bacteria 668
1023 Ga0587062_069540 3300059639 Bacteria 634
1024 Ga0587068_064862 3300059641 Bacteria 710
1025 Ga0587068_065733 3300059641 Bacteria 706
1026 Ga0587068_072764 3300059641 Bacteria 681
1027 Ga0587068_140533 3300059641 Bacteria 539
1028 Ga0587069_088448 3300059642 Bacteria 615
1029 Ga0587072_001969 3300059643 Bacteria 2674
1030 Ga0587072_086429 3300059643 Bacteria 685
1031 Ga0587072_119616 3300059643 Bacteria 609
1032 Ga0587072_173954 3300059643 Bacteria 533
1033 Ga0587075_035777 3300059644 Bacteria 811
1034 Ga0587075_053092 3300059644 Bacteria 712
1035 Ga0587075_071844 3300059644 Bacteria 644
1036 Ga0587076_001599 3300059645 Bacteria 2341
1037 Ga0587076_122057 3300059645 Bacteria 605
1038 Ga0587076_132225 3300059645 Bacteria 589
1039 Ga0587078_009790 3300059646 Bacteria 1092
1040 Ga0587078_028130 3300059646 Bacteria 745
1041 Ga0587079_027627 3300059647 Bacteria 1069
1042 Ga0587079_121447 3300059647 Bacteria 646
1043 Ga0587079_190566 3300059647 Bacteria 554
1044 Ga0587100_007768 3300059648 Bacteria 854
1045 Ga0587100_042521 3300059648 Bacteria 516
1046 Ga0587102_009709 3300059649 Bacteria 939
1047 Ga0587104_006947 3300059650 Bacteria 776
1048 Ga0587105_021399 3300059651 Bacteria 570
1049 Ga0587107_001723 3300059652 Bacteria 1834
1050 Ga0587107_003424 3300059652 Bacteria 1538
1051 Ga0587107_011495 3300059652 Bacteria 1085
1052 Ga0587107_079609 3300059652 Bacteria 614
1053 Ga0587107_088702 3300059652 Bacteria 594
1054 Ga0587108_002343 3300059653 Bacteria 1263
1055 Ga0587108_032191 3300059653 Bacteria 540
1056 Ga0587110_001125 3300059654 Bacteria 1853
1057 Ga0587110_046651 3300059654 Bacteria 570
1058 Ga0587114_052798 3300059655 Bacteria 693
1059 Ga0587119_044866 3300059658 Bacteria 645
1060 Ga0587124_004270 3300059660 Bacteria 1097
1061 Ga0587124_027474 3300059660 Bacteria 613
1062 Ga0587096_03993 3300060247 Bacteria 611
1063 Ga0587071_074262 3300060344 Bacteria 746
1064 Ga0587071_077540 3300060344 Bacteria 735
1065 Ga0587111_0000931 3300060346 Bacteria 3213
1066 Ga0587111_0029655 3300060346 Bacteria 1109
1067 Ga0587111_0032299 3300060346 Bacteria 1076
1068 Ga0587111_0098969 3300060346 Bacteria 724
1069 Ga0587111_0151807 3300060346 Bacteria 623
1070 Ga0501082_0090464 3300060353 Bacteria 2642
1071 Ga0501082_0629535 3300060353 Bacteria 939
1072 Ga0501082_1531683 3300060353 Bacteria 582
1073 Ga0466962_0189993 3300061719 Bacteria 1002
1074 Ga0466962_0490064 3300061719 Bacteria 621
1075 Ga0530510_0020928 3300061734 Bacteria 4652
1076 Ga0530510_0118649 3300061734 Bacteria 1941
1077 Ga0530510_0211241 3300061734 Bacteria 1442
1078 Ga0530510_0566665 3300061734 Bacteria 863
1079 Ga0530510_0665620 3300061734 Bacteria 793

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033541 Ga0316596_1046749 Ga0316596_10467492 113
2 3300032168 Ga0316593_10016899 Ga0316593_100168993 114
3 3300033528 Ga0316588_1091985 Ga0316588_10919852 114
4 3300033528 Ga0316588_1145952 Ga0316588_11459522 114
5 3300033541 Ga0316596_1002889 Ga0316596_10028893 114
6 3300044712 Ga0453684_0386411 Ga0453684_0386411_666_1046 114
7 3300005471 Ga0070698_100525376 Ga0070698_1005253761 118
8 3300006173 Ga0070716_101271575 Ga0070716_1012715751 118
9 3300041997 Ga0439431_0095136 Ga0439431_0095136_249_650 118
10 3300005439 Ga0070711_100426424 Ga0070711_1004264242 119
11 3300005539 Ga0068853_101193400 Ga0068853_1011934001 119
12 3300005563 Ga0068855_100404497 Ga0068855_1004044972 119
13 3300005618 Ga0068864_101511055 Ga0068864_1015110551 119
14 3300007788 Ga0099795_10033771 Ga0099795_100337712 119
15 3300010159 Ga0099796_10469469 Ga0099796_104694691 119
16 3300013105 Ga0157369_11953758 Ga0157369_119537581 119
17 3300031727 Ga0316576_10000992 Ga0316576_100009926 119
18 3300032168 Ga0316593_10180861 Ga0316593_101808612 119
19 3300033524 Ga0316592_1000397 Ga0316592_10003976 119
20 3300033524 Ga0316592_1002468 Ga0316592_10024684 119
21 3300033527 Ga0316586_1047442 Ga0316586_10474422 119
22 3300033528 Ga0316588_1021266 Ga0316588_10212663 119
23 3300033528 Ga0316588_1021863 Ga0316588_10218632 119
24 3300033528 Ga0316588_1069510 Ga0316588_10695101 119
25 3300033541 Ga0316596_1000006 Ga0316596_100000627 119
26 3300033541 Ga0316596_1001245 Ga0316596_10012455 119
27 3300035398 Ga0316574_0063562 Ga0316574_0063562_798_1196 119
28 3300035398 Ga0316574_0784145 Ga0316574_0784145_139_537 119
29 3300036712 Ga0316584_0335837 Ga0316584_0335837_23_421 119
30 3300039062 Ga0400483_094026 Ga0400483_094026_538_936 119
31 3300044712 Ga0453684_0007136 Ga0453684_0007136_12743_13141 119
32 3300049589 Ga0501073_0540520 Ga0501073_0540520_115_522 119
33 3300049823 Ga0501044_0182883 Ga0501044_0182883_822_1229 119
34 3300005327 Ga0070658_10483582 Ga0070658_104835821 120
35 3300005364 Ga0070673_100695057 Ga0070673_1006950571 120
36 3300005577 Ga0068857_100519616 Ga0068857_1005196162 120
37 3300005617 Ga0068859_101482758 Ga0068859_1014827582 120
38 3300005937 Ga0081455_10019943 Ga0081455_1001994312 120
39 3300006177 Ga0075362_10374474 Ga0075362_103744742 120
40 3300006914 Ga0075436_100881198 Ga0075436_1008811981 120
41 3300006931 Ga0097620_101482874 Ga0097620_1014828742 120
42 3300013105 Ga0157369_10140386 Ga0157369_101403863 120
43 3300020070 Ga0206356_11445679 Ga0206356_114456792 120
44 3300020082 Ga0206353_11578995 Ga0206353_115789952 120
45 3300025898 Ga0207692_10308768 Ga0207692_103087682 120
46 3300025906 Ga0207699_11447269 Ga0207699_114472691 120
47 3300025918 Ga0207662_10207608 Ga0207662_102076083 120
48 3300025920 Ga0207649_10928663 Ga0207649_109286632 120
49 3300025938 Ga0207704_11501213 Ga0207704_115012131 120
50 3300025986 Ga0207658_11135809 Ga0207658_111358091 120
51 3300026041 Ga0207639_10521468 Ga0207639_105214681 120
52 3300026116 Ga0207674_10467969 Ga0207674_104679692 120
53 3300026121 Ga0207683_10547904 Ga0207683_105479042 120
54 3300035695 Ga0373927_0093114 Ga0373927_0093114_304_738 120
55 3300035695 Ga0373927_0199442 Ga0373927_0199442_319_747 120
56 3300037466 Ga0395898_0045631 Ga0395898_0045631_2263_2679 120
57 3300039453 Ga0436362_0313849 Ga0436362_0313849_95_523 120
58 3300046517 Ga0495630_0370866 Ga0495630_0370866_73_501 120
59 3300050489 nmdc:mga03683_4551_c1 nmdc:mga03683_4551_c1_4093_4515 120
60 3300050514 nmdc:mga08x19_1313589_c1 nmdc:mga08x19_1313589_c1_38_454 120
61 3300053093 Ga0500651_0147122 Ga0500651_0147122_506_922 120
62 3300053106 Ga0500558_169022 Ga0500558_169022_241_657 120
63 3300053134 Ga0500658_0197301 Ga0500658_0197301_446_868 120
64 3300053153 Ga0500616_0004782 Ga0500616_0004782_1658_2080 120
65 3300053733 Ga0500552_000085 Ga0500552_000085_1691_2107 120
66 3300005329 Ga0070683_100081257 Ga0070683_1000812572 121
67 3300005339 Ga0070660_101397473 Ga0070660_1013974731 121
68 3300005340 Ga0070689_100196042 Ga0070689_1001960422 121
69 3300005457 Ga0070662_100298211 Ga0070662_1002982111 121
70 3300005563 Ga0068855_100514510 Ga0068855_1005145102 121
71 3300005564 Ga0070664_100028105 Ga0070664_1000281057 121
72 3300005614 Ga0068856_100009374 Ga0068856_10000937418 121
73 3300005616 Ga0068852_100323807 Ga0068852_1003238072 121
74 3300006038 Ga0075365_10394540 Ga0075365_103945401 121
75 3300006177 Ga0075362_10307659 Ga0075362_103076591 121
76 3300006186 Ga0075369_10493729 Ga0075369_104937291 121
77 3300006353 Ga0075370_10226593 Ga0075370_102265932 121
78 3300009545 Ga0105237_10324209 Ga0105237_103242093 121
79 3300009551 Ga0105238_10188920 Ga0105238_101889202 121
80 3300010375 Ga0105239_11564626 Ga0105239_115646262 121
81 3300013100 Ga0157373_10877508 Ga0157373_108775082 121
82 3300013307 Ga0157372_11177110 Ga0157372_111771102 121
83 3300013307 Ga0157372_12716499 Ga0157372_127164991 121
84 3300020082 Ga0206353_10208749 Ga0206353_102087492 121
85 3300025914 Ga0207671_10150809 Ga0207671_101508092 121
86 3300025926 Ga0207659_10851713 Ga0207659_108517132 121
87 3300025933 Ga0207706_10171232 Ga0207706_101712324 121
88 3300025935 Ga0207709_11264225 Ga0207709_112642251 121
89 3300025936 Ga0207670_10273018 Ga0207670_102730182 121
90 3300025942 Ga0207689_11336960 Ga0207689_113369602 121
91 3300025945 Ga0207679_10286228 Ga0207679_102862282 121
92 3300025949 Ga0207667_10254554 Ga0207667_102545542 121
93 3300025981 Ga0207640_10711524 Ga0207640_107115242 121
94 3300026041 Ga0207639_10236751 Ga0207639_102367512 121
95 3300026078 Ga0207702_10023608 Ga0207702_100236082 121
96 3300026116 Ga0207674_10150891 Ga0207674_101508912 121
97 3300026142 Ga0207698_10054516 Ga0207698_100545162 121
98 3300035084 Ga0373928_0111875 Ga0373928_0111875_211_633 121
99 3300037312 Ga0395899_0034692 Ga0395899_0034692_3310_3732 121
100 3300037418 Ga0395900_0415129 Ga0395900_0415129_828_1250 121
101 3300037466 Ga0395898_0005690 Ga0395898_0005690_2491_2913 121
102 3300038443 Ga0395901_0007619 Ga0395901_0007619_10321_10743 121
103 3300038443 Ga0395901_0146970 Ga0395901_0146970_185_607 121
104 3300039450 Ga0436363_0205355 Ga0436363_0205355_146_568 121
105 3300042005 Ga0439448_0014543 Ga0439448_0014543_1451_1873 121
106 3300044694 Ga0466963_0029443 Ga0466963_0029443_385_807 121
107 3300045976 Ga0466967_0013435 Ga0466967_0013435_1696_2118 121
108 3300049586 Ga0501070_0978559 Ga0501070_0978559_146_568 121
109 3300050496 nmdc:mga07m45_256893_c1 nmdc:mga07m45_256893_c1_311_730 121
110 3300005336 Ga0070680_100825801 Ga0070680_1008258012 122
111 3300005518 Ga0070699_100441013 Ga0070699_1004410132 122
112 3300005563 Ga0068855_101969227 Ga0068855_1019692271 122
113 3300006042 Ga0075368_10347243 Ga0075368_103472431 122
114 3300006237 Ga0097621_100872233 Ga0097621_1008722331 122
115 3300006358 Ga0068871_100902851 Ga0068871_1009028512 122
116 3300020080 Ga0206350_10890309 Ga0206350_108903091 122
117 3300025913 Ga0207695_10214224 Ga0207695_102142242 122
118 3300025921 Ga0207652_11735252 Ga0207652_117352521 122
119 3300025949 Ga0207667_10157267 Ga0207667_101572673 122
120 3300048907 Ga0496104_0228525 Ga0496104_0228525_825_1232 122
121 3300053093 Ga0500651_0749941 Ga0500651_0749941_23_445 122
122 3300053130 Ga0500642_0128563 Ga0500642_0128563_158_580 122
123 3300005445 Ga0070708_100278752 Ga0070708_1002787522 123
124 3300005536 Ga0070697_100081984 Ga0070697_1000819842 123
125 3300027671 Ga0209588_1094859 Ga0209588_10948592 123
126 3300028653 Ga0265323_10180116 Ga0265323_101801162 123
127 3300031235 Ga0265330_10001669 Ga0265330_1000166919 123
128 3300031238 Ga0265332_10104902 Ga0265332_101049022 123
129 3300031239 Ga0265328_10116335 Ga0265328_101163352 123
130 3300031249 Ga0265339_10294991 Ga0265339_102949911 123
131 3300031344 Ga0265316_10013594 Ga0265316_100135944 123
132 3300031344 Ga0265316_10865013 Ga0265316_108650131 123
133 3300031712 Ga0265342_10008211 Ga0265342_100082114 123
134 3300033528 Ga0316588_1018041 Ga0316588_10180413 123
135 3300033541 Ga0316596_1046657 Ga0316596_10466573 123
136 3300035170 Ga0373943_0119908 Ga0373943_0119908_841_1257 123
137 3300035695 Ga0373927_0280407 Ga0373927_0280407_185_601 123
138 3300035725 Ga0373947_0230782 Ga0373947_0230782_237_653 123
139 3300044712 Ga0453684_0041859 Ga0453684_0041859_4448_4828 123
140 3300044712 Ga0453684_0282064 Ga0453684_0282064_129_509 123
141 3300005328 Ga0070676_10322091 Ga0070676_103220912 124
142 3300005338 Ga0068868_100125269 Ga0068868_1001252692 124
143 3300005339 Ga0070660_100173896 Ga0070660_1001738962 124
144 3300005343 Ga0070687_100352816 Ga0070687_1003528162 124
145 3300005347 Ga0070668_100341616 Ga0070668_1003416162 124
146 3300005354 Ga0070675_100065182 Ga0070675_1000651824 124
147 3300005356 Ga0070674_100013740 Ga0070674_1000137403 124
148 3300005364 Ga0070673_100089902 Ga0070673_1000899023 124
149 3300005364 Ga0070673_101731876 Ga0070673_1017318761 124
150 3300005366 Ga0070659_100133943 Ga0070659_1001339432 124
151 3300005455 Ga0070663_100223410 Ga0070663_1002234102 124
152 3300005456 Ga0070678_100090091 Ga0070678_1000900912 124
153 3300005459 Ga0068867_100332252 Ga0068867_1003322521 124
154 3300005468 Ga0070707_101039777 Ga0070707_1010397772 124
155 3300005539 Ga0068853_100018646 Ga0068853_1000186462 124
156 3300006195 Ga0075366_10325152 Ga0075366_103251522 124
157 3300009093 Ga0105240_11245495 Ga0105240_112454952 124
158 3300009174 Ga0105241_10046588 Ga0105241_100465882 124
159 3300009176 Ga0105242_10785706 Ga0105242_107857062 124
160 3300009551 Ga0105238_10055969 Ga0105238_100559696 124
161 3300013100 Ga0157373_11110644 Ga0157373_111106441 124
162 3300013102 Ga0157371_10354604 Ga0157371_103546042 124
163 3300013306 Ga0163162_11135741 Ga0163162_111357412 124
164 3300013308 Ga0157375_11105737 Ga0157375_111057371 124
165 3300014325 Ga0163163_11694588 Ga0163163_116945881 124
166 3300014497 Ga0182008_10353852 Ga0182008_103538521 124
167 3300025907 Ga0207645_10096200 Ga0207645_100962002 124
168 3300034816 Ga0373930_0044054 Ga0373930_0044054_213_587 124
169 3300034817 Ga0373948_0088029 Ga0373948_0088029_306_680 124
170 3300035084 Ga0373928_0016766 Ga0373928_0016766_922_1296 124
171 3300035090 Ga0373949_0272614 Ga0373949_0272614_80_454 124
172 3300035092 Ga0373952_0067472 Ga0373952_0067472_376_750 124
173 3300035112 Ga0373932_0116585 Ga0373932_0116585_321_695 124
174 3300035207 Ga0373942_0064607 Ga0373942_0064607_126_500 124
175 3300042439 Ga0439464_0114669 Ga0439464_0114669_345_764 124
176 3300046616 Ga0495668_0439473 Ga0495668_0439473_300_674 124
177 3300048912 Ga0496109_0405595 Ga0496109_0405595_525_899 124
178 3300048920 Ga0496117_0190708 Ga0496117_0190708_236_610 124
179 3300048922 Ga0496119_0441059 Ga0496119_0441059_77_451 124
180 3300048924 Ga0496121_0091176 Ga0496121_0091176_1749_2123 124
181 3300050489 nmdc:mga03683_56660_c1 nmdc:mga03683_56660_c1_456_875 124
182 3300059643 Ga0587072_173954 Ga0587072_173954_74_484 124
183 3300005467 Ga0070706_100100584 Ga0070706_1001005843 125
184 3300005471 Ga0070698_100001015 Ga0070698_1000010155 125
185 3300044712 Ga0453684_1161825 Ga0453684_1161825_10_408 125
186 3300045051 Ga0451576_0001012 Ga0451576_0001012_13154_13552 125
187 iso_pu_bacteria 2713897090 2715500532 125
188 iso_pu_bacteria 2834578030 2834579311 125
189 iso_pu_bacteria 2855020534 2855020877 125
190 iso_pu_bacteria 2899259804 2899262523 125
191 iso_pu_bacteria 2899275550 2899277156 125
192 iso_pu_bacteria 3000405567 3000406711 125
193 iso_pu_bacteria 8057132660 8057134769 125
194 3300013306 Ga0163162_11674216 Ga0163162_116742162 126
195 3300059492 Ga0587073_0037841 Ga0587073_0037841_532_921 126
196 iso_pu_bacteria 2643221580 2643911603 126
197 iso_pu_bacteria 2643221591 2643963597 126
198 iso_pu_bacteria 2643221629 2644165879 126
199 iso_pu_bacteria 2643221662 2644347111 126
200 iso_pu_bacteria 2643221674 2644410395 126
201 iso_pu_bacteria 2898795034 2898796968 126
202 iso_pu_bacteria 2929297113 2929298349 126
203 iso_pu_bacteria 2932401849 2932403085 126
204 3300031691 Ga0316579_10466402 Ga0316579_104664022 127
205 3300031727 Ga0316576_10001969 Ga0316576_1000196910 127
206 3300031728 Ga0316578_10478936 Ga0316578_104789361 127
207 3300032133 Ga0316583_10037793 Ga0316583_100377932 127
208 3300032168 Ga0316593_10076675 Ga0316593_100766752 127
209 3300032168 Ga0316593_10086008 Ga0316593_100860082 127
210 3300032168 Ga0316593_10095295 Ga0316593_100952952 127
211 3300032168 Ga0316593_10186093 Ga0316593_101860931 127
212 3300033528 Ga0316588_1111182 Ga0316588_11111821 127
213 3300033541 Ga0316596_1006883 Ga0316596_10068832 127
214 3300033541 Ga0316596_1094274 Ga0316596_10942742 127
215 3300036647 Ga0316582_0502385 Ga0316582_0502385_13_402 127
216 3300036712 Ga0316584_0092322 Ga0316584_0092322_1217_1606 127
217 3300036712 Ga0316584_0779274 Ga0316584_0779274_221_610 127
218 3300041459 Ga0451800_1508070 Ga0451800_1508070_82_471 127
219 3300049127 Ga0501306_010078 Ga0501306_010078_214_597 127
220 3300049127 Ga0501306_014887 Ga0501306_014887_214_597 127
221 3300049130 Ga0501310_004086 Ga0501310_004086_641_1024 127
222 3300049571 Ga0501034_0000482 Ga0501034_0000482_33906_34295 127
223 iso_pu_bacteria 2522572158 2523107255 127
224 3300013102 Ga0157371_10294763 Ga0157371_102947631 128
225 3300031691 Ga0316579_10460260 Ga0316579_104602602 128
226 3300031727 Ga0316576_10165433 Ga0316576_101654333 128
227 3300032133 Ga0316583_10069858 Ga0316583_100698582 128
228 3300032168 Ga0316593_10012502 Ga0316593_100125023 128
229 3300032168 Ga0316593_10020111 Ga0316593_100201114 128
230 3300033524 Ga0316592_1024219 Ga0316592_10242191 128
231 3300033529 Ga0316587_1011518 Ga0316587_10115182 128
232 3300033541 Ga0316596_1014240 Ga0316596_10142401 128
233 3300036647 Ga0316582_0668648 Ga0316582_0668648_234_629 128
234 3300036712 Ga0316584_0607749 Ga0316584_0607749_113_511 128
235 3300038725 Ga0400484_12384 Ga0400484_12384_1975_2361 128
236 3300038726 Ga0400490_18978 Ga0400490_18978_26779_27165 128
237 3300038726 Ga0400490_19520 Ga0400490_19520_4375_4761 128
238 3300038726 Ga0400490_58666 Ga0400490_58666_373_759 128
239 3300038727 Ga0400491_29253 Ga0400491_29253_7026_7412 128
240 3300038735 Ga0400485_19339 Ga0400485_19339_1625_2011 128
241 3300038741 Ga0400488_57582 Ga0400488_57582_372_758 128
242 3300038741 Ga0400488_58232 Ga0400488_58232_1605_1991 128
243 3300038742 Ga0400486_32047 Ga0400486_32047_6114_6500 128
244 3300039062 Ga0400483_023928 Ga0400483_023928_1281_1667 128
245 3300039062 Ga0400483_042851 Ga0400483_042851_12840_13226 128
246 3300039062 Ga0400483_137186 Ga0400483_137186_584_973 128
247 3300039062 Ga0400483_198250 Ga0400483_198250_9604_9990 128
248 3300039062 Ga0400483_278711 Ga0400483_278711_4339_4725 128
249 3300039062 Ga0400483_281905 Ga0400483_281905_1789_2178 128
250 3300039093 Ga0400489_41472 Ga0400489_41472_6484_6870 128
251 3300039093 Ga0400489_66216 Ga0400489_66216_7084_7470 128
252 3300039110 Ga0400487_19781 Ga0400487_19781_1461_1847 128
253 3300039453 Ga0436362_0189083 Ga0436362_0189083_158_547 128
254 3300042876 Ga0451577_0030969 Ga0451577_0030969_2292_2690 128
255 3300044712 Ga0453684_0416986 Ga0453684_0416986_251_640 128
256 3300044712 Ga0453684_0788845 Ga0453684_0788845_50_448 128
257 3300049161 Ga0501305_010380 Ga0501305_010380_802_1197 128
258 3300049571 Ga0501034_0102596 Ga0501034_0102596_1195_1581 128
259 3300054114 Ga0501084_0646446 Ga0501084_0646446_14_400 128
260 3300059605 Ga0587106_014372 Ga0587106_014372_613_999 128
261 3300002073 JGI24745J21846_1003022 JGI24745J21846_10030223 129
262 3300005436 Ga0070713_100178759 Ga0070713_1001787593 129
263 3300005455 Ga0070663_100164203 Ga0070663_1001642031 129
264 3300006042 Ga0075368_10224016 Ga0075368_102240162 129
265 3300006178 Ga0075367_11045896 Ga0075367_110458961 129
266 3300006871 Ga0075434_100811425 Ga0075434_1008114252 129
267 3300009093 Ga0105240_12273581 Ga0105240_122735811 129
268 3300009177 Ga0105248_11173280 Ga0105248_111732801 129
269 3300009545 Ga0105237_10069626 Ga0105237_100696264 129
270 3300009988 Ga0105035_101729 Ga0105035_1017292 129
271 3300019182 Ga0184598_141942 Ga0184598_1419422 129
272 3300020070 Ga0206356_11636321 Ga0206356_116363211 129
273 3300021358 Ga0213873_10001663 Ga0213873_100016632 129
274 3300021377 Ga0213874_10001065 Ga0213874_100010653 129
275 3300021384 Ga0213876_10001556 Ga0213876_100015566 129
276 3300021384 Ga0213876_10003867 Ga0213876_1000386712 129
277 3300021388 Ga0213875_10004174 Ga0213875_100041744 129
278 3300024225 Ga0224572_1037153 Ga0224572_10371532 129
279 3300025908 Ga0207643_11076315 Ga0207643_110763152 129
280 3300026088 Ga0207641_11069923 Ga0207641_110699232 129
281 3300031235 Ga0265330_10152004 Ga0265330_101520042 129
282 3300031241 Ga0265325_10102490 Ga0265325_101024902 129
283 3300031241 Ga0265325_10139267 Ga0265325_101392672 129
284 3300031242 Ga0265329_10103667 Ga0265329_101036671 129
285 3300031247 Ga0265340_10036214 Ga0265340_100362142 129
286 3300031249 Ga0265339_10030849 Ga0265339_100308492 129
287 3300031249 Ga0265339_10142634 Ga0265339_101426342 129
288 3300031250 Ga0265331_10119834 Ga0265331_101198342 129
289 3300031344 Ga0265316_10486487 Ga0265316_104864871 129
290 3300031711 Ga0265314_10016860 Ga0265314_100168605 129
291 3300031711 Ga0265314_10095625 Ga0265314_100956253 129
292 3300031711 Ga0265314_10279521 Ga0265314_102795211 129
293 3300031712 Ga0265342_10030117 Ga0265342_100301173 129
294 3300031712 Ga0265342_10090566 Ga0265342_100905662 129
295 3300031727 Ga0316576_10703899 Ga0316576_107038992 129
296 3300035085 Ga0373929_0048291 Ga0373929_0048291_514_903 129
297 3300035112 Ga0373932_0061960 Ga0373932_0061960_608_997 129
298 3300035115 Ga0373941_0172622 Ga0373941_0172622_125_514 129
299 3300035121 Ga0373960_0074546 Ga0373960_0074546_508_897 129
300 3300035242 Ga0373962_0006987 Ga0373962_0006987_1506_1895 129
301 3300035692 Ga0373935_0225634 Ga0373935_0225634_512_901 129
302 3300035695 Ga0373927_0538286 Ga0373927_0538286_362_751 129
303 3300036401 Ga0373937_1771358 Ga0373937_1771358_131_520 129
304 3300037068 Ga0373925_1088508 Ga0373925_1088508_210_599 129
305 3300037853 Ga0436364_0013783 Ga0436364_0013783_4272_4661 129
306 3300037853 Ga0436364_0082147 Ga0436364_0082147_1490_1879 129
307 3300037853 Ga0436364_0675508 Ga0436364_0675508_700_1089 129
308 3300039437 Ga0436365_0555060 Ga0436365_0555060_407_796 129
309 3300039437 Ga0436365_0850961 Ga0436365_0850961_133_522 129
310 3300039437 Ga0436365_1136540 Ga0436365_1136540_19468_19857 129
311 3300039437 Ga0436365_1228764 Ga0436365_1228764_133_552 129
312 3300039437 Ga0436365_1253031 Ga0436365_1253031_31042_31431 129
313 3300039438 Ga0436360_0065948 Ga0436360_0065948_69_461 129
314 3300039438 Ga0436360_1251640 Ga0436360_1251640_162_551 129
315 3300039447 Ga0436361_0425653 Ga0436361_0425653_38_427 129
316 3300039450 Ga0436363_0121335 Ga0436363_0121335_1652_2041 129
317 3300039450 Ga0436363_0252353 Ga0436363_0252353_392_781 129
318 3300039450 Ga0436363_0746062 Ga0436363_0746062_1903_2292 129
319 3300039450 Ga0436363_1082032 Ga0436363_1082032_57_446 129
320 3300039453 Ga0436362_0060202 Ga0436362_0060202_82_471 129
321 3300039453 Ga0436362_0579275 Ga0436362_0579275_108_497 129
322 3300041453 Ga0451797_1514149 Ga0451797_1514149_89_478 129
323 3300041456 Ga0451795_1557624 Ga0451795_1557624_46_435 129
324 3300044684 Ga0466966_0207717 Ga0466966_0207717_436_825 129
325 3300044684 Ga0466966_0258704 Ga0466966_0258704_33_422 129
326 3300044693 Ga0466961_0121966 Ga0466961_0121966_561_950 129
327 3300044694 Ga0466963_0739702 Ga0466963_0739702_269_658 129
328 3300045049 Ga0466959_0084832 Ga0466959_0084832_493_882 129
329 3300045051 Ga0451576_0031820 Ga0451576_0031820_2786_3175 129
330 3300045836 Ga0466958_0264302 Ga0466958_0264302_387_776 129
331 3300046454 Ga0495592_0333617 Ga0495592_0333617_241_630 129
332 3300047319 Ga0495674_0887829 Ga0495674_0887829_90_479 129
333 3300047320 Ga0495672_0000511 Ga0495672_0000511_28972_29361 129
334 3300047320 Ga0495672_0031397 Ga0495672_0031397_1561_1950 129
335 3300048088 Ga0495602_0281167 Ga0495602_0281167_722_1111 129
336 3300048903 Ga0496100_1060656 Ga0496100_1060656_134_523 129
337 3300048913 Ga0496110_0268646 Ga0496110_0268646_164_553 129
338 3300048929 Ga0496126_0135898 Ga0496126_0135898_527_916 129
339 3300049571 Ga0501034_0120247 Ga0501034_0120247_390_809 129
340 3300049574 Ga0501038_0282354 Ga0501038_0282354_421_840 129
341 3300049743 Ga0501081_0577270 Ga0501081_0577270_280_669 129
342 3300050512 nmdc:mga0n895_915730_c1 nmdc:mga0n895_915730_c1_200_619 129
343 3300053096 Ga0500641_0004296 Ga0500641_0004296_3531_3950 129
344 3300053117 Ga0500593_000058 Ga0500593_000058_12707_13096 129
345 3300053139 Ga0500568_0000001 Ga0500568_0000001_13398_13787 129
346 3300059643 Ga0587072_086429 Ga0587072_086429_233_622 129
347 3300060247 Ga0587096_03993 Ga0587096_03993_64_453 129
348 3300060344 Ga0587071_077540 Ga0587071_077540_129_518 129
349 3300060346 Ga0587111_0029655 Ga0587111_0029655_567_956 129
350 3300061734 Ga0530510_0566665 Ga0530510_0566665_161_550 129
351 3300001979 JGI24740J21852_10036215 JGI24740J21852_100362152 130
352 3300003214 JGI25165J46597_1000961 JGI25165J46597_10009614 130
353 3300003781 Ga0055536_1016175 Ga0055536_10161752 130
354 3300004803 Ga0058862_10049717 Ga0058862_100497171 130
355 3300004803 Ga0058862_12821384 Ga0058862_128213842 130
356 3300005327 Ga0070658_10034257 Ga0070658_100342572 130
357 3300005327 Ga0070658_10236536 Ga0070658_102365362 130
358 3300005327 Ga0070658_10774137 Ga0070658_107741372 130
359 3300005329 Ga0070683_100931522 Ga0070683_1009315221 130
360 3300005335 Ga0070666_10543561 Ga0070666_105435611 130
361 3300005337 Ga0070682_100178640 Ga0070682_1001786401 130
362 3300005339 Ga0070660_100004846 Ga0070660_1000048463 130
363 3300005339 Ga0070660_100070020 Ga0070660_1000700204 130
364 3300005339 Ga0070660_100158975 Ga0070660_1001589752 130
365 3300005341 Ga0070691_10560979 Ga0070691_105609791 130
366 3300005344 Ga0070661_100001887 Ga0070661_10000188715 130
367 3300005344 Ga0070661_100381304 Ga0070661_1003813042 130
368 3300005344 Ga0070661_100971558 Ga0070661_1009715581 130
369 3300005347 Ga0070668_100092896 Ga0070668_1000928962 130
370 3300005347 Ga0070668_101254259 Ga0070668_1012542591 130
371 3300005366 Ga0070659_100017338 Ga0070659_1000173386 130
372 3300005367 Ga0070667_101559602 Ga0070667_1015596021 130
373 3300005455 Ga0070663_101316873 Ga0070663_1013168731 130
374 3300005458 Ga0070681_10001062 Ga0070681_1000106212 130
375 3300005458 Ga0070681_10009391 Ga0070681_100093915 130
376 3300005458 Ga0070681_10197259 Ga0070681_101972593 130
377 3300005458 Ga0070681_10197413 Ga0070681_101974132 130
378 3300005458 Ga0070681_10487401 Ga0070681_104874012 130
379 3300005530 Ga0070679_100007538 Ga0070679_10000753818 130
380 3300005530 Ga0070679_100010304 Ga0070679_1000103049 130
381 3300005530 Ga0070679_100113062 Ga0070679_1001130621 130
382 3300005530 Ga0070679_100753323 Ga0070679_1007533231 130
383 3300005539 Ga0068853_100000888 Ga0068853_10000088826 130
384 3300005539 Ga0068853_100007192 Ga0068853_1000071927 130
385 3300005539 Ga0068853_101001024 Ga0068853_1010010241 130
386 3300005543 Ga0070672_100347782 Ga0070672_1003477822 130
387 3300005543 Ga0070672_101170313 Ga0070672_1011703132 130
388 3300005547 Ga0070693_100354020 Ga0070693_1003540202 130
389 3300005548 Ga0070665_100050199 Ga0070665_1000501995 130
390 3300005548 Ga0070665_100323781 Ga0070665_1003237812 130
391 3300005548 Ga0070665_100823091 Ga0070665_1008230912 130
392 3300005548 Ga0070665_101598780 Ga0070665_1015987801 130
393 3300005563 Ga0068855_100075649 Ga0068855_1000756494 130
394 3300005563 Ga0068855_100323488 Ga0068855_1003234881 130
395 3300005563 Ga0068855_100367187 Ga0068855_1003671873 130
396 3300005563 Ga0068855_100827425 Ga0068855_1008274252 130
397 3300005563 Ga0068855_102172949 Ga0068855_1021729491 130
398 3300005564 Ga0070664_100688593 Ga0070664_1006885932 130
399 3300005577 Ga0068857_100165278 Ga0068857_1001652782 130
400 3300005577 Ga0068857_100260674 Ga0068857_1002606742 130
401 3300005577 Ga0068857_100402067 Ga0068857_1004020671 130
402 3300005577 Ga0068857_100845518 Ga0068857_1008455182 130
403 3300005578 Ga0068854_100157239 Ga0068854_1001572392 130
404 3300005578 Ga0068854_100159518 Ga0068854_1001595181 130
405 3300005578 Ga0068854_100362416 Ga0068854_1003624162 130
406 3300005578 Ga0068854_100561517 Ga0068854_1005615172 130
407 3300005578 Ga0068854_100592850 Ga0068854_1005928502 130
408 3300005614 Ga0068856_100028895 Ga0068856_1000288956 130
409 3300005614 Ga0068856_100059597 Ga0068856_1000595973 130
410 3300005614 Ga0068856_100193379 Ga0068856_1001933792 130
411 3300005614 Ga0068856_100370182 Ga0068856_1003701823 130
412 3300005616 Ga0068852_100031702 Ga0068852_1000317022 130
413 3300005616 Ga0068852_100324806 Ga0068852_1003248062 130
414 3300005616 Ga0068852_100757434 Ga0068852_1007574341 130
415 3300005617 Ga0068859_100894715 Ga0068859_1008947152 130
416 3300005618 Ga0068864_100927981 Ga0068864_1009279811 130
417 3300005719 Ga0068861_100513425 Ga0068861_1005134252 130
418 3300005834 Ga0068851_10002106 Ga0068851_100021068 130
419 3300005834 Ga0068851_10030591 Ga0068851_100305912 130
420 3300005842 Ga0068858_101166860 Ga0068858_1011668601 130
421 3300005843 Ga0068860_100307341 Ga0068860_1003073413 130
422 3300005844 Ga0068862_100218768 Ga0068862_1002187682 130
423 3300005937 Ga0081455_10000156 Ga0081455_1000015673 130
424 3300005937 Ga0081455_10043697 Ga0081455_100436974 130
425 3300005981 Ga0081538_10003741 Ga0081538_1000374126 130
426 3300005981 Ga0081538_10005275 Ga0081538_100052757 130
427 3300005981 Ga0081538_10105083 Ga0081538_101050831 130
428 3300005985 Ga0081539_10006788 Ga0081539_1000678810 130
429 3300006038 Ga0075365_10268947 Ga0075365_102689472 130
430 3300006038 Ga0075365_10955654 Ga0075365_109556541 130
431 3300006042 Ga0075368_10033501 Ga0075368_100335013 130
432 3300006048 Ga0075363_100016090 Ga0075363_1000160904 130
433 3300006048 Ga0075363_100682371 Ga0075363_1006823712 130
434 3300006051 Ga0075364_10014487 Ga0075364_100144874 130
435 3300006051 Ga0075364_10050081 Ga0075364_100500814 130
436 3300006051 Ga0075364_10724124 Ga0075364_107241242 130
437 3300006051 Ga0075364_10907606 Ga0075364_109076061 130
438 3300006175 Ga0070712_100304500 Ga0070712_1003045002 130
439 3300006177 Ga0075362_10010585 Ga0075362_100105855 130
440 3300006177 Ga0075362_10140013 Ga0075362_101400132 130
441 3300006178 Ga0075367_10338736 Ga0075367_103387362 130
442 3300006186 Ga0075369_10167594 Ga0075369_101675942 130
443 3300006195 Ga0075366_10059905 Ga0075366_100599052 130
444 3300006195 Ga0075366_10227727 Ga0075366_102277272 130
445 3300006237 Ga0097621_100590092 Ga0097621_1005900921 130
446 3300006237 Ga0097621_101270847 Ga0097621_1012708471 130
447 3300006353 Ga0075370_10032179 Ga0075370_100321794 130
448 3300006353 Ga0075370_10147741 Ga0075370_101477413 130
449 3300006353 Ga0075370_10170889 Ga0075370_101708892 130
450 3300006846 Ga0075430_100156687 Ga0075430_1001566872 130
451 3300006852 Ga0075433_10335429 Ga0075433_103354292 130
452 3300006852 Ga0075433_10776333 Ga0075433_107763332 130
453 3300006881 Ga0068865_100118650 Ga0068865_1001186502 130
454 3300006914 Ga0075436_100693895 Ga0075436_1006938951 130
455 3300006931 Ga0097620_100894723 Ga0097620_1008947232 130
456 3300009093 Ga0105240_10075852 Ga0105240_100758521 130
457 3300009093 Ga0105240_10804272 Ga0105240_108042722 130
458 3300009093 Ga0105240_10972505 Ga0105240_109725052 130
459 3300009093 Ga0105240_12560630 Ga0105240_125606301 130
460 3300009098 Ga0105245_11520332 Ga0105245_115203322 130
461 3300009148 Ga0105243_12061135 Ga0105243_120611351 130
462 3300009174 Ga0105241_11385553 Ga0105241_113855531 130
463 3300009176 Ga0105242_10963989 Ga0105242_109639892 130
464 3300009177 Ga0105248_10555050 Ga0105248_105550501 130
465 3300009545 Ga0105237_10002619 Ga0105237_1000261912 130
466 3300009545 Ga0105237_10244594 Ga0105237_102445943 130
467 3300009545 Ga0105237_10282372 Ga0105237_102823722 130
468 3300009545 Ga0105237_10311796 Ga0105237_103117961 130
469 3300009551 Ga0105238_10033303 Ga0105238_100333032 130
470 3300009551 Ga0105238_10323701 Ga0105238_103237011 130
471 3300009551 Ga0105238_12759932 Ga0105238_127599321 130
472 3300009993 Ga0105028_100431 Ga0105028_1004313 130
473 3300010375 Ga0105239_10166189 Ga0105239_101661894 130
474 3300010375 Ga0105239_10477867 Ga0105239_104778672 130
475 3300011119 Ga0105246_11167806 Ga0105246_111678062 130
476 3300013100 Ga0157373_10518982 Ga0157373_105189821 130
477 3300013100 Ga0157373_10822608 Ga0157373_108226081 130
478 3300013102 Ga0157371_11532809 Ga0157371_115328091 130
479 3300013104 Ga0157370_10001390 Ga0157370_1000139026 130
480 3300013104 Ga0157370_10008540 Ga0157370_100085409 130
481 3300013104 Ga0157370_10072284 Ga0157370_100722844 130
482 3300013104 Ga0157370_10822497 Ga0157370_108224972 130
483 3300013104 Ga0157370_10954247 Ga0157370_109542472 130
484 3300013105 Ga0157369_10026398 Ga0157369_100263986 130
485 3300013105 Ga0157369_10196070 Ga0157369_101960702 130
486 3300013105 Ga0157369_10625868 Ga0157369_106258682 130
487 3300013105 Ga0157369_10660984 Ga0157369_106609842 130
488 3300013105 Ga0157369_11700577 Ga0157369_117005771 130
489 3300013296 Ga0157374_11020482 Ga0157374_110204822 130
490 3300013296 Ga0157374_11500375 Ga0157374_115003752 130
491 3300013297 Ga0157378_10605597 Ga0157378_106055972 130
492 3300013297 Ga0157378_11073281 Ga0157378_110732812 130
493 3300013297 Ga0157378_12706115 Ga0157378_127061151 130
494 3300013306 Ga0163162_13109394 Ga0163162_131093941 130
495 3300013307 Ga0157372_10111907 Ga0157372_101119072 130
496 3300013307 Ga0157372_10324059 Ga0157372_103240592 130
497 3300013307 Ga0157372_11652053 Ga0157372_116520531 130
498 3300013307 Ga0157372_12101897 Ga0157372_121018972 130
499 3300014325 Ga0163163_10466658 Ga0163163_104666581 130
500 3300014497 Ga0182008_10876149 Ga0182008_108761491 130
501 3300014969 Ga0157376_10251797 Ga0157376_102517972 130
502 3300014969 Ga0157376_10402106 Ga0157376_104021061 130
503 3300020069 Ga0197907_10410046 Ga0197907_104100463 130
504 3300020070 Ga0206356_10510010 Ga0206356_105100103 130
505 3300020070 Ga0206356_10669629 Ga0206356_106696291 130
506 3300020076 Ga0206355_1092081 Ga0206355_10920812 130
507 3300020078 Ga0206352_10440244 Ga0206352_104402442 130
508 3300020080 Ga0206350_10063581 Ga0206350_100635811 130
509 3300020082 Ga0206353_10170206 Ga0206353_101702062 130
510 3300021358 Ga0213873_10135056 Ga0213873_101350562 130
511 3300021358 Ga0213873_10198427 Ga0213873_101984272 130
512 3300021361 Ga0213872_10045368 Ga0213872_100453681 130
513 3300021361 Ga0213872_10060192 Ga0213872_100601922 130
514 3300021361 Ga0213872_10074275 Ga0213872_100742751 130
515 3300021361 Ga0213872_10122271 Ga0213872_101222711 130
516 3300021388 Ga0213875_10259268 Ga0213875_102592682 130
517 3300021441 Ga0213871_10071071 Ga0213871_100710711 130
518 3300022467 Ga0224712_10017793 Ga0224712_100177933 130
519 3300022467 Ga0224712_10203237 Ga0224712_102032372 130
520 3300025231 Ga0207427_101221 Ga0207427_1012219 130
521 3300025261 Ga0209233_1000293 Ga0209233_100029313 130
522 3300025292 Ga0209676_1000092 Ga0209676_100009226 130
523 3300025298 Ga0209050_1007590 Ga0209050_10075905 130
524 3300025303 Ga0209051_1025622 Ga0209051_10256222 130
525 3300025321 Ga0207656_10001058 Ga0207656_100010584 130
526 3300025321 Ga0207656_10030934 Ga0207656_100309343 130
527 3300025899 Ga0207642_10394017 Ga0207642_103940172 130
528 3300025901 Ga0207688_10037880 Ga0207688_100378803 130
529 3300025904 Ga0207647_10089449 Ga0207647_100894493 130
530 3300025904 Ga0207647_10141952 Ga0207647_101419522 130
531 3300025909 Ga0207705_10020427 Ga0207705_100204274 130
532 3300025909 Ga0207705_10071391 Ga0207705_100713912 130
533 3300025909 Ga0207705_10075111 Ga0207705_100751112 130
534 3300025911 Ga0207654_10953111 Ga0207654_109531111 130
535 3300025912 Ga0207707_10000624 Ga0207707_1000062434 130
536 3300025912 Ga0207707_10022305 Ga0207707_100223053 130
537 3300025912 Ga0207707_10078099 Ga0207707_100780994 130
538 3300025912 Ga0207707_10119622 Ga0207707_101196222 130
539 3300025913 Ga0207695_10043881 Ga0207695_100438815 130
540 3300025914 Ga0207671_10001074 Ga0207671_1000107412 130
541 3300025914 Ga0207671_10184945 Ga0207671_101849451 130
542 3300025914 Ga0207671_10254384 Ga0207671_102543841 130
543 3300025914 Ga0207671_10344051 Ga0207671_103440512 130
544 3300025915 Ga0207693_10474744 Ga0207693_104747442 130
545 3300025917 Ga0207660_10017860 Ga0207660_100178604 130
546 3300025917 Ga0207660_10369650 Ga0207660_103696502 130
547 3300025917 Ga0207660_10512111 Ga0207660_105121111 130
548 3300025919 Ga0207657_10008060 Ga0207657_100080603 130
549 3300025919 Ga0207657_10044882 Ga0207657_100448824 130
550 3300025919 Ga0207657_10076211 Ga0207657_100762114 130
551 3300025919 Ga0207657_10289780 Ga0207657_102897803 130
552 3300025920 Ga0207649_10001226 Ga0207649_1000122611 130
553 3300025920 Ga0207649_10093984 Ga0207649_100939842 130
554 3300025920 Ga0207649_11229423 Ga0207649_112294231 130
555 3300025921 Ga0207652_10002587 Ga0207652_1000258718 130
556 3300025921 Ga0207652_10057886 Ga0207652_100578863 130
557 3300025921 Ga0207652_10218820 Ga0207652_102188202 130
558 3300025921 Ga0207652_10462324 Ga0207652_104623242 130
559 3300025921 Ga0207652_10718760 Ga0207652_107187601 130
560 3300025921 Ga0207652_11778783 Ga0207652_117787831 130
561 3300025924 Ga0207694_10008555 Ga0207694_100085555 130
562 3300025924 Ga0207694_10172425 Ga0207694_101724251 130
563 3300025924 Ga0207694_10511921 Ga0207694_105119212 130
564 3300025925 Ga0207650_10382801 Ga0207650_103828012 130
565 3300025926 Ga0207659_10273630 Ga0207659_102736302 130
566 3300025927 Ga0207687_10652660 Ga0207687_106526602 130
567 3300025928 Ga0207700_10360140 Ga0207700_103601402 130
568 3300025932 Ga0207690_10019639 Ga0207690_100196393 130
569 3300025932 Ga0207690_10089309 Ga0207690_100893091 130
570 3300025932 Ga0207690_10477913 Ga0207690_104779132 130
571 3300025933 Ga0207706_10214453 Ga0207706_102144532 130
572 3300025937 Ga0207669_10012602 Ga0207669_100126022 130
573 3300025940 Ga0207691_10455149 Ga0207691_104551492 130
574 3300025941 Ga0207711_10388325 Ga0207711_103883253 130
575 3300025944 Ga0207661_10380109 Ga0207661_103801092 130
576 3300025945 Ga0207679_10573235 Ga0207679_105732352 130
577 3300025949 Ga0207667_10000877 Ga0207667_100008777 130
578 3300025949 Ga0207667_10002756 Ga0207667_100027569 130
579 3300025949 Ga0207667_10019501 Ga0207667_1001950113 130
580 3300025961 Ga0207712_11648842 Ga0207712_116488421 130
581 3300025972 Ga0207668_10009850 Ga0207668_100098509 130
582 3300025972 Ga0207668_10536746 Ga0207668_105367462 130
583 3300025981 Ga0207640_10009094 Ga0207640_100090944 130
584 3300025981 Ga0207640_10016034 Ga0207640_100160342 130
585 3300025981 Ga0207640_10046887 Ga0207640_100468872 130
586 3300025981 Ga0207640_10112501 Ga0207640_101125011 130
587 3300025981 Ga0207640_10426997 Ga0207640_104269972 130
588 3300025986 Ga0207658_11548342 Ga0207658_115483421 130
589 3300026023 Ga0207677_10101363 Ga0207677_101013633 130
590 3300026023 Ga0207677_10962746 Ga0207677_109627462 130
591 3300026041 Ga0207639_10004515 Ga0207639_1000451511 130
592 3300026041 Ga0207639_10007867 Ga0207639_100078677 130
593 3300026041 Ga0207639_10029135 Ga0207639_100291354 130
594 3300026075 Ga0207708_11231094 Ga0207708_112310941 130
595 3300026078 Ga0207702_10006196 Ga0207702_100061962 130
596 3300026078 Ga0207702_10029655 Ga0207702_100296552 130
597 3300026078 Ga0207702_10459283 Ga0207702_104592832 130
598 3300026078 Ga0207702_10575395 Ga0207702_105753952 130
599 3300026078 Ga0207702_11739716 Ga0207702_117397162 130
600 3300026089 Ga0207648_10242504 Ga0207648_102425042 130
601 3300026089 Ga0207648_10275281 Ga0207648_102752812 130
602 3300026095 Ga0207676_10792910 Ga0207676_107929102 130
603 3300026116 Ga0207674_10045512 Ga0207674_100455126 130
604 3300026116 Ga0207674_10070606 Ga0207674_100706063 130
605 3300026116 Ga0207674_10245498 Ga0207674_102454982 130
606 3300026116 Ga0207674_10249766 Ga0207674_102497663 130
607 3300026118 Ga0207675_100405521 Ga0207675_1004055212 130
608 3300026121 Ga0207683_10144767 Ga0207683_101447672 130
609 3300026142 Ga0207698_10140737 Ga0207698_101407373 130
610 3300026142 Ga0207698_10155782 Ga0207698_101557822 130
611 3300026142 Ga0207698_11431508 Ga0207698_114315082 130
612 3300027462 Ga0210000_1063313 Ga0210000_10633131 130
613 3300027665 Ga0209983_1009332 Ga0209983_10093322 130
614 3300027866 Ga0209813_10102649 Ga0209813_101026492 130
615 3300027876 Ga0209974_10063329 Ga0209974_100633292 130
616 3300027907 Ga0207428_10929259 Ga0207428_109292592 130
617 3300028379 Ga0268266_10000321 Ga0268266_1000032133 130
618 3300028379 Ga0268266_11142114 Ga0268266_111421141 130
619 3300028573 Ga0265334_10150039 Ga0265334_101500392 130
620 3300028577 Ga0265318_10008175 Ga0265318_100081755 130
621 3300028800 Ga0265338_10069830 Ga0265338_100698302 130
622 3300028800 Ga0265338_10590173 Ga0265338_105901732 130
623 3300029957 Ga0265324_10063838 Ga0265324_100638382 130
624 3300031235 Ga0265330_10006274 Ga0265330_100062747 130
625 3300031235 Ga0265330_10120455 Ga0265330_101204552 130
626 3300031235 Ga0265330_10197428 Ga0265330_101974281 130
627 3300031238 Ga0265332_10065930 Ga0265332_100659302 130
628 3300031238 Ga0265332_10121255 Ga0265332_101212551 130
629 3300031239 Ga0265328_10074526 Ga0265328_100745262 130
630 3300031239 Ga0265328_10187815 Ga0265328_101878152 130
631 3300031240 Ga0265320_10060485 Ga0265320_100604852 130
632 3300031241 Ga0265325_10080671 Ga0265325_100806712 130
633 3300031249 Ga0265339_10013124 Ga0265339_100131247 130
634 3300031250 Ga0265331_10157792 Ga0265331_101577922 130
635 3300031251 Ga0265327_10000100 Ga0265327_10000100182 130
636 3300031251 Ga0265327_10050054 Ga0265327_100500542 130
637 3300031344 Ga0265316_10209865 Ga0265316_102098652 130
638 3300031344 Ga0265316_10294616 Ga0265316_102946162 130
639 3300031548 Ga0307408_100739691 Ga0307408_1007396912 130
640 3300031595 Ga0265313_10002227 Ga0265313_1000222716 130
641 3300031595 Ga0265313_10005420 Ga0265313_100054206 130
642 3300031595 Ga0265313_10283610 Ga0265313_102836102 130
643 3300031616 Ga0307508_10530512 Ga0307508_105305121 130
644 3300031711 Ga0265314_10031281 Ga0265314_100312815 130
645 3300031711 Ga0265314_10106792 Ga0265314_101067922 130
646 3300031711 Ga0265314_10119547 Ga0265314_101195472 130
647 3300031712 Ga0265342_10077955 Ga0265342_100779552 130
648 3300031712 Ga0265342_10248561 Ga0265342_102485612 130
649 3300031712 Ga0265342_10266813 Ga0265342_102668132 130
650 3300031730 Ga0307516_10367781 Ga0307516_103677812 130
651 3300031731 Ga0307405_10335410 Ga0307405_103354103 130
652 3300031824 Ga0307413_10162983 Ga0307413_101629832 130
653 3300031824 Ga0307413_10354841 Ga0307413_103548413 130
654 3300031852 Ga0307410_10051793 Ga0307410_100517933 130
655 3300031852 Ga0307410_10840362 Ga0307410_108403621 130
656 3300031852 Ga0307410_10945600 Ga0307410_109456002 130
657 3300031901 Ga0307406_10167970 Ga0307406_101679703 130
658 3300031901 Ga0307406_10240419 Ga0307406_102404192 130
659 3300031901 Ga0307406_10271008 Ga0307406_102710081 130
660 3300031901 Ga0307406_10334186 Ga0307406_103341862 130
661 3300031901 Ga0307406_10655183 Ga0307406_106551832 130
662 3300031903 Ga0307407_10499792 Ga0307407_104997921 130
663 3300031911 Ga0307412_10063396 Ga0307412_100633962 130
664 3300031911 Ga0307412_10241524 Ga0307412_102415242 130
665 3300031911 Ga0307412_10535596 Ga0307412_105355962 130
666 3300031995 Ga0307409_100376008 Ga0307409_1003760082 130
667 3300031995 Ga0307409_100387076 Ga0307409_1003870762 130
668 3300031995 Ga0307409_100782482 Ga0307409_1007824822 130
669 3300031995 Ga0307409_100949381 Ga0307409_1009493812 130
670 3300032004 Ga0307414_10122495 Ga0307414_101224952 130
671 3300032004 Ga0307414_10203250 Ga0307414_102032502 130
672 3300032004 Ga0307414_10286581 Ga0307414_102865813 130
673 3300032004 Ga0307414_10365082 Ga0307414_103650823 130
674 3300032004 Ga0307414_10984833 Ga0307414_109848332 130
675 3300032004 Ga0307414_11383389 Ga0307414_113833891 130
676 3300032004 Ga0307414_11769193 Ga0307414_117691932 130
677 3300032004 Ga0307414_11783581 Ga0307414_117835811 130
678 3300032004 Ga0307414_12032744 Ga0307414_120327441 130
679 3300032005 Ga0307411_10522795 Ga0307411_105227952 130
680 3300032005 Ga0307411_10826661 Ga0307411_108266612 130
681 3300032126 Ga0307415_101315648 Ga0307415_1013156481 130
682 3300032126 Ga0307415_101343883 Ga0307415_1013438832 130
683 3300033529 Ga0316587_1017547 Ga0316587_10175473 130
684 3300034818 Ga0373950_0160311 Ga0373950_0160311_10_402 130
685 3300034820 Ga0373959_0014406 Ga0373959_0014406_868_1287 130
686 3300035090 Ga0373949_0072876 Ga0373949_0072876_470_889 130
687 3300035112 Ga0373932_0095872 Ga0373932_0095872_79_471 130
688 3300035115 Ga0373941_0258908 Ga0373941_0258908_228_620 130
689 3300035398 Ga0316574_0362033 Ga0316574_0362033_58_450 130
690 3300035691 Ga0373931_0318912 Ga0373931_0318912_48_440 130
691 3300035691 Ga0373931_0664801 Ga0373931_0664801_111_533 130
692 3300036401 Ga0373937_0273760 Ga0373937_0273760_271_666 130
693 3300037068 Ga0373925_0060365 Ga0373925_0060365_1384_1776 130
694 3300037312 Ga0395899_0044661 Ga0395899_0044661_1906_2298 130
695 3300037418 Ga0395900_0075274 Ga0395900_0075274_1700_2092 130
696 3300037418 Ga0395900_0078542 Ga0395900_0078542_481_873 130
697 3300037418 Ga0395900_0308699 Ga0395900_0308699_64_456 130
698 3300037418 Ga0395900_0346946 Ga0395900_0346946_580_987 130
699 3300037466 Ga0395898_0203092 Ga0395898_0203092_921_1313 130
700 3300037466 Ga0395898_0270557 Ga0395898_0270557_397_789 130
701 3300037466 Ga0395898_1236517 Ga0395898_1236517_49_441 130
702 3300037853 Ga0436364_1463267 Ga0436364_1463267_464_859 130
703 3300038443 Ga0395901_0108247 Ga0395901_0108247_886_1278 130
704 3300038443 Ga0395901_0166684 Ga0395901_0166684_1652_2044 130
705 3300038443 Ga0395901_1191589 Ga0395901_1191589_320_712 130
706 3300039062 Ga0400483_057660 Ga0400483_057660_213_605 130
707 3300039062 Ga0400483_114523 Ga0400483_114523_2286_2678 130
708 3300039062 Ga0400483_151905 Ga0400483_151905_155_547 130
709 3300039062 Ga0400483_217885 Ga0400483_217885_3666_4058 130
710 3300039437 Ga0436365_1369855 Ga0436365_1369855_113_505 130
711 3300039438 Ga0436360_0229296 Ga0436360_0229296_459_854 130
712 3300039438 Ga0436360_0840585 Ga0436360_0840585_467_859 130
713 3300039438 Ga0436360_0870274 Ga0436360_0870274_436_831 130
714 3300039438 Ga0436360_1007386 Ga0436360_1007386_575_967 130
715 3300039438 Ga0436360_1307620 Ga0436360_1307620_163_555 130
716 3300039447 Ga0436361_0305976 Ga0436361_0305976_1441_1836 130
717 3300039447 Ga0436361_0448350 Ga0436361_0448350_94_489 130
718 3300039447 Ga0436361_0498700 Ga0436361_0498700_100_495 130
719 3300039447 Ga0436361_0587648 Ga0436361_0587648_210_605 130
720 3300039447 Ga0436361_0618512 Ga0436361_0618512_748_1143 130
721 3300039447 Ga0436361_0632864 Ga0436361_0632864_784_1179 130
722 3300039447 Ga0436361_0834792 Ga0436361_0834792_121_516 130
723 3300039447 Ga0436361_0846724 Ga0436361_0846724_326_721 130
724 3300039447 Ga0436361_0853694 Ga0436361_0853694_165_560 130
725 3300039447 Ga0436361_1035119 Ga0436361_1035119_4053_4448 130
726 3300039447 Ga0436361_1061350 Ga0436361_1061350_408_803 130
727 3300039453 Ga0436362_0437344 Ga0436362_0437344_122_517 130
728 3300039453 Ga0436362_0608067 Ga0436362_0608067_168_563 130
729 3300039453 Ga0436362_1149838 Ga0436362_1149838_350_742 130
730 3300041410 Ga0439461_0027483 Ga0439461_0027483_599_991 130
731 3300041411 Ga0439466_0165373 Ga0439466_0165373_200_592 130
732 3300041413 Ga0439465_0041213 Ga0439465_0041213_36_428 130
733 3300041413 Ga0439465_0047897 Ga0439465_0047897_377_796 130
734 3300041413 Ga0439465_0055961 Ga0439465_0055961_387_779 130
735 3300041413 Ga0439465_0060786 Ga0439465_0060786_29_421 130
736 3300041413 Ga0439465_0134278 Ga0439465_0134278_434_826 130
737 3300041443 Ga0451789_0925233 Ga0451789_0925233_166_558 130
738 3300041445 Ga0451792_23296 Ga0451792_23296_195_587 130
739 3300041446 Ga0451794_41389 Ga0451794_41389_43_435 130
740 3300041451 Ga0451791_1156556 Ga0451791_1156556_120_512 130
741 3300041452 Ga0451793_0423706 Ga0451793_0423706_427_819 130
742 3300041452 Ga0451793_0894875 Ga0451793_0894875_309_701 130
743 3300041453 Ga0451797_1483980 Ga0451797_1483980_176_568 130
744 3300041453 Ga0451797_1528640 Ga0451797_1528640_289_693 130
745 3300041459 Ga0451800_0842399 Ga0451800_0842399_98_490 130
746 3300041494 Ga0451837_1281237 Ga0451837_1281237_371_763 130
747 3300041494 Ga0451837_1624919 Ga0451837_1624919_195_587 130
748 3300041498 Ga0451841_1096970 Ga0451841_1096970_139_531 130
749 3300041509 Ga0451843_0419583 Ga0451843_0419583_157_549 130
750 3300041512 Ga0451853_1217462 Ga0451853_1217462_244_636 130
751 3300041512 Ga0451853_1342895 Ga0451853_1342895_28_420 130
752 3300041997 Ga0439431_0116185 Ga0439431_0116185_44_436 130
753 3300041999 Ga0439433_0034999 Ga0439433_0034999_332_751 130
754 3300042001 Ga0439441_007617 Ga0439441_007617_1088_1480 130
755 3300042003 Ga0439443_043477 Ga0439443_043477_197_589 130
756 3300042003 Ga0439443_069840 Ga0439443_069840_19_438 130
757 3300042004 Ga0439445_0033058 Ga0439445_0033058_160_552 130
758 3300042004 Ga0439445_0037160 Ga0439445_0037160_266_658 130
759 3300042006 Ga0439432_052284 Ga0439432_052284_718_1110 130
760 3300042006 Ga0439432_164323 Ga0439432_164323_206_598 130
761 3300042007 Ga0439449_0071350 Ga0439449_0071350_13_405 130
762 3300042010 Ga0439452_044390 Ga0439452_044390_298_717 130
763 3300042127 Ga0450890_029163 Ga0450890_029163_355_747 130
764 3300042128 Ga0450897_047122 Ga0450897_047122_45_437 130
765 3300042435 Ga0439434_0037933 Ga0439434_0037933_722_1114 130
766 3300042435 Ga0439434_0094189 Ga0439434_0094189_436_828 130
767 3300042436 Ga0439435_0238884 Ga0439435_0238884_57_449 130
768 3300042438 Ga0439459_0204423 Ga0439459_0204423_115_507 130
769 3300042876 Ga0451577_0442387 Ga0451577_0442387_512_913 130
770 3300044673 Ga0453683_0050267 Ga0453683_0050267_71_466 130
771 3300044683 Ga0466965_0062359 Ga0466965_0062359_802_1194 130
772 3300044694 Ga0466963_0294172 Ga0466963_0294172_688_1083 130
773 3300044694 Ga0466963_0585595 Ga0466963_0585595_28_420 130
774 3300044706 Ga0466964_0629683 Ga0466964_0629683_69_464 130
775 3300044712 Ga0453684_0000204 Ga0453684_0000204_12197_12598 130
776 3300044712 Ga0453684_0001066 Ga0453684_0001066_12119_12520 130
777 3300044719 Ga0466971_0653608 Ga0466971_0653608_85_477 130
778 3300044842 Ga0466957_0021853 Ga0466957_0021853_3186_3581 130
779 3300044842 Ga0466957_0768282 Ga0466957_0768282_103_495 130
780 3300045049 Ga0466959_0599077 Ga0466959_0599077_142_537 130
781 3300045051 Ga0451576_0029379 Ga0451576_0029379_885_1280 130
782 3300045051 Ga0451576_0059829 Ga0451576_0059829_2614_3009 130
783 3300045836 Ga0466958_0000676 Ga0466958_0000676_6786_7181 130
784 3300045836 Ga0466958_0821197 Ga0466958_0821197_41_448 130
785 3300045976 Ga0466967_0242158 Ga0466967_0242158_124_519 130
786 3300045976 Ga0466967_0515250 Ga0466967_0515250_513_908 130
787 3300045976 Ga0466967_0547034 Ga0466967_0547034_313_705 130
788 3300045976 Ga0466967_0973100 Ga0466967_0973100_403_795 130
789 3300045976 Ga0466967_2250869 Ga0466967_2250869_21_413 130
790 3300046500 Ga0495596_0250676 Ga0495596_0250676_141_533 130
791 3300046615 Ga0495656_0371829 Ga0495656_0371829_119_514 130
792 3300046616 Ga0495668_0545614 Ga0495668_0545614_197_589 130
793 3300047472 Ga0495686_0047436 Ga0495686_0047436_589_981 130
794 3300048905 Ga0496102_0668275 Ga0496102_0668275_65_457 130
795 3300048909 Ga0496106_0491162 Ga0496106_0491162_447_839 130
796 3300048913 Ga0496110_0542264 Ga0496110_0542264_567_959 130
797 3300048914 Ga0496111_0364438 Ga0496111_0364438_317_709 130
798 3300048915 Ga0496112_0518153 Ga0496112_0518153_77_496 130
799 3300048921 Ga0496118_0121464 Ga0496118_0121464_188_580 130
800 3300048924 Ga0496121_0111944 Ga0496121_0111944_547_939 130
801 3300048924 Ga0496121_0533132 Ga0496121_0533132_26_418 130
802 3300048927 Ga0496124_0030584 Ga0496124_0030584_1185_1577 130
803 3300048927 Ga0496124_0211277 Ga0496124_0211277_877_1269 130
804 3300048927 Ga0496124_0297344 Ga0496124_0297344_657_1049 130
805 3300048928 Ga0496125_0000815 Ga0496125_0000815_25948_26340 130
806 3300048928 Ga0496125_0254919 Ga0496125_0254919_538_930 130
807 3300048929 Ga0496126_0119659 Ga0496126_0119659_28_420 130
808 3300048929 Ga0496126_0206650 Ga0496126_0206650_604_996 130
809 3300048929 Ga0496126_0271543 Ga0496126_0271543_609_1001 130
810 3300049127 Ga0501306_004657 Ga0501306_004657_196_588 130
811 3300049127 Ga0501306_040025 Ga0501306_040025_147_539 130
812 3300049161 Ga0501305_002063 Ga0501305_002063_138_530 130
813 3300049161 Ga0501305_016841 Ga0501305_016841_163_555 130
814 3300049162 Ga0501307_005955 Ga0501307_005955_365_757 130
815 3300049528 Ga0501312_078181 Ga0501312_078181_142_534 130
816 3300049529 Ga0501313_018950 Ga0501313_018950_75_467 130
817 3300049530 Ga0501314_010050 Ga0501314_010050_403_795 130
818 3300049531 Ga0501315_058471 Ga0501315_058471_145_537 130
819 3300049532 Ga0501316_024206 Ga0501316_024206_36_428 130
820 3300049533 Ga0501317_023840 Ga0501317_023840_295_687 130
821 3300049536 Ga0501320_009962 Ga0501320_009962_480_872 130
822 3300049537 Ga0501321_022779 Ga0501321_022779_104_496 130
823 3300049539 Ga0501323_002663 Ga0501323_002663_1265_1657 130
824 3300049568 Ga0501031_0046811 Ga0501031_0046811_1522_1914 130
825 3300049568 Ga0501031_0628297 Ga0501031_0628297_218_610 130
826 3300049569 Ga0501032_0062255 Ga0501032_0062255_1893_2285 130
827 3300049569 Ga0501032_0156892 Ga0501032_0156892_1040_1432 130
828 3300049569 Ga0501032_0258239 Ga0501032_0258239_31_423 130
829 3300049569 Ga0501032_0296046 Ga0501032_0296046_87_479 130
830 3300049570 Ga0501033_0020210 Ga0501033_0020210_2977_3369 130
831 3300049570 Ga0501033_0089600 Ga0501033_0089600_592_984 130
832 3300049570 Ga0501033_0094339 Ga0501033_0094339_760_1152 130
833 3300049570 Ga0501033_1067626 Ga0501033_1067626_31_423 130
834 3300049571 Ga0501034_0009019 Ga0501034_0009019_9947_10339 130
835 3300049571 Ga0501034_0063216 Ga0501034_0063216_317_709 130
836 3300049571 Ga0501034_0085750 Ga0501034_0085750_764_1156 130
837 3300049571 Ga0501034_0105047 Ga0501034_0105047_1514_1906 130
838 3300049571 Ga0501034_0158436 Ga0501034_0158436_1821_2213 130
839 3300049571 Ga0501034_0311870 Ga0501034_0311870_251_643 130
840 3300049571 Ga0501034_0328774 Ga0501034_0328774_130_522 130
841 3300049571 Ga0501034_0442975 Ga0501034_0442975_190_582 130
842 3300049571 Ga0501034_0559110 Ga0501034_0559110_199_591 130
843 3300049571 Ga0501034_0632220 Ga0501034_0632220_329_721 130
844 3300049572 Ga0501036_0035510 Ga0501036_0035510_3623_4015 130
845 3300049572 Ga0501036_0087494 Ga0501036_0087494_1063_1455 130
846 3300049572 Ga0501036_0138141 Ga0501036_0138141_1548_1940 130
847 3300049572 Ga0501036_0237253 Ga0501036_0237253_43_435 130
848 3300049572 Ga0501036_0411357 Ga0501036_0411357_604_996 130
849 3300049572 Ga0501036_0411687 Ga0501036_0411687_664_1056 130
850 3300049572 Ga0501036_0996251 Ga0501036_0996251_115_507 130
851 3300049572 Ga0501036_1058290 Ga0501036_1058290_191_583 130
852 3300049573 Ga0501037_0017735 Ga0501037_0017735_1521_1913 130
853 3300049573 Ga0501037_0021388 Ga0501037_0021388_1507_1899 130
854 3300049573 Ga0501037_0168587 Ga0501037_0168587_390_782 130
855 3300049573 Ga0501037_0195584 Ga0501037_0195584_43_435 130
856 3300049573 Ga0501037_0206675 Ga0501037_0206675_562_954 130
857 3300049573 Ga0501037_0519538 Ga0501037_0519538_248_640 130
858 3300049574 Ga0501038_0042562 Ga0501038_0042562_1695_2087 130
859 3300049574 Ga0501038_0180198 Ga0501038_0180198_104_496 130
860 3300049574 Ga0501038_0536937 Ga0501038_0536937_322_714 130
861 3300049574 Ga0501038_0906948 Ga0501038_0906948_193_585 130
862 3300049575 Ga0501039_0002113 Ga0501039_0002113_4002_4394 130
863 3300049575 Ga0501039_0049376 Ga0501039_0049376_1624_2016 130
864 3300049575 Ga0501039_0308727 Ga0501039_0308727_416_808 130
865 3300049575 Ga0501039_1047509 Ga0501039_1047509_74_466 130
866 3300049576 Ga0501040_0017061 Ga0501040_0017061_3661_4053 130
867 3300049577 Ga0501041_0017640 Ga0501041_0017640_2011_2403 130
868 3300049578 Ga0501042_0008704 Ga0501042_0008704_926_1318 130
869 3300049578 Ga0501042_0228234 Ga0501042_0228234_441_833 130
870 3300049578 Ga0501042_0260029 Ga0501042_0260029_589_1005 130
871 3300049578 Ga0501042_0288533 Ga0501042_0288533_322_714 130
872 3300049579 Ga0501043_0041509 Ga0501043_0041509_1588_1980 130
873 3300049579 Ga0501043_0102115 Ga0501043_0102115_730_1122 130
874 3300049579 Ga0501043_0147855 Ga0501043_0147855_224_616 130
875 3300049579 Ga0501043_0346802 Ga0501043_0346802_402_794 130
876 3300049579 Ga0501043_0395431 Ga0501043_0395431_464_856 130
877 3300049579 Ga0501043_0484803 Ga0501043_0484803_350_742 130
878 3300049580 Ga0501046_0014121 Ga0501046_0014121_3198_3590 130
879 3300049580 Ga0501046_0084362 Ga0501046_0084362_1340_1732 130
880 3300049580 Ga0501046_0342154 Ga0501046_0342154_520_912 130
881 3300049580 Ga0501046_0430184 Ga0501046_0430184_435_827 130
882 3300049580 Ga0501046_0633474 Ga0501046_0633474_83_475 130
883 3300049581 Ga0501047_0023666 Ga0501047_0023666_2015_2407 130
884 3300049581 Ga0501047_0072862 Ga0501047_0072862_1015_1407 130
885 3300049581 Ga0501047_0272848 Ga0501047_0272848_875_1267 130
886 3300049581 Ga0501047_0327459 Ga0501047_0327459_61_477 130
887 3300049581 Ga0501047_0373505 Ga0501047_0373505_483_875 130
888 3300049581 Ga0501047_1010840 Ga0501047_1010840_123_518 130
889 3300049581 Ga0501047_1052878 Ga0501047_1052878_101_493 130
890 3300049582 Ga0501048_0010039 Ga0501048_0010039_1243_1635 130
891 3300049582 Ga0501048_0198057 Ga0501048_0198057_828_1220 130
892 3300049583 Ga0501067_0158465 Ga0501067_0158465_52_444 130
893 3300049584 Ga0501068_0094949 Ga0501068_0094949_997_1389 130
894 3300049585 Ga0501069_0612400 Ga0501069_0612400_112_504 130
895 3300049585 Ga0501069_0631134 Ga0501069_0631134_222_614 130
896 3300049586 Ga0501070_0048130 Ga0501070_0048130_1735_2127 130
897 3300049586 Ga0501070_0057104 Ga0501070_0057104_1264_1656 130
898 3300049586 Ga0501070_0548828 Ga0501070_0548828_235_627 130
899 3300049586 Ga0501070_0809480 Ga0501070_0809480_212_604 130
900 3300049586 Ga0501070_0996187 Ga0501070_0996187_169_561 130
901 3300049587 Ga0501071_0050852 Ga0501071_0050852_1399_1791 130
902 3300049587 Ga0501071_0382330 Ga0501071_0382330_488_880 130
903 3300049588 Ga0501072_0001884 Ga0501072_0001884_5785_6177 130
904 3300049588 Ga0501072_0263164 Ga0501072_0263164_611_1003 130
905 3300049588 Ga0501072_0321875 Ga0501072_0321875_632_1024 130
906 3300049588 Ga0501072_0345687 Ga0501072_0345687_770_1162 130
907 3300049588 Ga0501072_0503985 Ga0501072_0503985_94_486 130
908 3300049588 Ga0501072_1018620 Ga0501072_1018620_177_569 130
909 3300049588 Ga0501072_1138625 Ga0501072_1138625_38_430 130
910 3300049589 Ga0501073_0039915 Ga0501073_0039915_1712_2104 130
911 3300049589 Ga0501073_0617429 Ga0501073_0617429_249_653 130
912 3300049590 Ga0501074_0189365 Ga0501074_0189365_429_833 130
913 3300049590 Ga0501074_0219718 Ga0501074_0219718_60_452 130
914 3300049590 Ga0501074_0405920 Ga0501074_0405920_412_804 130
915 3300049590 Ga0501074_0576756 Ga0501074_0576756_375_767 130
916 3300049590 Ga0501074_0666831 Ga0501074_0666831_157_549 130
917 3300049591 Ga0501075_0015718 Ga0501075_0015718_2493_2885 130
918 3300049592 Ga0501076_0018242 Ga0501076_0018242_2534_2926 130
919 3300049592 Ga0501076_0142095 Ga0501076_0142095_649_1068 130
920 3300049592 Ga0501076_0224846 Ga0501076_0224846_40_432 130
921 3300049592 Ga0501076_0942531 Ga0501076_0942531_307_699 130
922 3300049593 Ga0501077_0116244 Ga0501077_0116244_14_406 130
923 3300049705 Ga0501225_0013278 Ga0501225_0013278_197_589 130
924 3300049708 Ga0501245_081165 Ga0501245_081165_214_606 130
925 3300049741 Ga0501079_0099277 Ga0501079_0099277_1851_2243 130
926 3300049741 Ga0501079_0555316 Ga0501079_0555316_380_772 130
927 3300049741 Ga0501079_0666962 Ga0501079_0666962_193_585 130
928 3300049742 Ga0501080_0040964 Ga0501080_0040964_2662_3054 130
929 3300049742 Ga0501080_0043942 Ga0501080_0043942_2480_2872 130
930 3300049742 Ga0501080_0267426 Ga0501080_0267426_1038_1430 130
931 3300049742 Ga0501080_0379970 Ga0501080_0379970_92_514 130
932 3300049742 Ga0501080_0390530 Ga0501080_0390530_403_822 130
933 3300049742 Ga0501080_0461476 Ga0501080_0461476_336_728 130
934 3300049742 Ga0501080_0506927 Ga0501080_0506927_540_944 130
935 3300049742 Ga0501080_1724065 Ga0501080_1724065_78_470 130
936 3300049743 Ga0501081_0115551 Ga0501081_0115551_1034_1426 130
937 3300049743 Ga0501081_0305799 Ga0501081_0305799_281_673 130
938 3300049743 Ga0501081_0390799 Ga0501081_0390799_556_948 130
939 3300049744 Ga0501083_0076712 Ga0501083_0076712_1263_1655 130
940 3300049763 Ga0501266_092015 Ga0501266_092015_38_430 130
941 3300049822 Ga0501035_0004418 Ga0501035_0004418_4705_5097 130
942 3300049822 Ga0501035_0106313 Ga0501035_0106313_1750_2142 130
943 3300049822 Ga0501035_0206294 Ga0501035_0206294_771_1163 130
944 3300049823 Ga0501044_0151055 Ga0501044_0151055_1569_1961 130
945 3300049823 Ga0501044_0309268 Ga0501044_0309268_324_716 130
946 3300049823 Ga0501044_0315133 Ga0501044_0315133_709_1101 130
947 3300049823 Ga0501044_0389944 Ga0501044_0389944_878_1270 130
948 3300049823 Ga0501044_0548368 Ga0501044_0548368_110_502 130
949 3300049823 Ga0501044_0556863 Ga0501044_0556863_455_847 130
950 3300049823 Ga0501044_0753926 Ga0501044_0753926_183_575 130
951 3300049823 Ga0501044_0997315 Ga0501044_0997315_153_545 130
952 3300049823 Ga0501044_1459637 Ga0501044_1459637_39_431 130
953 3300049824 Ga0501045_0054331 Ga0501045_0054331_1271_1663 130
954 3300049824 Ga0501045_0736522 Ga0501045_0736522_20_412 130
955 3300049824 Ga0501045_1249794 Ga0501045_1249794_129_521 130
956 3300050489 nmdc:mga03683_15426_c1 nmdc:mga03683_15426_c1_513_905 130
957 3300050489 nmdc:mga03683_33662_c1 nmdc:mga03683_33662_c1_476_868 130
958 3300050490 nmdc:mga03n38_27914_c1 nmdc:mga03n38_27914_c1_352_744 130
959 3300050490 nmdc:mga03n38_471881_c1 nmdc:mga03n38_471881_c1_142_534 130
960 3300050490 nmdc:mga03n38_7293_c1 nmdc:mga03n38_7293_c1_1481_1873 130
961 3300050491 nmdc:mga00v17_126638_c1 nmdc:mga00v17_126638_c1_256_648 130
962 3300050491 nmdc:mga00v17_170368_c1 nmdc:mga00v17_170368_c1_759_1178 130
963 3300050491 nmdc:mga00v17_59684_c1 nmdc:mga00v17_59684_c1_1261_1653 130
964 3300050492 nmdc:mga0yw44_523446_c1 nmdc:mga0yw44_523446_c1_334_726 130
965 3300050493 nmdc:mga0k408_235620_c1 nmdc:mga0k408_235620_c1_440_832 130
966 3300050493 nmdc:mga0k408_24799_c1 nmdc:mga0k408_24799_c1_1904_2296 130
967 3300050493 nmdc:mga0k408_63879_c1 nmdc:mga0k408_63879_c1_322_741 130
968 3300050494 nmdc:mga06z11_15472_c1 nmdc:mga06z11_15472_c1_706_1098 130
969 3300050494 nmdc:mga06z11_593224_c1 nmdc:mga06z11_593224_c1_252_644 130
970 3300050494 nmdc:mga06z11_77218_c1 nmdc:mga06z11_77218_c1_823_1242 130
971 3300050494 nmdc:mga06z11_777235_c1 nmdc:mga06z11_777235_c1_170_562 130
972 3300050496 nmdc:mga07m45_277624_c1 nmdc:mga07m45_277624_c1_371_790 130
973 3300050496 nmdc:mga07m45_87006_c1 nmdc:mga07m45_87006_c1_467_859 130
974 3300050508 nmdc:mga09592_150655_c1 nmdc:mga09592_150655_c1_547_966 130
975 3300050509 nmdc:mga0qj67_138207_c1 nmdc:mga0qj67_138207_c1_1046_1438 130
976 3300050510 nmdc:mga06r32_1500966_c1 nmdc:mga06r32_1500966_c1_63_455 130
977 3300050511 nmdc:mga08y16_225804_c1 nmdc:mga08y16_225804_c1_317_736 130
978 3300050515 nmdc:mga0a205_400896_c1 nmdc:mga0a205_400896_c1_44_463 130
979 3300053108 Ga0500562_045367 Ga0500562_045367_208_600 130
980 3300053116 Ga0500592_073790 Ga0500592_073790_37_429 130
981 3300053119 Ga0500595_035050 Ga0500595_035050_1008_1400 130
982 3300053120 Ga0500597_424565 Ga0500597_424565_22_414 130
983 3300053125 Ga0500618_099914 Ga0500618_099914_233_643 130
984 3300053134 Ga0500658_0152050 Ga0500658_0152050_432_827 130
985 3300053136 Ga0500559_0351656 Ga0500559_0351656_149_541 130
986 3300053146 Ga0500588_0026749 Ga0500588_0026749_57_452 130
987 3300053151 Ga0500604_0000294 Ga0500604_0000294_11207_11599 130
988 3300053153 Ga0500616_0036565 Ga0500616_0036565_1797_2189 130
989 3300053157 Ga0500624_002765 Ga0500624_002765_1557_1949 130
990 3300053158 Ga0500627_0230262 Ga0500627_0230262_19_411 130
991 3300053161 Ga0500634_0000031 Ga0500634_0000031_14992_15384 130
992 3300053731 Ga0500609_017819 Ga0500609_017819_295_690 130
993 3300054114 Ga0501084_0412365 Ga0501084_0412365_267_659 130
994 3300054114 Ga0501084_1333973 Ga0501084_1333973_165_566 130
995 3300059477 Ga0587084_003875 Ga0587084_003875_288_680 130
996 3300059477 Ga0587084_050266 Ga0587084_050266_157_549 130
997 3300059477 Ga0587084_055003 Ga0587084_055003_231_623 130
998 3300059477 Ga0587084_083566 Ga0587084_083566_173_568 130
999 3300059477 Ga0587084_089472 Ga0587084_089472_67_459 130
1000 3300059478 Ga0587093_010726 Ga0587093_010726_511_903 130
1001 3300059491 Ga0587070_051636 Ga0587070_051636_168_560 130
1002 3300059493 Ga0587077_001444 Ga0587077_001444_1292_1684 130
1003 3300059493 Ga0587077_001858 Ga0587077_001858_1292_1684 130
1004 3300059493 Ga0587077_002494 Ga0587077_002494_599_991 130
1005 3300059493 Ga0587077_023368 Ga0587077_023368_370_762 130
1006 3300059493 Ga0587077_034979 Ga0587077_034979_420_812 130
1007 3300059503 Ga0587080_006331 Ga0587080_006331_124_516 130
1008 3300059504 Ga0587082_001421 Ga0587082_001421_708_1100 130
1009 3300059504 Ga0587082_015733 Ga0587082_015733_689_1081 130
1010 3300059504 Ga0587082_071053 Ga0587082_071053_164_556 130
1011 3300059504 Ga0587082_105589 Ga0587082_105589_129_521 130
1012 3300059505 Ga0587083_0082405 Ga0587083_0082405_273_668 130
1013 3300059506 Ga0587085_057305 Ga0587085_057305_234_626 130
1014 3300059506 Ga0587085_096769 Ga0587085_096769_73_465 130
1015 3300059507 Ga0587086_009659 Ga0587086_009659_118_510 130
1016 3300059508 Ga0587088_007703 Ga0587088_007703_151_543 130
1017 3300059508 Ga0587088_011507 Ga0587088_011507_387_779 130
1018 3300059508 Ga0587088_013341 Ga0587088_013341_715_1107 130
1019 3300059508 Ga0587088_066307 Ga0587088_066307_203_595 130
1020 3300059508 Ga0587088_093330 Ga0587088_093330_126_518 130
1021 3300059509 Ga0587089_012097 Ga0587089_012097_627_1019 130
1022 3300059510 Ga0587090_007514 Ga0587090_007514_250_642 130
1023 3300059510 Ga0587090_037431 Ga0587090_037431_137_529 130
1024 3300059510 Ga0587090_047818 Ga0587090_047818_302_694 130
1025 3300059511 Ga0587091_037281 Ga0587091_037281_129_521 130
1026 3300059511 Ga0587091_077869 Ga0587091_077869_145_537 130
1027 3300059512 Ga0587092_045558 Ga0587092_045558_138_530 130
1028 3300059513 Ga0587094_016519 Ga0587094_016519_483_875 130
1029 3300059514 Ga0587095_016766 Ga0587095_016766_131_523 130
1030 3300059605 Ga0587106_037582 Ga0587106_037582_306_698 130
1031 3300059607 Ga0587125_004018 Ga0587125_004018_831_1223 130
1032 3300059607 Ga0587125_004288 Ga0587125_004288_741_1133 130
1033 3300059607 Ga0587125_014823 Ga0587125_014823_150_542 130
1034 3300059623 Ga0587101_000419 Ga0587101_000419_1663_2055 130
1035 3300059623 Ga0587101_005367 Ga0587101_005367_76_468 130
1036 3300059623 Ga0587101_052671 Ga0587101_052671_161_553 130
1037 3300059624 Ga0587109_008800 Ga0587109_008800_126_518 130
1038 3300059625 Ga0587113_007243 Ga0587113_007243_377_769 130
1039 3300059626 Ga0587115_002202 Ga0587115_002202_101_493 130
1040 3300059630 Ga0587128_022544 Ga0587128_022544_355_747 130
1041 3300059630 Ga0587128_072627 Ga0587128_072627_186_578 130
1042 3300059639 Ga0587062_000396 Ga0587062_000396_971_1363 130
1043 3300059639 Ga0587062_035592 Ga0587062_035592_118_516 130
1044 3300059639 Ga0587062_059166 Ga0587062_059166_124_516 130
1045 3300059639 Ga0587062_069540 Ga0587062_069540_145_537 130
1046 3300059641 Ga0587068_064862 Ga0587068_064862_167_559 130
1047 3300059641 Ga0587068_065733 Ga0587068_065733_149_541 130
1048 3300059641 Ga0587068_072764 Ga0587068_072764_140_532 130
1049 3300059641 Ga0587068_140533 Ga0587068_140533_126_518 130
1050 3300059642 Ga0587069_088448 Ga0587069_088448_150_542 130
1051 3300059643 Ga0587072_001969 Ga0587072_001969_1579_1971 130
1052 3300059643 Ga0587072_119616 Ga0587072_119616_148_540 130
1053 3300059644 Ga0587075_035777 Ga0587075_035777_165_557 130
1054 3300059644 Ga0587075_053092 Ga0587075_053092_64_456 130
1055 3300059644 Ga0587075_071844 Ga0587075_071844_103_495 130
1056 3300059645 Ga0587076_001599 Ga0587076_001599_861_1253 130
1057 3300059645 Ga0587076_122057 Ga0587076_122057_62_454 130
1058 3300059645 Ga0587076_132225 Ga0587076_132225_44_436 130
1059 3300059646 Ga0587078_009790 Ga0587078_009790_152_544 130
1060 3300059646 Ga0587078_028130 Ga0587078_028130_59_451 130
1061 3300059647 Ga0587079_027627 Ga0587079_027627_524_916 130
1062 3300059647 Ga0587079_121447 Ga0587079_121447_152_544 130
1063 3300059647 Ga0587079_190566 Ga0587079_190566_71_463 130
1064 3300059648 Ga0587100_007768 Ga0587100_007768_84_476 130
1065 3300059648 Ga0587100_042521 Ga0587100_042521_88_480 130
1066 3300059649 Ga0587102_009709 Ga0587102_009709_427_819 130
1067 3300059650 Ga0587104_006947 Ga0587104_006947_71_463 130
1068 3300059651 Ga0587105_021399 Ga0587105_021399_37_429 130
1069 3300059652 Ga0587107_001723 Ga0587107_001723_784_1176 130
1070 3300059652 Ga0587107_003424 Ga0587107_003424_64_456 130
1071 3300059652 Ga0587107_011495 Ga0587107_011495_347_739 130
1072 3300059652 Ga0587107_079609 Ga0587107_079609_81_473 130
1073 3300059652 Ga0587107_088702 Ga0587107_088702_155_547 130
1074 3300059653 Ga0587108_002343 Ga0587108_002343_319_711 130
1075 3300059653 Ga0587108_032191 Ga0587108_032191_84_476 130
1076 3300059654 Ga0587110_001125 Ga0587110_001125_1391_1783 130
1077 3300059654 Ga0587110_046651 Ga0587110_046651_105_497 130
1078 3300059655 Ga0587114_052798 Ga0587114_052798_218_610 130
1079 3300059658 Ga0587119_044866 Ga0587119_044866_110_502 130
1080 3300059660 Ga0587124_004270 Ga0587124_004270_610_1002 130
1081 3300059660 Ga0587124_027474 Ga0587124_027474_126_518 130
1082 3300060344 Ga0587071_074262 Ga0587071_074262_321_713 130
1083 3300060346 Ga0587111_0000931 Ga0587111_0000931_1614_2006 130
1084 3300060346 Ga0587111_0032299 Ga0587111_0032299_141_533 130
1085 3300060346 Ga0587111_0098969 Ga0587111_0098969_182_574 130
1086 3300060346 Ga0587111_0151807 Ga0587111_0151807_135_527 130
1087 3300060353 Ga0501082_0090464 Ga0501082_0090464_1349_1741 130
1088 3300060353 Ga0501082_0629535 Ga0501082_0629535_81_473 130
1089 3300060353 Ga0501082_1531683 Ga0501082_1531683_18_410 130
1090 3300061719 Ga0466962_0189993 Ga0466962_0189993_66_458 130
1091 3300061719 Ga0466962_0490064 Ga0466962_0490064_164_559 130
1092 3300061734 Ga0530510_0020928 Ga0530510_0020928_1261_1653 130
1093 3300061734 Ga0530510_0118649 Ga0530510_0118649_1440_1832 130
1094 3300061734 Ga0530510_0211241 Ga0530510_0211241_418_810 130
1095 3300061734 Ga0530510_0665620 Ga0530510_0665620_221_613 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00411

Ribosomal_S11

Ribosomal protein S11

39

148

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9486 16 115
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9409 17 108
8cdv-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state ii) 0.9312 17 108
8cee-assembly1.cif.gz_V rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9306 16 115
4v48-assembly1.cif.gz_BK real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9291 15 114
ID Description Score Start End Superfamily
af_K7VRG2_61_286_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9035 18 47 3.60.21.10
af_P55138_1_114_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8814 19 47 3.30.420.40
4qs2K00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.876 15 130 3.30.420.80
af_P0C464_21_142_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8648 9 129 3.30.420.80
af_Q9VEN6_71_200_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8539 16 130 3.30.420.80
ID Description Score Start End GO Terms
AF-A0A2E0GRJ6-F1-model_v4 30S ribosomal protein S11 0.947 7 117 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2E0GRJ6-F1-model_v4 30S ribosomal protein S11 0.9388 7 117 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D0RPL5-F1-model_v4 30S ribosomal protein S11 0.9371 22 109 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0G1UXB4-F1-model_v4 Small ribosomal subunit protein uS11 0.9332 18 101 GO:0003735
GO:0005840
GO:0006412
GO:0008168
GO:0019843
GO:0032259
GO:1990904
AF-A0A3D4MDQ3-F1-model_v4 Small ribosomal subunit protein uS11 (30S ribosomal protein S11) 0.921 15 130 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
81.19 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map