F489953
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1095 | 481 | 1079 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10555050|Ga0105248_105550501 |
| Length | 149 |
| Sequence | VELPEHFAYGGADIEQRNSMAKTETTRVRRKERKNITSGVAHVNASFNNTMITITDVQGNTISWSSSGVMGFKGSRKSTPYAAQVAAEDAAKKAQEHGMKTLEVEVRGPGSGRESALRALQAAGFNVTSIRDVTSIPHNGCRPRKRRRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 2 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 3 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 4 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 5 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 6 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 7 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 8 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 9 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 10 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 11 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 12 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 13 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 14 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 15 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 102 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 122 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 133 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 215 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 219 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 220 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 240 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 252 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 259 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 267 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 268 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 269 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 270 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 271 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 272 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 273 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 274 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 279 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 280 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 281 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 282 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 283 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 285 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 286 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 292 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 293 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 294 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 295 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 296 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 297 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 298 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 299 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 300 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 301 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 302 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 303 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 304 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 305 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 306 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 307 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 308 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 309 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 310 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 311 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 312 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 313 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 314 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 315 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 316 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 317 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 318 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 319 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 320 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 321 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 322 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 323 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 324 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 342 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 343 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 344 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 345 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 346 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 347 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 348 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 389 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 412 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 413 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 414 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 415 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 416 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 417 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 421 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 423 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 425 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 426 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 427 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 428 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 430 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 432 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 480 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 481 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.47 |
| Metatranscriptomes | 15.07 |
| Isolates | 1.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.31 |
| Nodule | 0.09 |
| Rhizoplane | 1.92 |
| Rhizosphere | 83.93 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10036215 | 3300001979 | Bacteria | 1535 |
| 2 | JGI24745J21846_1003022 | 3300002073 | Bacteria | 1742 |
| 3 | JGI25165J46597_1000961 | 3300003214 | Bacteria | 19619 |
| 4 | Ga0055536_1016175 | 3300003781 | Bacteria | 2508 |
| 5 | Ga0058862_10049717 | 3300004803 | Bacteria | 698 |
| 6 | Ga0058862_12821384 | 3300004803 | Bacteria | 961 |
| 7 | Ga0070658_10034257 | 3300005327 | Bacteria | 4086 |
| 8 | Ga0070658_10236536 | 3300005327 | Bacteria | 1548 |
| 9 | Ga0070658_10483582 | 3300005327 | Bacteria | 1068 |
| 10 | Ga0070658_10774137 | 3300005327 | Bacteria | 833 |
| 11 | Ga0070676_10322091 | 3300005328 | Bacteria | 1054 |
| 12 | Ga0070683_100081257 | 3300005329 | Bacteria | 3034 |
| 13 | Ga0070683_100931522 | 3300005329 | Bacteria | 834 |
| 14 | Ga0070666_10543561 | 3300005335 | Bacteria | 845 |
| 15 | Ga0070680_100825801 | 3300005336 | Bacteria | 799 |
| 16 | Ga0070682_100178640 | 3300005337 | Bacteria | 1481 |
| 17 | Ga0068868_100125269 | 3300005338 | Bacteria | 2098 |
| 18 | Ga0070660_100004846 | 3300005339 | Bacteria | 9293 |
| 19 | Ga0070660_100070020 | 3300005339 | Bacteria | 2737 |
| 20 | Ga0070660_100158975 | 3300005339 | Bacteria | 1820 |
| 21 | Ga0070660_100173896 | 3300005339 | Bacteria | 1740 |
| 22 | Ga0070660_101397473 | 3300005339 | Bacteria | 595 |
| 23 | Ga0070689_100196042 | 3300005340 | Bacteria | 1647 |
| 24 | Ga0070691_10560979 | 3300005341 | Bacteria | 669 |
| 25 | Ga0070687_100352816 | 3300005343 | Bacteria | 950 |
| 26 | Ga0070661_100001887 | 3300005344 | Bacteria | 14515 |
| 27 | Ga0070661_100381304 | 3300005344 | Bacteria | 1111 |
| 28 | Ga0070661_100971558 | 3300005344 | Bacteria | 703 |
| 29 | Ga0070668_100092896 | 3300005347 | Bacteria | 2381 |
| 30 | Ga0070668_100341616 | 3300005347 | Bacteria | 1265 |
| 31 | Ga0070668_101254259 | 3300005347 | Bacteria | 673 |
| 32 | Ga0070675_100065182 | 3300005354 | Bacteria | 3011 |
| 33 | Ga0070674_100013740 | 3300005356 | Bacteria | 5011 |
| 34 | Ga0070673_100089902 | 3300005364 | Bacteria | 2508 |
| 35 | Ga0070673_100695057 | 3300005364 | Bacteria | 934 |
| 36 | Ga0070673_101731876 | 3300005364 | Bacteria | 592 |
| 37 | Ga0070659_100017338 | 3300005366 | Bacteria | 5417 |
| 38 | Ga0070659_100133943 | 3300005366 | Bacteria | 2014 |
| 39 | Ga0070667_101559602 | 3300005367 | Bacteria | 621 |
| 40 | Ga0070713_100178759 | 3300005436 | Bacteria | 1905 |
| 41 | Ga0070711_100426424 | 3300005439 | Bacteria | 1082 |
| 42 | Ga0070708_100278752 | 3300005445 | Bacteria | 1573 |
| 43 | Ga0070663_100164203 | 3300005455 | Bacteria | 1711 |
| 44 | Ga0070663_100223410 | 3300005455 | Bacteria | 1479 |
| 45 | Ga0070663_101316873 | 3300005455 | Bacteria | 638 |
| 46 | Ga0070678_100090091 | 3300005456 | Bacteria | 2350 |
| 47 | Ga0070662_100298211 | 3300005457 | Bacteria | 1309 |
| 48 | Ga0070681_10001062 | 3300005458 | Bacteria | 23407 |
| 49 | Ga0070681_10009391 | 3300005458 | Bacteria | 9625 |
| 50 | Ga0070681_10197259 | 3300005458 | Bacteria | 1931 |
| 51 | Ga0070681_10197413 | 3300005458 | Bacteria | 1931 |
| 52 | Ga0070681_10487401 | 3300005458 | Bacteria | 1146 |
| 53 | Ga0068867_100332252 | 3300005459 | Bacteria | 1263 |
| 54 | Ga0070706_100100584 | 3300005467 | Bacteria | 2686 |
| 55 | Ga0070707_101039777 | 3300005468 | Bacteria | 785 |
| 56 | Ga0070698_100001015 | 3300005471 | Bacteria | 30868 |
| 57 | Ga0070698_100525376 | 3300005471 | Bacteria | 1122 |
| 58 | Ga0070699_100441013 | 3300005518 | Bacteria | 1180 |
| 59 | Ga0070679_100007538 | 3300005530 | Bacteria | 10174 |
| 60 | Ga0070679_100010304 | 3300005530 | Bacteria | 8860 |
| 61 | Ga0070679_100113062 | 3300005530 | Bacteria | 2701 |
| 62 | Ga0070679_100753323 | 3300005530 | Bacteria | 917 |
| 63 | Ga0070697_100081984 | 3300005536 | Bacteria | 2658 |
| 64 | Ga0068853_100000888 | 3300005539 | Bacteria | 20812 |
| 65 | Ga0068853_100007192 | 3300005539 | Bacteria | 8911 |
| 66 | Ga0068853_100018646 | 3300005539 | Bacteria | 5744 |
| 67 | Ga0068853_101001024 | 3300005539 | Bacteria | 804 |
| 68 | Ga0068853_101193400 | 3300005539 | Bacteria | 735 |
| 69 | Ga0070672_100347782 | 3300005543 | Bacteria | 1263 |
| 70 | Ga0070672_101170313 | 3300005543 | Bacteria | 684 |
| 71 | Ga0070693_100354020 | 3300005547 | Bacteria | 1006 |
| 72 | Ga0070665_100050199 | 3300005548 | Bacteria | 4186 |
| 73 | Ga0070665_100323781 | 3300005548 | Bacteria | 1546 |
| 74 | Ga0070665_100823091 | 3300005548 | Bacteria | 941 |
| 75 | Ga0070665_101598780 | 3300005548 | Bacteria | 660 |
| 76 | Ga0068855_100075649 | 3300005563 | Bacteria | 3909 |
| 77 | Ga0068855_100323488 | 3300005563 | Bacteria | 1704 |
| 78 | Ga0068855_100367187 | 3300005563 | Bacteria | 1583 |
| 79 | Ga0068855_100404497 | 3300005563 | Bacteria | 1495 |
| 80 | Ga0068855_100514510 | 3300005563 | Bacteria | 1299 |
| 81 | Ga0068855_100827425 | 3300005563 | Bacteria | 982 |
| 82 | Ga0068855_101969227 | 3300005563 | Bacteria | 591 |
| 83 | Ga0068855_102172949 | 3300005563 | Bacteria | 558 |
| 84 | Ga0070664_100028105 | 3300005564 | Bacteria | 4677 |
| 85 | Ga0070664_100688593 | 3300005564 | Bacteria | 952 |
| 86 | Ga0068857_100165278 | 3300005577 | Bacteria | 2009 |
| 87 | Ga0068857_100260674 | 3300005577 | Bacteria | 1591 |
| 88 | Ga0068857_100402067 | 3300005577 | Bacteria | 1274 |
| 89 | Ga0068857_100519616 | 3300005577 | Bacteria | 1119 |
| 90 | Ga0068857_100845518 | 3300005577 | Bacteria | 876 |
| 91 | Ga0068854_100157239 | 3300005578 | Bacteria | 1757 |
| 92 | Ga0068854_100159518 | 3300005578 | Bacteria | 1745 |
| 93 | Ga0068854_100362416 | 3300005578 | Bacteria | 1190 |
| 94 | Ga0068854_100561517 | 3300005578 | Bacteria | 970 |
| 95 | Ga0068854_100592850 | 3300005578 | Bacteria | 945 |
| 96 | Ga0068856_100009374 | 3300005614 | Bacteria | 9508 |
| 97 | Ga0068856_100028895 | 3300005614 | Bacteria | 5417 |
| 98 | Ga0068856_100059597 | 3300005614 | Bacteria | 3770 |
| 99 | Ga0068856_100193379 | 3300005614 | Bacteria | 2048 |
| 100 | Ga0068856_100370182 | 3300005614 | Bacteria | 1452 |
| 101 | Ga0068852_100031702 | 3300005616 | Bacteria | 4367 |
| 102 | Ga0068852_100323807 | 3300005616 | Bacteria | 1498 |
| 103 | Ga0068852_100324806 | 3300005616 | Bacteria | 1495 |
| 104 | Ga0068852_100757434 | 3300005616 | Bacteria | 983 |
| 105 | Ga0068859_100894715 | 3300005617 | Bacteria | 973 |
| 106 | Ga0068859_101482758 | 3300005617 | Bacteria | 749 |
| 107 | Ga0068864_100927981 | 3300005618 | Bacteria | 861 |
| 108 | Ga0068864_101511055 | 3300005618 | Bacteria | 675 |
| 109 | Ga0068861_100513425 | 3300005719 | Bacteria | 1085 |
| 110 | Ga0068851_10002106 | 3300005834 | Bacteria | 8757 |
| 111 | Ga0068851_10030591 | 3300005834 | Bacteria | 2670 |
| 112 | Ga0068858_101166860 | 3300005842 | Bacteria | 757 |
| 113 | Ga0068860_100307341 | 3300005843 | Bacteria | 1554 |
| 114 | Ga0068862_100218768 | 3300005844 | Bacteria | 1723 |
| 115 | Ga0081455_10000156 | 3300005937 | Bacteria | 82406 |
| 116 | Ga0081455_10019943 | 3300005937 | Bacteria | 6329 |
| 117 | Ga0081455_10043697 | 3300005937 | Bacteria | 3916 |
| 118 | Ga0081538_10003741 | 3300005981 | Bacteria | 14245 |
| 119 | Ga0081538_10005275 | 3300005981 | Bacteria | 11664 |
| 120 | Ga0081538_10105083 | 3300005981 | Bacteria | 1406 |
| 121 | Ga0081539_10006788 | 3300005985 | Bacteria | 10739 |
| 122 | Ga0075365_10268947 | 3300006038 | Bacteria | 1199 |
| 123 | Ga0075365_10394540 | 3300006038 | Bacteria | 976 |
| 124 | Ga0075365_10955654 | 3300006038 | Bacteria | 604 |
| 125 | Ga0075368_10033501 | 3300006042 | Bacteria | 1998 |
| 126 | Ga0075368_10224016 | 3300006042 | Bacteria | 799 |
| 127 | Ga0075368_10347243 | 3300006042 | Bacteria | 646 |
| 128 | Ga0075363_100016090 | 3300006048 | Bacteria | 3690 |
| 129 | Ga0075363_100682371 | 3300006048 | Bacteria | 619 |
| 130 | Ga0075364_10014487 | 3300006051 | Bacteria | 4873 |
| 131 | Ga0075364_10050081 | 3300006051 | Bacteria | 2726 |
| 132 | Ga0075364_10724124 | 3300006051 | Bacteria | 679 |
| 133 | Ga0075364_10907606 | 3300006051 | Bacteria | 600 |
| 134 | Ga0070716_101271575 | 3300006173 | Bacteria | 594 |
| 135 | Ga0070712_100304500 | 3300006175 | Bacteria | 1291 |
| 136 | Ga0075362_10010585 | 3300006177 | Bacteria | 3606 |
| 137 | Ga0075362_10140013 | 3300006177 | Bacteria | 1156 |
| 138 | Ga0075362_10307659 | 3300006177 | Bacteria | 787 |
| 139 | Ga0075362_10374474 | 3300006177 | Bacteria | 715 |
| 140 | Ga0075367_10338736 | 3300006178 | Bacteria | 949 |
| 141 | Ga0075367_11045896 | 3300006178 | Bacteria | 522 |
| 142 | Ga0075369_10167594 | 3300006186 | Bacteria | 1008 |
| 143 | Ga0075369_10493729 | 3300006186 | Bacteria | 581 |
| 144 | Ga0075366_10059905 | 3300006195 | Bacteria | 2261 |
| 145 | Ga0075366_10227727 | 3300006195 | Bacteria | 1136 |
| 146 | Ga0075366_10325152 | 3300006195 | Bacteria | 942 |
| 147 | Ga0097621_100590092 | 3300006237 | Bacteria | 1015 |
| 148 | Ga0097621_100872233 | 3300006237 | Bacteria | 837 |
| 149 | Ga0097621_101270847 | 3300006237 | Bacteria | 695 |
| 150 | Ga0075370_10032179 | 3300006353 | Bacteria | 2930 |
| 151 | Ga0075370_10147741 | 3300006353 | Bacteria | 1377 |
| 152 | Ga0075370_10170889 | 3300006353 | Bacteria | 1277 |
| 153 | Ga0075370_10226593 | 3300006353 | Bacteria | 1105 |
| 154 | Ga0068871_100902851 | 3300006358 | Bacteria | 819 |
| 155 | Ga0075430_100156687 | 3300006846 | Bacteria | 1896 |
| 156 | Ga0075433_10335429 | 3300006852 | Bacteria | 1337 |
| 157 | Ga0075433_10776333 | 3300006852 | Bacteria | 838 |
| 158 | Ga0075434_100811425 | 3300006871 | Bacteria | 952 |
| 159 | Ga0068865_100118650 | 3300006881 | Bacteria | 1963 |
| 160 | Ga0075436_100693895 | 3300006914 | Bacteria | 754 |
| 161 | Ga0075436_100881198 | 3300006914 | Bacteria | 669 |
| 162 | Ga0097620_100894723 | 3300006931 | Bacteria | 973 |
| 163 | Ga0097620_101482874 | 3300006931 | Bacteria | 749 |
| 164 | Ga0099795_10033771 | 3300007788 | Bacteria | 1779 |
| 165 | Ga0105240_10075852 | 3300009093 | Bacteria | 4146 |
| 166 | Ga0105240_10804272 | 3300009093 | Bacteria | 1018 |
| 167 | Ga0105240_10972505 | 3300009093 | Bacteria | 909 |
| 168 | Ga0105240_11245495 | 3300009093 | Bacteria | 786 |
| 169 | Ga0105240_12273581 | 3300009093 | Bacteria | 562 |
| 170 | Ga0105240_12560630 | 3300009093 | Bacteria | 527 |
| 171 | Ga0105245_11520332 | 3300009098 | Bacteria | 720 |
| 172 | Ga0105243_12061135 | 3300009148 | Bacteria | 606 |
| 173 | Ga0105241_10046588 | 3300009174 | Bacteria | 3293 |
| 174 | Ga0105241_11385553 | 3300009174 | Bacteria | 673 |
| 175 | Ga0105242_10785706 | 3300009176 | Bacteria | 941 |
| 176 | Ga0105242_10963989 | 3300009176 | Bacteria | 858 |
| 177 | Ga0105248_10555050 | 3300009177 | Bacteria | 1296 |
| 178 | Ga0105248_11173280 | 3300009177 | Bacteria | 868 |
| 179 | Ga0105237_10002619 | 3300009545 | Bacteria | 22167 |
| 180 | Ga0105237_10069626 | 3300009545 | Bacteria | 3514 |
| 181 | Ga0105237_10244594 | 3300009545 | Bacteria | 1795 |
| 182 | Ga0105237_10282372 | 3300009545 | Bacteria | 1663 |
| 183 | Ga0105237_10311796 | 3300009545 | Bacteria | 1577 |
| 184 | Ga0105237_10324209 | 3300009545 | Bacteria | 1544 |
| 185 | Ga0105238_10033303 | 3300009551 | Bacteria | 5244 |
| 186 | Ga0105238_10055969 | 3300009551 | Bacteria | 3958 |
| 187 | Ga0105238_10188920 | 3300009551 | Bacteria | 2036 |
| 188 | Ga0105238_10323701 | 3300009551 | Bacteria | 1528 |
| 189 | Ga0105238_12759932 | 3300009551 | Bacteria | 528 |
| 190 | Ga0105035_101729 | 3300009988 | Bacteria | 1543 |
| 191 | Ga0105028_100431 | 3300009993 | Bacteria | 4482 |
| 192 | Ga0099796_10469469 | 3300010159 | Bacteria | 561 |
| 193 | Ga0105239_10166189 | 3300010375 | Bacteria | 2467 |
| 194 | Ga0105239_10477867 | 3300010375 | Bacteria | 1416 |
| 195 | Ga0105239_11564626 | 3300010375 | Bacteria | 762 |
| 196 | Ga0105246_11167806 | 3300011119 | Bacteria | 707 |
| 197 | Ga0157373_10518982 | 3300013100 | Bacteria | 862 |
| 198 | Ga0157373_10822608 | 3300013100 | Bacteria | 686 |
| 199 | Ga0157373_10877508 | 3300013100 | Bacteria | 665 |
| 200 | Ga0157373_11110644 | 3300013100 | Bacteria | 593 |
| 201 | Ga0157371_10294763 | 3300013102 | Bacteria | 1173 |
| 202 | Ga0157371_10354604 | 3300013102 | Bacteria | 1068 |
| 203 | Ga0157371_11532809 | 3300013102 | Bacteria | 520 |
| 204 | Ga0157370_10001390 | 3300013104 | Bacteria | 29988 |
| 205 | Ga0157370_10008540 | 3300013104 | Bacteria | 11039 |
| 206 | Ga0157370_10072284 | 3300013104 | Bacteria | 3255 |
| 207 | Ga0157370_10822497 | 3300013104 | Bacteria | 845 |
| 208 | Ga0157370_10954247 | 3300013104 | Bacteria | 777 |
| 209 | Ga0157369_10026398 | 3300013105 | Bacteria | 6442 |
| 210 | Ga0157369_10140386 | 3300013105 | Bacteria | 2557 |
| 211 | Ga0157369_10196070 | 3300013105 | Bacteria | 2121 |
| 212 | Ga0157369_10625868 | 3300013105 | Bacteria | 1110 |
| 213 | Ga0157369_10660984 | 3300013105 | Bacteria | 1077 |
| 214 | Ga0157369_11700577 | 3300013105 | Bacteria | 641 |
| 215 | Ga0157369_11953758 | 3300013105 | Bacteria | 595 |
| 216 | Ga0157374_11020482 | 3300013296 | Bacteria | 847 |
| 217 | Ga0157374_11500375 | 3300013296 | Bacteria | 697 |
| 218 | Ga0157378_10605597 | 3300013297 | Bacteria | 1107 |
| 219 | Ga0157378_11073281 | 3300013297 | Bacteria | 841 |
| 220 | Ga0157378_12706115 | 3300013297 | Bacteria | 548 |
| 221 | Ga0163162_11135741 | 3300013306 | Bacteria | 886 |
| 222 | Ga0163162_11674216 | 3300013306 | Bacteria | 726 |
| 223 | Ga0163162_13109394 | 3300013306 | Bacteria | 533 |
| 224 | Ga0157372_10111907 | 3300013307 | Bacteria | 3128 |
| 225 | Ga0157372_10324059 | 3300013307 | Bacteria | 1794 |
| 226 | Ga0157372_11177110 | 3300013307 | Bacteria | 886 |
| 227 | Ga0157372_11652053 | 3300013307 | Bacteria | 737 |
| 228 | Ga0157372_12101897 | 3300013307 | Bacteria | 649 |
| 229 | Ga0157372_12716499 | 3300013307 | Bacteria | 568 |
| 230 | Ga0157375_11105737 | 3300013308 | Bacteria | 928 |
| 231 | Ga0163163_10466658 | 3300014325 | Bacteria | 1323 |
| 232 | Ga0163163_11694588 | 3300014325 | Bacteria | 693 |
| 233 | Ga0182008_10353852 | 3300014497 | Bacteria | 779 |
| 234 | Ga0182008_10876149 | 3300014497 | Bacteria | 527 |
| 235 | Ga0157376_10251797 | 3300014969 | Bacteria | 1650 |
| 236 | Ga0157376_10402106 | 3300014969 | Bacteria | 1325 |
| 237 | Ga0184598_141942 | 3300019182 | Bacteria | 612 |
| 238 | Ga0197907_10410046 | 3300020069 | Bacteria | 1244 |
| 239 | Ga0206356_10510010 | 3300020070 | Bacteria | 1225 |
| 240 | Ga0206356_10669629 | 3300020070 | Bacteria | 885 |
| 241 | Ga0206356_11445679 | 3300020070 | Bacteria | 831 |
| 242 | Ga0206356_11636321 | 3300020070 | Bacteria | 762 |
| 243 | Ga0206355_1092081 | 3300020076 | Bacteria | 1467 |
| 244 | Ga0206352_10440244 | 3300020078 | Bacteria | 791 |
| 245 | Ga0206350_10063581 | 3300020080 | Bacteria | 1093 |
| 246 | Ga0206350_10890309 | 3300020080 | Bacteria | 967 |
| 247 | Ga0206353_10170206 | 3300020082 | Bacteria | 1238 |
| 248 | Ga0206353_10208749 | 3300020082 | Bacteria | 959 |
| 249 | Ga0206353_11578995 | 3300020082 | Bacteria | 728 |
| 250 | Ga0213873_10001663 | 3300021358 | Bacteria | 3727 |
| 251 | Ga0213873_10135056 | 3300021358 | Bacteria | 733 |
| 252 | Ga0213873_10198427 | 3300021358 | Bacteria | 622 |
| 253 | Ga0213872_10045368 | 3300021361 | Bacteria | 1999 |
| 254 | Ga0213872_10060192 | 3300021361 | Bacteria | 1717 |
| 255 | Ga0213872_10074275 | 3300021361 | Bacteria | 1530 |
| 256 | Ga0213872_10122271 | 3300021361 | Bacteria | 1150 |
| 257 | Ga0213874_10001065 | 3300021377 | Bacteria | 5640 |
| 258 | Ga0213876_10001556 | 3300021384 | Bacteria | 14102 |
| 259 | Ga0213876_10003867 | 3300021384 | Bacteria | 8462 |
| 260 | Ga0213875_10004174 | 3300021388 | Bacteria | 7998 |
| 261 | Ga0213875_10259268 | 3300021388 | Bacteria | 820 |
| 262 | Ga0213871_10071071 | 3300021441 | Bacteria | 984 |
| 263 | Ga0224712_10017793 | 3300022467 | Bacteria | 2363 |
| 264 | Ga0224712_10203237 | 3300022467 | Bacteria | 901 |
| 265 | Ga0224572_1037153 | 3300024225 | Bacteria | 922 |
| 266 | Ga0207427_101221 | 3300025231 | Bacteria | 9946 |
| 267 | Ga0209233_1000293 | 3300025261 | Bacteria | 63470 |
| 268 | Ga0209676_1000092 | 3300025292 | Bacteria | 250453 |
| 269 | Ga0209050_1007590 | 3300025298 | Bacteria | 6028 |
| 270 | Ga0209051_1025622 | 3300025303 | Bacteria | 2395 |
| 271 | Ga0207656_10001058 | 3300025321 | Bacteria | 9002 |
| 272 | Ga0207656_10030934 | 3300025321 | Bacteria | 2214 |
| 273 | Ga0207692_10308768 | 3300025898 | Bacteria | 965 |
| 274 | Ga0207642_10394017 | 3300025899 | Bacteria | 827 |
| 275 | Ga0207688_10037880 | 3300025901 | Bacteria | 2675 |
| 276 | Ga0207647_10089449 | 3300025904 | Bacteria | 1838 |
| 277 | Ga0207647_10141952 | 3300025904 | Bacteria | 1407 |
| 278 | Ga0207699_11447269 | 3300025906 | Bacteria | 508 |
| 279 | Ga0207645_10096200 | 3300025907 | Bacteria | 1907 |
| 280 | Ga0207643_11076315 | 3300025908 | Bacteria | 519 |
| 281 | Ga0207705_10020427 | 3300025909 | Bacteria | 4732 |
| 282 | Ga0207705_10071391 | 3300025909 | Bacteria | 2517 |
| 283 | Ga0207705_10075111 | 3300025909 | Bacteria | 2454 |
| 284 | Ga0207654_10953111 | 3300025911 | Bacteria | 623 |
| 285 | Ga0207707_10000624 | 3300025912 | Bacteria | 35078 |
| 286 | Ga0207707_10022305 | 3300025912 | Bacteria | 5536 |
| 287 | Ga0207707_10078099 | 3300025912 | Bacteria | 2890 |
| 288 | Ga0207707_10119622 | 3300025912 | Bacteria | 2302 |
| 289 | Ga0207695_10043881 | 3300025913 | Bacteria | 4760 |
| 290 | Ga0207695_10214224 | 3300025913 | Bacteria | 1835 |
| 291 | Ga0207671_10001074 | 3300025914 | Bacteria | 33173 |
| 292 | Ga0207671_10150809 | 3300025914 | Bacteria | 1796 |
| 293 | Ga0207671_10184945 | 3300025914 | Bacteria | 1623 |
| 294 | Ga0207671_10254384 | 3300025914 | Bacteria | 1381 |
| 295 | Ga0207671_10344051 | 3300025914 | Bacteria | 1182 |
| 296 | Ga0207693_10474744 | 3300025915 | Bacteria | 977 |
| 297 | Ga0207660_10017860 | 3300025917 | Bacteria | 4721 |
| 298 | Ga0207660_10369650 | 3300025917 | Bacteria | 1151 |
| 299 | Ga0207660_10512111 | 3300025917 | Bacteria | 974 |
| 300 | Ga0207662_10207608 | 3300025918 | Bacteria | 1270 |
| 301 | Ga0207657_10008060 | 3300025919 | Bacteria | 10742 |
| 302 | Ga0207657_10044882 | 3300025919 | Bacteria | 3882 |
| 303 | Ga0207657_10076211 | 3300025919 | Bacteria | 2830 |
| 304 | Ga0207657_10289780 | 3300025919 | Bacteria | 1298 |
| 305 | Ga0207649_10001226 | 3300025920 | Bacteria | 15405 |
| 306 | Ga0207649_10093984 | 3300025920 | Bacteria | 1969 |
| 307 | Ga0207649_10928663 | 3300025920 | Bacteria | 683 |
| 308 | Ga0207649_11229423 | 3300025920 | Bacteria | 592 |
| 309 | Ga0207652_10002587 | 3300025921 | Bacteria | 15177 |
| 310 | Ga0207652_10057886 | 3300025921 | Bacteria | 3338 |
| 311 | Ga0207652_10218820 | 3300025921 | Bacteria | 1716 |
| 312 | Ga0207652_10462324 | 3300025921 | Bacteria | 1144 |
| 313 | Ga0207652_10718760 | 3300025921 | Bacteria | 890 |
| 314 | Ga0207652_11735252 | 3300025921 | Bacteria | 529 |
| 315 | Ga0207652_11778783 | 3300025921 | Bacteria | 521 |
| 316 | Ga0207694_10008555 | 3300025924 | Bacteria | 7728 |
| 317 | Ga0207694_10172425 | 3300025924 | Bacteria | 1752 |
| 318 | Ga0207694_10511921 | 3300025924 | Bacteria | 1005 |
| 319 | Ga0207650_10382801 | 3300025925 | Bacteria | 1162 |
| 320 | Ga0207659_10273630 | 3300025926 | Bacteria | 1378 |
| 321 | Ga0207659_10851713 | 3300025926 | Bacteria | 784 |
| 322 | Ga0207687_10652660 | 3300025927 | Bacteria | 890 |
| 323 | Ga0207700_10360140 | 3300025928 | Bacteria | 1268 |
| 324 | Ga0207690_10019639 | 3300025932 | Bacteria | 4164 |
| 325 | Ga0207690_10089309 | 3300025932 | Bacteria | 2173 |
| 326 | Ga0207690_10477913 | 3300025932 | Bacteria | 1005 |
| 327 | Ga0207706_10171232 | 3300025933 | Bacteria | 1908 |
| 328 | Ga0207706_10214453 | 3300025933 | Bacteria | 1687 |
| 329 | Ga0207709_11264225 | 3300025935 | Bacteria | 609 |
| 330 | Ga0207670_10273018 | 3300025936 | Bacteria | 1315 |
| 331 | Ga0207669_10012602 | 3300025937 | Bacteria | 4163 |
| 332 | Ga0207704_11501213 | 3300025938 | Bacteria | 578 |
| 333 | Ga0207691_10455149 | 3300025940 | Bacteria | 1089 |
| 334 | Ga0207711_10388325 | 3300025941 | Bacteria | 1296 |
| 335 | Ga0207689_11336960 | 3300025942 | Bacteria | 602 |
| 336 | Ga0207661_10380109 | 3300025944 | Bacteria | 1278 |
| 337 | Ga0207679_10286228 | 3300025945 | Bacteria | 1415 |
| 338 | Ga0207679_10573235 | 3300025945 | Bacteria | 1015 |
| 339 | Ga0207667_10000877 | 3300025949 | Bacteria | 38435 |
| 340 | Ga0207667_10002756 | 3300025949 | Bacteria | 21724 |
| 341 | Ga0207667_10019501 | 3300025949 | Bacteria | 7568 |
| 342 | Ga0207667_10157267 | 3300025949 | Bacteria | 2338 |
| 343 | Ga0207667_10254554 | 3300025949 | Bacteria | 1796 |
| 344 | Ga0207712_11648842 | 3300025961 | Bacteria | 575 |
| 345 | Ga0207668_10009850 | 3300025972 | Bacteria | 5742 |
| 346 | Ga0207668_10536746 | 3300025972 | Bacteria | 1011 |
| 347 | Ga0207640_10009094 | 3300025981 | Bacteria | 5547 |
| 348 | Ga0207640_10016034 | 3300025981 | Bacteria | 4349 |
| 349 | Ga0207640_10046887 | 3300025981 | Bacteria | 2784 |
| 350 | Ga0207640_10112501 | 3300025981 | Bacteria | 1933 |
| 351 | Ga0207640_10426997 | 3300025981 | Bacteria | 1086 |
| 352 | Ga0207640_10711524 | 3300025981 | Bacteria | 862 |
| 353 | Ga0207658_11135809 | 3300025986 | Bacteria | 714 |
| 354 | Ga0207658_11548342 | 3300025986 | Bacteria | 606 |
| 355 | Ga0207677_10101363 | 3300026023 | Bacteria | 2120 |
| 356 | Ga0207677_10962746 | 3300026023 | Bacteria | 772 |
| 357 | Ga0207639_10004515 | 3300026041 | Bacteria | 9386 |
| 358 | Ga0207639_10007867 | 3300026041 | Bacteria | 7280 |
| 359 | Ga0207639_10029135 | 3300026041 | Bacteria | 4039 |
| 360 | Ga0207639_10236751 | 3300026041 | Bacteria | 1585 |
| 361 | Ga0207639_10521468 | 3300026041 | Bacteria | 1088 |
| 362 | Ga0207708_11231094 | 3300026075 | Bacteria | 655 |
| 363 | Ga0207702_10006196 | 3300026078 | Bacteria | 10341 |
| 364 | Ga0207702_10023608 | 3300026078 | Bacteria | 5102 |
| 365 | Ga0207702_10029655 | 3300026078 | Bacteria | 4554 |
| 366 | Ga0207702_10459283 | 3300026078 | Bacteria | 1237 |
| 367 | Ga0207702_10575395 | 3300026078 | Bacteria | 1104 |
| 368 | Ga0207702_11739716 | 3300026078 | Bacteria | 616 |
| 369 | Ga0207641_11069923 | 3300026088 | Bacteria | 805 |
| 370 | Ga0207648_10242504 | 3300026089 | Bacteria | 1605 |
| 371 | Ga0207648_10275281 | 3300026089 | Bacteria | 1504 |
| 372 | Ga0207676_10792910 | 3300026095 | Bacteria | 924 |
| 373 | Ga0207674_10045512 | 3300026116 | Bacteria | 4513 |
| 374 | Ga0207674_10070606 | 3300026116 | Bacteria | 3511 |
| 375 | Ga0207674_10150891 | 3300026116 | Bacteria | 2281 |
| 376 | Ga0207674_10245498 | 3300026116 | Bacteria | 1737 |
| 377 | Ga0207674_10249766 | 3300026116 | Bacteria | 1721 |
| 378 | Ga0207674_10467969 | 3300026116 | Bacteria | 1218 |
| 379 | Ga0207675_100405521 | 3300026118 | Bacteria | 1344 |
| 380 | Ga0207683_10144767 | 3300026121 | Bacteria | 2142 |
| 381 | Ga0207683_10547904 | 3300026121 | Bacteria | 1069 |
| 382 | Ga0207698_10054516 | 3300026142 | Bacteria | 3077 |
| 383 | Ga0207698_10140737 | 3300026142 | Bacteria | 2078 |
| 384 | Ga0207698_10155782 | 3300026142 | Bacteria | 1990 |
| 385 | Ga0207698_11431508 | 3300026142 | Bacteria | 706 |
| 386 | Ga0210000_1063313 | 3300027462 | Bacteria | 599 |
| 387 | Ga0209983_1009332 | 3300027665 | Bacteria | 2005 |
| 388 | Ga0209588_1094859 | 3300027671 | Bacteria | 961 |
| 389 | Ga0209813_10102649 | 3300027866 | Bacteria | 975 |
| 390 | Ga0209974_10063329 | 3300027876 | Bacteria | 1254 |
| 391 | Ga0207428_10929259 | 3300027907 | Bacteria | 614 |
| 392 | Ga0268266_10000321 | 3300028379 | Bacteria | 75565 |
| 393 | Ga0268266_11142114 | 3300028379 | Bacteria | 753 |
| 394 | Ga0265334_10150039 | 3300028573 | Bacteria | 822 |
| 395 | Ga0265318_10008175 | 3300028577 | Bacteria | 4675 |
| 396 | Ga0265323_10180116 | 3300028653 | Unclassified | 669 |
| 397 | Ga0265338_10069830 | 3300028800 | Bacteria | 3016 |
| 398 | Ga0265338_10590173 | 3300028800 | Bacteria | 774 |
| 399 | Ga0265324_10063838 | 3300029957 | Bacteria | 1257 |
| 400 | Ga0265330_10001669 | 3300031235 | Bacteria | 12591 |
| 401 | Ga0265330_10006274 | 3300031235 | Bacteria | 5877 |
| 402 | Ga0265330_10120455 | 3300031235 | Bacteria | 1118 |
| 403 | Ga0265330_10152004 | 3300031235 | Bacteria | 983 |
| 404 | Ga0265330_10197428 | 3300031235 | Bacteria | 851 |
| 405 | Ga0265332_10065930 | 3300031238 | Bacteria | 1546 |
| 406 | Ga0265332_10104902 | 3300031238 | Bacteria | 1192 |
| 407 | Ga0265332_10121255 | 3300031238 | Bacteria | 1098 |
| 408 | Ga0265328_10074526 | 3300031239 | Bacteria | 1249 |
| 409 | Ga0265328_10116335 | 3300031239 | Bacteria | 996 |
| 410 | Ga0265328_10187815 | 3300031239 | Bacteria | 783 |
| 411 | Ga0265320_10060485 | 3300031240 | Bacteria | 1808 |
| 412 | Ga0265325_10080671 | 3300031241 | Bacteria | 1618 |
| 413 | Ga0265325_10102490 | 3300031241 | Bacteria | 1399 |
| 414 | Ga0265325_10139267 | 3300031241 | Bacteria | 1155 |
| 415 | Ga0265329_10103667 | 3300031242 | Bacteria | 907 |
| 416 | Ga0265340_10036214 | 3300031247 | Bacteria | 2447 |
| 417 | Ga0265339_10013124 | 3300031249 | Bacteria | 5031 |
| 418 | Ga0265339_10030849 | 3300031249 | Bacteria | 3033 |
| 419 | Ga0265339_10142634 | 3300031249 | Bacteria | 1217 |
| 420 | Ga0265339_10294991 | 3300031249 | Bacteria | 774 |
| 421 | Ga0265331_10119834 | 3300031250 | Bacteria | 1204 |
| 422 | Ga0265331_10157792 | 3300031250 | Bacteria | 1029 |
| 423 | Ga0265327_10000100 | 3300031251 | Bacteria | 189591 |
| 424 | Ga0265327_10050054 | 3300031251 | Bacteria | 2188 |
| 425 | Ga0265316_10013594 | 3300031344 | Bacteria | 7222 |
| 426 | Ga0265316_10209865 | 3300031344 | Bacteria | 1441 |
| 427 | Ga0265316_10294616 | 3300031344 | Bacteria | 1183 |
| 428 | Ga0265316_10486487 | 3300031344 | Bacteria | 883 |
| 429 | Ga0265316_10865013 | 3300031344 | Bacteria | 632 |
| 430 | Ga0307408_100739691 | 3300031548 | Bacteria | 887 |
| 431 | Ga0265313_10002227 | 3300031595 | Bacteria | 17059 |
| 432 | Ga0265313_10005420 | 3300031595 | Bacteria | 9398 |
| 433 | Ga0265313_10283610 | 3300031595 | Bacteria | 669 |
| 434 | Ga0307508_10530512 | 3300031616 | Bacteria | 774 |
| 435 | Ga0316579_10460260 | 3300031691 | Bacteria | 615 |
| 436 | Ga0316579_10466402 | 3300031691 | Bacteria | 611 |
| 437 | Ga0265314_10016860 | 3300031711 | Bacteria | 5756 |
| 438 | Ga0265314_10031281 | 3300031711 | Bacteria | 3932 |
| 439 | Ga0265314_10095625 | 3300031711 | Bacteria | 1923 |
| 440 | Ga0265314_10106792 | 3300031711 | Bacteria | 1787 |
| 441 | Ga0265314_10119547 | 3300031711 | Bacteria | 1661 |
| 442 | Ga0265314_10279521 | 3300031711 | Bacteria | 945 |
| 443 | Ga0265342_10008211 | 3300031712 | Bacteria | 7520 |
| 444 | Ga0265342_10030117 | 3300031712 | Bacteria | 3367 |
| 445 | Ga0265342_10077955 | 3300031712 | Bacteria | 1918 |
| 446 | Ga0265342_10090566 | 3300031712 | Bacteria | 1754 |
| 447 | Ga0265342_10248561 | 3300031712 | Bacteria | 950 |
| 448 | Ga0265342_10266813 | 3300031712 | Bacteria | 909 |
| 449 | Ga0316576_10000992 | 3300031727 | Bacteria | 14602 |
| 450 | Ga0316576_10001969 | 3300031727 | Bacteria | 11478 |
| 451 | Ga0316576_10165433 | 3300031727 | Bacteria | 1669 |
| 452 | Ga0316576_10703899 | 3300031727 | Bacteria | 732 |
| 453 | Ga0316578_10478936 | 3300031728 | Bacteria | 734 |
| 454 | Ga0307516_10367781 | 3300031730 | Bacteria | 1101 |
| 455 | Ga0307405_10335410 | 3300031731 | Bacteria | 1160 |
| 456 | Ga0307413_10162983 | 3300031824 | Bacteria | 1568 |
| 457 | Ga0307413_10354841 | 3300031824 | Bacteria | 1133 |
| 458 | Ga0307410_10051793 | 3300031852 | Bacteria | 2769 |
| 459 | Ga0307410_10840362 | 3300031852 | Bacteria | 783 |
| 460 | Ga0307410_10945600 | 3300031852 | Bacteria | 740 |
| 461 | Ga0307406_10167970 | 3300031901 | Bacteria | 1585 |
| 462 | Ga0307406_10240419 | 3300031901 | Bacteria | 1358 |
| 463 | Ga0307406_10271008 | 3300031901 | Bacteria | 1290 |
| 464 | Ga0307406_10334186 | 3300031901 | Bacteria | 1177 |
| 465 | Ga0307406_10655183 | 3300031901 | Bacteria | 872 |
| 466 | Ga0307407_10499792 | 3300031903 | Bacteria | 891 |
| 467 | Ga0307412_10063396 | 3300031911 | Bacteria | 2493 |
| 468 | Ga0307412_10241524 | 3300031911 | Bacteria | 1397 |
| 469 | Ga0307412_10535596 | 3300031911 | Bacteria | 981 |
| 470 | Ga0307409_100376008 | 3300031995 | Bacteria | 1349 |
| 471 | Ga0307409_100387076 | 3300031995 | Bacteria | 1331 |
| 472 | Ga0307409_100782482 | 3300031995 | Bacteria | 960 |
| 473 | Ga0307409_100949381 | 3300031995 | Bacteria | 876 |
| 474 | Ga0307414_10122495 | 3300032004 | Bacteria | 2002 |
| 475 | Ga0307414_10203250 | 3300032004 | Bacteria | 1613 |
| 476 | Ga0307414_10286581 | 3300032004 | Bacteria | 1386 |
| 477 | Ga0307414_10365082 | 3300032004 | Bacteria | 1243 |
| 478 | Ga0307414_10984833 | 3300032004 | Bacteria | 776 |
| 479 | Ga0307414_11383389 | 3300032004 | Bacteria | 654 |
| 480 | Ga0307414_11769193 | 3300032004 | Bacteria | 576 |
| 481 | Ga0307414_11783581 | 3300032004 | Bacteria | 574 |
| 482 | Ga0307414_12032744 | 3300032004 | Bacteria | 536 |
| 483 | Ga0307411_10522795 | 3300032005 | Bacteria | 1007 |
| 484 | Ga0307411_10826661 | 3300032005 | Bacteria | 818 |
| 485 | Ga0307415_101315648 | 3300032126 | Bacteria | 685 |
| 486 | Ga0307415_101343883 | 3300032126 | Bacteria | 678 |
| 487 | Ga0316583_10037793 | 3300032133 | Bacteria | 1712 |
| 488 | Ga0316583_10069858 | 3300032133 | Bacteria | 1229 |
| 489 | Ga0316593_10012502 | 3300032168 | Bacteria | 2492 |
| 490 | Ga0316593_10016899 | 3300032168 | Bacteria | 2219 |
| 491 | Ga0316593_10020111 | 3300032168 | Bacteria | 2071 |
| 492 | Ga0316593_10076675 | 3300032168 | Bacteria | 1162 |
| 493 | Ga0316593_10086008 | 3300032168 | Bacteria | 1102 |
| 494 | Ga0316593_10095295 | 3300032168 | Bacteria | 1051 |
| 495 | Ga0316593_10180861 | 3300032168 | Unclassified | 775 |
| 496 | Ga0316593_10186093 | 3300032168 | Bacteria | 765 |
| 497 | Ga0316592_1000397 | 3300033524 | Bacteria | 5838 |
| 498 | Ga0316592_1002468 | 3300033524 | Bacteria | 3201 |
| 499 | Ga0316592_1024219 | 3300033524 | Bacteria | 1305 |
| 500 | Ga0316586_1047442 | 3300033527 | Bacteria | 764 |
| 501 | Ga0316588_1018041 | 3300033528 | Bacteria | 1577 |
| 502 | Ga0316588_1021266 | 3300033528 | Bacteria | 1475 |
| 503 | Ga0316588_1021863 | 3300033528 | Unclassified | 1458 |
| 504 | Ga0316588_1069510 | 3300033528 | Bacteria | 864 |
| 505 | Ga0316588_1091985 | 3300033528 | Bacteria | 756 |
| 506 | Ga0316588_1111182 | 3300033528 | Bacteria | 689 |
| 507 | Ga0316588_1145952 | 3300033528 | Unclassified | 606 |
| 508 | Ga0316587_1011518 | 3300033529 | Bacteria | 1428 |
| 509 | Ga0316587_1017547 | 3300033529 | Bacteria | 1200 |
| 510 | Ga0316596_1000006 | 3300033541 | Bacteria | 19978 |
| 511 | Ga0316596_1001245 | 3300033541 | Bacteria | 5036 |
| 512 | Ga0316596_1002889 | 3300033541 | Bacteria | 3719 |
| 513 | Ga0316596_1006883 | 3300033541 | Bacteria | 2663 |
| 514 | Ga0316596_1014240 | 3300033541 | Bacteria | 1970 |
| 515 | Ga0316596_1046657 | 3300033541 | Bacteria | 1144 |
| 516 | Ga0316596_1046749 | 3300033541 | Bacteria | 1143 |
| 517 | Ga0316596_1094274 | 3300033541 | Bacteria | 807 |
| 518 | Ga0373930_0044054 | 3300034816 | Bacteria | 958 |
| 519 | Ga0373948_0088029 | 3300034817 | Bacteria | 717 |
| 520 | Ga0373950_0160311 | 3300034818 | Bacteria | 519 |
| 521 | Ga0373959_0014406 | 3300034820 | Bacteria | 1439 |
| 522 | Ga0373928_0016766 | 3300035084 | Bacteria | 1501 |
| 523 | Ga0373928_0111875 | 3300035084 | Bacteria | 723 |
| 524 | Ga0373929_0048291 | 3300035085 | Bacteria | 966 |
| 525 | Ga0373949_0072876 | 3300035090 | Bacteria | 902 |
| 526 | Ga0373949_0272614 | 3300035090 | Bacteria | 529 |
| 527 | Ga0373952_0067472 | 3300035092 | Bacteria | 888 |
| 528 | Ga0373932_0061960 | 3300035112 | Bacteria | 1139 |
| 529 | Ga0373932_0095872 | 3300035112 | Bacteria | 959 |
| 530 | Ga0373932_0116585 | 3300035112 | Bacteria | 886 |
| 531 | Ga0373941_0172622 | 3300035115 | Bacteria | 806 |
| 532 | Ga0373941_0258908 | 3300035115 | Bacteria | 682 |
| 533 | Ga0373960_0074546 | 3300035121 | Bacteria | 1056 |
| 534 | Ga0373943_0119908 | 3300035170 | Bacteria | 1397 |
| 535 | Ga0373942_0064607 | 3300035207 | Bacteria | 1056 |
| 536 | Ga0373962_0006987 | 3300035242 | Bacteria | 2751 |
| 537 | Ga0316574_0063562 | 3300035398 | Bacteria | 2321 |
| 538 | Ga0316574_0362033 | 3300035398 | Bacteria | 917 |
| 539 | Ga0316574_0784145 | 3300035398 | Bacteria | 581 |
| 540 | Ga0373931_0318912 | 3300035691 | Bacteria | 965 |
| 541 | Ga0373931_0664801 | 3300035691 | Bacteria | 685 |
| 542 | Ga0373935_0225634 | 3300035692 | Bacteria | 1303 |
| 543 | Ga0373927_0093114 | 3300035695 | Bacteria | 1958 |
| 544 | Ga0373927_0199442 | 3300035695 | Bacteria | 1314 |
| 545 | Ga0373927_0280407 | 3300035695 | Bacteria | 1096 |
| 546 | Ga0373927_0538286 | 3300035695 | Bacteria | 772 |
| 547 | Ga0373947_0230782 | 3300035725 | Bacteria | 1219 |
| 548 | Ga0373937_0273760 | 3300036401 | Bacteria | 1594 |
| 549 | Ga0373937_1771358 | 3300036401 | Bacteria | 564 |
| 550 | Ga0316582_0502385 | 3300036647 | Bacteria | 836 |
| 551 | Ga0316582_0668648 | 3300036647 | Bacteria | 714 |
| 552 | Ga0316584_0092322 | 3300036712 | Bacteria | 2267 |
| 553 | Ga0316584_0335837 | 3300036712 | Unclassified | 1087 |
| 554 | Ga0316584_0607749 | 3300036712 | Bacteria | 758 |
| 555 | Ga0316584_0779274 | 3300036712 | Bacteria | 651 |
| 556 | Ga0373925_0060365 | 3300037068 | Bacteria | 2848 |
| 557 | Ga0373925_1088508 | 3300037068 | Bacteria | 658 |
| 558 | Ga0395899_0034692 | 3300037312 | Bacteria | 3789 |
| 559 | Ga0395899_0044661 | 3300037312 | Bacteria | 3301 |
| 560 | Ga0395900_0075274 | 3300037418 | Bacteria | 3470 |
| 561 | Ga0395900_0078542 | 3300037418 | Bacteria | 3391 |
| 562 | Ga0395900_0308699 | 3300037418 | Bacteria | 1565 |
| 563 | Ga0395900_0346946 | 3300037418 | Bacteria | 1459 |
| 564 | Ga0395900_0415129 | 3300037418 | Bacteria | 1307 |
| 565 | Ga0395898_0005690 | 3300037466 | Bacteria | 13432 |
| 566 | Ga0395898_0045631 | 3300037466 | Bacteria | 4307 |
| 567 | Ga0395898_0203092 | 3300037466 | Bacteria | 1891 |
| 568 | Ga0395898_0270557 | 3300037466 | Bacteria | 1620 |
| 569 | Ga0395898_1236517 | 3300037466 | Bacteria | 677 |
| 570 | Ga0436364_0013783 | 3300037853 | Bacteria | 29941 |
| 571 | Ga0436364_0082147 | 3300037853 | Bacteria | 4075 |
| 572 | Ga0436364_0675508 | 3300037853 | Bacteria | 1246 |
| 573 | Ga0436364_1463267 | 3300037853 | Bacteria | 1139 |
| 574 | Ga0395901_0007619 | 3300038443 | Bacteria | 10927 |
| 575 | Ga0395901_0108247 | 3300038443 | Bacteria | 2917 |
| 576 | Ga0395901_0146970 | 3300038443 | Bacteria | 2477 |
| 577 | Ga0395901_0166684 | 3300038443 | Bacteria | 2312 |
| 578 | Ga0395901_1191589 | 3300038443 | Bacteria | 728 |
| 579 | Ga0400484_12384 | 3300038725 | Bacteria | 5081 |
| 580 | Ga0400490_18978 | 3300038726 | Bacteria | 41932 |
| 581 | Ga0400490_19520 | 3300038726 | Bacteria | 4897 |
| 582 | Ga0400490_58666 | 3300038726 | Bacteria | 1178 |
| 583 | Ga0400491_29253 | 3300038727 | Bacteria | 8022 |
| 584 | Ga0400485_19339 | 3300038735 | Bacteria | 2888 |
| 585 | Ga0400488_57582 | 3300038741 | Bacteria | 1769 |
| 586 | Ga0400488_58232 | 3300038741 | Bacteria | 2013 |
| 587 | Ga0400486_32047 | 3300038742 | Bacteria | 23991 |
| 588 | Ga0400483_023928 | 3300039062 | Bacteria | 5426 |
| 589 | Ga0400483_042851 | 3300039062 | Bacteria | 14723 |
| 590 | Ga0400483_057660 | 3300039062 | Bacteria | 5388 |
| 591 | Ga0400483_094026 | 3300039062 | Bacteria | 1333 |
| 592 | Ga0400483_114523 | 3300039062 | Bacteria | 3519 |
| 593 | Ga0400483_137186 | 3300039062 | Bacteria | 1244 |
| 594 | Ga0400483_151905 | 3300039062 | Bacteria | 1759 |
| 595 | Ga0400483_198250 | 3300039062 | Bacteria | 18872 |
| 596 | Ga0400483_217885 | 3300039062 | Bacteria | 12374 |
| 597 | Ga0400483_278711 | 3300039062 | Bacteria | 5840 |
| 598 | Ga0400483_281905 | 3300039062 | Bacteria | 2950 |
| 599 | Ga0400489_41472 | 3300039093 | Bacteria | 14759 |
| 600 | Ga0400489_66216 | 3300039093 | Bacteria | 19270 |
| 601 | Ga0400487_19781 | 3300039110 | Bacteria | 4881 |
| 602 | Ga0436365_0555060 | 3300039437 | Bacteria | 868 |
| 603 | Ga0436365_0850961 | 3300039437 | Bacteria | 3131 |
| 604 | Ga0436365_1136540 | 3300039437 | Bacteria | 40433 |
| 605 | Ga0436365_1228764 | 3300039437 | Bacteria | 1301 |
| 606 | Ga0436365_1253031 | 3300039437 | Bacteria | 47093 |
| 607 | Ga0436365_1369855 | 3300039437 | Bacteria | 566 |
| 608 | Ga0436360_0065948 | 3300039438 | Bacteria | 881 |
| 609 | Ga0436360_0229296 | 3300039438 | Bacteria | 941 |
| 610 | Ga0436360_0840585 | 3300039438 | Bacteria | 1648 |
| 611 | Ga0436360_0870274 | 3300039438 | Bacteria | 1560 |
| 612 | Ga0436360_1007386 | 3300039438 | Bacteria | 999 |
| 613 | Ga0436360_1251640 | 3300039438 | Bacteria | 1036 |
| 614 | Ga0436360_1307620 | 3300039438 | Bacteria | 1366 |
| 615 | Ga0436361_0305976 | 3300039447 | Bacteria | 2290 |
| 616 | Ga0436361_0425653 | 3300039447 | Bacteria | 1680 |
| 617 | Ga0436361_0448350 | 3300039447 | Bacteria | 514 |
| 618 | Ga0436361_0498700 | 3300039447 | Bacteria | 612 |
| 619 | Ga0436361_0587648 | 3300039447 | Bacteria | 1983 |
| 620 | Ga0436361_0618512 | 3300039447 | Bacteria | 1599 |
| 621 | Ga0436361_0632864 | 3300039447 | Bacteria | 1504 |
| 622 | Ga0436361_0834792 | 3300039447 | Bacteria | 965 |
| 623 | Ga0436361_0846724 | 3300039447 | Bacteria | 2220 |
| 624 | Ga0436361_0853694 | 3300039447 | Bacteria | 723 |
| 625 | Ga0436361_1035119 | 3300039447 | Bacteria | 5692 |
| 626 | Ga0436361_1061350 | 3300039447 | Bacteria | 899 |
| 627 | Ga0436363_0121335 | 3300039450 | Bacteria | 5796 |
| 628 | Ga0436363_0205355 | 3300039450 | Bacteria | 875 |
| 629 | Ga0436363_0252353 | 3300039450 | Bacteria | 1038 |
| 630 | Ga0436363_0746062 | 3300039450 | Bacteria | 9943 |
| 631 | Ga0436363_1082032 | 3300039450 | Bacteria | 626 |
| 632 | Ga0436362_0060202 | 3300039453 | Bacteria | 561 |
| 633 | Ga0436362_0189083 | 3300039453 | Bacteria | 587 |
| 634 | Ga0436362_0313849 | 3300039453 | Bacteria | 1168 |
| 635 | Ga0436362_0437344 | 3300039453 | Bacteria | 556 |
| 636 | Ga0436362_0579275 | 3300039453 | Bacteria | 788 |
| 637 | Ga0436362_0608067 | 3300039453 | Bacteria | 1311 |
| 638 | Ga0436362_1149838 | 3300039453 | Bacteria | 1943 |
| 639 | Ga0439461_0027483 | 3300041410 | Bacteria | 1167 |
| 640 | Ga0439466_0165373 | 3300041411 | Bacteria | 676 |
| 641 | Ga0439465_0041213 | 3300041413 | Bacteria | 1494 |
| 642 | Ga0439465_0047897 | 3300041413 | Bacteria | 1394 |
| 643 | Ga0439465_0055961 | 3300041413 | Bacteria | 1299 |
| 644 | Ga0439465_0060786 | 3300041413 | Bacteria | 1252 |
| 645 | Ga0439465_0134278 | 3300041413 | Bacteria | 875 |
| 646 | Ga0451789_0925233 | 3300041443 | Bacteria | 661 |
| 647 | Ga0451792_23296 | 3300041445 | Bacteria | 696 |
| 648 | Ga0451794_41389 | 3300041446 | Bacteria | 530 |
| 649 | Ga0451791_1156556 | 3300041451 | Bacteria | 533 |
| 650 | Ga0451793_0423706 | 3300041452 | Bacteria | 847 |
| 651 | Ga0451793_0894875 | 3300041452 | Bacteria | 731 |
| 652 | Ga0451797_1483980 | 3300041453 | Bacteria | 626 |
| 653 | Ga0451797_1514149 | 3300041453 | Bacteria | 620 |
| 654 | Ga0451797_1528640 | 3300041453 | Bacteria | 723 |
| 655 | Ga0451795_1557624 | 3300041456 | Bacteria | 818 |
| 656 | Ga0451800_0842399 | 3300041459 | Bacteria | 525 |
| 657 | Ga0451800_1508070 | 3300041459 | Bacteria | 594 |
| 658 | Ga0451837_1281237 | 3300041494 | Bacteria | 917 |
| 659 | Ga0451837_1624919 | 3300041494 | Bacteria | 929 |
| 660 | Ga0451841_1096970 | 3300041498 | Bacteria | 959 |
| 661 | Ga0451843_0419583 | 3300041509 | Bacteria | 678 |
| 662 | Ga0451853_1217462 | 3300041512 | Bacteria | 687 |
| 663 | Ga0451853_1342895 | 3300041512 | Bacteria | 905 |
| 664 | Ga0439431_0095136 | 3300041997 | Bacteria | 815 |
| 665 | Ga0439431_0116185 | 3300041997 | Bacteria | 744 |
| 666 | Ga0439433_0034999 | 3300041999 | Bacteria | 1157 |
| 667 | Ga0439441_007617 | 3300042001 | Bacteria | 1750 |
| 668 | Ga0439443_043477 | 3300042003 | Bacteria | 772 |
| 669 | Ga0439443_069840 | 3300042003 | Bacteria | 640 |
| 670 | Ga0439445_0033058 | 3300042004 | Bacteria | 1350 |
| 671 | Ga0439445_0037160 | 3300042004 | Bacteria | 1284 |
| 672 | Ga0439448_0014543 | 3300042005 | Bacteria | 2375 |
| 673 | Ga0439432_052284 | 3300042006 | Bacteria | 1272 |
| 674 | Ga0439432_164323 | 3300042006 | Bacteria | 649 |
| 675 | Ga0439449_0071350 | 3300042007 | Bacteria | 1280 |
| 676 | Ga0439452_044390 | 3300042010 | Bacteria | 1037 |
| 677 | Ga0450890_029163 | 3300042127 | Bacteria | 779 |
| 678 | Ga0450897_047122 | 3300042128 | Bacteria | 515 |
| 679 | Ga0439434_0037933 | 3300042435 | Bacteria | 1476 |
| 680 | Ga0439434_0094189 | 3300042435 | Bacteria | 960 |
| 681 | Ga0439435_0238884 | 3300042436 | Bacteria | 609 |
| 682 | Ga0439459_0204423 | 3300042438 | Bacteria | 541 |
| 683 | Ga0439464_0114669 | 3300042439 | Bacteria | 827 |
| 684 | Ga0451577_0030969 | 3300042876 | Bacteria | 4830 |
| 685 | Ga0451577_0442387 | 3300042876 | Bacteria | 1180 |
| 686 | Ga0453683_0050267 | 3300044673 | Bacteria | 2612 |
| 687 | Ga0466965_0062359 | 3300044683 | Bacteria | 1865 |
| 688 | Ga0466966_0207717 | 3300044684 | Bacteria | 1184 |
| 689 | Ga0466966_0258704 | 3300044684 | Bacteria | 1048 |
| 690 | Ga0466961_0121966 | 3300044693 | Bacteria | 1636 |
| 691 | Ga0466963_0029443 | 3300044694 | Bacteria | 3535 |
| 692 | Ga0466963_0294172 | 3300044694 | Bacteria | 1142 |
| 693 | Ga0466963_0585595 | 3300044694 | Bacteria | 788 |
| 694 | Ga0466963_0739702 | 3300044694 | Bacteria | 694 |
| 695 | Ga0466964_0629683 | 3300044706 | Bacteria | 591 |
| 696 | Ga0453684_0000204 | 3300044712 | Bacteria | 258105 |
| 697 | Ga0453684_0001066 | 3300044712 | Bacteria | 87216 |
| 698 | Ga0453684_0007136 | 3300044712 | Bacteria | 20809 |
| 699 | Ga0453684_0041859 | 3300044712 | Bacteria | 6185 |
| 700 | Ga0453684_0282064 | 3300044712 | Bacteria | 1894 |
| 701 | Ga0453684_0386411 | 3300044712 | Bacteria | 1571 |
| 702 | Ga0453684_0416986 | 3300044712 | Bacteria | 1501 |
| 703 | Ga0453684_0788845 | 3300044712 | Bacteria | 1025 |
| 704 | Ga0453684_1161825 | 3300044712 | Bacteria | 812 |
| 705 | Ga0466971_0653608 | 3300044719 | Bacteria | 527 |
| 706 | Ga0466957_0021853 | 3300044842 | Bacteria | 3772 |
| 707 | Ga0466957_0768282 | 3300044842 | Bacteria | 683 |
| 708 | Ga0466959_0084832 | 3300045049 | Bacteria | 2280 |
| 709 | Ga0466959_0599077 | 3300045049 | Bacteria | 741 |
| 710 | Ga0451576_0001012 | 3300045051 | Bacteria | 51921 |
| 711 | Ga0451576_0029379 | 3300045051 | Bacteria | 5883 |
| 712 | Ga0451576_0031820 | 3300045051 | Bacteria | 5623 |
| 713 | Ga0451576_0059829 | 3300045051 | Bacteria | 3976 |
| 714 | Ga0466958_0000676 | 3300045836 | Bacteria | 14782 |
| 715 | Ga0466958_0264302 | 3300045836 | Bacteria | 1102 |
| 716 | Ga0466958_0821197 | 3300045836 | Bacteria | 606 |
| 717 | Ga0466967_0013435 | 3300045976 | Bacteria | 6326 |
| 718 | Ga0466967_0242158 | 3300045976 | Bacteria | 1721 |
| 719 | Ga0466967_0515250 | 3300045976 | Bacteria | 1175 |
| 720 | Ga0466967_0547034 | 3300045976 | Bacteria | 1139 |
| 721 | Ga0466967_0973100 | 3300045976 | Bacteria | 845 |
| 722 | Ga0466967_2250869 | 3300045976 | Bacteria | 541 |
| 723 | Ga0495592_0333617 | 3300046454 | Bacteria | 977 |
| 724 | Ga0495596_0250676 | 3300046500 | Bacteria | 687 |
| 725 | Ga0495630_0370866 | 3300046517 | Bacteria | 1096 |
| 726 | Ga0495656_0371829 | 3300046615 | Bacteria | 744 |
| 727 | Ga0495668_0439473 | 3300046616 | Bacteria | 718 |
| 728 | Ga0495668_0545614 | 3300046616 | Bacteria | 640 |
| 729 | Ga0495674_0887829 | 3300047319 | Bacteria | 689 |
| 730 | Ga0495672_0000511 | 3300047320 | Bacteria | 44639 |
| 731 | Ga0495672_0031397 | 3300047320 | Bacteria | 3316 |
| 732 | Ga0495686_0047436 | 3300047472 | Bacteria | 2712 |
| 733 | Ga0495602_0281167 | 3300048088 | Bacteria | 1226 |
| 734 | Ga0496100_1060656 | 3300048903 | Bacteria | 638 |
| 735 | Ga0496102_0668275 | 3300048905 | Bacteria | 962 |
| 736 | Ga0496104_0228525 | 3300048907 | Bacteria | 1773 |
| 737 | Ga0496106_0491162 | 3300048909 | Bacteria | 986 |
| 738 | Ga0496109_0405595 | 3300048912 | Bacteria | 1288 |
| 739 | Ga0496110_0268646 | 3300048913 | Bacteria | 1553 |
| 740 | Ga0496110_0542264 | 3300048913 | Bacteria | 1057 |
| 741 | Ga0496111_0364438 | 3300048914 | Bacteria | 1069 |
| 742 | Ga0496112_0518153 | 3300048915 | Bacteria | 1127 |
| 743 | Ga0496117_0190708 | 3300048920 | Bacteria | 1168 |
| 744 | Ga0496118_0121464 | 3300048921 | Bacteria | 1702 |
| 745 | Ga0496119_0441059 | 3300048922 | Bacteria | 615 |
| 746 | Ga0496121_0091176 | 3300048924 | Bacteria | 2380 |
| 747 | Ga0496121_0111944 | 3300048924 | Bacteria | 2080 |
| 748 | Ga0496121_0533132 | 3300048924 | Bacteria | 738 |
| 749 | Ga0496124_0030584 | 3300048927 | Bacteria | 4777 |
| 750 | Ga0496124_0211277 | 3300048927 | Bacteria | 1468 |
| 751 | Ga0496124_0297344 | 3300048927 | Bacteria | 1168 |
| 752 | Ga0496125_0000815 | 3300048928 | Bacteria | 50702 |
| 753 | Ga0496125_0254919 | 3300048928 | Bacteria | 1104 |
| 754 | Ga0496126_0119659 | 3300048929 | Bacteria | 2285 |
| 755 | Ga0496126_0135898 | 3300048929 | Bacteria | 2121 |
| 756 | Ga0496126_0206650 | 3300048929 | Bacteria | 1655 |
| 757 | Ga0496126_0271543 | 3300048929 | Bacteria | 1407 |
| 758 | Ga0501306_004657 | 3300049127 | Bacteria | 1544 |
| 759 | Ga0501306_010078 | 3300049127 | Bacteria | 1183 |
| 760 | Ga0501306_014887 | 3300049127 | Bacteria | 1030 |
| 761 | Ga0501306_040025 | 3300049127 | Bacteria | 724 |
| 762 | Ga0501310_004086 | 3300049130 | Bacteria | 1451 |
| 763 | Ga0501305_002063 | 3300049161 | Bacteria | 2105 |
| 764 | Ga0501305_010380 | 3300049161 | Bacteria | 1242 |
| 765 | Ga0501305_016841 | 3300049161 | Bacteria | 1046 |
| 766 | Ga0501307_005955 | 3300049162 | Bacteria | 1301 |
| 767 | Ga0501312_078181 | 3300049528 | Bacteria | 595 |
| 768 | Ga0501313_018950 | 3300049529 | Bacteria | 839 |
| 769 | Ga0501314_010050 | 3300049530 | Bacteria | 877 |
| 770 | Ga0501315_058471 | 3300049531 | Bacteria | 619 |
| 771 | Ga0501316_024206 | 3300049532 | Bacteria | 783 |
| 772 | Ga0501317_023840 | 3300049533 | Bacteria | 847 |
| 773 | Ga0501320_009962 | 3300049536 | Bacteria | 961 |
| 774 | Ga0501321_022779 | 3300049537 | Bacteria | 791 |
| 775 | Ga0501323_002663 | 3300049539 | Bacteria | 1754 |
| 776 | Ga0501031_0046811 | 3300049568 | Bacteria | 2820 |
| 777 | Ga0501031_0628297 | 3300049568 | Bacteria | 691 |
| 778 | Ga0501032_0062255 | 3300049569 | Bacteria | 2500 |
| 779 | Ga0501032_0156892 | 3300049569 | Bacteria | 1495 |
| 780 | Ga0501032_0258239 | 3300049569 | Bacteria | 1130 |
| 781 | Ga0501032_0296046 | 3300049569 | Bacteria | 1046 |
| 782 | Ga0501033_0020210 | 3300049570 | Bacteria | 5033 |
| 783 | Ga0501033_0089600 | 3300049570 | Bacteria | 2250 |
| 784 | Ga0501033_0094339 | 3300049570 | Bacteria | 2188 |
| 785 | Ga0501033_1067626 | 3300049570 | Bacteria | 538 |
| 786 | Ga0501034_0000482 | 3300049571 | Bacteria | 65380 |
| 787 | Ga0501034_0009019 | 3300049571 | Bacteria | 10475 |
| 788 | Ga0501034_0063216 | 3300049571 | Bacteria | 3715 |
| 789 | Ga0501034_0085750 | 3300049571 | Bacteria | 3150 |
| 790 | Ga0501034_0102596 | 3300049571 | Bacteria | 2854 |
| 791 | Ga0501034_0105047 | 3300049571 | Bacteria | 2817 |
| 792 | Ga0501034_0120247 | 3300049571 | Bacteria | 2613 |
| 793 | Ga0501034_0158436 | 3300049571 | Bacteria | 2236 |
| 794 | Ga0501034_0311870 | 3300049571 | Bacteria | 1507 |
| 795 | Ga0501034_0328774 | 3300049571 | Bacteria | 1460 |
| 796 | Ga0501034_0442975 | 3300049571 | Bacteria | 1217 |
| 797 | Ga0501034_0559110 | 3300049571 | Bacteria | 1053 |
| 798 | Ga0501034_0632220 | 3300049571 | Bacteria | 973 |
| 799 | Ga0501036_0035510 | 3300049572 | Bacteria | 4218 |
| 800 | Ga0501036_0087494 | 3300049572 | Bacteria | 2633 |
| 801 | Ga0501036_0138141 | 3300049572 | Bacteria | 2057 |
| 802 | Ga0501036_0237253 | 3300049572 | Bacteria | 1530 |
| 803 | Ga0501036_0411357 | 3300049572 | Bacteria | 1128 |
| 804 | Ga0501036_0411687 | 3300049572 | Bacteria | 1127 |
| 805 | Ga0501036_0996251 | 3300049572 | Bacteria | 686 |
| 806 | Ga0501036_1058290 | 3300049572 | Bacteria | 663 |
| 807 | Ga0501037_0017735 | 3300049573 | Bacteria | 5239 |
| 808 | Ga0501037_0021388 | 3300049573 | Bacteria | 4779 |
| 809 | Ga0501037_0168587 | 3300049573 | Bacteria | 1558 |
| 810 | Ga0501037_0195584 | 3300049573 | Bacteria | 1430 |
| 811 | Ga0501037_0206675 | 3300049573 | Bacteria | 1386 |
| 812 | Ga0501037_0519538 | 3300049573 | Bacteria | 806 |
| 813 | Ga0501038_0042562 | 3300049574 | Bacteria | 3955 |
| 814 | Ga0501038_0180198 | 3300049574 | Bacteria | 1705 |
| 815 | Ga0501038_0282354 | 3300049574 | Bacteria | 1307 |
| 816 | Ga0501038_0536937 | 3300049574 | Bacteria | 891 |
| 817 | Ga0501038_0906948 | 3300049574 | Bacteria | 650 |
| 818 | Ga0501039_0002113 | 3300049575 | Bacteria | 14711 |
| 819 | Ga0501039_0049376 | 3300049575 | Bacteria | 3252 |
| 820 | Ga0501039_0308727 | 3300049575 | Bacteria | 1243 |
| 821 | Ga0501039_1047509 | 3300049575 | Bacteria | 633 |
| 822 | Ga0501040_0017061 | 3300049576 | Bacteria | 4816 |
| 823 | Ga0501041_0017640 | 3300049577 | Bacteria | 4248 |
| 824 | Ga0501042_0008704 | 3300049578 | Bacteria | 6730 |
| 825 | Ga0501042_0228234 | 3300049578 | Bacteria | 1343 |
| 826 | Ga0501042_0260029 | 3300049578 | Bacteria | 1253 |
| 827 | Ga0501042_0288533 | 3300049578 | Bacteria | 1185 |
| 828 | Ga0501043_0041509 | 3300049579 | Bacteria | 3614 |
| 829 | Ga0501043_0102115 | 3300049579 | Bacteria | 2254 |
| 830 | Ga0501043_0147855 | 3300049579 | Bacteria | 1839 |
| 831 | Ga0501043_0346802 | 3300049579 | Bacteria | 1129 |
| 832 | Ga0501043_0395431 | 3300049579 | Bacteria | 1045 |
| 833 | Ga0501043_0484803 | 3300049579 | Bacteria | 925 |
| 834 | Ga0501046_0014121 | 3300049580 | Bacteria | 6745 |
| 835 | Ga0501046_0084362 | 3300049580 | Bacteria | 2450 |
| 836 | Ga0501046_0342154 | 3300049580 | Bacteria | 1087 |
| 837 | Ga0501046_0430184 | 3300049580 | Bacteria | 951 |
| 838 | Ga0501046_0633474 | 3300049580 | Bacteria | 757 |
| 839 | Ga0501047_0023666 | 3300049581 | Bacteria | 5896 |
| 840 | Ga0501047_0072862 | 3300049581 | Bacteria | 3306 |
| 841 | Ga0501047_0272848 | 3300049581 | Bacteria | 1537 |
| 842 | Ga0501047_0327459 | 3300049581 | Bacteria | 1371 |
| 843 | Ga0501047_0373505 | 3300049581 | Bacteria | 1261 |
| 844 | Ga0501047_1010840 | 3300049581 | Bacteria | 645 |
| 845 | Ga0501047_1052878 | 3300049581 | Bacteria | 627 |
| 846 | Ga0501048_0010039 | 3300049582 | Bacteria | 7084 |
| 847 | Ga0501048_0198057 | 3300049582 | Bacteria | 1424 |
| 848 | Ga0501067_0158465 | 3300049583 | Bacteria | 1261 |
| 849 | Ga0501068_0094949 | 3300049584 | Bacteria | 1843 |
| 850 | Ga0501069_0612400 | 3300049585 | Bacteria | 654 |
| 851 | Ga0501069_0631134 | 3300049585 | Bacteria | 644 |
| 852 | Ga0501070_0048130 | 3300049586 | Bacteria | 3542 |
| 853 | Ga0501070_0057104 | 3300049586 | Bacteria | 3235 |
| 854 | Ga0501070_0548828 | 3300049586 | Bacteria | 925 |
| 855 | Ga0501070_0809480 | 3300049586 | Bacteria | 735 |
| 856 | Ga0501070_0978559 | 3300049586 | Bacteria | 657 |
| 857 | Ga0501070_0996187 | 3300049586 | Bacteria | 650 |
| 858 | Ga0501071_0050852 | 3300049587 | Bacteria | 2985 |
| 859 | Ga0501071_0382330 | 3300049587 | Bacteria | 1074 |
| 860 | Ga0501072_0001884 | 3300049588 | Bacteria | 15620 |
| 861 | Ga0501072_0263164 | 3300049588 | Bacteria | 1373 |
| 862 | Ga0501072_0321875 | 3300049588 | Bacteria | 1229 |
| 863 | Ga0501072_0345687 | 3300049588 | Bacteria | 1181 |
| 864 | Ga0501072_0503985 | 3300049588 | Bacteria | 957 |
| 865 | Ga0501072_1018620 | 3300049588 | Bacteria | 645 |
| 866 | Ga0501072_1138625 | 3300049588 | Bacteria | 607 |
| 867 | Ga0501073_0039915 | 3300049589 | Bacteria | 3324 |
| 868 | Ga0501073_0540520 | 3300049589 | Bacteria | 805 |
| 869 | Ga0501073_0617429 | 3300049589 | Bacteria | 748 |
| 870 | Ga0501074_0189365 | 3300049590 | Bacteria | 1467 |
| 871 | Ga0501074_0219718 | 3300049590 | Bacteria | 1353 |
| 872 | Ga0501074_0405920 | 3300049590 | Bacteria | 966 |
| 873 | Ga0501074_0576756 | 3300049590 | Bacteria | 796 |
| 874 | Ga0501074_0666831 | 3300049590 | Bacteria | 734 |
| 875 | Ga0501075_0015718 | 3300049591 | Bacteria | 5438 |
| 876 | Ga0501076_0018242 | 3300049592 | Bacteria | 5346 |
| 877 | Ga0501076_0142095 | 3300049592 | Bacteria | 1951 |
| 878 | Ga0501076_0224846 | 3300049592 | Bacteria | 1534 |
| 879 | Ga0501076_0942531 | 3300049592 | Bacteria | 711 |
| 880 | Ga0501077_0116244 | 3300049593 | Bacteria | 1695 |
| 881 | Ga0501225_0013278 | 3300049705 | Bacteria | 2307 |
| 882 | Ga0501245_081165 | 3300049708 | Bacteria | 627 |
| 883 | Ga0501079_0099277 | 3300049741 | Bacteria | 2256 |
| 884 | Ga0501079_0555316 | 3300049741 | Bacteria | 903 |
| 885 | Ga0501079_0666962 | 3300049741 | Bacteria | 819 |
| 886 | Ga0501080_0040964 | 3300049742 | Bacteria | 4318 |
| 887 | Ga0501080_0043942 | 3300049742 | Bacteria | 4160 |
| 888 | Ga0501080_0267426 | 3300049742 | Bacteria | 1557 |
| 889 | Ga0501080_0379970 | 3300049742 | Bacteria | 1273 |
| 890 | Ga0501080_0390530 | 3300049742 | Bacteria | 1253 |
| 891 | Ga0501080_0461476 | 3300049742 | Bacteria | 1138 |
| 892 | Ga0501080_0506927 | 3300049742 | Bacteria | 1078 |
| 893 | Ga0501080_1724065 | 3300049742 | Bacteria | 528 |
| 894 | Ga0501081_0115551 | 3300049743 | Bacteria | 1907 |
| 895 | Ga0501081_0305799 | 3300049743 | Bacteria | 1167 |
| 896 | Ga0501081_0390799 | 3300049743 | Bacteria | 1029 |
| 897 | Ga0501081_0577270 | 3300049743 | Bacteria | 841 |
| 898 | Ga0501083_0076712 | 3300049744 | Bacteria | 2218 |
| 899 | Ga0501266_092015 | 3300049763 | Bacteria | 528 |
| 900 | Ga0501035_0004418 | 3300049822 | Bacteria | 13348 |
| 901 | Ga0501035_0106313 | 3300049822 | Bacteria | 2460 |
| 902 | Ga0501035_0206294 | 3300049822 | Bacteria | 1683 |
| 903 | Ga0501044_0151055 | 3300049823 | Bacteria | 2304 |
| 904 | Ga0501044_0182883 | 3300049823 | Bacteria | 2062 |
| 905 | Ga0501044_0309268 | 3300049823 | Bacteria | 1507 |
| 906 | Ga0501044_0315133 | 3300049823 | Bacteria | 1490 |
| 907 | Ga0501044_0389944 | 3300049823 | Bacteria | 1307 |
| 908 | Ga0501044_0548368 | 3300049823 | Bacteria | 1053 |
| 909 | Ga0501044_0556863 | 3300049823 | Bacteria | 1043 |
| 910 | Ga0501044_0753926 | 3300049823 | Bacteria | 855 |
| 911 | Ga0501044_0997315 | 3300049823 | Bacteria | 709 |
| 912 | Ga0501044_1459637 | 3300049823 | Bacteria | 549 |
| 913 | Ga0501045_0054331 | 3300049824 | Bacteria | 2927 |
| 914 | Ga0501045_0736522 | 3300049824 | Bacteria | 727 |
| 915 | Ga0501045_1249794 | 3300049824 | Bacteria | 541 |
| 916 | nmdc:mga03683_15426_c1 | 3300050489 | Bacteria | 1887 |
| 917 | nmdc:mga03683_33662_c1 | 3300050489 | Bacteria | 2070 |
| 918 | nmdc:mga03683_4551_c1 | 3300050489 | Bacteria | 4615 |
| 919 | nmdc:mga03683_56660_c1 | 3300050489 | Bacteria | 1648 |
| 920 | nmdc:mga03n38_27914_c1 | 3300050490 | Bacteria | 2346 |
| 921 | nmdc:mga03n38_471881_c1 | 3300050490 | Bacteria | 701 |
| 922 | nmdc:mga03n38_7293_c1 | 3300050490 | Bacteria | 3906 |
| 923 | nmdc:mga00v17_126638_c1 | 3300050491 | Bacteria | 1630 |
| 924 | nmdc:mga00v17_170368_c1 | 3300050491 | Bacteria | 1404 |
| 925 | nmdc:mga00v17_59684_c1 | 3300050491 | Bacteria | 2341 |
| 926 | nmdc:mga0yw44_523446_c1 | 3300050492 | Bacteria | 805 |
| 927 | nmdc:mga0k408_235620_c1 | 3300050493 | Bacteria | 1093 |
| 928 | nmdc:mga0k408_24799_c1 | 3300050493 | Bacteria | 3393 |
| 929 | nmdc:mga0k408_63879_c1 | 3300050493 | Bacteria | 2142 |
| 930 | nmdc:mga06z11_15472_c1 | 3300050494 | Bacteria | 3406 |
| 931 | nmdc:mga06z11_593224_c1 | 3300050494 | Bacteria | 674 |
| 932 | nmdc:mga06z11_77218_c1 | 3300050494 | Bacteria | 1778 |
| 933 | nmdc:mga06z11_777235_c1 | 3300050494 | Bacteria | 583 |
| 934 | nmdc:mga07m45_256893_c1 | 3300050496 | Bacteria | 1016 |
| 935 | nmdc:mga07m45_277624_c1 | 3300050496 | Bacteria | 975 |
| 936 | nmdc:mga07m45_87006_c1 | 3300050496 | Bacteria | 1788 |
| 937 | nmdc:mga09592_150655_c1 | 3300050508 | Bacteria | 2006 |
| 938 | nmdc:mga0qj67_138207_c1 | 3300050509 | Bacteria | 1975 |
| 939 | nmdc:mga06r32_1500966_c1 | 3300050510 | Bacteria | 614 |
| 940 | nmdc:mga08y16_225804_c1 | 3300050511 | Bacteria | 1938 |
| 941 | nmdc:mga0n895_915730_c1 | 3300050512 | Bacteria | 861 |
| 942 | nmdc:mga08x19_1313589_c1 | 3300050514 | Bacteria | 512 |
| 943 | nmdc:mga0a205_400896_c1 | 3300050515 | Bacteria | 1235 |
| 944 | Ga0500651_0147122 | 3300053093 | Bacteria | 1417 |
| 945 | Ga0500651_0749941 | 3300053093 | Bacteria | 518 |
| 946 | Ga0500641_0004296 | 3300053096 | Bacteria | 5026 |
| 947 | Ga0500558_169022 | 3300053106 | Bacteria | 793 |
| 948 | Ga0500562_045367 | 3300053108 | Bacteria | 1171 |
| 949 | Ga0500592_073790 | 3300053116 | Bacteria | 564 |
| 950 | Ga0500593_000058 | 3300053117 | Bacteria | 41070 |
| 951 | Ga0500595_035050 | 3300053119 | Bacteria | 1656 |
| 952 | Ga0500597_424565 | 3300053120 | Bacteria | 500 |
| 953 | Ga0500618_099914 | 3300053125 | Bacteria | 653 |
| 954 | Ga0500642_0128563 | 3300053130 | Bacteria | 1187 |
| 955 | Ga0500658_0152050 | 3300053134 | Bacteria | 1044 |
| 956 | Ga0500658_0197301 | 3300053134 | Bacteria | 920 |
| 957 | Ga0500559_0351656 | 3300053136 | Bacteria | 689 |
| 958 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 959 | Ga0500588_0026749 | 3300053146 | Bacteria | 1617 |
| 960 | Ga0500604_0000294 | 3300053151 | Bacteria | 13881 |
| 961 | Ga0500616_0004782 | 3300053153 | Bacteria | 9491 |
| 962 | Ga0500616_0036565 | 3300053153 | Bacteria | 2665 |
| 963 | Ga0500624_002765 | 3300053157 | Bacteria | 2333 |
| 964 | Ga0500627_0230262 | 3300053158 | Bacteria | 825 |
| 965 | Ga0500634_0000031 | 3300053161 | Bacteria | 75547 |
| 966 | Ga0500609_017819 | 3300053731 | Bacteria | 966 |
| 967 | Ga0500552_000085 | 3300053733 | Bacteria | 7626 |
| 968 | Ga0501084_0412365 | 3300054114 | Bacteria | 1142 |
| 969 | Ga0501084_0646446 | 3300054114 | Bacteria | 893 |
| 970 | Ga0501084_1333973 | 3300054114 | Bacteria | 601 |
| 971 | Ga0587084_003875 | 3300059477 | Bacteria | 1675 |
| 972 | Ga0587084_050266 | 3300059477 | Bacteria | 736 |
| 973 | Ga0587084_055003 | 3300059477 | Bacteria | 715 |
| 974 | Ga0587084_083566 | 3300059477 | Bacteria | 622 |
| 975 | Ga0587084_089472 | 3300059477 | Bacteria | 608 |
| 976 | Ga0587093_010726 | 3300059478 | Bacteria | 1086 |
| 977 | Ga0587070_051636 | 3300059491 | Bacteria | 823 |
| 978 | Ga0587073_0037841 | 3300059492 | Bacteria | 1036 |
| 979 | Ga0587077_001444 | 3300059493 | Bacteria | 2552 |
| 980 | Ga0587077_001858 | 3300059493 | Bacteria | 2381 |
| 981 | Ga0587077_002494 | 3300059493 | Bacteria | 2191 |
| 982 | Ga0587077_023368 | 3300059493 | Bacteria | 1116 |
| 983 | Ga0587077_034979 | 3300059493 | Bacteria | 979 |
| 984 | Ga0587080_006331 | 3300059503 | Bacteria | 1627 |
| 985 | Ga0587082_001421 | 3300059504 | Bacteria | 2483 |
| 986 | Ga0587082_015733 | 3300059504 | Bacteria | 1172 |
| 987 | Ga0587082_071053 | 3300059504 | Bacteria | 707 |
| 988 | Ga0587082_105589 | 3300059504 | Bacteria | 619 |
| 989 | Ga0587083_0082405 | 3300059505 | Bacteria | 769 |
| 990 | Ga0587085_057305 | 3300059506 | Bacteria | 727 |
| 991 | Ga0587085_096769 | 3300059506 | Bacteria | 617 |
| 992 | Ga0587086_009659 | 3300059507 | Bacteria | 1152 |
| 993 | Ga0587088_007703 | 3300059508 | Bacteria | 1499 |
| 994 | Ga0587088_011507 | 3300059508 | Bacteria | 1319 |
| 995 | Ga0587088_013341 | 3300059508 | Bacteria | 1260 |
| 996 | Ga0587088_066307 | 3300059508 | Bacteria | 743 |
| 997 | Ga0587088_093330 | 3300059508 | Bacteria | 662 |
| 998 | Ga0587089_012097 | 3300059509 | Bacteria | 1097 |
| 999 | Ga0587090_007514 | 3300059510 | Bacteria | 1433 |
| 1000 | Ga0587090_037431 | 3300059510 | Bacteria | 839 |
| 1001 | Ga0587090_047818 | 3300059510 | Bacteria | 775 |
| 1002 | Ga0587091_037281 | 3300059511 | Bacteria | 943 |
| 1003 | Ga0587091_077869 | 3300059511 | Bacteria | 738 |
| 1004 | Ga0587092_045558 | 3300059512 | Bacteria | 778 |
| 1005 | Ga0587094_016519 | 3300059513 | Bacteria | 1029 |
| 1006 | Ga0587095_016766 | 3300059514 | Bacteria | 674 |
| 1007 | Ga0587106_014372 | 3300059605 | Bacteria | 1090 |
| 1008 | Ga0587106_037582 | 3300059605 | Bacteria | 807 |
| 1009 | Ga0587125_004018 | 3300059607 | Bacteria | 1285 |
| 1010 | Ga0587125_004288 | 3300059607 | Bacteria | 1260 |
| 1011 | Ga0587125_014823 | 3300059607 | Bacteria | 858 |
| 1012 | Ga0587101_000419 | 3300059623 | Bacteria | 2969 |
| 1013 | Ga0587101_005367 | 3300059623 | Bacteria | 1419 |
| 1014 | Ga0587101_052671 | 3300059623 | Bacteria | 705 |
| 1015 | Ga0587109_008800 | 3300059624 | Bacteria | 1568 |
| 1016 | Ga0587113_007243 | 3300059625 | Bacteria | 962 |
| 1017 | Ga0587115_002202 | 3300059626 | Bacteria | 1904 |
| 1018 | Ga0587128_022544 | 3300059630 | Bacteria | 981 |
| 1019 | Ga0587128_072627 | 3300059630 | Bacteria | 673 |
| 1020 | Ga0587062_000396 | 3300059639 | Bacteria | 2976 |
| 1021 | Ga0587062_035592 | 3300059639 | Bacteria | 785 |
| 1022 | Ga0587062_059166 | 3300059639 | Bacteria | 668 |
| 1023 | Ga0587062_069540 | 3300059639 | Bacteria | 634 |
| 1024 | Ga0587068_064862 | 3300059641 | Bacteria | 710 |
| 1025 | Ga0587068_065733 | 3300059641 | Bacteria | 706 |
| 1026 | Ga0587068_072764 | 3300059641 | Bacteria | 681 |
| 1027 | Ga0587068_140533 | 3300059641 | Bacteria | 539 |
| 1028 | Ga0587069_088448 | 3300059642 | Bacteria | 615 |
| 1029 | Ga0587072_001969 | 3300059643 | Bacteria | 2674 |
| 1030 | Ga0587072_086429 | 3300059643 | Bacteria | 685 |
| 1031 | Ga0587072_119616 | 3300059643 | Bacteria | 609 |
| 1032 | Ga0587072_173954 | 3300059643 | Bacteria | 533 |
| 1033 | Ga0587075_035777 | 3300059644 | Bacteria | 811 |
| 1034 | Ga0587075_053092 | 3300059644 | Bacteria | 712 |
| 1035 | Ga0587075_071844 | 3300059644 | Bacteria | 644 |
| 1036 | Ga0587076_001599 | 3300059645 | Bacteria | 2341 |
| 1037 | Ga0587076_122057 | 3300059645 | Bacteria | 605 |
| 1038 | Ga0587076_132225 | 3300059645 | Bacteria | 589 |
| 1039 | Ga0587078_009790 | 3300059646 | Bacteria | 1092 |
| 1040 | Ga0587078_028130 | 3300059646 | Bacteria | 745 |
| 1041 | Ga0587079_027627 | 3300059647 | Bacteria | 1069 |
| 1042 | Ga0587079_121447 | 3300059647 | Bacteria | 646 |
| 1043 | Ga0587079_190566 | 3300059647 | Bacteria | 554 |
| 1044 | Ga0587100_007768 | 3300059648 | Bacteria | 854 |
| 1045 | Ga0587100_042521 | 3300059648 | Bacteria | 516 |
| 1046 | Ga0587102_009709 | 3300059649 | Bacteria | 939 |
| 1047 | Ga0587104_006947 | 3300059650 | Bacteria | 776 |
| 1048 | Ga0587105_021399 | 3300059651 | Bacteria | 570 |
| 1049 | Ga0587107_001723 | 3300059652 | Bacteria | 1834 |
| 1050 | Ga0587107_003424 | 3300059652 | Bacteria | 1538 |
| 1051 | Ga0587107_011495 | 3300059652 | Bacteria | 1085 |
| 1052 | Ga0587107_079609 | 3300059652 | Bacteria | 614 |
| 1053 | Ga0587107_088702 | 3300059652 | Bacteria | 594 |
| 1054 | Ga0587108_002343 | 3300059653 | Bacteria | 1263 |
| 1055 | Ga0587108_032191 | 3300059653 | Bacteria | 540 |
| 1056 | Ga0587110_001125 | 3300059654 | Bacteria | 1853 |
| 1057 | Ga0587110_046651 | 3300059654 | Bacteria | 570 |
| 1058 | Ga0587114_052798 | 3300059655 | Bacteria | 693 |
| 1059 | Ga0587119_044866 | 3300059658 | Bacteria | 645 |
| 1060 | Ga0587124_004270 | 3300059660 | Bacteria | 1097 |
| 1061 | Ga0587124_027474 | 3300059660 | Bacteria | 613 |
| 1062 | Ga0587096_03993 | 3300060247 | Bacteria | 611 |
| 1063 | Ga0587071_074262 | 3300060344 | Bacteria | 746 |
| 1064 | Ga0587071_077540 | 3300060344 | Bacteria | 735 |
| 1065 | Ga0587111_0000931 | 3300060346 | Bacteria | 3213 |
| 1066 | Ga0587111_0029655 | 3300060346 | Bacteria | 1109 |
| 1067 | Ga0587111_0032299 | 3300060346 | Bacteria | 1076 |
| 1068 | Ga0587111_0098969 | 3300060346 | Bacteria | 724 |
| 1069 | Ga0587111_0151807 | 3300060346 | Bacteria | 623 |
| 1070 | Ga0501082_0090464 | 3300060353 | Bacteria | 2642 |
| 1071 | Ga0501082_0629535 | 3300060353 | Bacteria | 939 |
| 1072 | Ga0501082_1531683 | 3300060353 | Bacteria | 582 |
| 1073 | Ga0466962_0189993 | 3300061719 | Bacteria | 1002 |
| 1074 | Ga0466962_0490064 | 3300061719 | Bacteria | 621 |
| 1075 | Ga0530510_0020928 | 3300061734 | Bacteria | 4652 |
| 1076 | Ga0530510_0118649 | 3300061734 | Bacteria | 1941 |
| 1077 | Ga0530510_0211241 | 3300061734 | Bacteria | 1442 |
| 1078 | Ga0530510_0566665 | 3300061734 | Bacteria | 863 |
| 1079 | Ga0530510_0665620 | 3300061734 | Bacteria | 793 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300033541 | Ga0316596_1046749 | Ga0316596_10467492 | 113 |
| 2 | 3300032168 | Ga0316593_10016899 | Ga0316593_100168993 | 114 |
| 3 | 3300033528 | Ga0316588_1091985 | Ga0316588_10919852 | 114 |
| 4 | 3300033528 | Ga0316588_1145952 | Ga0316588_11459522 | 114 |
| 5 | 3300033541 | Ga0316596_1002889 | Ga0316596_10028893 | 114 |
| 6 | 3300044712 | Ga0453684_0386411 | Ga0453684_0386411_666_1046 | 114 |
| 7 | 3300005471 | Ga0070698_100525376 | Ga0070698_1005253761 | 118 |
| 8 | 3300006173 | Ga0070716_101271575 | Ga0070716_1012715751 | 118 |
| 9 | 3300041997 | Ga0439431_0095136 | Ga0439431_0095136_249_650 | 118 |
| 10 | 3300005439 | Ga0070711_100426424 | Ga0070711_1004264242 | 119 |
| 11 | 3300005539 | Ga0068853_101193400 | Ga0068853_1011934001 | 119 |
| 12 | 3300005563 | Ga0068855_100404497 | Ga0068855_1004044972 | 119 |
| 13 | 3300005618 | Ga0068864_101511055 | Ga0068864_1015110551 | 119 |
| 14 | 3300007788 | Ga0099795_10033771 | Ga0099795_100337712 | 119 |
| 15 | 3300010159 | Ga0099796_10469469 | Ga0099796_104694691 | 119 |
| 16 | 3300013105 | Ga0157369_11953758 | Ga0157369_119537581 | 119 |
| 17 | 3300031727 | Ga0316576_10000992 | Ga0316576_100009926 | 119 |
| 18 | 3300032168 | Ga0316593_10180861 | Ga0316593_101808612 | 119 |
| 19 | 3300033524 | Ga0316592_1000397 | Ga0316592_10003976 | 119 |
| 20 | 3300033524 | Ga0316592_1002468 | Ga0316592_10024684 | 119 |
| 21 | 3300033527 | Ga0316586_1047442 | Ga0316586_10474422 | 119 |
| 22 | 3300033528 | Ga0316588_1021266 | Ga0316588_10212663 | 119 |
| 23 | 3300033528 | Ga0316588_1021863 | Ga0316588_10218632 | 119 |
| 24 | 3300033528 | Ga0316588_1069510 | Ga0316588_10695101 | 119 |
| 25 | 3300033541 | Ga0316596_1000006 | Ga0316596_100000627 | 119 |
| 26 | 3300033541 | Ga0316596_1001245 | Ga0316596_10012455 | 119 |
| 27 | 3300035398 | Ga0316574_0063562 | Ga0316574_0063562_798_1196 | 119 |
| 28 | 3300035398 | Ga0316574_0784145 | Ga0316574_0784145_139_537 | 119 |
| 29 | 3300036712 | Ga0316584_0335837 | Ga0316584_0335837_23_421 | 119 |
| 30 | 3300039062 | Ga0400483_094026 | Ga0400483_094026_538_936 | 119 |
| 31 | 3300044712 | Ga0453684_0007136 | Ga0453684_0007136_12743_13141 | 119 |
| 32 | 3300049589 | Ga0501073_0540520 | Ga0501073_0540520_115_522 | 119 |
| 33 | 3300049823 | Ga0501044_0182883 | Ga0501044_0182883_822_1229 | 119 |
| 34 | 3300005327 | Ga0070658_10483582 | Ga0070658_104835821 | 120 |
| 35 | 3300005364 | Ga0070673_100695057 | Ga0070673_1006950571 | 120 |
| 36 | 3300005577 | Ga0068857_100519616 | Ga0068857_1005196162 | 120 |
| 37 | 3300005617 | Ga0068859_101482758 | Ga0068859_1014827582 | 120 |
| 38 | 3300005937 | Ga0081455_10019943 | Ga0081455_1001994312 | 120 |
| 39 | 3300006177 | Ga0075362_10374474 | Ga0075362_103744742 | 120 |
| 40 | 3300006914 | Ga0075436_100881198 | Ga0075436_1008811981 | 120 |
| 41 | 3300006931 | Ga0097620_101482874 | Ga0097620_1014828742 | 120 |
| 42 | 3300013105 | Ga0157369_10140386 | Ga0157369_101403863 | 120 |
| 43 | 3300020070 | Ga0206356_11445679 | Ga0206356_114456792 | 120 |
| 44 | 3300020082 | Ga0206353_11578995 | Ga0206353_115789952 | 120 |
| 45 | 3300025898 | Ga0207692_10308768 | Ga0207692_103087682 | 120 |
| 46 | 3300025906 | Ga0207699_11447269 | Ga0207699_114472691 | 120 |
| 47 | 3300025918 | Ga0207662_10207608 | Ga0207662_102076083 | 120 |
| 48 | 3300025920 | Ga0207649_10928663 | Ga0207649_109286632 | 120 |
| 49 | 3300025938 | Ga0207704_11501213 | Ga0207704_115012131 | 120 |
| 50 | 3300025986 | Ga0207658_11135809 | Ga0207658_111358091 | 120 |
| 51 | 3300026041 | Ga0207639_10521468 | Ga0207639_105214681 | 120 |
| 52 | 3300026116 | Ga0207674_10467969 | Ga0207674_104679692 | 120 |
| 53 | 3300026121 | Ga0207683_10547904 | Ga0207683_105479042 | 120 |
| 54 | 3300035695 | Ga0373927_0093114 | Ga0373927_0093114_304_738 | 120 |
| 55 | 3300035695 | Ga0373927_0199442 | Ga0373927_0199442_319_747 | 120 |
| 56 | 3300037466 | Ga0395898_0045631 | Ga0395898_0045631_2263_2679 | 120 |
| 57 | 3300039453 | Ga0436362_0313849 | Ga0436362_0313849_95_523 | 120 |
| 58 | 3300046517 | Ga0495630_0370866 | Ga0495630_0370866_73_501 | 120 |
| 59 | 3300050489 | nmdc:mga03683_4551_c1 | nmdc:mga03683_4551_c1_4093_4515 | 120 |
| 60 | 3300050514 | nmdc:mga08x19_1313589_c1 | nmdc:mga08x19_1313589_c1_38_454 | 120 |
| 61 | 3300053093 | Ga0500651_0147122 | Ga0500651_0147122_506_922 | 120 |
| 62 | 3300053106 | Ga0500558_169022 | Ga0500558_169022_241_657 | 120 |
| 63 | 3300053134 | Ga0500658_0197301 | Ga0500658_0197301_446_868 | 120 |
| 64 | 3300053153 | Ga0500616_0004782 | Ga0500616_0004782_1658_2080 | 120 |
| 65 | 3300053733 | Ga0500552_000085 | Ga0500552_000085_1691_2107 | 120 |
| 66 | 3300005329 | Ga0070683_100081257 | Ga0070683_1000812572 | 121 |
| 67 | 3300005339 | Ga0070660_101397473 | Ga0070660_1013974731 | 121 |
| 68 | 3300005340 | Ga0070689_100196042 | Ga0070689_1001960422 | 121 |
| 69 | 3300005457 | Ga0070662_100298211 | Ga0070662_1002982111 | 121 |
| 70 | 3300005563 | Ga0068855_100514510 | Ga0068855_1005145102 | 121 |
| 71 | 3300005564 | Ga0070664_100028105 | Ga0070664_1000281057 | 121 |
| 72 | 3300005614 | Ga0068856_100009374 | Ga0068856_10000937418 | 121 |
| 73 | 3300005616 | Ga0068852_100323807 | Ga0068852_1003238072 | 121 |
| 74 | 3300006038 | Ga0075365_10394540 | Ga0075365_103945401 | 121 |
| 75 | 3300006177 | Ga0075362_10307659 | Ga0075362_103076591 | 121 |
| 76 | 3300006186 | Ga0075369_10493729 | Ga0075369_104937291 | 121 |
| 77 | 3300006353 | Ga0075370_10226593 | Ga0075370_102265932 | 121 |
| 78 | 3300009545 | Ga0105237_10324209 | Ga0105237_103242093 | 121 |
| 79 | 3300009551 | Ga0105238_10188920 | Ga0105238_101889202 | 121 |
| 80 | 3300010375 | Ga0105239_11564626 | Ga0105239_115646262 | 121 |
| 81 | 3300013100 | Ga0157373_10877508 | Ga0157373_108775082 | 121 |
| 82 | 3300013307 | Ga0157372_11177110 | Ga0157372_111771102 | 121 |
| 83 | 3300013307 | Ga0157372_12716499 | Ga0157372_127164991 | 121 |
| 84 | 3300020082 | Ga0206353_10208749 | Ga0206353_102087492 | 121 |
| 85 | 3300025914 | Ga0207671_10150809 | Ga0207671_101508092 | 121 |
| 86 | 3300025926 | Ga0207659_10851713 | Ga0207659_108517132 | 121 |
| 87 | 3300025933 | Ga0207706_10171232 | Ga0207706_101712324 | 121 |
| 88 | 3300025935 | Ga0207709_11264225 | Ga0207709_112642251 | 121 |
| 89 | 3300025936 | Ga0207670_10273018 | Ga0207670_102730182 | 121 |
| 90 | 3300025942 | Ga0207689_11336960 | Ga0207689_113369602 | 121 |
| 91 | 3300025945 | Ga0207679_10286228 | Ga0207679_102862282 | 121 |
| 92 | 3300025949 | Ga0207667_10254554 | Ga0207667_102545542 | 121 |
| 93 | 3300025981 | Ga0207640_10711524 | Ga0207640_107115242 | 121 |
| 94 | 3300026041 | Ga0207639_10236751 | Ga0207639_102367512 | 121 |
| 95 | 3300026078 | Ga0207702_10023608 | Ga0207702_100236082 | 121 |
| 96 | 3300026116 | Ga0207674_10150891 | Ga0207674_101508912 | 121 |
| 97 | 3300026142 | Ga0207698_10054516 | Ga0207698_100545162 | 121 |
| 98 | 3300035084 | Ga0373928_0111875 | Ga0373928_0111875_211_633 | 121 |
| 99 | 3300037312 | Ga0395899_0034692 | Ga0395899_0034692_3310_3732 | 121 |
| 100 | 3300037418 | Ga0395900_0415129 | Ga0395900_0415129_828_1250 | 121 |
| 101 | 3300037466 | Ga0395898_0005690 | Ga0395898_0005690_2491_2913 | 121 |
| 102 | 3300038443 | Ga0395901_0007619 | Ga0395901_0007619_10321_10743 | 121 |
| 103 | 3300038443 | Ga0395901_0146970 | Ga0395901_0146970_185_607 | 121 |
| 104 | 3300039450 | Ga0436363_0205355 | Ga0436363_0205355_146_568 | 121 |
| 105 | 3300042005 | Ga0439448_0014543 | Ga0439448_0014543_1451_1873 | 121 |
| 106 | 3300044694 | Ga0466963_0029443 | Ga0466963_0029443_385_807 | 121 |
| 107 | 3300045976 | Ga0466967_0013435 | Ga0466967_0013435_1696_2118 | 121 |
| 108 | 3300049586 | Ga0501070_0978559 | Ga0501070_0978559_146_568 | 121 |
| 109 | 3300050496 | nmdc:mga07m45_256893_c1 | nmdc:mga07m45_256893_c1_311_730 | 121 |
| 110 | 3300005336 | Ga0070680_100825801 | Ga0070680_1008258012 | 122 |
| 111 | 3300005518 | Ga0070699_100441013 | Ga0070699_1004410132 | 122 |
| 112 | 3300005563 | Ga0068855_101969227 | Ga0068855_1019692271 | 122 |
| 113 | 3300006042 | Ga0075368_10347243 | Ga0075368_103472431 | 122 |
| 114 | 3300006237 | Ga0097621_100872233 | Ga0097621_1008722331 | 122 |
| 115 | 3300006358 | Ga0068871_100902851 | Ga0068871_1009028512 | 122 |
| 116 | 3300020080 | Ga0206350_10890309 | Ga0206350_108903091 | 122 |
| 117 | 3300025913 | Ga0207695_10214224 | Ga0207695_102142242 | 122 |
| 118 | 3300025921 | Ga0207652_11735252 | Ga0207652_117352521 | 122 |
| 119 | 3300025949 | Ga0207667_10157267 | Ga0207667_101572673 | 122 |
| 120 | 3300048907 | Ga0496104_0228525 | Ga0496104_0228525_825_1232 | 122 |
| 121 | 3300053093 | Ga0500651_0749941 | Ga0500651_0749941_23_445 | 122 |
| 122 | 3300053130 | Ga0500642_0128563 | Ga0500642_0128563_158_580 | 122 |
| 123 | 3300005445 | Ga0070708_100278752 | Ga0070708_1002787522 | 123 |
| 124 | 3300005536 | Ga0070697_100081984 | Ga0070697_1000819842 | 123 |
| 125 | 3300027671 | Ga0209588_1094859 | Ga0209588_10948592 | 123 |
| 126 | 3300028653 | Ga0265323_10180116 | Ga0265323_101801162 | 123 |
| 127 | 3300031235 | Ga0265330_10001669 | Ga0265330_1000166919 | 123 |
| 128 | 3300031238 | Ga0265332_10104902 | Ga0265332_101049022 | 123 |
| 129 | 3300031239 | Ga0265328_10116335 | Ga0265328_101163352 | 123 |
| 130 | 3300031249 | Ga0265339_10294991 | Ga0265339_102949911 | 123 |
| 131 | 3300031344 | Ga0265316_10013594 | Ga0265316_100135944 | 123 |
| 132 | 3300031344 | Ga0265316_10865013 | Ga0265316_108650131 | 123 |
| 133 | 3300031712 | Ga0265342_10008211 | Ga0265342_100082114 | 123 |
| 134 | 3300033528 | Ga0316588_1018041 | Ga0316588_10180413 | 123 |
| 135 | 3300033541 | Ga0316596_1046657 | Ga0316596_10466573 | 123 |
| 136 | 3300035170 | Ga0373943_0119908 | Ga0373943_0119908_841_1257 | 123 |
| 137 | 3300035695 | Ga0373927_0280407 | Ga0373927_0280407_185_601 | 123 |
| 138 | 3300035725 | Ga0373947_0230782 | Ga0373947_0230782_237_653 | 123 |
| 139 | 3300044712 | Ga0453684_0041859 | Ga0453684_0041859_4448_4828 | 123 |
| 140 | 3300044712 | Ga0453684_0282064 | Ga0453684_0282064_129_509 | 123 |
| 141 | 3300005328 | Ga0070676_10322091 | Ga0070676_103220912 | 124 |
| 142 | 3300005338 | Ga0068868_100125269 | Ga0068868_1001252692 | 124 |
| 143 | 3300005339 | Ga0070660_100173896 | Ga0070660_1001738962 | 124 |
| 144 | 3300005343 | Ga0070687_100352816 | Ga0070687_1003528162 | 124 |
| 145 | 3300005347 | Ga0070668_100341616 | Ga0070668_1003416162 | 124 |
| 146 | 3300005354 | Ga0070675_100065182 | Ga0070675_1000651824 | 124 |
| 147 | 3300005356 | Ga0070674_100013740 | Ga0070674_1000137403 | 124 |
| 148 | 3300005364 | Ga0070673_100089902 | Ga0070673_1000899023 | 124 |
| 149 | 3300005364 | Ga0070673_101731876 | Ga0070673_1017318761 | 124 |
| 150 | 3300005366 | Ga0070659_100133943 | Ga0070659_1001339432 | 124 |
| 151 | 3300005455 | Ga0070663_100223410 | Ga0070663_1002234102 | 124 |
| 152 | 3300005456 | Ga0070678_100090091 | Ga0070678_1000900912 | 124 |
| 153 | 3300005459 | Ga0068867_100332252 | Ga0068867_1003322521 | 124 |
| 154 | 3300005468 | Ga0070707_101039777 | Ga0070707_1010397772 | 124 |
| 155 | 3300005539 | Ga0068853_100018646 | Ga0068853_1000186462 | 124 |
| 156 | 3300006195 | Ga0075366_10325152 | Ga0075366_103251522 | 124 |
| 157 | 3300009093 | Ga0105240_11245495 | Ga0105240_112454952 | 124 |
| 158 | 3300009174 | Ga0105241_10046588 | Ga0105241_100465882 | 124 |
| 159 | 3300009176 | Ga0105242_10785706 | Ga0105242_107857062 | 124 |
| 160 | 3300009551 | Ga0105238_10055969 | Ga0105238_100559696 | 124 |
| 161 | 3300013100 | Ga0157373_11110644 | Ga0157373_111106441 | 124 |
| 162 | 3300013102 | Ga0157371_10354604 | Ga0157371_103546042 | 124 |
| 163 | 3300013306 | Ga0163162_11135741 | Ga0163162_111357412 | 124 |
| 164 | 3300013308 | Ga0157375_11105737 | Ga0157375_111057371 | 124 |
| 165 | 3300014325 | Ga0163163_11694588 | Ga0163163_116945881 | 124 |
| 166 | 3300014497 | Ga0182008_10353852 | Ga0182008_103538521 | 124 |
| 167 | 3300025907 | Ga0207645_10096200 | Ga0207645_100962002 | 124 |
| 168 | 3300034816 | Ga0373930_0044054 | Ga0373930_0044054_213_587 | 124 |
| 169 | 3300034817 | Ga0373948_0088029 | Ga0373948_0088029_306_680 | 124 |
| 170 | 3300035084 | Ga0373928_0016766 | Ga0373928_0016766_922_1296 | 124 |
| 171 | 3300035090 | Ga0373949_0272614 | Ga0373949_0272614_80_454 | 124 |
| 172 | 3300035092 | Ga0373952_0067472 | Ga0373952_0067472_376_750 | 124 |
| 173 | 3300035112 | Ga0373932_0116585 | Ga0373932_0116585_321_695 | 124 |
| 174 | 3300035207 | Ga0373942_0064607 | Ga0373942_0064607_126_500 | 124 |
| 175 | 3300042439 | Ga0439464_0114669 | Ga0439464_0114669_345_764 | 124 |
| 176 | 3300046616 | Ga0495668_0439473 | Ga0495668_0439473_300_674 | 124 |
| 177 | 3300048912 | Ga0496109_0405595 | Ga0496109_0405595_525_899 | 124 |
| 178 | 3300048920 | Ga0496117_0190708 | Ga0496117_0190708_236_610 | 124 |
| 179 | 3300048922 | Ga0496119_0441059 | Ga0496119_0441059_77_451 | 124 |
| 180 | 3300048924 | Ga0496121_0091176 | Ga0496121_0091176_1749_2123 | 124 |
| 181 | 3300050489 | nmdc:mga03683_56660_c1 | nmdc:mga03683_56660_c1_456_875 | 124 |
| 182 | 3300059643 | Ga0587072_173954 | Ga0587072_173954_74_484 | 124 |
| 183 | 3300005467 | Ga0070706_100100584 | Ga0070706_1001005843 | 125 |
| 184 | 3300005471 | Ga0070698_100001015 | Ga0070698_1000010155 | 125 |
| 185 | 3300044712 | Ga0453684_1161825 | Ga0453684_1161825_10_408 | 125 |
| 186 | 3300045051 | Ga0451576_0001012 | Ga0451576_0001012_13154_13552 | 125 |
| 187 | iso_pu_bacteria | 2713897090 | 2715500532 | 125 |
| 188 | iso_pu_bacteria | 2834578030 | 2834579311 | 125 |
| 189 | iso_pu_bacteria | 2855020534 | 2855020877 | 125 |
| 190 | iso_pu_bacteria | 2899259804 | 2899262523 | 125 |
| 191 | iso_pu_bacteria | 2899275550 | 2899277156 | 125 |
| 192 | iso_pu_bacteria | 3000405567 | 3000406711 | 125 |
| 193 | iso_pu_bacteria | 8057132660 | 8057134769 | 125 |
| 194 | 3300013306 | Ga0163162_11674216 | Ga0163162_116742162 | 126 |
| 195 | 3300059492 | Ga0587073_0037841 | Ga0587073_0037841_532_921 | 126 |
| 196 | iso_pu_bacteria | 2643221580 | 2643911603 | 126 |
| 197 | iso_pu_bacteria | 2643221591 | 2643963597 | 126 |
| 198 | iso_pu_bacteria | 2643221629 | 2644165879 | 126 |
| 199 | iso_pu_bacteria | 2643221662 | 2644347111 | 126 |
| 200 | iso_pu_bacteria | 2643221674 | 2644410395 | 126 |
| 201 | iso_pu_bacteria | 2898795034 | 2898796968 | 126 |
| 202 | iso_pu_bacteria | 2929297113 | 2929298349 | 126 |
| 203 | iso_pu_bacteria | 2932401849 | 2932403085 | 126 |
| 204 | 3300031691 | Ga0316579_10466402 | Ga0316579_104664022 | 127 |
| 205 | 3300031727 | Ga0316576_10001969 | Ga0316576_1000196910 | 127 |
| 206 | 3300031728 | Ga0316578_10478936 | Ga0316578_104789361 | 127 |
| 207 | 3300032133 | Ga0316583_10037793 | Ga0316583_100377932 | 127 |
| 208 | 3300032168 | Ga0316593_10076675 | Ga0316593_100766752 | 127 |
| 209 | 3300032168 | Ga0316593_10086008 | Ga0316593_100860082 | 127 |
| 210 | 3300032168 | Ga0316593_10095295 | Ga0316593_100952952 | 127 |
| 211 | 3300032168 | Ga0316593_10186093 | Ga0316593_101860931 | 127 |
| 212 | 3300033528 | Ga0316588_1111182 | Ga0316588_11111821 | 127 |
| 213 | 3300033541 | Ga0316596_1006883 | Ga0316596_10068832 | 127 |
| 214 | 3300033541 | Ga0316596_1094274 | Ga0316596_10942742 | 127 |
| 215 | 3300036647 | Ga0316582_0502385 | Ga0316582_0502385_13_402 | 127 |
| 216 | 3300036712 | Ga0316584_0092322 | Ga0316584_0092322_1217_1606 | 127 |
| 217 | 3300036712 | Ga0316584_0779274 | Ga0316584_0779274_221_610 | 127 |
| 218 | 3300041459 | Ga0451800_1508070 | Ga0451800_1508070_82_471 | 127 |
| 219 | 3300049127 | Ga0501306_010078 | Ga0501306_010078_214_597 | 127 |
| 220 | 3300049127 | Ga0501306_014887 | Ga0501306_014887_214_597 | 127 |
| 221 | 3300049130 | Ga0501310_004086 | Ga0501310_004086_641_1024 | 127 |
| 222 | 3300049571 | Ga0501034_0000482 | Ga0501034_0000482_33906_34295 | 127 |
| 223 | iso_pu_bacteria | 2522572158 | 2523107255 | 127 |
| 224 | 3300013102 | Ga0157371_10294763 | Ga0157371_102947631 | 128 |
| 225 | 3300031691 | Ga0316579_10460260 | Ga0316579_104602602 | 128 |
| 226 | 3300031727 | Ga0316576_10165433 | Ga0316576_101654333 | 128 |
| 227 | 3300032133 | Ga0316583_10069858 | Ga0316583_100698582 | 128 |
| 228 | 3300032168 | Ga0316593_10012502 | Ga0316593_100125023 | 128 |
| 229 | 3300032168 | Ga0316593_10020111 | Ga0316593_100201114 | 128 |
| 230 | 3300033524 | Ga0316592_1024219 | Ga0316592_10242191 | 128 |
| 231 | 3300033529 | Ga0316587_1011518 | Ga0316587_10115182 | 128 |
| 232 | 3300033541 | Ga0316596_1014240 | Ga0316596_10142401 | 128 |
| 233 | 3300036647 | Ga0316582_0668648 | Ga0316582_0668648_234_629 | 128 |
| 234 | 3300036712 | Ga0316584_0607749 | Ga0316584_0607749_113_511 | 128 |
| 235 | 3300038725 | Ga0400484_12384 | Ga0400484_12384_1975_2361 | 128 |
| 236 | 3300038726 | Ga0400490_18978 | Ga0400490_18978_26779_27165 | 128 |
| 237 | 3300038726 | Ga0400490_19520 | Ga0400490_19520_4375_4761 | 128 |
| 238 | 3300038726 | Ga0400490_58666 | Ga0400490_58666_373_759 | 128 |
| 239 | 3300038727 | Ga0400491_29253 | Ga0400491_29253_7026_7412 | 128 |
| 240 | 3300038735 | Ga0400485_19339 | Ga0400485_19339_1625_2011 | 128 |
| 241 | 3300038741 | Ga0400488_57582 | Ga0400488_57582_372_758 | 128 |
| 242 | 3300038741 | Ga0400488_58232 | Ga0400488_58232_1605_1991 | 128 |
| 243 | 3300038742 | Ga0400486_32047 | Ga0400486_32047_6114_6500 | 128 |
| 244 | 3300039062 | Ga0400483_023928 | Ga0400483_023928_1281_1667 | 128 |
| 245 | 3300039062 | Ga0400483_042851 | Ga0400483_042851_12840_13226 | 128 |
| 246 | 3300039062 | Ga0400483_137186 | Ga0400483_137186_584_973 | 128 |
| 247 | 3300039062 | Ga0400483_198250 | Ga0400483_198250_9604_9990 | 128 |
| 248 | 3300039062 | Ga0400483_278711 | Ga0400483_278711_4339_4725 | 128 |
| 249 | 3300039062 | Ga0400483_281905 | Ga0400483_281905_1789_2178 | 128 |
| 250 | 3300039093 | Ga0400489_41472 | Ga0400489_41472_6484_6870 | 128 |
| 251 | 3300039093 | Ga0400489_66216 | Ga0400489_66216_7084_7470 | 128 |
| 252 | 3300039110 | Ga0400487_19781 | Ga0400487_19781_1461_1847 | 128 |
| 253 | 3300039453 | Ga0436362_0189083 | Ga0436362_0189083_158_547 | 128 |
| 254 | 3300042876 | Ga0451577_0030969 | Ga0451577_0030969_2292_2690 | 128 |
| 255 | 3300044712 | Ga0453684_0416986 | Ga0453684_0416986_251_640 | 128 |
| 256 | 3300044712 | Ga0453684_0788845 | Ga0453684_0788845_50_448 | 128 |
| 257 | 3300049161 | Ga0501305_010380 | Ga0501305_010380_802_1197 | 128 |
| 258 | 3300049571 | Ga0501034_0102596 | Ga0501034_0102596_1195_1581 | 128 |
| 259 | 3300054114 | Ga0501084_0646446 | Ga0501084_0646446_14_400 | 128 |
| 260 | 3300059605 | Ga0587106_014372 | Ga0587106_014372_613_999 | 128 |
| 261 | 3300002073 | JGI24745J21846_1003022 | JGI24745J21846_10030223 | 129 |
| 262 | 3300005436 | Ga0070713_100178759 | Ga0070713_1001787593 | 129 |
| 263 | 3300005455 | Ga0070663_100164203 | Ga0070663_1001642031 | 129 |
| 264 | 3300006042 | Ga0075368_10224016 | Ga0075368_102240162 | 129 |
| 265 | 3300006178 | Ga0075367_11045896 | Ga0075367_110458961 | 129 |
| 266 | 3300006871 | Ga0075434_100811425 | Ga0075434_1008114252 | 129 |
| 267 | 3300009093 | Ga0105240_12273581 | Ga0105240_122735811 | 129 |
| 268 | 3300009177 | Ga0105248_11173280 | Ga0105248_111732801 | 129 |
| 269 | 3300009545 | Ga0105237_10069626 | Ga0105237_100696264 | 129 |
| 270 | 3300009988 | Ga0105035_101729 | Ga0105035_1017292 | 129 |
| 271 | 3300019182 | Ga0184598_141942 | Ga0184598_1419422 | 129 |
| 272 | 3300020070 | Ga0206356_11636321 | Ga0206356_116363211 | 129 |
| 273 | 3300021358 | Ga0213873_10001663 | Ga0213873_100016632 | 129 |
| 274 | 3300021377 | Ga0213874_10001065 | Ga0213874_100010653 | 129 |
| 275 | 3300021384 | Ga0213876_10001556 | Ga0213876_100015566 | 129 |
| 276 | 3300021384 | Ga0213876_10003867 | Ga0213876_1000386712 | 129 |
| 277 | 3300021388 | Ga0213875_10004174 | Ga0213875_100041744 | 129 |
| 278 | 3300024225 | Ga0224572_1037153 | Ga0224572_10371532 | 129 |
| 279 | 3300025908 | Ga0207643_11076315 | Ga0207643_110763152 | 129 |
| 280 | 3300026088 | Ga0207641_11069923 | Ga0207641_110699232 | 129 |
| 281 | 3300031235 | Ga0265330_10152004 | Ga0265330_101520042 | 129 |
| 282 | 3300031241 | Ga0265325_10102490 | Ga0265325_101024902 | 129 |
| 283 | 3300031241 | Ga0265325_10139267 | Ga0265325_101392672 | 129 |
| 284 | 3300031242 | Ga0265329_10103667 | Ga0265329_101036671 | 129 |
| 285 | 3300031247 | Ga0265340_10036214 | Ga0265340_100362142 | 129 |
| 286 | 3300031249 | Ga0265339_10030849 | Ga0265339_100308492 | 129 |
| 287 | 3300031249 | Ga0265339_10142634 | Ga0265339_101426342 | 129 |
| 288 | 3300031250 | Ga0265331_10119834 | Ga0265331_101198342 | 129 |
| 289 | 3300031344 | Ga0265316_10486487 | Ga0265316_104864871 | 129 |
| 290 | 3300031711 | Ga0265314_10016860 | Ga0265314_100168605 | 129 |
| 291 | 3300031711 | Ga0265314_10095625 | Ga0265314_100956253 | 129 |
| 292 | 3300031711 | Ga0265314_10279521 | Ga0265314_102795211 | 129 |
| 293 | 3300031712 | Ga0265342_10030117 | Ga0265342_100301173 | 129 |
| 294 | 3300031712 | Ga0265342_10090566 | Ga0265342_100905662 | 129 |
| 295 | 3300031727 | Ga0316576_10703899 | Ga0316576_107038992 | 129 |
| 296 | 3300035085 | Ga0373929_0048291 | Ga0373929_0048291_514_903 | 129 |
| 297 | 3300035112 | Ga0373932_0061960 | Ga0373932_0061960_608_997 | 129 |
| 298 | 3300035115 | Ga0373941_0172622 | Ga0373941_0172622_125_514 | 129 |
| 299 | 3300035121 | Ga0373960_0074546 | Ga0373960_0074546_508_897 | 129 |
| 300 | 3300035242 | Ga0373962_0006987 | Ga0373962_0006987_1506_1895 | 129 |
| 301 | 3300035692 | Ga0373935_0225634 | Ga0373935_0225634_512_901 | 129 |
| 302 | 3300035695 | Ga0373927_0538286 | Ga0373927_0538286_362_751 | 129 |
| 303 | 3300036401 | Ga0373937_1771358 | Ga0373937_1771358_131_520 | 129 |
| 304 | 3300037068 | Ga0373925_1088508 | Ga0373925_1088508_210_599 | 129 |
| 305 | 3300037853 | Ga0436364_0013783 | Ga0436364_0013783_4272_4661 | 129 |
| 306 | 3300037853 | Ga0436364_0082147 | Ga0436364_0082147_1490_1879 | 129 |
| 307 | 3300037853 | Ga0436364_0675508 | Ga0436364_0675508_700_1089 | 129 |
| 308 | 3300039437 | Ga0436365_0555060 | Ga0436365_0555060_407_796 | 129 |
| 309 | 3300039437 | Ga0436365_0850961 | Ga0436365_0850961_133_522 | 129 |
| 310 | 3300039437 | Ga0436365_1136540 | Ga0436365_1136540_19468_19857 | 129 |
| 311 | 3300039437 | Ga0436365_1228764 | Ga0436365_1228764_133_552 | 129 |
| 312 | 3300039437 | Ga0436365_1253031 | Ga0436365_1253031_31042_31431 | 129 |
| 313 | 3300039438 | Ga0436360_0065948 | Ga0436360_0065948_69_461 | 129 |
| 314 | 3300039438 | Ga0436360_1251640 | Ga0436360_1251640_162_551 | 129 |
| 315 | 3300039447 | Ga0436361_0425653 | Ga0436361_0425653_38_427 | 129 |
| 316 | 3300039450 | Ga0436363_0121335 | Ga0436363_0121335_1652_2041 | 129 |
| 317 | 3300039450 | Ga0436363_0252353 | Ga0436363_0252353_392_781 | 129 |
| 318 | 3300039450 | Ga0436363_0746062 | Ga0436363_0746062_1903_2292 | 129 |
| 319 | 3300039450 | Ga0436363_1082032 | Ga0436363_1082032_57_446 | 129 |
| 320 | 3300039453 | Ga0436362_0060202 | Ga0436362_0060202_82_471 | 129 |
| 321 | 3300039453 | Ga0436362_0579275 | Ga0436362_0579275_108_497 | 129 |
| 322 | 3300041453 | Ga0451797_1514149 | Ga0451797_1514149_89_478 | 129 |
| 323 | 3300041456 | Ga0451795_1557624 | Ga0451795_1557624_46_435 | 129 |
| 324 | 3300044684 | Ga0466966_0207717 | Ga0466966_0207717_436_825 | 129 |
| 325 | 3300044684 | Ga0466966_0258704 | Ga0466966_0258704_33_422 | 129 |
| 326 | 3300044693 | Ga0466961_0121966 | Ga0466961_0121966_561_950 | 129 |
| 327 | 3300044694 | Ga0466963_0739702 | Ga0466963_0739702_269_658 | 129 |
| 328 | 3300045049 | Ga0466959_0084832 | Ga0466959_0084832_493_882 | 129 |
| 329 | 3300045051 | Ga0451576_0031820 | Ga0451576_0031820_2786_3175 | 129 |
| 330 | 3300045836 | Ga0466958_0264302 | Ga0466958_0264302_387_776 | 129 |
| 331 | 3300046454 | Ga0495592_0333617 | Ga0495592_0333617_241_630 | 129 |
| 332 | 3300047319 | Ga0495674_0887829 | Ga0495674_0887829_90_479 | 129 |
| 333 | 3300047320 | Ga0495672_0000511 | Ga0495672_0000511_28972_29361 | 129 |
| 334 | 3300047320 | Ga0495672_0031397 | Ga0495672_0031397_1561_1950 | 129 |
| 335 | 3300048088 | Ga0495602_0281167 | Ga0495602_0281167_722_1111 | 129 |
| 336 | 3300048903 | Ga0496100_1060656 | Ga0496100_1060656_134_523 | 129 |
| 337 | 3300048913 | Ga0496110_0268646 | Ga0496110_0268646_164_553 | 129 |
| 338 | 3300048929 | Ga0496126_0135898 | Ga0496126_0135898_527_916 | 129 |
| 339 | 3300049571 | Ga0501034_0120247 | Ga0501034_0120247_390_809 | 129 |
| 340 | 3300049574 | Ga0501038_0282354 | Ga0501038_0282354_421_840 | 129 |
| 341 | 3300049743 | Ga0501081_0577270 | Ga0501081_0577270_280_669 | 129 |
| 342 | 3300050512 | nmdc:mga0n895_915730_c1 | nmdc:mga0n895_915730_c1_200_619 | 129 |
| 343 | 3300053096 | Ga0500641_0004296 | Ga0500641_0004296_3531_3950 | 129 |
| 344 | 3300053117 | Ga0500593_000058 | Ga0500593_000058_12707_13096 | 129 |
| 345 | 3300053139 | Ga0500568_0000001 | Ga0500568_0000001_13398_13787 | 129 |
| 346 | 3300059643 | Ga0587072_086429 | Ga0587072_086429_233_622 | 129 |
| 347 | 3300060247 | Ga0587096_03993 | Ga0587096_03993_64_453 | 129 |
| 348 | 3300060344 | Ga0587071_077540 | Ga0587071_077540_129_518 | 129 |
| 349 | 3300060346 | Ga0587111_0029655 | Ga0587111_0029655_567_956 | 129 |
| 350 | 3300061734 | Ga0530510_0566665 | Ga0530510_0566665_161_550 | 129 |
| 351 | 3300001979 | JGI24740J21852_10036215 | JGI24740J21852_100362152 | 130 |
| 352 | 3300003214 | JGI25165J46597_1000961 | JGI25165J46597_10009614 | 130 |
| 353 | 3300003781 | Ga0055536_1016175 | Ga0055536_10161752 | 130 |
| 354 | 3300004803 | Ga0058862_10049717 | Ga0058862_100497171 | 130 |
| 355 | 3300004803 | Ga0058862_12821384 | Ga0058862_128213842 | 130 |
| 356 | 3300005327 | Ga0070658_10034257 | Ga0070658_100342572 | 130 |
| 357 | 3300005327 | Ga0070658_10236536 | Ga0070658_102365362 | 130 |
| 358 | 3300005327 | Ga0070658_10774137 | Ga0070658_107741372 | 130 |
| 359 | 3300005329 | Ga0070683_100931522 | Ga0070683_1009315221 | 130 |
| 360 | 3300005335 | Ga0070666_10543561 | Ga0070666_105435611 | 130 |
| 361 | 3300005337 | Ga0070682_100178640 | Ga0070682_1001786401 | 130 |
| 362 | 3300005339 | Ga0070660_100004846 | Ga0070660_1000048463 | 130 |
| 363 | 3300005339 | Ga0070660_100070020 | Ga0070660_1000700204 | 130 |
| 364 | 3300005339 | Ga0070660_100158975 | Ga0070660_1001589752 | 130 |
| 365 | 3300005341 | Ga0070691_10560979 | Ga0070691_105609791 | 130 |
| 366 | 3300005344 | Ga0070661_100001887 | Ga0070661_10000188715 | 130 |
| 367 | 3300005344 | Ga0070661_100381304 | Ga0070661_1003813042 | 130 |
| 368 | 3300005344 | Ga0070661_100971558 | Ga0070661_1009715581 | 130 |
| 369 | 3300005347 | Ga0070668_100092896 | Ga0070668_1000928962 | 130 |
| 370 | 3300005347 | Ga0070668_101254259 | Ga0070668_1012542591 | 130 |
| 371 | 3300005366 | Ga0070659_100017338 | Ga0070659_1000173386 | 130 |
| 372 | 3300005367 | Ga0070667_101559602 | Ga0070667_1015596021 | 130 |
| 373 | 3300005455 | Ga0070663_101316873 | Ga0070663_1013168731 | 130 |
| 374 | 3300005458 | Ga0070681_10001062 | Ga0070681_1000106212 | 130 |
| 375 | 3300005458 | Ga0070681_10009391 | Ga0070681_100093915 | 130 |
| 376 | 3300005458 | Ga0070681_10197259 | Ga0070681_101972593 | 130 |
| 377 | 3300005458 | Ga0070681_10197413 | Ga0070681_101974132 | 130 |
| 378 | 3300005458 | Ga0070681_10487401 | Ga0070681_104874012 | 130 |
| 379 | 3300005530 | Ga0070679_100007538 | Ga0070679_10000753818 | 130 |
| 380 | 3300005530 | Ga0070679_100010304 | Ga0070679_1000103049 | 130 |
| 381 | 3300005530 | Ga0070679_100113062 | Ga0070679_1001130621 | 130 |
| 382 | 3300005530 | Ga0070679_100753323 | Ga0070679_1007533231 | 130 |
| 383 | 3300005539 | Ga0068853_100000888 | Ga0068853_10000088826 | 130 |
| 384 | 3300005539 | Ga0068853_100007192 | Ga0068853_1000071927 | 130 |
| 385 | 3300005539 | Ga0068853_101001024 | Ga0068853_1010010241 | 130 |
| 386 | 3300005543 | Ga0070672_100347782 | Ga0070672_1003477822 | 130 |
| 387 | 3300005543 | Ga0070672_101170313 | Ga0070672_1011703132 | 130 |
| 388 | 3300005547 | Ga0070693_100354020 | Ga0070693_1003540202 | 130 |
| 389 | 3300005548 | Ga0070665_100050199 | Ga0070665_1000501995 | 130 |
| 390 | 3300005548 | Ga0070665_100323781 | Ga0070665_1003237812 | 130 |
| 391 | 3300005548 | Ga0070665_100823091 | Ga0070665_1008230912 | 130 |
| 392 | 3300005548 | Ga0070665_101598780 | Ga0070665_1015987801 | 130 |
| 393 | 3300005563 | Ga0068855_100075649 | Ga0068855_1000756494 | 130 |
| 394 | 3300005563 | Ga0068855_100323488 | Ga0068855_1003234881 | 130 |
| 395 | 3300005563 | Ga0068855_100367187 | Ga0068855_1003671873 | 130 |
| 396 | 3300005563 | Ga0068855_100827425 | Ga0068855_1008274252 | 130 |
| 397 | 3300005563 | Ga0068855_102172949 | Ga0068855_1021729491 | 130 |
| 398 | 3300005564 | Ga0070664_100688593 | Ga0070664_1006885932 | 130 |
| 399 | 3300005577 | Ga0068857_100165278 | Ga0068857_1001652782 | 130 |
| 400 | 3300005577 | Ga0068857_100260674 | Ga0068857_1002606742 | 130 |
| 401 | 3300005577 | Ga0068857_100402067 | Ga0068857_1004020671 | 130 |
| 402 | 3300005577 | Ga0068857_100845518 | Ga0068857_1008455182 | 130 |
| 403 | 3300005578 | Ga0068854_100157239 | Ga0068854_1001572392 | 130 |
| 404 | 3300005578 | Ga0068854_100159518 | Ga0068854_1001595181 | 130 |
| 405 | 3300005578 | Ga0068854_100362416 | Ga0068854_1003624162 | 130 |
| 406 | 3300005578 | Ga0068854_100561517 | Ga0068854_1005615172 | 130 |
| 407 | 3300005578 | Ga0068854_100592850 | Ga0068854_1005928502 | 130 |
| 408 | 3300005614 | Ga0068856_100028895 | Ga0068856_1000288956 | 130 |
| 409 | 3300005614 | Ga0068856_100059597 | Ga0068856_1000595973 | 130 |
| 410 | 3300005614 | Ga0068856_100193379 | Ga0068856_1001933792 | 130 |
| 411 | 3300005614 | Ga0068856_100370182 | Ga0068856_1003701823 | 130 |
| 412 | 3300005616 | Ga0068852_100031702 | Ga0068852_1000317022 | 130 |
| 413 | 3300005616 | Ga0068852_100324806 | Ga0068852_1003248062 | 130 |
| 414 | 3300005616 | Ga0068852_100757434 | Ga0068852_1007574341 | 130 |
| 415 | 3300005617 | Ga0068859_100894715 | Ga0068859_1008947152 | 130 |
| 416 | 3300005618 | Ga0068864_100927981 | Ga0068864_1009279811 | 130 |
| 417 | 3300005719 | Ga0068861_100513425 | Ga0068861_1005134252 | 130 |
| 418 | 3300005834 | Ga0068851_10002106 | Ga0068851_100021068 | 130 |
| 419 | 3300005834 | Ga0068851_10030591 | Ga0068851_100305912 | 130 |
| 420 | 3300005842 | Ga0068858_101166860 | Ga0068858_1011668601 | 130 |
| 421 | 3300005843 | Ga0068860_100307341 | Ga0068860_1003073413 | 130 |
| 422 | 3300005844 | Ga0068862_100218768 | Ga0068862_1002187682 | 130 |
| 423 | 3300005937 | Ga0081455_10000156 | Ga0081455_1000015673 | 130 |
| 424 | 3300005937 | Ga0081455_10043697 | Ga0081455_100436974 | 130 |
| 425 | 3300005981 | Ga0081538_10003741 | Ga0081538_1000374126 | 130 |
| 426 | 3300005981 | Ga0081538_10005275 | Ga0081538_100052757 | 130 |
| 427 | 3300005981 | Ga0081538_10105083 | Ga0081538_101050831 | 130 |
| 428 | 3300005985 | Ga0081539_10006788 | Ga0081539_1000678810 | 130 |
| 429 | 3300006038 | Ga0075365_10268947 | Ga0075365_102689472 | 130 |
| 430 | 3300006038 | Ga0075365_10955654 | Ga0075365_109556541 | 130 |
| 431 | 3300006042 | Ga0075368_10033501 | Ga0075368_100335013 | 130 |
| 432 | 3300006048 | Ga0075363_100016090 | Ga0075363_1000160904 | 130 |
| 433 | 3300006048 | Ga0075363_100682371 | Ga0075363_1006823712 | 130 |
| 434 | 3300006051 | Ga0075364_10014487 | Ga0075364_100144874 | 130 |
| 435 | 3300006051 | Ga0075364_10050081 | Ga0075364_100500814 | 130 |
| 436 | 3300006051 | Ga0075364_10724124 | Ga0075364_107241242 | 130 |
| 437 | 3300006051 | Ga0075364_10907606 | Ga0075364_109076061 | 130 |
| 438 | 3300006175 | Ga0070712_100304500 | Ga0070712_1003045002 | 130 |
| 439 | 3300006177 | Ga0075362_10010585 | Ga0075362_100105855 | 130 |
| 440 | 3300006177 | Ga0075362_10140013 | Ga0075362_101400132 | 130 |
| 441 | 3300006178 | Ga0075367_10338736 | Ga0075367_103387362 | 130 |
| 442 | 3300006186 | Ga0075369_10167594 | Ga0075369_101675942 | 130 |
| 443 | 3300006195 | Ga0075366_10059905 | Ga0075366_100599052 | 130 |
| 444 | 3300006195 | Ga0075366_10227727 | Ga0075366_102277272 | 130 |
| 445 | 3300006237 | Ga0097621_100590092 | Ga0097621_1005900921 | 130 |
| 446 | 3300006237 | Ga0097621_101270847 | Ga0097621_1012708471 | 130 |
| 447 | 3300006353 | Ga0075370_10032179 | Ga0075370_100321794 | 130 |
| 448 | 3300006353 | Ga0075370_10147741 | Ga0075370_101477413 | 130 |
| 449 | 3300006353 | Ga0075370_10170889 | Ga0075370_101708892 | 130 |
| 450 | 3300006846 | Ga0075430_100156687 | Ga0075430_1001566872 | 130 |
| 451 | 3300006852 | Ga0075433_10335429 | Ga0075433_103354292 | 130 |
| 452 | 3300006852 | Ga0075433_10776333 | Ga0075433_107763332 | 130 |
| 453 | 3300006881 | Ga0068865_100118650 | Ga0068865_1001186502 | 130 |
| 454 | 3300006914 | Ga0075436_100693895 | Ga0075436_1006938951 | 130 |
| 455 | 3300006931 | Ga0097620_100894723 | Ga0097620_1008947232 | 130 |
| 456 | 3300009093 | Ga0105240_10075852 | Ga0105240_100758521 | 130 |
| 457 | 3300009093 | Ga0105240_10804272 | Ga0105240_108042722 | 130 |
| 458 | 3300009093 | Ga0105240_10972505 | Ga0105240_109725052 | 130 |
| 459 | 3300009093 | Ga0105240_12560630 | Ga0105240_125606301 | 130 |
| 460 | 3300009098 | Ga0105245_11520332 | Ga0105245_115203322 | 130 |
| 461 | 3300009148 | Ga0105243_12061135 | Ga0105243_120611351 | 130 |
| 462 | 3300009174 | Ga0105241_11385553 | Ga0105241_113855531 | 130 |
| 463 | 3300009176 | Ga0105242_10963989 | Ga0105242_109639892 | 130 |
| 464 | 3300009177 | Ga0105248_10555050 | Ga0105248_105550501 | 130 |
| 465 | 3300009545 | Ga0105237_10002619 | Ga0105237_1000261912 | 130 |
| 466 | 3300009545 | Ga0105237_10244594 | Ga0105237_102445943 | 130 |
| 467 | 3300009545 | Ga0105237_10282372 | Ga0105237_102823722 | 130 |
| 468 | 3300009545 | Ga0105237_10311796 | Ga0105237_103117961 | 130 |
| 469 | 3300009551 | Ga0105238_10033303 | Ga0105238_100333032 | 130 |
| 470 | 3300009551 | Ga0105238_10323701 | Ga0105238_103237011 | 130 |
| 471 | 3300009551 | Ga0105238_12759932 | Ga0105238_127599321 | 130 |
| 472 | 3300009993 | Ga0105028_100431 | Ga0105028_1004313 | 130 |
| 473 | 3300010375 | Ga0105239_10166189 | Ga0105239_101661894 | 130 |
| 474 | 3300010375 | Ga0105239_10477867 | Ga0105239_104778672 | 130 |
| 475 | 3300011119 | Ga0105246_11167806 | Ga0105246_111678062 | 130 |
| 476 | 3300013100 | Ga0157373_10518982 | Ga0157373_105189821 | 130 |
| 477 | 3300013100 | Ga0157373_10822608 | Ga0157373_108226081 | 130 |
| 478 | 3300013102 | Ga0157371_11532809 | Ga0157371_115328091 | 130 |
| 479 | 3300013104 | Ga0157370_10001390 | Ga0157370_1000139026 | 130 |
| 480 | 3300013104 | Ga0157370_10008540 | Ga0157370_100085409 | 130 |
| 481 | 3300013104 | Ga0157370_10072284 | Ga0157370_100722844 | 130 |
| 482 | 3300013104 | Ga0157370_10822497 | Ga0157370_108224972 | 130 |
| 483 | 3300013104 | Ga0157370_10954247 | Ga0157370_109542472 | 130 |
| 484 | 3300013105 | Ga0157369_10026398 | Ga0157369_100263986 | 130 |
| 485 | 3300013105 | Ga0157369_10196070 | Ga0157369_101960702 | 130 |
| 486 | 3300013105 | Ga0157369_10625868 | Ga0157369_106258682 | 130 |
| 487 | 3300013105 | Ga0157369_10660984 | Ga0157369_106609842 | 130 |
| 488 | 3300013105 | Ga0157369_11700577 | Ga0157369_117005771 | 130 |
| 489 | 3300013296 | Ga0157374_11020482 | Ga0157374_110204822 | 130 |
| 490 | 3300013296 | Ga0157374_11500375 | Ga0157374_115003752 | 130 |
| 491 | 3300013297 | Ga0157378_10605597 | Ga0157378_106055972 | 130 |
| 492 | 3300013297 | Ga0157378_11073281 | Ga0157378_110732812 | 130 |
| 493 | 3300013297 | Ga0157378_12706115 | Ga0157378_127061151 | 130 |
| 494 | 3300013306 | Ga0163162_13109394 | Ga0163162_131093941 | 130 |
| 495 | 3300013307 | Ga0157372_10111907 | Ga0157372_101119072 | 130 |
| 496 | 3300013307 | Ga0157372_10324059 | Ga0157372_103240592 | 130 |
| 497 | 3300013307 | Ga0157372_11652053 | Ga0157372_116520531 | 130 |
| 498 | 3300013307 | Ga0157372_12101897 | Ga0157372_121018972 | 130 |
| 499 | 3300014325 | Ga0163163_10466658 | Ga0163163_104666581 | 130 |
| 500 | 3300014497 | Ga0182008_10876149 | Ga0182008_108761491 | 130 |
| 501 | 3300014969 | Ga0157376_10251797 | Ga0157376_102517972 | 130 |
| 502 | 3300014969 | Ga0157376_10402106 | Ga0157376_104021061 | 130 |
| 503 | 3300020069 | Ga0197907_10410046 | Ga0197907_104100463 | 130 |
| 504 | 3300020070 | Ga0206356_10510010 | Ga0206356_105100103 | 130 |
| 505 | 3300020070 | Ga0206356_10669629 | Ga0206356_106696291 | 130 |
| 506 | 3300020076 | Ga0206355_1092081 | Ga0206355_10920812 | 130 |
| 507 | 3300020078 | Ga0206352_10440244 | Ga0206352_104402442 | 130 |
| 508 | 3300020080 | Ga0206350_10063581 | Ga0206350_100635811 | 130 |
| 509 | 3300020082 | Ga0206353_10170206 | Ga0206353_101702062 | 130 |
| 510 | 3300021358 | Ga0213873_10135056 | Ga0213873_101350562 | 130 |
| 511 | 3300021358 | Ga0213873_10198427 | Ga0213873_101984272 | 130 |
| 512 | 3300021361 | Ga0213872_10045368 | Ga0213872_100453681 | 130 |
| 513 | 3300021361 | Ga0213872_10060192 | Ga0213872_100601922 | 130 |
| 514 | 3300021361 | Ga0213872_10074275 | Ga0213872_100742751 | 130 |
| 515 | 3300021361 | Ga0213872_10122271 | Ga0213872_101222711 | 130 |
| 516 | 3300021388 | Ga0213875_10259268 | Ga0213875_102592682 | 130 |
| 517 | 3300021441 | Ga0213871_10071071 | Ga0213871_100710711 | 130 |
| 518 | 3300022467 | Ga0224712_10017793 | Ga0224712_100177933 | 130 |
| 519 | 3300022467 | Ga0224712_10203237 | Ga0224712_102032372 | 130 |
| 520 | 3300025231 | Ga0207427_101221 | Ga0207427_1012219 | 130 |
| 521 | 3300025261 | Ga0209233_1000293 | Ga0209233_100029313 | 130 |
| 522 | 3300025292 | Ga0209676_1000092 | Ga0209676_100009226 | 130 |
| 523 | 3300025298 | Ga0209050_1007590 | Ga0209050_10075905 | 130 |
| 524 | 3300025303 | Ga0209051_1025622 | Ga0209051_10256222 | 130 |
| 525 | 3300025321 | Ga0207656_10001058 | Ga0207656_100010584 | 130 |
| 526 | 3300025321 | Ga0207656_10030934 | Ga0207656_100309343 | 130 |
| 527 | 3300025899 | Ga0207642_10394017 | Ga0207642_103940172 | 130 |
| 528 | 3300025901 | Ga0207688_10037880 | Ga0207688_100378803 | 130 |
| 529 | 3300025904 | Ga0207647_10089449 | Ga0207647_100894493 | 130 |
| 530 | 3300025904 | Ga0207647_10141952 | Ga0207647_101419522 | 130 |
| 531 | 3300025909 | Ga0207705_10020427 | Ga0207705_100204274 | 130 |
| 532 | 3300025909 | Ga0207705_10071391 | Ga0207705_100713912 | 130 |
| 533 | 3300025909 | Ga0207705_10075111 | Ga0207705_100751112 | 130 |
| 534 | 3300025911 | Ga0207654_10953111 | Ga0207654_109531111 | 130 |
| 535 | 3300025912 | Ga0207707_10000624 | Ga0207707_1000062434 | 130 |
| 536 | 3300025912 | Ga0207707_10022305 | Ga0207707_100223053 | 130 |
| 537 | 3300025912 | Ga0207707_10078099 | Ga0207707_100780994 | 130 |
| 538 | 3300025912 | Ga0207707_10119622 | Ga0207707_101196222 | 130 |
| 539 | 3300025913 | Ga0207695_10043881 | Ga0207695_100438815 | 130 |
| 540 | 3300025914 | Ga0207671_10001074 | Ga0207671_1000107412 | 130 |
| 541 | 3300025914 | Ga0207671_10184945 | Ga0207671_101849451 | 130 |
| 542 | 3300025914 | Ga0207671_10254384 | Ga0207671_102543841 | 130 |
| 543 | 3300025914 | Ga0207671_10344051 | Ga0207671_103440512 | 130 |
| 544 | 3300025915 | Ga0207693_10474744 | Ga0207693_104747442 | 130 |
| 545 | 3300025917 | Ga0207660_10017860 | Ga0207660_100178604 | 130 |
| 546 | 3300025917 | Ga0207660_10369650 | Ga0207660_103696502 | 130 |
| 547 | 3300025917 | Ga0207660_10512111 | Ga0207660_105121111 | 130 |
| 548 | 3300025919 | Ga0207657_10008060 | Ga0207657_100080603 | 130 |
| 549 | 3300025919 | Ga0207657_10044882 | Ga0207657_100448824 | 130 |
| 550 | 3300025919 | Ga0207657_10076211 | Ga0207657_100762114 | 130 |
| 551 | 3300025919 | Ga0207657_10289780 | Ga0207657_102897803 | 130 |
| 552 | 3300025920 | Ga0207649_10001226 | Ga0207649_1000122611 | 130 |
| 553 | 3300025920 | Ga0207649_10093984 | Ga0207649_100939842 | 130 |
| 554 | 3300025920 | Ga0207649_11229423 | Ga0207649_112294231 | 130 |
| 555 | 3300025921 | Ga0207652_10002587 | Ga0207652_1000258718 | 130 |
| 556 | 3300025921 | Ga0207652_10057886 | Ga0207652_100578863 | 130 |
| 557 | 3300025921 | Ga0207652_10218820 | Ga0207652_102188202 | 130 |
| 558 | 3300025921 | Ga0207652_10462324 | Ga0207652_104623242 | 130 |
| 559 | 3300025921 | Ga0207652_10718760 | Ga0207652_107187601 | 130 |
| 560 | 3300025921 | Ga0207652_11778783 | Ga0207652_117787831 | 130 |
| 561 | 3300025924 | Ga0207694_10008555 | Ga0207694_100085555 | 130 |
| 562 | 3300025924 | Ga0207694_10172425 | Ga0207694_101724251 | 130 |
| 563 | 3300025924 | Ga0207694_10511921 | Ga0207694_105119212 | 130 |
| 564 | 3300025925 | Ga0207650_10382801 | Ga0207650_103828012 | 130 |
| 565 | 3300025926 | Ga0207659_10273630 | Ga0207659_102736302 | 130 |
| 566 | 3300025927 | Ga0207687_10652660 | Ga0207687_106526602 | 130 |
| 567 | 3300025928 | Ga0207700_10360140 | Ga0207700_103601402 | 130 |
| 568 | 3300025932 | Ga0207690_10019639 | Ga0207690_100196393 | 130 |
| 569 | 3300025932 | Ga0207690_10089309 | Ga0207690_100893091 | 130 |
| 570 | 3300025932 | Ga0207690_10477913 | Ga0207690_104779132 | 130 |
| 571 | 3300025933 | Ga0207706_10214453 | Ga0207706_102144532 | 130 |
| 572 | 3300025937 | Ga0207669_10012602 | Ga0207669_100126022 | 130 |
| 573 | 3300025940 | Ga0207691_10455149 | Ga0207691_104551492 | 130 |
| 574 | 3300025941 | Ga0207711_10388325 | Ga0207711_103883253 | 130 |
| 575 | 3300025944 | Ga0207661_10380109 | Ga0207661_103801092 | 130 |
| 576 | 3300025945 | Ga0207679_10573235 | Ga0207679_105732352 | 130 |
| 577 | 3300025949 | Ga0207667_10000877 | Ga0207667_100008777 | 130 |
| 578 | 3300025949 | Ga0207667_10002756 | Ga0207667_100027569 | 130 |
| 579 | 3300025949 | Ga0207667_10019501 | Ga0207667_1001950113 | 130 |
| 580 | 3300025961 | Ga0207712_11648842 | Ga0207712_116488421 | 130 |
| 581 | 3300025972 | Ga0207668_10009850 | Ga0207668_100098509 | 130 |
| 582 | 3300025972 | Ga0207668_10536746 | Ga0207668_105367462 | 130 |
| 583 | 3300025981 | Ga0207640_10009094 | Ga0207640_100090944 | 130 |
| 584 | 3300025981 | Ga0207640_10016034 | Ga0207640_100160342 | 130 |
| 585 | 3300025981 | Ga0207640_10046887 | Ga0207640_100468872 | 130 |
| 586 | 3300025981 | Ga0207640_10112501 | Ga0207640_101125011 | 130 |
| 587 | 3300025981 | Ga0207640_10426997 | Ga0207640_104269972 | 130 |
| 588 | 3300025986 | Ga0207658_11548342 | Ga0207658_115483421 | 130 |
| 589 | 3300026023 | Ga0207677_10101363 | Ga0207677_101013633 | 130 |
| 590 | 3300026023 | Ga0207677_10962746 | Ga0207677_109627462 | 130 |
| 591 | 3300026041 | Ga0207639_10004515 | Ga0207639_1000451511 | 130 |
| 592 | 3300026041 | Ga0207639_10007867 | Ga0207639_100078677 | 130 |
| 593 | 3300026041 | Ga0207639_10029135 | Ga0207639_100291354 | 130 |
| 594 | 3300026075 | Ga0207708_11231094 | Ga0207708_112310941 | 130 |
| 595 | 3300026078 | Ga0207702_10006196 | Ga0207702_100061962 | 130 |
| 596 | 3300026078 | Ga0207702_10029655 | Ga0207702_100296552 | 130 |
| 597 | 3300026078 | Ga0207702_10459283 | Ga0207702_104592832 | 130 |
| 598 | 3300026078 | Ga0207702_10575395 | Ga0207702_105753952 | 130 |
| 599 | 3300026078 | Ga0207702_11739716 | Ga0207702_117397162 | 130 |
| 600 | 3300026089 | Ga0207648_10242504 | Ga0207648_102425042 | 130 |
| 601 | 3300026089 | Ga0207648_10275281 | Ga0207648_102752812 | 130 |
| 602 | 3300026095 | Ga0207676_10792910 | Ga0207676_107929102 | 130 |
| 603 | 3300026116 | Ga0207674_10045512 | Ga0207674_100455126 | 130 |
| 604 | 3300026116 | Ga0207674_10070606 | Ga0207674_100706063 | 130 |
| 605 | 3300026116 | Ga0207674_10245498 | Ga0207674_102454982 | 130 |
| 606 | 3300026116 | Ga0207674_10249766 | Ga0207674_102497663 | 130 |
| 607 | 3300026118 | Ga0207675_100405521 | Ga0207675_1004055212 | 130 |
| 608 | 3300026121 | Ga0207683_10144767 | Ga0207683_101447672 | 130 |
| 609 | 3300026142 | Ga0207698_10140737 | Ga0207698_101407373 | 130 |
| 610 | 3300026142 | Ga0207698_10155782 | Ga0207698_101557822 | 130 |
| 611 | 3300026142 | Ga0207698_11431508 | Ga0207698_114315082 | 130 |
| 612 | 3300027462 | Ga0210000_1063313 | Ga0210000_10633131 | 130 |
| 613 | 3300027665 | Ga0209983_1009332 | Ga0209983_10093322 | 130 |
| 614 | 3300027866 | Ga0209813_10102649 | Ga0209813_101026492 | 130 |
| 615 | 3300027876 | Ga0209974_10063329 | Ga0209974_100633292 | 130 |
| 616 | 3300027907 | Ga0207428_10929259 | Ga0207428_109292592 | 130 |
| 617 | 3300028379 | Ga0268266_10000321 | Ga0268266_1000032133 | 130 |
| 618 | 3300028379 | Ga0268266_11142114 | Ga0268266_111421141 | 130 |
| 619 | 3300028573 | Ga0265334_10150039 | Ga0265334_101500392 | 130 |
| 620 | 3300028577 | Ga0265318_10008175 | Ga0265318_100081755 | 130 |
| 621 | 3300028800 | Ga0265338_10069830 | Ga0265338_100698302 | 130 |
| 622 | 3300028800 | Ga0265338_10590173 | Ga0265338_105901732 | 130 |
| 623 | 3300029957 | Ga0265324_10063838 | Ga0265324_100638382 | 130 |
| 624 | 3300031235 | Ga0265330_10006274 | Ga0265330_100062747 | 130 |
| 625 | 3300031235 | Ga0265330_10120455 | Ga0265330_101204552 | 130 |
| 626 | 3300031235 | Ga0265330_10197428 | Ga0265330_101974281 | 130 |
| 627 | 3300031238 | Ga0265332_10065930 | Ga0265332_100659302 | 130 |
| 628 | 3300031238 | Ga0265332_10121255 | Ga0265332_101212551 | 130 |
| 629 | 3300031239 | Ga0265328_10074526 | Ga0265328_100745262 | 130 |
| 630 | 3300031239 | Ga0265328_10187815 | Ga0265328_101878152 | 130 |
| 631 | 3300031240 | Ga0265320_10060485 | Ga0265320_100604852 | 130 |
| 632 | 3300031241 | Ga0265325_10080671 | Ga0265325_100806712 | 130 |
| 633 | 3300031249 | Ga0265339_10013124 | Ga0265339_100131247 | 130 |
| 634 | 3300031250 | Ga0265331_10157792 | Ga0265331_101577922 | 130 |
| 635 | 3300031251 | Ga0265327_10000100 | Ga0265327_10000100182 | 130 |
| 636 | 3300031251 | Ga0265327_10050054 | Ga0265327_100500542 | 130 |
| 637 | 3300031344 | Ga0265316_10209865 | Ga0265316_102098652 | 130 |
| 638 | 3300031344 | Ga0265316_10294616 | Ga0265316_102946162 | 130 |
| 639 | 3300031548 | Ga0307408_100739691 | Ga0307408_1007396912 | 130 |
| 640 | 3300031595 | Ga0265313_10002227 | Ga0265313_1000222716 | 130 |
| 641 | 3300031595 | Ga0265313_10005420 | Ga0265313_100054206 | 130 |
| 642 | 3300031595 | Ga0265313_10283610 | Ga0265313_102836102 | 130 |
| 643 | 3300031616 | Ga0307508_10530512 | Ga0307508_105305121 | 130 |
| 644 | 3300031711 | Ga0265314_10031281 | Ga0265314_100312815 | 130 |
| 645 | 3300031711 | Ga0265314_10106792 | Ga0265314_101067922 | 130 |
| 646 | 3300031711 | Ga0265314_10119547 | Ga0265314_101195472 | 130 |
| 647 | 3300031712 | Ga0265342_10077955 | Ga0265342_100779552 | 130 |
| 648 | 3300031712 | Ga0265342_10248561 | Ga0265342_102485612 | 130 |
| 649 | 3300031712 | Ga0265342_10266813 | Ga0265342_102668132 | 130 |
| 650 | 3300031730 | Ga0307516_10367781 | Ga0307516_103677812 | 130 |
| 651 | 3300031731 | Ga0307405_10335410 | Ga0307405_103354103 | 130 |
| 652 | 3300031824 | Ga0307413_10162983 | Ga0307413_101629832 | 130 |
| 653 | 3300031824 | Ga0307413_10354841 | Ga0307413_103548413 | 130 |
| 654 | 3300031852 | Ga0307410_10051793 | Ga0307410_100517933 | 130 |
| 655 | 3300031852 | Ga0307410_10840362 | Ga0307410_108403621 | 130 |
| 656 | 3300031852 | Ga0307410_10945600 | Ga0307410_109456002 | 130 |
| 657 | 3300031901 | Ga0307406_10167970 | Ga0307406_101679703 | 130 |
| 658 | 3300031901 | Ga0307406_10240419 | Ga0307406_102404192 | 130 |
| 659 | 3300031901 | Ga0307406_10271008 | Ga0307406_102710081 | 130 |
| 660 | 3300031901 | Ga0307406_10334186 | Ga0307406_103341862 | 130 |
| 661 | 3300031901 | Ga0307406_10655183 | Ga0307406_106551832 | 130 |
| 662 | 3300031903 | Ga0307407_10499792 | Ga0307407_104997921 | 130 |
| 663 | 3300031911 | Ga0307412_10063396 | Ga0307412_100633962 | 130 |
| 664 | 3300031911 | Ga0307412_10241524 | Ga0307412_102415242 | 130 |
| 665 | 3300031911 | Ga0307412_10535596 | Ga0307412_105355962 | 130 |
| 666 | 3300031995 | Ga0307409_100376008 | Ga0307409_1003760082 | 130 |
| 667 | 3300031995 | Ga0307409_100387076 | Ga0307409_1003870762 | 130 |
| 668 | 3300031995 | Ga0307409_100782482 | Ga0307409_1007824822 | 130 |
| 669 | 3300031995 | Ga0307409_100949381 | Ga0307409_1009493812 | 130 |
| 670 | 3300032004 | Ga0307414_10122495 | Ga0307414_101224952 | 130 |
| 671 | 3300032004 | Ga0307414_10203250 | Ga0307414_102032502 | 130 |
| 672 | 3300032004 | Ga0307414_10286581 | Ga0307414_102865813 | 130 |
| 673 | 3300032004 | Ga0307414_10365082 | Ga0307414_103650823 | 130 |
| 674 | 3300032004 | Ga0307414_10984833 | Ga0307414_109848332 | 130 |
| 675 | 3300032004 | Ga0307414_11383389 | Ga0307414_113833891 | 130 |
| 676 | 3300032004 | Ga0307414_11769193 | Ga0307414_117691932 | 130 |
| 677 | 3300032004 | Ga0307414_11783581 | Ga0307414_117835811 | 130 |
| 678 | 3300032004 | Ga0307414_12032744 | Ga0307414_120327441 | 130 |
| 679 | 3300032005 | Ga0307411_10522795 | Ga0307411_105227952 | 130 |
| 680 | 3300032005 | Ga0307411_10826661 | Ga0307411_108266612 | 130 |
| 681 | 3300032126 | Ga0307415_101315648 | Ga0307415_1013156481 | 130 |
| 682 | 3300032126 | Ga0307415_101343883 | Ga0307415_1013438832 | 130 |
| 683 | 3300033529 | Ga0316587_1017547 | Ga0316587_10175473 | 130 |
| 684 | 3300034818 | Ga0373950_0160311 | Ga0373950_0160311_10_402 | 130 |
| 685 | 3300034820 | Ga0373959_0014406 | Ga0373959_0014406_868_1287 | 130 |
| 686 | 3300035090 | Ga0373949_0072876 | Ga0373949_0072876_470_889 | 130 |
| 687 | 3300035112 | Ga0373932_0095872 | Ga0373932_0095872_79_471 | 130 |
| 688 | 3300035115 | Ga0373941_0258908 | Ga0373941_0258908_228_620 | 130 |
| 689 | 3300035398 | Ga0316574_0362033 | Ga0316574_0362033_58_450 | 130 |
| 690 | 3300035691 | Ga0373931_0318912 | Ga0373931_0318912_48_440 | 130 |
| 691 | 3300035691 | Ga0373931_0664801 | Ga0373931_0664801_111_533 | 130 |
| 692 | 3300036401 | Ga0373937_0273760 | Ga0373937_0273760_271_666 | 130 |
| 693 | 3300037068 | Ga0373925_0060365 | Ga0373925_0060365_1384_1776 | 130 |
| 694 | 3300037312 | Ga0395899_0044661 | Ga0395899_0044661_1906_2298 | 130 |
| 695 | 3300037418 | Ga0395900_0075274 | Ga0395900_0075274_1700_2092 | 130 |
| 696 | 3300037418 | Ga0395900_0078542 | Ga0395900_0078542_481_873 | 130 |
| 697 | 3300037418 | Ga0395900_0308699 | Ga0395900_0308699_64_456 | 130 |
| 698 | 3300037418 | Ga0395900_0346946 | Ga0395900_0346946_580_987 | 130 |
| 699 | 3300037466 | Ga0395898_0203092 | Ga0395898_0203092_921_1313 | 130 |
| 700 | 3300037466 | Ga0395898_0270557 | Ga0395898_0270557_397_789 | 130 |
| 701 | 3300037466 | Ga0395898_1236517 | Ga0395898_1236517_49_441 | 130 |
| 702 | 3300037853 | Ga0436364_1463267 | Ga0436364_1463267_464_859 | 130 |
| 703 | 3300038443 | Ga0395901_0108247 | Ga0395901_0108247_886_1278 | 130 |
| 704 | 3300038443 | Ga0395901_0166684 | Ga0395901_0166684_1652_2044 | 130 |
| 705 | 3300038443 | Ga0395901_1191589 | Ga0395901_1191589_320_712 | 130 |
| 706 | 3300039062 | Ga0400483_057660 | Ga0400483_057660_213_605 | 130 |
| 707 | 3300039062 | Ga0400483_114523 | Ga0400483_114523_2286_2678 | 130 |
| 708 | 3300039062 | Ga0400483_151905 | Ga0400483_151905_155_547 | 130 |
| 709 | 3300039062 | Ga0400483_217885 | Ga0400483_217885_3666_4058 | 130 |
| 710 | 3300039437 | Ga0436365_1369855 | Ga0436365_1369855_113_505 | 130 |
| 711 | 3300039438 | Ga0436360_0229296 | Ga0436360_0229296_459_854 | 130 |
| 712 | 3300039438 | Ga0436360_0840585 | Ga0436360_0840585_467_859 | 130 |
| 713 | 3300039438 | Ga0436360_0870274 | Ga0436360_0870274_436_831 | 130 |
| 714 | 3300039438 | Ga0436360_1007386 | Ga0436360_1007386_575_967 | 130 |
| 715 | 3300039438 | Ga0436360_1307620 | Ga0436360_1307620_163_555 | 130 |
| 716 | 3300039447 | Ga0436361_0305976 | Ga0436361_0305976_1441_1836 | 130 |
| 717 | 3300039447 | Ga0436361_0448350 | Ga0436361_0448350_94_489 | 130 |
| 718 | 3300039447 | Ga0436361_0498700 | Ga0436361_0498700_100_495 | 130 |
| 719 | 3300039447 | Ga0436361_0587648 | Ga0436361_0587648_210_605 | 130 |
| 720 | 3300039447 | Ga0436361_0618512 | Ga0436361_0618512_748_1143 | 130 |
| 721 | 3300039447 | Ga0436361_0632864 | Ga0436361_0632864_784_1179 | 130 |
| 722 | 3300039447 | Ga0436361_0834792 | Ga0436361_0834792_121_516 | 130 |
| 723 | 3300039447 | Ga0436361_0846724 | Ga0436361_0846724_326_721 | 130 |
| 724 | 3300039447 | Ga0436361_0853694 | Ga0436361_0853694_165_560 | 130 |
| 725 | 3300039447 | Ga0436361_1035119 | Ga0436361_1035119_4053_4448 | 130 |
| 726 | 3300039447 | Ga0436361_1061350 | Ga0436361_1061350_408_803 | 130 |
| 727 | 3300039453 | Ga0436362_0437344 | Ga0436362_0437344_122_517 | 130 |
| 728 | 3300039453 | Ga0436362_0608067 | Ga0436362_0608067_168_563 | 130 |
| 729 | 3300039453 | Ga0436362_1149838 | Ga0436362_1149838_350_742 | 130 |
| 730 | 3300041410 | Ga0439461_0027483 | Ga0439461_0027483_599_991 | 130 |
| 731 | 3300041411 | Ga0439466_0165373 | Ga0439466_0165373_200_592 | 130 |
| 732 | 3300041413 | Ga0439465_0041213 | Ga0439465_0041213_36_428 | 130 |
| 733 | 3300041413 | Ga0439465_0047897 | Ga0439465_0047897_377_796 | 130 |
| 734 | 3300041413 | Ga0439465_0055961 | Ga0439465_0055961_387_779 | 130 |
| 735 | 3300041413 | Ga0439465_0060786 | Ga0439465_0060786_29_421 | 130 |
| 736 | 3300041413 | Ga0439465_0134278 | Ga0439465_0134278_434_826 | 130 |
| 737 | 3300041443 | Ga0451789_0925233 | Ga0451789_0925233_166_558 | 130 |
| 738 | 3300041445 | Ga0451792_23296 | Ga0451792_23296_195_587 | 130 |
| 739 | 3300041446 | Ga0451794_41389 | Ga0451794_41389_43_435 | 130 |
| 740 | 3300041451 | Ga0451791_1156556 | Ga0451791_1156556_120_512 | 130 |
| 741 | 3300041452 | Ga0451793_0423706 | Ga0451793_0423706_427_819 | 130 |
| 742 | 3300041452 | Ga0451793_0894875 | Ga0451793_0894875_309_701 | 130 |
| 743 | 3300041453 | Ga0451797_1483980 | Ga0451797_1483980_176_568 | 130 |
| 744 | 3300041453 | Ga0451797_1528640 | Ga0451797_1528640_289_693 | 130 |
| 745 | 3300041459 | Ga0451800_0842399 | Ga0451800_0842399_98_490 | 130 |
| 746 | 3300041494 | Ga0451837_1281237 | Ga0451837_1281237_371_763 | 130 |
| 747 | 3300041494 | Ga0451837_1624919 | Ga0451837_1624919_195_587 | 130 |
| 748 | 3300041498 | Ga0451841_1096970 | Ga0451841_1096970_139_531 | 130 |
| 749 | 3300041509 | Ga0451843_0419583 | Ga0451843_0419583_157_549 | 130 |
| 750 | 3300041512 | Ga0451853_1217462 | Ga0451853_1217462_244_636 | 130 |
| 751 | 3300041512 | Ga0451853_1342895 | Ga0451853_1342895_28_420 | 130 |
| 752 | 3300041997 | Ga0439431_0116185 | Ga0439431_0116185_44_436 | 130 |
| 753 | 3300041999 | Ga0439433_0034999 | Ga0439433_0034999_332_751 | 130 |
| 754 | 3300042001 | Ga0439441_007617 | Ga0439441_007617_1088_1480 | 130 |
| 755 | 3300042003 | Ga0439443_043477 | Ga0439443_043477_197_589 | 130 |
| 756 | 3300042003 | Ga0439443_069840 | Ga0439443_069840_19_438 | 130 |
| 757 | 3300042004 | Ga0439445_0033058 | Ga0439445_0033058_160_552 | 130 |
| 758 | 3300042004 | Ga0439445_0037160 | Ga0439445_0037160_266_658 | 130 |
| 759 | 3300042006 | Ga0439432_052284 | Ga0439432_052284_718_1110 | 130 |
| 760 | 3300042006 | Ga0439432_164323 | Ga0439432_164323_206_598 | 130 |
| 761 | 3300042007 | Ga0439449_0071350 | Ga0439449_0071350_13_405 | 130 |
| 762 | 3300042010 | Ga0439452_044390 | Ga0439452_044390_298_717 | 130 |
| 763 | 3300042127 | Ga0450890_029163 | Ga0450890_029163_355_747 | 130 |
| 764 | 3300042128 | Ga0450897_047122 | Ga0450897_047122_45_437 | 130 |
| 765 | 3300042435 | Ga0439434_0037933 | Ga0439434_0037933_722_1114 | 130 |
| 766 | 3300042435 | Ga0439434_0094189 | Ga0439434_0094189_436_828 | 130 |
| 767 | 3300042436 | Ga0439435_0238884 | Ga0439435_0238884_57_449 | 130 |
| 768 | 3300042438 | Ga0439459_0204423 | Ga0439459_0204423_115_507 | 130 |
| 769 | 3300042876 | Ga0451577_0442387 | Ga0451577_0442387_512_913 | 130 |
| 770 | 3300044673 | Ga0453683_0050267 | Ga0453683_0050267_71_466 | 130 |
| 771 | 3300044683 | Ga0466965_0062359 | Ga0466965_0062359_802_1194 | 130 |
| 772 | 3300044694 | Ga0466963_0294172 | Ga0466963_0294172_688_1083 | 130 |
| 773 | 3300044694 | Ga0466963_0585595 | Ga0466963_0585595_28_420 | 130 |
| 774 | 3300044706 | Ga0466964_0629683 | Ga0466964_0629683_69_464 | 130 |
| 775 | 3300044712 | Ga0453684_0000204 | Ga0453684_0000204_12197_12598 | 130 |
| 776 | 3300044712 | Ga0453684_0001066 | Ga0453684_0001066_12119_12520 | 130 |
| 777 | 3300044719 | Ga0466971_0653608 | Ga0466971_0653608_85_477 | 130 |
| 778 | 3300044842 | Ga0466957_0021853 | Ga0466957_0021853_3186_3581 | 130 |
| 779 | 3300044842 | Ga0466957_0768282 | Ga0466957_0768282_103_495 | 130 |
| 780 | 3300045049 | Ga0466959_0599077 | Ga0466959_0599077_142_537 | 130 |
| 781 | 3300045051 | Ga0451576_0029379 | Ga0451576_0029379_885_1280 | 130 |
| 782 | 3300045051 | Ga0451576_0059829 | Ga0451576_0059829_2614_3009 | 130 |
| 783 | 3300045836 | Ga0466958_0000676 | Ga0466958_0000676_6786_7181 | 130 |
| 784 | 3300045836 | Ga0466958_0821197 | Ga0466958_0821197_41_448 | 130 |
| 785 | 3300045976 | Ga0466967_0242158 | Ga0466967_0242158_124_519 | 130 |
| 786 | 3300045976 | Ga0466967_0515250 | Ga0466967_0515250_513_908 | 130 |
| 787 | 3300045976 | Ga0466967_0547034 | Ga0466967_0547034_313_705 | 130 |
| 788 | 3300045976 | Ga0466967_0973100 | Ga0466967_0973100_403_795 | 130 |
| 789 | 3300045976 | Ga0466967_2250869 | Ga0466967_2250869_21_413 | 130 |
| 790 | 3300046500 | Ga0495596_0250676 | Ga0495596_0250676_141_533 | 130 |
| 791 | 3300046615 | Ga0495656_0371829 | Ga0495656_0371829_119_514 | 130 |
| 792 | 3300046616 | Ga0495668_0545614 | Ga0495668_0545614_197_589 | 130 |
| 793 | 3300047472 | Ga0495686_0047436 | Ga0495686_0047436_589_981 | 130 |
| 794 | 3300048905 | Ga0496102_0668275 | Ga0496102_0668275_65_457 | 130 |
| 795 | 3300048909 | Ga0496106_0491162 | Ga0496106_0491162_447_839 | 130 |
| 796 | 3300048913 | Ga0496110_0542264 | Ga0496110_0542264_567_959 | 130 |
| 797 | 3300048914 | Ga0496111_0364438 | Ga0496111_0364438_317_709 | 130 |
| 798 | 3300048915 | Ga0496112_0518153 | Ga0496112_0518153_77_496 | 130 |
| 799 | 3300048921 | Ga0496118_0121464 | Ga0496118_0121464_188_580 | 130 |
| 800 | 3300048924 | Ga0496121_0111944 | Ga0496121_0111944_547_939 | 130 |
| 801 | 3300048924 | Ga0496121_0533132 | Ga0496121_0533132_26_418 | 130 |
| 802 | 3300048927 | Ga0496124_0030584 | Ga0496124_0030584_1185_1577 | 130 |
| 803 | 3300048927 | Ga0496124_0211277 | Ga0496124_0211277_877_1269 | 130 |
| 804 | 3300048927 | Ga0496124_0297344 | Ga0496124_0297344_657_1049 | 130 |
| 805 | 3300048928 | Ga0496125_0000815 | Ga0496125_0000815_25948_26340 | 130 |
| 806 | 3300048928 | Ga0496125_0254919 | Ga0496125_0254919_538_930 | 130 |
| 807 | 3300048929 | Ga0496126_0119659 | Ga0496126_0119659_28_420 | 130 |
| 808 | 3300048929 | Ga0496126_0206650 | Ga0496126_0206650_604_996 | 130 |
| 809 | 3300048929 | Ga0496126_0271543 | Ga0496126_0271543_609_1001 | 130 |
| 810 | 3300049127 | Ga0501306_004657 | Ga0501306_004657_196_588 | 130 |
| 811 | 3300049127 | Ga0501306_040025 | Ga0501306_040025_147_539 | 130 |
| 812 | 3300049161 | Ga0501305_002063 | Ga0501305_002063_138_530 | 130 |
| 813 | 3300049161 | Ga0501305_016841 | Ga0501305_016841_163_555 | 130 |
| 814 | 3300049162 | Ga0501307_005955 | Ga0501307_005955_365_757 | 130 |
| 815 | 3300049528 | Ga0501312_078181 | Ga0501312_078181_142_534 | 130 |
| 816 | 3300049529 | Ga0501313_018950 | Ga0501313_018950_75_467 | 130 |
| 817 | 3300049530 | Ga0501314_010050 | Ga0501314_010050_403_795 | 130 |
| 818 | 3300049531 | Ga0501315_058471 | Ga0501315_058471_145_537 | 130 |
| 819 | 3300049532 | Ga0501316_024206 | Ga0501316_024206_36_428 | 130 |
| 820 | 3300049533 | Ga0501317_023840 | Ga0501317_023840_295_687 | 130 |
| 821 | 3300049536 | Ga0501320_009962 | Ga0501320_009962_480_872 | 130 |
| 822 | 3300049537 | Ga0501321_022779 | Ga0501321_022779_104_496 | 130 |
| 823 | 3300049539 | Ga0501323_002663 | Ga0501323_002663_1265_1657 | 130 |
| 824 | 3300049568 | Ga0501031_0046811 | Ga0501031_0046811_1522_1914 | 130 |
| 825 | 3300049568 | Ga0501031_0628297 | Ga0501031_0628297_218_610 | 130 |
| 826 | 3300049569 | Ga0501032_0062255 | Ga0501032_0062255_1893_2285 | 130 |
| 827 | 3300049569 | Ga0501032_0156892 | Ga0501032_0156892_1040_1432 | 130 |
| 828 | 3300049569 | Ga0501032_0258239 | Ga0501032_0258239_31_423 | 130 |
| 829 | 3300049569 | Ga0501032_0296046 | Ga0501032_0296046_87_479 | 130 |
| 830 | 3300049570 | Ga0501033_0020210 | Ga0501033_0020210_2977_3369 | 130 |
| 831 | 3300049570 | Ga0501033_0089600 | Ga0501033_0089600_592_984 | 130 |
| 832 | 3300049570 | Ga0501033_0094339 | Ga0501033_0094339_760_1152 | 130 |
| 833 | 3300049570 | Ga0501033_1067626 | Ga0501033_1067626_31_423 | 130 |
| 834 | 3300049571 | Ga0501034_0009019 | Ga0501034_0009019_9947_10339 | 130 |
| 835 | 3300049571 | Ga0501034_0063216 | Ga0501034_0063216_317_709 | 130 |
| 836 | 3300049571 | Ga0501034_0085750 | Ga0501034_0085750_764_1156 | 130 |
| 837 | 3300049571 | Ga0501034_0105047 | Ga0501034_0105047_1514_1906 | 130 |
| 838 | 3300049571 | Ga0501034_0158436 | Ga0501034_0158436_1821_2213 | 130 |
| 839 | 3300049571 | Ga0501034_0311870 | Ga0501034_0311870_251_643 | 130 |
| 840 | 3300049571 | Ga0501034_0328774 | Ga0501034_0328774_130_522 | 130 |
| 841 | 3300049571 | Ga0501034_0442975 | Ga0501034_0442975_190_582 | 130 |
| 842 | 3300049571 | Ga0501034_0559110 | Ga0501034_0559110_199_591 | 130 |
| 843 | 3300049571 | Ga0501034_0632220 | Ga0501034_0632220_329_721 | 130 |
| 844 | 3300049572 | Ga0501036_0035510 | Ga0501036_0035510_3623_4015 | 130 |
| 845 | 3300049572 | Ga0501036_0087494 | Ga0501036_0087494_1063_1455 | 130 |
| 846 | 3300049572 | Ga0501036_0138141 | Ga0501036_0138141_1548_1940 | 130 |
| 847 | 3300049572 | Ga0501036_0237253 | Ga0501036_0237253_43_435 | 130 |
| 848 | 3300049572 | Ga0501036_0411357 | Ga0501036_0411357_604_996 | 130 |
| 849 | 3300049572 | Ga0501036_0411687 | Ga0501036_0411687_664_1056 | 130 |
| 850 | 3300049572 | Ga0501036_0996251 | Ga0501036_0996251_115_507 | 130 |
| 851 | 3300049572 | Ga0501036_1058290 | Ga0501036_1058290_191_583 | 130 |
| 852 | 3300049573 | Ga0501037_0017735 | Ga0501037_0017735_1521_1913 | 130 |
| 853 | 3300049573 | Ga0501037_0021388 | Ga0501037_0021388_1507_1899 | 130 |
| 854 | 3300049573 | Ga0501037_0168587 | Ga0501037_0168587_390_782 | 130 |
| 855 | 3300049573 | Ga0501037_0195584 | Ga0501037_0195584_43_435 | 130 |
| 856 | 3300049573 | Ga0501037_0206675 | Ga0501037_0206675_562_954 | 130 |
| 857 | 3300049573 | Ga0501037_0519538 | Ga0501037_0519538_248_640 | 130 |
| 858 | 3300049574 | Ga0501038_0042562 | Ga0501038_0042562_1695_2087 | 130 |
| 859 | 3300049574 | Ga0501038_0180198 | Ga0501038_0180198_104_496 | 130 |
| 860 | 3300049574 | Ga0501038_0536937 | Ga0501038_0536937_322_714 | 130 |
| 861 | 3300049574 | Ga0501038_0906948 | Ga0501038_0906948_193_585 | 130 |
| 862 | 3300049575 | Ga0501039_0002113 | Ga0501039_0002113_4002_4394 | 130 |
| 863 | 3300049575 | Ga0501039_0049376 | Ga0501039_0049376_1624_2016 | 130 |
| 864 | 3300049575 | Ga0501039_0308727 | Ga0501039_0308727_416_808 | 130 |
| 865 | 3300049575 | Ga0501039_1047509 | Ga0501039_1047509_74_466 | 130 |
| 866 | 3300049576 | Ga0501040_0017061 | Ga0501040_0017061_3661_4053 | 130 |
| 867 | 3300049577 | Ga0501041_0017640 | Ga0501041_0017640_2011_2403 | 130 |
| 868 | 3300049578 | Ga0501042_0008704 | Ga0501042_0008704_926_1318 | 130 |
| 869 | 3300049578 | Ga0501042_0228234 | Ga0501042_0228234_441_833 | 130 |
| 870 | 3300049578 | Ga0501042_0260029 | Ga0501042_0260029_589_1005 | 130 |
| 871 | 3300049578 | Ga0501042_0288533 | Ga0501042_0288533_322_714 | 130 |
| 872 | 3300049579 | Ga0501043_0041509 | Ga0501043_0041509_1588_1980 | 130 |
| 873 | 3300049579 | Ga0501043_0102115 | Ga0501043_0102115_730_1122 | 130 |
| 874 | 3300049579 | Ga0501043_0147855 | Ga0501043_0147855_224_616 | 130 |
| 875 | 3300049579 | Ga0501043_0346802 | Ga0501043_0346802_402_794 | 130 |
| 876 | 3300049579 | Ga0501043_0395431 | Ga0501043_0395431_464_856 | 130 |
| 877 | 3300049579 | Ga0501043_0484803 | Ga0501043_0484803_350_742 | 130 |
| 878 | 3300049580 | Ga0501046_0014121 | Ga0501046_0014121_3198_3590 | 130 |
| 879 | 3300049580 | Ga0501046_0084362 | Ga0501046_0084362_1340_1732 | 130 |
| 880 | 3300049580 | Ga0501046_0342154 | Ga0501046_0342154_520_912 | 130 |
| 881 | 3300049580 | Ga0501046_0430184 | Ga0501046_0430184_435_827 | 130 |
| 882 | 3300049580 | Ga0501046_0633474 | Ga0501046_0633474_83_475 | 130 |
| 883 | 3300049581 | Ga0501047_0023666 | Ga0501047_0023666_2015_2407 | 130 |
| 884 | 3300049581 | Ga0501047_0072862 | Ga0501047_0072862_1015_1407 | 130 |
| 885 | 3300049581 | Ga0501047_0272848 | Ga0501047_0272848_875_1267 | 130 |
| 886 | 3300049581 | Ga0501047_0327459 | Ga0501047_0327459_61_477 | 130 |
| 887 | 3300049581 | Ga0501047_0373505 | Ga0501047_0373505_483_875 | 130 |
| 888 | 3300049581 | Ga0501047_1010840 | Ga0501047_1010840_123_518 | 130 |
| 889 | 3300049581 | Ga0501047_1052878 | Ga0501047_1052878_101_493 | 130 |
| 890 | 3300049582 | Ga0501048_0010039 | Ga0501048_0010039_1243_1635 | 130 |
| 891 | 3300049582 | Ga0501048_0198057 | Ga0501048_0198057_828_1220 | 130 |
| 892 | 3300049583 | Ga0501067_0158465 | Ga0501067_0158465_52_444 | 130 |
| 893 | 3300049584 | Ga0501068_0094949 | Ga0501068_0094949_997_1389 | 130 |
| 894 | 3300049585 | Ga0501069_0612400 | Ga0501069_0612400_112_504 | 130 |
| 895 | 3300049585 | Ga0501069_0631134 | Ga0501069_0631134_222_614 | 130 |
| 896 | 3300049586 | Ga0501070_0048130 | Ga0501070_0048130_1735_2127 | 130 |
| 897 | 3300049586 | Ga0501070_0057104 | Ga0501070_0057104_1264_1656 | 130 |
| 898 | 3300049586 | Ga0501070_0548828 | Ga0501070_0548828_235_627 | 130 |
| 899 | 3300049586 | Ga0501070_0809480 | Ga0501070_0809480_212_604 | 130 |
| 900 | 3300049586 | Ga0501070_0996187 | Ga0501070_0996187_169_561 | 130 |
| 901 | 3300049587 | Ga0501071_0050852 | Ga0501071_0050852_1399_1791 | 130 |
| 902 | 3300049587 | Ga0501071_0382330 | Ga0501071_0382330_488_880 | 130 |
| 903 | 3300049588 | Ga0501072_0001884 | Ga0501072_0001884_5785_6177 | 130 |
| 904 | 3300049588 | Ga0501072_0263164 | Ga0501072_0263164_611_1003 | 130 |
| 905 | 3300049588 | Ga0501072_0321875 | Ga0501072_0321875_632_1024 | 130 |
| 906 | 3300049588 | Ga0501072_0345687 | Ga0501072_0345687_770_1162 | 130 |
| 907 | 3300049588 | Ga0501072_0503985 | Ga0501072_0503985_94_486 | 130 |
| 908 | 3300049588 | Ga0501072_1018620 | Ga0501072_1018620_177_569 | 130 |
| 909 | 3300049588 | Ga0501072_1138625 | Ga0501072_1138625_38_430 | 130 |
| 910 | 3300049589 | Ga0501073_0039915 | Ga0501073_0039915_1712_2104 | 130 |
| 911 | 3300049589 | Ga0501073_0617429 | Ga0501073_0617429_249_653 | 130 |
| 912 | 3300049590 | Ga0501074_0189365 | Ga0501074_0189365_429_833 | 130 |
| 913 | 3300049590 | Ga0501074_0219718 | Ga0501074_0219718_60_452 | 130 |
| 914 | 3300049590 | Ga0501074_0405920 | Ga0501074_0405920_412_804 | 130 |
| 915 | 3300049590 | Ga0501074_0576756 | Ga0501074_0576756_375_767 | 130 |
| 916 | 3300049590 | Ga0501074_0666831 | Ga0501074_0666831_157_549 | 130 |
| 917 | 3300049591 | Ga0501075_0015718 | Ga0501075_0015718_2493_2885 | 130 |
| 918 | 3300049592 | Ga0501076_0018242 | Ga0501076_0018242_2534_2926 | 130 |
| 919 | 3300049592 | Ga0501076_0142095 | Ga0501076_0142095_649_1068 | 130 |
| 920 | 3300049592 | Ga0501076_0224846 | Ga0501076_0224846_40_432 | 130 |
| 921 | 3300049592 | Ga0501076_0942531 | Ga0501076_0942531_307_699 | 130 |
| 922 | 3300049593 | Ga0501077_0116244 | Ga0501077_0116244_14_406 | 130 |
| 923 | 3300049705 | Ga0501225_0013278 | Ga0501225_0013278_197_589 | 130 |
| 924 | 3300049708 | Ga0501245_081165 | Ga0501245_081165_214_606 | 130 |
| 925 | 3300049741 | Ga0501079_0099277 | Ga0501079_0099277_1851_2243 | 130 |
| 926 | 3300049741 | Ga0501079_0555316 | Ga0501079_0555316_380_772 | 130 |
| 927 | 3300049741 | Ga0501079_0666962 | Ga0501079_0666962_193_585 | 130 |
| 928 | 3300049742 | Ga0501080_0040964 | Ga0501080_0040964_2662_3054 | 130 |
| 929 | 3300049742 | Ga0501080_0043942 | Ga0501080_0043942_2480_2872 | 130 |
| 930 | 3300049742 | Ga0501080_0267426 | Ga0501080_0267426_1038_1430 | 130 |
| 931 | 3300049742 | Ga0501080_0379970 | Ga0501080_0379970_92_514 | 130 |
| 932 | 3300049742 | Ga0501080_0390530 | Ga0501080_0390530_403_822 | 130 |
| 933 | 3300049742 | Ga0501080_0461476 | Ga0501080_0461476_336_728 | 130 |
| 934 | 3300049742 | Ga0501080_0506927 | Ga0501080_0506927_540_944 | 130 |
| 935 | 3300049742 | Ga0501080_1724065 | Ga0501080_1724065_78_470 | 130 |
| 936 | 3300049743 | Ga0501081_0115551 | Ga0501081_0115551_1034_1426 | 130 |
| 937 | 3300049743 | Ga0501081_0305799 | Ga0501081_0305799_281_673 | 130 |
| 938 | 3300049743 | Ga0501081_0390799 | Ga0501081_0390799_556_948 | 130 |
| 939 | 3300049744 | Ga0501083_0076712 | Ga0501083_0076712_1263_1655 | 130 |
| 940 | 3300049763 | Ga0501266_092015 | Ga0501266_092015_38_430 | 130 |
| 941 | 3300049822 | Ga0501035_0004418 | Ga0501035_0004418_4705_5097 | 130 |
| 942 | 3300049822 | Ga0501035_0106313 | Ga0501035_0106313_1750_2142 | 130 |
| 943 | 3300049822 | Ga0501035_0206294 | Ga0501035_0206294_771_1163 | 130 |
| 944 | 3300049823 | Ga0501044_0151055 | Ga0501044_0151055_1569_1961 | 130 |
| 945 | 3300049823 | Ga0501044_0309268 | Ga0501044_0309268_324_716 | 130 |
| 946 | 3300049823 | Ga0501044_0315133 | Ga0501044_0315133_709_1101 | 130 |
| 947 | 3300049823 | Ga0501044_0389944 | Ga0501044_0389944_878_1270 | 130 |
| 948 | 3300049823 | Ga0501044_0548368 | Ga0501044_0548368_110_502 | 130 |
| 949 | 3300049823 | Ga0501044_0556863 | Ga0501044_0556863_455_847 | 130 |
| 950 | 3300049823 | Ga0501044_0753926 | Ga0501044_0753926_183_575 | 130 |
| 951 | 3300049823 | Ga0501044_0997315 | Ga0501044_0997315_153_545 | 130 |
| 952 | 3300049823 | Ga0501044_1459637 | Ga0501044_1459637_39_431 | 130 |
| 953 | 3300049824 | Ga0501045_0054331 | Ga0501045_0054331_1271_1663 | 130 |
| 954 | 3300049824 | Ga0501045_0736522 | Ga0501045_0736522_20_412 | 130 |
| 955 | 3300049824 | Ga0501045_1249794 | Ga0501045_1249794_129_521 | 130 |
| 956 | 3300050489 | nmdc:mga03683_15426_c1 | nmdc:mga03683_15426_c1_513_905 | 130 |
| 957 | 3300050489 | nmdc:mga03683_33662_c1 | nmdc:mga03683_33662_c1_476_868 | 130 |
| 958 | 3300050490 | nmdc:mga03n38_27914_c1 | nmdc:mga03n38_27914_c1_352_744 | 130 |
| 959 | 3300050490 | nmdc:mga03n38_471881_c1 | nmdc:mga03n38_471881_c1_142_534 | 130 |
| 960 | 3300050490 | nmdc:mga03n38_7293_c1 | nmdc:mga03n38_7293_c1_1481_1873 | 130 |
| 961 | 3300050491 | nmdc:mga00v17_126638_c1 | nmdc:mga00v17_126638_c1_256_648 | 130 |
| 962 | 3300050491 | nmdc:mga00v17_170368_c1 | nmdc:mga00v17_170368_c1_759_1178 | 130 |
| 963 | 3300050491 | nmdc:mga00v17_59684_c1 | nmdc:mga00v17_59684_c1_1261_1653 | 130 |
| 964 | 3300050492 | nmdc:mga0yw44_523446_c1 | nmdc:mga0yw44_523446_c1_334_726 | 130 |
| 965 | 3300050493 | nmdc:mga0k408_235620_c1 | nmdc:mga0k408_235620_c1_440_832 | 130 |
| 966 | 3300050493 | nmdc:mga0k408_24799_c1 | nmdc:mga0k408_24799_c1_1904_2296 | 130 |
| 967 | 3300050493 | nmdc:mga0k408_63879_c1 | nmdc:mga0k408_63879_c1_322_741 | 130 |
| 968 | 3300050494 | nmdc:mga06z11_15472_c1 | nmdc:mga06z11_15472_c1_706_1098 | 130 |
| 969 | 3300050494 | nmdc:mga06z11_593224_c1 | nmdc:mga06z11_593224_c1_252_644 | 130 |
| 970 | 3300050494 | nmdc:mga06z11_77218_c1 | nmdc:mga06z11_77218_c1_823_1242 | 130 |
| 971 | 3300050494 | nmdc:mga06z11_777235_c1 | nmdc:mga06z11_777235_c1_170_562 | 130 |
| 972 | 3300050496 | nmdc:mga07m45_277624_c1 | nmdc:mga07m45_277624_c1_371_790 | 130 |
| 973 | 3300050496 | nmdc:mga07m45_87006_c1 | nmdc:mga07m45_87006_c1_467_859 | 130 |
| 974 | 3300050508 | nmdc:mga09592_150655_c1 | nmdc:mga09592_150655_c1_547_966 | 130 |
| 975 | 3300050509 | nmdc:mga0qj67_138207_c1 | nmdc:mga0qj67_138207_c1_1046_1438 | 130 |
| 976 | 3300050510 | nmdc:mga06r32_1500966_c1 | nmdc:mga06r32_1500966_c1_63_455 | 130 |
| 977 | 3300050511 | nmdc:mga08y16_225804_c1 | nmdc:mga08y16_225804_c1_317_736 | 130 |
| 978 | 3300050515 | nmdc:mga0a205_400896_c1 | nmdc:mga0a205_400896_c1_44_463 | 130 |
| 979 | 3300053108 | Ga0500562_045367 | Ga0500562_045367_208_600 | 130 |
| 980 | 3300053116 | Ga0500592_073790 | Ga0500592_073790_37_429 | 130 |
| 981 | 3300053119 | Ga0500595_035050 | Ga0500595_035050_1008_1400 | 130 |
| 982 | 3300053120 | Ga0500597_424565 | Ga0500597_424565_22_414 | 130 |
| 983 | 3300053125 | Ga0500618_099914 | Ga0500618_099914_233_643 | 130 |
| 984 | 3300053134 | Ga0500658_0152050 | Ga0500658_0152050_432_827 | 130 |
| 985 | 3300053136 | Ga0500559_0351656 | Ga0500559_0351656_149_541 | 130 |
| 986 | 3300053146 | Ga0500588_0026749 | Ga0500588_0026749_57_452 | 130 |
| 987 | 3300053151 | Ga0500604_0000294 | Ga0500604_0000294_11207_11599 | 130 |
| 988 | 3300053153 | Ga0500616_0036565 | Ga0500616_0036565_1797_2189 | 130 |
| 989 | 3300053157 | Ga0500624_002765 | Ga0500624_002765_1557_1949 | 130 |
| 990 | 3300053158 | Ga0500627_0230262 | Ga0500627_0230262_19_411 | 130 |
| 991 | 3300053161 | Ga0500634_0000031 | Ga0500634_0000031_14992_15384 | 130 |
| 992 | 3300053731 | Ga0500609_017819 | Ga0500609_017819_295_690 | 130 |
| 993 | 3300054114 | Ga0501084_0412365 | Ga0501084_0412365_267_659 | 130 |
| 994 | 3300054114 | Ga0501084_1333973 | Ga0501084_1333973_165_566 | 130 |
| 995 | 3300059477 | Ga0587084_003875 | Ga0587084_003875_288_680 | 130 |
| 996 | 3300059477 | Ga0587084_050266 | Ga0587084_050266_157_549 | 130 |
| 997 | 3300059477 | Ga0587084_055003 | Ga0587084_055003_231_623 | 130 |
| 998 | 3300059477 | Ga0587084_083566 | Ga0587084_083566_173_568 | 130 |
| 999 | 3300059477 | Ga0587084_089472 | Ga0587084_089472_67_459 | 130 |
| 1000 | 3300059478 | Ga0587093_010726 | Ga0587093_010726_511_903 | 130 |
| 1001 | 3300059491 | Ga0587070_051636 | Ga0587070_051636_168_560 | 130 |
| 1002 | 3300059493 | Ga0587077_001444 | Ga0587077_001444_1292_1684 | 130 |
| 1003 | 3300059493 | Ga0587077_001858 | Ga0587077_001858_1292_1684 | 130 |
| 1004 | 3300059493 | Ga0587077_002494 | Ga0587077_002494_599_991 | 130 |
| 1005 | 3300059493 | Ga0587077_023368 | Ga0587077_023368_370_762 | 130 |
| 1006 | 3300059493 | Ga0587077_034979 | Ga0587077_034979_420_812 | 130 |
| 1007 | 3300059503 | Ga0587080_006331 | Ga0587080_006331_124_516 | 130 |
| 1008 | 3300059504 | Ga0587082_001421 | Ga0587082_001421_708_1100 | 130 |
| 1009 | 3300059504 | Ga0587082_015733 | Ga0587082_015733_689_1081 | 130 |
| 1010 | 3300059504 | Ga0587082_071053 | Ga0587082_071053_164_556 | 130 |
| 1011 | 3300059504 | Ga0587082_105589 | Ga0587082_105589_129_521 | 130 |
| 1012 | 3300059505 | Ga0587083_0082405 | Ga0587083_0082405_273_668 | 130 |
| 1013 | 3300059506 | Ga0587085_057305 | Ga0587085_057305_234_626 | 130 |
| 1014 | 3300059506 | Ga0587085_096769 | Ga0587085_096769_73_465 | 130 |
| 1015 | 3300059507 | Ga0587086_009659 | Ga0587086_009659_118_510 | 130 |
| 1016 | 3300059508 | Ga0587088_007703 | Ga0587088_007703_151_543 | 130 |
| 1017 | 3300059508 | Ga0587088_011507 | Ga0587088_011507_387_779 | 130 |
| 1018 | 3300059508 | Ga0587088_013341 | Ga0587088_013341_715_1107 | 130 |
| 1019 | 3300059508 | Ga0587088_066307 | Ga0587088_066307_203_595 | 130 |
| 1020 | 3300059508 | Ga0587088_093330 | Ga0587088_093330_126_518 | 130 |
| 1021 | 3300059509 | Ga0587089_012097 | Ga0587089_012097_627_1019 | 130 |
| 1022 | 3300059510 | Ga0587090_007514 | Ga0587090_007514_250_642 | 130 |
| 1023 | 3300059510 | Ga0587090_037431 | Ga0587090_037431_137_529 | 130 |
| 1024 | 3300059510 | Ga0587090_047818 | Ga0587090_047818_302_694 | 130 |
| 1025 | 3300059511 | Ga0587091_037281 | Ga0587091_037281_129_521 | 130 |
| 1026 | 3300059511 | Ga0587091_077869 | Ga0587091_077869_145_537 | 130 |
| 1027 | 3300059512 | Ga0587092_045558 | Ga0587092_045558_138_530 | 130 |
| 1028 | 3300059513 | Ga0587094_016519 | Ga0587094_016519_483_875 | 130 |
| 1029 | 3300059514 | Ga0587095_016766 | Ga0587095_016766_131_523 | 130 |
| 1030 | 3300059605 | Ga0587106_037582 | Ga0587106_037582_306_698 | 130 |
| 1031 | 3300059607 | Ga0587125_004018 | Ga0587125_004018_831_1223 | 130 |
| 1032 | 3300059607 | Ga0587125_004288 | Ga0587125_004288_741_1133 | 130 |
| 1033 | 3300059607 | Ga0587125_014823 | Ga0587125_014823_150_542 | 130 |
| 1034 | 3300059623 | Ga0587101_000419 | Ga0587101_000419_1663_2055 | 130 |
| 1035 | 3300059623 | Ga0587101_005367 | Ga0587101_005367_76_468 | 130 |
| 1036 | 3300059623 | Ga0587101_052671 | Ga0587101_052671_161_553 | 130 |
| 1037 | 3300059624 | Ga0587109_008800 | Ga0587109_008800_126_518 | 130 |
| 1038 | 3300059625 | Ga0587113_007243 | Ga0587113_007243_377_769 | 130 |
| 1039 | 3300059626 | Ga0587115_002202 | Ga0587115_002202_101_493 | 130 |
| 1040 | 3300059630 | Ga0587128_022544 | Ga0587128_022544_355_747 | 130 |
| 1041 | 3300059630 | Ga0587128_072627 | Ga0587128_072627_186_578 | 130 |
| 1042 | 3300059639 | Ga0587062_000396 | Ga0587062_000396_971_1363 | 130 |
| 1043 | 3300059639 | Ga0587062_035592 | Ga0587062_035592_118_516 | 130 |
| 1044 | 3300059639 | Ga0587062_059166 | Ga0587062_059166_124_516 | 130 |
| 1045 | 3300059639 | Ga0587062_069540 | Ga0587062_069540_145_537 | 130 |
| 1046 | 3300059641 | Ga0587068_064862 | Ga0587068_064862_167_559 | 130 |
| 1047 | 3300059641 | Ga0587068_065733 | Ga0587068_065733_149_541 | 130 |
| 1048 | 3300059641 | Ga0587068_072764 | Ga0587068_072764_140_532 | 130 |
| 1049 | 3300059641 | Ga0587068_140533 | Ga0587068_140533_126_518 | 130 |
| 1050 | 3300059642 | Ga0587069_088448 | Ga0587069_088448_150_542 | 130 |
| 1051 | 3300059643 | Ga0587072_001969 | Ga0587072_001969_1579_1971 | 130 |
| 1052 | 3300059643 | Ga0587072_119616 | Ga0587072_119616_148_540 | 130 |
| 1053 | 3300059644 | Ga0587075_035777 | Ga0587075_035777_165_557 | 130 |
| 1054 | 3300059644 | Ga0587075_053092 | Ga0587075_053092_64_456 | 130 |
| 1055 | 3300059644 | Ga0587075_071844 | Ga0587075_071844_103_495 | 130 |
| 1056 | 3300059645 | Ga0587076_001599 | Ga0587076_001599_861_1253 | 130 |
| 1057 | 3300059645 | Ga0587076_122057 | Ga0587076_122057_62_454 | 130 |
| 1058 | 3300059645 | Ga0587076_132225 | Ga0587076_132225_44_436 | 130 |
| 1059 | 3300059646 | Ga0587078_009790 | Ga0587078_009790_152_544 | 130 |
| 1060 | 3300059646 | Ga0587078_028130 | Ga0587078_028130_59_451 | 130 |
| 1061 | 3300059647 | Ga0587079_027627 | Ga0587079_027627_524_916 | 130 |
| 1062 | 3300059647 | Ga0587079_121447 | Ga0587079_121447_152_544 | 130 |
| 1063 | 3300059647 | Ga0587079_190566 | Ga0587079_190566_71_463 | 130 |
| 1064 | 3300059648 | Ga0587100_007768 | Ga0587100_007768_84_476 | 130 |
| 1065 | 3300059648 | Ga0587100_042521 | Ga0587100_042521_88_480 | 130 |
| 1066 | 3300059649 | Ga0587102_009709 | Ga0587102_009709_427_819 | 130 |
| 1067 | 3300059650 | Ga0587104_006947 | Ga0587104_006947_71_463 | 130 |
| 1068 | 3300059651 | Ga0587105_021399 | Ga0587105_021399_37_429 | 130 |
| 1069 | 3300059652 | Ga0587107_001723 | Ga0587107_001723_784_1176 | 130 |
| 1070 | 3300059652 | Ga0587107_003424 | Ga0587107_003424_64_456 | 130 |
| 1071 | 3300059652 | Ga0587107_011495 | Ga0587107_011495_347_739 | 130 |
| 1072 | 3300059652 | Ga0587107_079609 | Ga0587107_079609_81_473 | 130 |
| 1073 | 3300059652 | Ga0587107_088702 | Ga0587107_088702_155_547 | 130 |
| 1074 | 3300059653 | Ga0587108_002343 | Ga0587108_002343_319_711 | 130 |
| 1075 | 3300059653 | Ga0587108_032191 | Ga0587108_032191_84_476 | 130 |
| 1076 | 3300059654 | Ga0587110_001125 | Ga0587110_001125_1391_1783 | 130 |
| 1077 | 3300059654 | Ga0587110_046651 | Ga0587110_046651_105_497 | 130 |
| 1078 | 3300059655 | Ga0587114_052798 | Ga0587114_052798_218_610 | 130 |
| 1079 | 3300059658 | Ga0587119_044866 | Ga0587119_044866_110_502 | 130 |
| 1080 | 3300059660 | Ga0587124_004270 | Ga0587124_004270_610_1002 | 130 |
| 1081 | 3300059660 | Ga0587124_027474 | Ga0587124_027474_126_518 | 130 |
| 1082 | 3300060344 | Ga0587071_074262 | Ga0587071_074262_321_713 | 130 |
| 1083 | 3300060346 | Ga0587111_0000931 | Ga0587111_0000931_1614_2006 | 130 |
| 1084 | 3300060346 | Ga0587111_0032299 | Ga0587111_0032299_141_533 | 130 |
| 1085 | 3300060346 | Ga0587111_0098969 | Ga0587111_0098969_182_574 | 130 |
| 1086 | 3300060346 | Ga0587111_0151807 | Ga0587111_0151807_135_527 | 130 |
| 1087 | 3300060353 | Ga0501082_0090464 | Ga0501082_0090464_1349_1741 | 130 |
| 1088 | 3300060353 | Ga0501082_0629535 | Ga0501082_0629535_81_473 | 130 |
| 1089 | 3300060353 | Ga0501082_1531683 | Ga0501082_1531683_18_410 | 130 |
| 1090 | 3300061719 | Ga0466962_0189993 | Ga0466962_0189993_66_458 | 130 |
| 1091 | 3300061719 | Ga0466962_0490064 | Ga0466962_0490064_164_559 | 130 |
| 1092 | 3300061734 | Ga0530510_0020928 | Ga0530510_0020928_1261_1653 | 130 |
| 1093 | 3300061734 | Ga0530510_0118649 | Ga0530510_0118649_1440_1832 | 130 |
| 1094 | 3300061734 | Ga0530510_0211241 | Ga0530510_0211241_418_810 | 130 |
| 1095 | 3300061734 | Ga0530510_0665620 | Ga0530510_0665620_221_613 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cee-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9486 | 16 | 115 |
| 8cdv-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state ii) | 0.9409 | 17 | 108 |
| 8cdv-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state ii) | 0.9312 | 17 | 108 |
| 8cee-assembly1.cif.gz_V | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9306 | 16 | 115 |
| 4v48-assembly1.cif.gz_BK | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9291 | 15 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7VRG2_61_286_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9035 | 18 | 47 | 3.60.21.10 |
| af_P55138_1_114_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8814 | 19 | 47 | 3.30.420.40 |
| 4qs2K00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.876 | 15 | 130 | 3.30.420.80 |
| af_P0C464_21_142_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8648 | 9 | 129 | 3.30.420.80 |
| af_Q9VEN6_71_200_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.8539 | 16 | 130 | 3.30.420.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E0GRJ6-F1-model_v4 | 30S ribosomal protein S11 | 0.947 | 7 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2E0GRJ6-F1-model_v4 | 30S ribosomal protein S11 | 0.9388 | 7 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A3D0RPL5-F1-model_v4 | 30S ribosomal protein S11 | 0.9371 | 22 | 109 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A0G1UXB4-F1-model_v4 | Small ribosomal subunit protein uS11 | 0.9332 | 18 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0008168 GO:0019843 GO:0032259 GO:1990904 |
| AF-A0A3D4MDQ3-F1-model_v4 | Small ribosomal subunit protein uS11 (30S ribosomal protein S11) | 0.921 | 15 | 130 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar