F489965
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1095 | 625 | 2190 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300050516|nmdc:mga0sz30_2522_c2|nmdc:mga0sz30_2522_c2_1396_2205 |
| Length | 269 |
| Sequence | MRQYLELMEHVLANGVQKHDRTGTGTLSVFGHQMRFDLSEGFPLVTTKKIHLKSIIHELIWFLAGDTNIKYLNDNGVRIWDEWADNDGELGPVYGKQWRSWPTSDGGGPDGKTIDQIGNLLAMIRKNPDSRRLIVSAWNPAEVDKMALPPCHTMFQFYVANGKLSCQLYQRSADIFLGVPFNIASYALLTMMIAQVTNLKLGEFIHTFGDAHLYSNHIEQAHLQLSRAPKALPTMRINPGVTDLFAFRYDDFTLEGYEPHPHIKAEVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 18 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 19 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 22 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 23 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 24 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 25 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 26 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 27 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 29 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 32 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 105 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 110 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 111 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 112 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 113 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 117 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 120 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 127 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 128 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 129 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 130 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 133 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 134 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 135 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 136 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 137 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 169 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 170 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 171 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 249 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 250 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 260 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 264 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 265 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 266 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 268 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 269 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 270 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 271 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 273 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 276 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 277 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 278 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 279 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 280 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 281 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 282 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 283 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 284 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 285 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 286 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 287 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 291 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 295 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 298 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 299 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 301 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 303 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 307 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 308 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 310 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 311 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 312 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 313 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 315 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 316 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 317 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 318 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 319 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 320 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 321 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 322 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 323 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 324 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 325 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 326 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 327 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 328 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 329 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 330 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 331 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 332 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 333 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 334 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 335 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 336 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 337 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 338 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 339 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 340 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 341 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 342 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 343 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 344 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 399 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 400 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 401 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 402 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 403 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 404 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 407 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 408 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 409 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 410 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 411 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 412 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 413 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 416 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 440 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 447 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 448 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 450 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 451 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 452 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 462 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 465 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 466 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 467 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 468 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 469 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 470 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 471 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 472 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 473 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 474 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 475 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 476 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 477 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 478 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 483 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 484 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 486 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 487 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 489 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 491 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 492 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 493 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 494 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 496 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 500 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 501 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 502 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 503 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 504 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 505 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 506 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 507 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 508 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 509 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 510 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 511 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 512 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 513 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 514 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 515 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 516 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 517 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 518 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 519 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 520 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 521 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 522 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 523 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 524 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 525 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 526 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 527 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 528 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 529 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 530 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 531 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 532 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 533 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 534 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 535 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 536 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 537 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 538 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 539 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 540 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 541 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 542 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 543 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 544 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 545 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 546 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 547 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 548 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 549 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 550 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 551 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 552 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 553 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 554 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 555 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 556 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 557 | 2904699407 | |||
| 558 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 559 | 2906610324 | |||
| 560 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 561 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 562 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 563 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 564 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 565 | 2922425934 | |||
| 566 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 567 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 568 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 569 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 570 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 571 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 572 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 573 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 574 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 575 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 576 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 577 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 578 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 579 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 580 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 581 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 582 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 583 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 584 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 585 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 586 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 587 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 588 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 589 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 590 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 591 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 592 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 593 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 594 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 595 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 596 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 597 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 598 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 599 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 600 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 601 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 602 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 603 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 604 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 605 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 606 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 607 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 608 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 609 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 610 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 611 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 612 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 613 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 614 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 615 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 616 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 617 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 618 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 619 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 620 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 621 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 622 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 623 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 624 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 625 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.46 |
| Metatranscriptomes | 0.27 |
| Isolates | 11.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.94 |
| Nodule | 9.68 |
| Rhizoplane | 6.12 |
| Rhizosphere | 71.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga0sz30_2522_c2 | 3300050516 | Bacteria | 3587 |
| 2 | 2214911854 | 2209111006 | Bacteria | 7055 |
| 3 | ARcpr5oldR_c000012 | 3300000041 | Bacteria | 38255 |
| 4 | ARSoilYngRDRAFT_c00099 | 3300000042 | Bacteria | 14927 |
| 5 | ARcpr5yngRDRAFT_c000214 | 3300000043 | Bacteria | 8894 |
| 6 | ARSoilOldRDRAFT_c000006 | 3300000044 | Bacteria | 57169 |
| 7 | ARCol0oldRDRAFT_c00072 | 3300000045 | Bacteria | 8400 |
| 8 | ARCol0yngRDRAFT_1000024 | 3300000652 | Bacteria | 27598 |
| 9 | JGI24032J14994_100446 | 3300001430 | Bacteria | 2147 |
| 10 | JGI24736J21556_1004023 | 3300001904 | Bacteria | 2529 |
| 11 | JGI24736J21556_1013778 | 3300001904 | Bacteria | 1303 |
| 12 | JGI24746J21847_1000004 | 3300001977 | Bacteria | 23439 |
| 13 | JGI24740J21852_10009185 | 3300001979 | Bacteria | 3887 |
| 14 | JGI24740J21852_10011971 | 3300001979 | Bacteria | 3284 |
| 15 | JGI24739J22299_10000221 | 3300001989 | Bacteria | 19153 |
| 16 | JGI24739J22299_10003634 | 3300001989 | Bacteria | 5890 |
| 17 | JGI24737J22298_10001028 | 3300001990 | Bacteria | 9875 |
| 18 | JGI24737J22298_10001466 | 3300001990 | Bacteria | 8407 |
| 19 | JGI24737J22298_10001696 | 3300001990 | Bacteria | 7860 |
| 20 | JGI24737J22298_10008401 | 3300001990 | Bacteria | 3458 |
| 21 | JGI24737J22298_10065115 | 3300001990 | Bacteria | 1093 |
| 22 | JGI24743J22301_10000152 | 3300001991 | Bacteria | 7097 |
| 23 | JGI24735J21928_10041745 | 3300002067 | Bacteria | 1336 |
| 24 | JGI24750J21931_1000917 | 3300002070 | Bacteria | 3970 |
| 25 | JGI24745J21846_1000053 | 3300002073 | Bacteria | 8015 |
| 26 | JGI24748J21848_1000596 | 3300002074 | Bacteria | 3876 |
| 27 | JGI24738J21930_10000058 | 3300002075 | Bacteria | 22933 |
| 28 | JGI24738J21930_10027194 | 3300002075 | Bacteria | 1172 |
| 29 | JGI24749J21850_1000249 | 3300002076 | Bacteria | 8446 |
| 30 | JGI24749J21850_1003439 | 3300002076 | Bacteria | 2214 |
| 31 | JGI24035J26624_1000075 | 3300002126 | Bacteria | 8037 |
| 32 | JGI24033J26618_1000198 | 3300002155 | Bacteria | 7172 |
| 33 | JGI24034J26672_10007459 | 3300002239 | Bacteria | 1588 |
| 34 | JGI24742J22300_10000188 | 3300002244 | Bacteria | 9190 |
| 35 | JGI24742J22300_10000399 | 3300002244 | Bacteria | 6461 |
| 36 | JGI24751J29686_10003710 | 3300002459 | Bacteria | 3079 |
| 37 | JGI25406J46586_10002605 | 3300003203 | Bacteria | 8502 |
| 38 | JGI25153J46596_10002925 | 3300003215 | Bacteria | 9669 |
| 39 | JGI25404J52841_10005249 | 3300003659 | Bacteria | 2671 |
| 40 | JGI25405J52794_10001521 | 3300003911 | Bacteria | 3834 |
| 41 | JGI25405J52794_10004316 | 3300003911 | Bacteria | 2538 |
| 42 | Ga0065717_1002324 | 3300005276 | Bacteria | 2177 |
| 43 | Ga0065716_1001675 | 3300005277 | Bacteria | 4312 |
| 44 | Ga0065704_10113663 | 3300005289 | Bacteria | 1907 |
| 45 | Ga0065712_10002185 | 3300005290 | Bacteria | 5099 |
| 46 | Ga0065712_10011548 | 3300005290 | Bacteria | 2403 |
| 47 | Ga0065712_10085453 | 3300005290 | Bacteria | 2667 |
| 48 | Ga0065712_10093250 | 3300005290 | Bacteria | 2300 |
| 49 | Ga0065715_10089737 | 3300005293 | Bacteria | 8669 |
| 50 | Ga0065715_10091024 | 3300005293 | Bacteria | 6200 |
| 51 | Ga0065715_10224033 | 3300005293 | Bacteria | 1260 |
| 52 | Ga0065707_10090255 | 3300005295 | Bacteria | 4179 |
| 53 | Ga0070658_10033742 | 3300005327 | Bacteria | 4118 |
| 54 | Ga0070676_10000425 | 3300005328 | Bacteria | 19956 |
| 55 | Ga0070676_10075394 | 3300005328 | Bacteria | 2034 |
| 56 | Ga0070683_100000363 | 3300005329 | Bacteria | 31390 |
| 57 | Ga0070683_100029418 | 3300005329 | Bacteria | 4973 |
| 58 | Ga0070683_100085825 | 3300005329 | Bacteria | 2951 |
| 59 | Ga0070690_100007589 | 3300005330 | Bacteria | 6212 |
| 60 | Ga0070690_100036302 | 3300005330 | Bacteria | 3096 |
| 61 | Ga0070690_100158730 | 3300005330 | Bacteria | 1548 |
| 62 | Ga0070670_100074536 | 3300005331 | Bacteria | 2916 |
| 63 | Ga0070670_100099748 | 3300005331 | Bacteria | 2499 |
| 64 | Ga0070677_10000454 | 3300005333 | Bacteria | 14053 |
| 65 | Ga0068869_100000203 | 3300005334 | Bacteria | 31014 |
| 66 | Ga0068869_100036762 | 3300005334 | Bacteria | 3478 |
| 67 | Ga0070666_10157831 | 3300005335 | Bacteria | 1585 |
| 68 | Ga0070680_100015133 | 3300005336 | Bacteria | 6041 |
| 69 | Ga0070680_100041121 | 3300005336 | Bacteria | 3747 |
| 70 | Ga0070680_100097113 | 3300005336 | Bacteria | 2443 |
| 71 | Ga0070682_100000328 | 3300005337 | Bacteria | 32600 |
| 72 | Ga0068868_100538282 | 3300005338 | Bacteria | 1028 |
| 73 | Ga0070660_100006935 | 3300005339 | Bacteria | 7856 |
| 74 | Ga0070660_100023679 | 3300005339 | Bacteria | 4551 |
| 75 | Ga0070660_100095121 | 3300005339 | Bacteria | 2354 |
| 76 | Ga0070689_100008577 | 3300005340 | Bacteria | 7204 |
| 77 | Ga0070689_100022900 | 3300005340 | Bacteria | 4670 |
| 78 | Ga0070689_100087788 | 3300005340 | Bacteria | 2447 |
| 79 | Ga0070691_10059636 | 3300005341 | Bacteria | 1834 |
| 80 | Ga0070687_100000915 | 3300005343 | Bacteria | 9962 |
| 81 | Ga0070687_100001008 | 3300005343 | Bacteria | 9590 |
| 82 | Ga0070661_100005445 | 3300005344 | Bacteria | 8776 |
| 83 | Ga0070692_10012884 | 3300005345 | Bacteria | 3885 |
| 84 | Ga0070692_10030929 | 3300005345 | Bacteria | 2680 |
| 85 | Ga0070668_100001452 | 3300005347 | Bacteria | 17113 |
| 86 | Ga0070668_100001970 | 3300005347 | Bacteria | 14990 |
| 87 | Ga0070668_100109141 | 3300005347 | Bacteria | 2201 |
| 88 | Ga0070668_100369055 | 3300005347 | Bacteria | 1219 |
| 89 | Ga0070669_100002674 | 3300005353 | Bacteria | 12837 |
| 90 | Ga0070669_100003013 | 3300005353 | Bacteria | 12129 |
| 91 | Ga0070669_100038147 | 3300005353 | Bacteria | 3487 |
| 92 | Ga0070675_100000701 | 3300005354 | Bacteria | 23221 |
| 93 | Ga0070675_100005532 | 3300005354 | Bacteria | 9669 |
| 94 | Ga0070675_100026525 | 3300005354 | Bacteria | 4651 |
| 95 | Ga0070671_100013070 | 3300005355 | Bacteria | 6689 |
| 96 | Ga0070674_100000715 | 3300005356 | Bacteria | 16918 |
| 97 | Ga0070674_100052938 | 3300005356 | Bacteria | 2801 |
| 98 | Ga0070674_100210355 | 3300005356 | Bacteria | 1507 |
| 99 | Ga0070673_100007600 | 3300005364 | Bacteria | 7169 |
| 100 | Ga0070673_100320347 | 3300005364 | Bacteria | 1369 |
| 101 | Ga0070688_100002137 | 3300005365 | Bacteria | 9961 |
| 102 | Ga0070688_100031069 | 3300005365 | Bacteria | 3210 |
| 103 | Ga0070688_100185897 | 3300005365 | Bacteria | 1444 |
| 104 | Ga0070659_100000350 | 3300005366 | Bacteria | 35169 |
| 105 | Ga0070659_100022386 | 3300005366 | Bacteria | 4824 |
| 106 | Ga0070667_100002937 | 3300005367 | Bacteria | 14657 |
| 107 | Ga0070667_100003352 | 3300005367 | Bacteria | 13683 |
| 108 | Ga0070667_100127124 | 3300005367 | Bacteria | 2222 |
| 109 | Ga0070703_10001493 | 3300005406 | Bacteria | 7012 |
| 110 | Ga0070703_10016560 | 3300005406 | Bacteria | 2116 |
| 111 | Ga0070709_10230963 | 3300005434 | Bacteria | 1324 |
| 112 | Ga0070714_100153696 | 3300005435 | Bacteria | 2076 |
| 113 | Ga0070714_100303960 | 3300005435 | Bacteria | 1488 |
| 114 | Ga0070714_100346237 | 3300005435 | Bacteria | 1395 |
| 115 | Ga0070713_100094913 | 3300005436 | Bacteria | 2572 |
| 116 | Ga0070713_100343468 | 3300005436 | Bacteria | 1383 |
| 117 | Ga0070710_10028612 | 3300005437 | Bacteria | 2982 |
| 118 | Ga0070710_10039318 | 3300005437 | Bacteria | 2602 |
| 119 | Ga0070701_10003358 | 3300005438 | Bacteria | 6322 |
| 120 | Ga0070701_10016284 | 3300005438 | Bacteria | 3453 |
| 121 | Ga0070711_100006095 | 3300005439 | Bacteria | 7247 |
| 122 | Ga0070711_100030964 | 3300005439 | Bacteria | 3547 |
| 123 | Ga0070711_100056134 | 3300005439 | Bacteria | 2722 |
| 124 | Ga0070711_100078163 | 3300005439 | Bacteria | 2350 |
| 125 | Ga0070705_100006049 | 3300005440 | Bacteria | 5922 |
| 126 | Ga0070700_100009242 | 3300005441 | Bacteria | 5404 |
| 127 | Ga0070700_100012827 | 3300005441 | Bacteria | 4694 |
| 128 | Ga0070694_100006962 | 3300005444 | Bacteria | 6868 |
| 129 | Ga0070694_100018454 | 3300005444 | Bacteria | 4426 |
| 130 | Ga0070694_100210351 | 3300005444 | Bacteria | 1454 |
| 131 | Ga0070708_100025760 | 3300005445 | Bacteria | 5030 |
| 132 | Ga0070708_100138146 | 3300005445 | Bacteria | 2259 |
| 133 | Ga0070708_100237766 | 3300005445 | Bacteria | 1710 |
| 134 | Ga0070663_100001251 | 3300005455 | Bacteria | 13950 |
| 135 | Ga0070663_100181379 | 3300005455 | Bacteria | 1634 |
| 136 | Ga0070678_100000662 | 3300005456 | Bacteria | 16885 |
| 137 | Ga0070678_100206569 | 3300005456 | Bacteria | 1624 |
| 138 | Ga0070662_100001650 | 3300005457 | Bacteria | 13726 |
| 139 | Ga0070662_100086690 | 3300005457 | Bacteria | 2342 |
| 140 | Ga0070662_100166867 | 3300005457 | Bacteria | 1726 |
| 141 | Ga0070681_10011538 | 3300005458 | Bacteria | 8747 |
| 142 | Ga0070681_10122358 | 3300005458 | Bacteria | 2535 |
| 143 | Ga0070681_10161762 | 3300005458 | Bacteria | 2163 |
| 144 | Ga0070681_10189332 | 3300005458 | Bacteria | 1977 |
| 145 | Ga0070681_10209531 | 3300005458 | Bacteria | 1865 |
| 146 | Ga0068867_100000679 | 3300005459 | Bacteria | 22540 |
| 147 | Ga0070685_10001744 | 3300005466 | Bacteria | 11398 |
| 148 | Ga0070685_10021982 | 3300005466 | Bacteria | 3471 |
| 149 | Ga0070706_100295831 | 3300005467 | Bacteria | 1511 |
| 150 | Ga0070707_100002340 | 3300005468 | Bacteria | 18075 |
| 151 | Ga0070698_100000476 | 3300005471 | Bacteria | 42469 |
| 152 | Ga0070679_100000963 | 3300005530 | Bacteria | 25049 |
| 153 | Ga0070679_100030571 | 3300005530 | Bacteria | 5316 |
| 154 | Ga0070679_100121452 | 3300005530 | Bacteria | 2597 |
| 155 | Ga0070679_100358036 | 3300005530 | Bacteria | 1407 |
| 156 | Ga0070684_100000693 | 3300005535 | Bacteria | 23221 |
| 157 | Ga0070684_100008128 | 3300005535 | Bacteria | 8189 |
| 158 | Ga0070684_100155308 | 3300005535 | Bacteria | 2075 |
| 159 | Ga0070697_100099620 | 3300005536 | Bacteria | 2413 |
| 160 | Ga0068853_100010934 | 3300005539 | Bacteria | 7356 |
| 161 | Ga0068853_100158061 | 3300005539 | Bacteria | 2043 |
| 162 | Ga0068853_100179093 | 3300005539 | Bacteria | 1922 |
| 163 | Ga0068853_100181525 | 3300005539 | Bacteria | 1909 |
| 164 | Ga0070672_100000403 | 3300005543 | Bacteria | 24982 |
| 165 | Ga0070672_100139942 | 3300005543 | Bacteria | 1995 |
| 166 | Ga0070672_100208807 | 3300005543 | Bacteria | 1635 |
| 167 | Ga0070686_100001759 | 3300005544 | Bacteria | 12129 |
| 168 | Ga0070686_100013702 | 3300005544 | Bacteria | 4650 |
| 169 | Ga0070695_100005593 | 3300005545 | Bacteria | 7401 |
| 170 | Ga0070695_100018083 | 3300005545 | Bacteria | 4279 |
| 171 | Ga0070696_100012376 | 3300005546 | Bacteria | 5725 |
| 172 | Ga0070696_100015841 | 3300005546 | Bacteria | 5067 |
| 173 | Ga0070693_100000031 | 3300005547 | Bacteria | 53010 |
| 174 | Ga0070693_100065487 | 3300005547 | Bacteria | 2124 |
| 175 | Ga0070704_100008423 | 3300005549 | Bacteria | 6184 |
| 176 | Ga0070704_100022851 | 3300005549 | Bacteria | 4074 |
| 177 | Ga0068855_100026306 | 3300005563 | Bacteria | 6960 |
| 178 | Ga0068855_100207709 | 3300005563 | Bacteria | 2202 |
| 179 | Ga0068855_100302568 | 3300005563 | Bacteria | 1771 |
| 180 | Ga0070664_100004498 | 3300005564 | Bacteria | 11186 |
| 181 | Ga0070664_100233082 | 3300005564 | Bacteria | 1651 |
| 182 | Ga0068857_100007652 | 3300005577 | Bacteria | 9304 |
| 183 | Ga0068857_100060044 | 3300005577 | Bacteria | 3378 |
| 184 | Ga0068857_100124784 | 3300005577 | Bacteria | 2320 |
| 185 | Ga0068857_100126180 | 3300005577 | Bacteria | 2306 |
| 186 | Ga0068854_100001548 | 3300005578 | Bacteria | 13950 |
| 187 | Ga0068854_100041518 | 3300005578 | Bacteria | 3250 |
| 188 | Ga0068856_100006301 | 3300005614 | Bacteria | 11639 |
| 189 | Ga0068856_100189710 | 3300005614 | Bacteria | 2069 |
| 190 | Ga0068856_100195998 | 3300005614 | Bacteria | 2034 |
| 191 | Ga0068856_100239630 | 3300005614 | Bacteria | 1829 |
| 192 | Ga0070702_100000222 | 3300005615 | Bacteria | 19156 |
| 193 | Ga0068852_100002780 | 3300005616 | Bacteria | 12118 |
| 194 | Ga0068852_100012504 | 3300005616 | Bacteria | 6448 |
| 195 | Ga0068859_100006131 | 3300005617 | Bacteria | 12216 |
| 196 | Ga0068859_100041002 | 3300005617 | Bacteria | 4651 |
| 197 | Ga0068859_100190389 | 3300005617 | Bacteria | 2136 |
| 198 | Ga0068864_100000746 | 3300005618 | Bacteria | 27280 |
| 199 | Ga0068864_100110396 | 3300005618 | Bacteria | 2449 |
| 200 | Ga0068866_10000252 | 3300005718 | Bacteria | 25051 |
| 201 | Ga0068861_100002529 | 3300005719 | Bacteria | 11945 |
| 202 | Ga0068861_100101918 | 3300005719 | Bacteria | 2285 |
| 203 | Ga0068851_10006094 | 3300005834 | Bacteria | 5500 |
| 204 | Ga0068870_10000355 | 3300005840 | Bacteria | 17198 |
| 205 | Ga0068863_100000150 | 3300005841 | Bacteria | 72968 |
| 206 | Ga0068858_100005633 | 3300005842 | Bacteria | 12248 |
| 207 | Ga0068858_100020291 | 3300005842 | Bacteria | 6215 |
| 208 | Ga0068858_100290580 | 3300005842 | Bacteria | 1558 |
| 209 | Ga0068860_100005002 | 3300005843 | Bacteria | 13502 |
| 210 | Ga0068860_100026141 | 3300005843 | Bacteria | 5630 |
| 211 | Ga0068860_100072103 | 3300005843 | Bacteria | 3282 |
| 212 | Ga0068860_100250528 | 3300005843 | Bacteria | 1725 |
| 213 | Ga0068862_100002000 | 3300005844 | Bacteria | 18481 |
| 214 | Ga0068862_100030036 | 3300005844 | Bacteria | 4580 |
| 215 | Ga0081455_10000185 | 3300005937 | Bacteria | 78750 |
| 216 | Ga0081455_10021796 | 3300005937 | Bacteria | 6000 |
| 217 | Ga0081540_1003091 | 3300005983 | Bacteria | 13334 |
| 218 | Ga0081540_1003850 | 3300005983 | Bacteria | 11721 |
| 219 | Ga0081540_1005107 | 3300005983 | Bacteria | 9846 |
| 220 | Ga0081540_1009371 | 3300005983 | Bacteria | 6752 |
| 221 | Ga0081540_1021357 | 3300005983 | Bacteria | 3859 |
| 222 | Ga0081539_10001829 | 3300005985 | Bacteria | 33573 |
| 223 | Ga0081539_10043867 | 3300005985 | Bacteria | 2587 |
| 224 | Ga0070717_10064620 | 3300006028 | Bacteria | 3040 |
| 225 | Ga0075365_10059842 | 3300006038 | Bacteria | 2540 |
| 226 | Ga0075363_100070398 | 3300006048 | Bacteria | 1899 |
| 227 | Ga0075363_100082851 | 3300006048 | Bacteria | 1757 |
| 228 | Ga0075363_100186208 | 3300006048 | Bacteria | 1183 |
| 229 | Ga0075364_10006374 | 3300006051 | Bacteria | 6934 |
| 230 | Ga0070712_100140844 | 3300006175 | Bacteria | 1840 |
| 231 | Ga0075362_10042011 | 3300006177 | Bacteria | 2019 |
| 232 | Ga0075362_10052041 | 3300006177 | Bacteria | 1834 |
| 233 | Ga0075367_10006879 | 3300006178 | Bacteria | 5787 |
| 234 | Ga0075367_10061374 | 3300006178 | Bacteria | 2243 |
| 235 | Ga0075367_10126797 | 3300006178 | Bacteria | 1576 |
| 236 | Ga0075369_10083660 | 3300006186 | Bacteria | 1417 |
| 237 | Ga0075366_10023757 | 3300006195 | Bacteria | 3572 |
| 238 | Ga0097621_100000544 | 3300006237 | Bacteria | 26555 |
| 239 | Ga0075370_10035636 | 3300006353 | Bacteria | 2793 |
| 240 | Ga0075370_10055514 | 3300006353 | Bacteria | 2250 |
| 241 | Ga0075370_10231294 | 3300006353 | Bacteria | 1094 |
| 242 | Ga0068871_100000512 | 3300006358 | Bacteria | 26615 |
| 243 | Ga0075428_100159543 | 3300006844 | Bacteria | 2448 |
| 244 | Ga0075428_100220351 | 3300006844 | Bacteria | 2049 |
| 245 | Ga0075430_100268576 | 3300006846 | Bacteria | 1412 |
| 246 | Ga0075430_100451549 | 3300006846 | Bacteria | 1061 |
| 247 | Ga0075431_100132466 | 3300006847 | Bacteria | 2571 |
| 248 | Ga0075433_10042184 | 3300006852 | Bacteria | 3957 |
| 249 | Ga0075433_10055682 | 3300006852 | Bacteria | 3453 |
| 250 | Ga0075434_100014347 | 3300006871 | Bacteria | 7574 |
| 251 | Ga0075434_100076189 | 3300006871 | Bacteria | 3349 |
| 252 | Ga0068865_100000085 | 3300006881 | Bacteria | 50007 |
| 253 | Ga0068865_100176544 | 3300006881 | Bacteria | 1642 |
| 254 | Ga0097620_100006131 | 3300006931 | Bacteria | 12216 |
| 255 | Ga0097620_100041002 | 3300006931 | Bacteria | 4651 |
| 256 | Ga0097620_100190380 | 3300006931 | Bacteria | 2136 |
| 257 | Ga0099825_1024777 | 3300006941 | Bacteria | 3446 |
| 258 | Ga0099825_1039567 | 3300006941 | Bacteria | 1441 |
| 259 | Ga0099824_1003225 | 3300006942 | Bacteria | 23847 |
| 260 | Ga0099822_1005628 | 3300006943 | Bacteria | 16352 |
| 261 | Ga0099823_1076552 | 3300006944 | Bacteria | 1374 |
| 262 | Ga0099795_10023051 | 3300007788 | Bacteria | 2062 |
| 263 | Ga0105244_10013947 | 3300009036 | Bacteria | 4669 |
| 264 | Ga0105240_10014565 | 3300009093 | Bacteria | 10730 |
| 265 | Ga0105240_10022233 | 3300009093 | Bacteria | 8414 |
| 266 | Ga0105240_10035302 | 3300009093 | Bacteria | 6444 |
| 267 | Ga0105240_10136986 | 3300009093 | Bacteria | 2931 |
| 268 | Ga0105240_10396752 | 3300009093 | Bacteria | 1555 |
| 269 | Ga0105240_10767016 | 3300009093 | Bacteria | 1047 |
| 270 | Ga0111539_10003892 | 3300009094 | Bacteria | 19636 |
| 271 | Ga0111539_10007488 | 3300009094 | Bacteria | 13974 |
| 272 | Ga0111539_10095217 | 3300009094 | Bacteria | 3498 |
| 273 | Ga0111539_11225340 | 3300009094 | Bacteria | 871 |
| 274 | Ga0105245_10000235 | 3300009098 | Bacteria | 52697 |
| 275 | Ga0105247_10004099 | 3300009101 | Bacteria | 9363 |
| 276 | Ga0105247_10082721 | 3300009101 | Bacteria | 2026 |
| 277 | Ga0114129_10062929 | 3300009147 | Bacteria | 5183 |
| 278 | Ga0105243_10000699 | 3300009148 | Bacteria | 32411 |
| 279 | Ga0105243_10004332 | 3300009148 | Bacteria | 11241 |
| 280 | Ga0105241_10002051 | 3300009174 | Bacteria | 15218 |
| 281 | Ga0105241_10013209 | 3300009174 | Bacteria | 6053 |
| 282 | Ga0105241_10029810 | 3300009174 | Bacteria | 4073 |
| 283 | Ga0105242_10000134 | 3300009176 | Bacteria | 53681 |
| 284 | Ga0105248_10005592 | 3300009177 | Bacteria | 13817 |
| 285 | Ga0105248_10071872 | 3300009177 | Bacteria | 3888 |
| 286 | Ga0105237_10004158 | 3300009545 | Bacteria | 16863 |
| 287 | Ga0105237_10015363 | 3300009545 | Bacteria | 7971 |
| 288 | Ga0105237_10039663 | 3300009545 | Bacteria | 4753 |
| 289 | Ga0105237_10087159 | 3300009545 | Bacteria | 3112 |
| 290 | Ga0105237_10377112 | 3300009545 | Bacteria | 1423 |
| 291 | Ga0105237_10494275 | 3300009545 | Bacteria | 1230 |
| 292 | Ga0105238_10005587 | 3300009551 | Bacteria | 12424 |
| 293 | Ga0105238_10398272 | 3300009551 | Bacteria | 1370 |
| 294 | Ga0105249_10000325 | 3300009553 | Bacteria | 48220 |
| 295 | Ga0105249_10003708 | 3300009553 | Bacteria | 13173 |
| 296 | Ga0105249_10147991 | 3300009553 | Bacteria | 2258 |
| 297 | Ga0099796_10006501 | 3300010159 | Bacteria | 2995 |
| 298 | Ga0105239_10015503 | 3300010375 | Bacteria | 8441 |
| 299 | Ga0105239_10018609 | 3300010375 | Bacteria | 7673 |
| 300 | Ga0105239_10026934 | 3300010375 | Bacteria | 6328 |
| 301 | Ga0105239_10132469 | 3300010375 | Bacteria | 2774 |
| 302 | Ga0105239_10606301 | 3300010375 | Bacteria | 1249 |
| 303 | Ga0105239_10689771 | 3300010375 | Bacteria | 1167 |
| 304 | Ga0105246_10000041 | 3300011119 | Bacteria | 48215 |
| 305 | Ga0105246_10106021 | 3300011119 | Bacteria | 2055 |
| 306 | Ga0157329_1000654 | 3300012491 | Bacteria | 1466 |
| 307 | Ga0157373_10029849 | 3300013100 | Bacteria | 3926 |
| 308 | Ga0157370_10117537 | 3300013104 | Bacteria | 2484 |
| 309 | Ga0157370_10687958 | 3300013104 | Bacteria | 934 |
| 310 | Ga0157369_10058666 | 3300013105 | Bacteria | 4151 |
| 311 | Ga0157369_10139062 | 3300013105 | Bacteria | 2570 |
| 312 | Ga0157369_10433749 | 3300013105 | Bacteria | 1361 |
| 313 | Ga0157374_10004647 | 3300013296 | Bacteria | 11513 |
| 314 | Ga0157378_10000434 | 3300013297 | Bacteria | 40722 |
| 315 | Ga0157378_10387741 | 3300013297 | Bacteria | 1373 |
| 316 | Ga0163162_10000973 | 3300013306 | Bacteria | 26626 |
| 317 | Ga0163162_10008401 | 3300013306 | Bacteria | 10070 |
| 318 | Ga0157372_10026570 | 3300013307 | Bacteria | 6300 |
| 319 | Ga0157375_10000181 | 3300013308 | Bacteria | 59305 |
| 320 | Ga0157375_10024009 | 3300013308 | Bacteria | 5637 |
| 321 | Ga0163163_10005840 | 3300014325 | Bacteria | 10705 |
| 322 | Ga0157380_10000049 | 3300014326 | Bacteria | 71296 |
| 323 | Ga0157380_10078389 | 3300014326 | Bacteria | 2695 |
| 324 | Ga0157377_10003889 | 3300014745 | Bacteria | 6806 |
| 325 | Ga0157379_10015146 | 3300014968 | Bacteria | 6764 |
| 326 | Ga0157379_10046331 | 3300014968 | Bacteria | 3879 |
| 327 | Ga0157376_10000142 | 3300014969 | Bacteria | 49085 |
| 328 | Ga0163161_10000081 | 3300017792 | Bacteria | 97213 |
| 329 | Ga0213872_10015785 | 3300021361 | Bacteria | 3508 |
| 330 | Ga0213872_10034986 | 3300021361 | Bacteria | 2297 |
| 331 | Ga0213876_10111209 | 3300021384 | Bacteria | 1454 |
| 332 | Ga0213875_10026325 | 3300021388 | Bacteria | 2767 |
| 333 | Ga0224712_10030894 | 3300022467 | Bacteria | 1938 |
| 334 | Ga0209563_100927 | 3300025230 | Bacteria | 8651 |
| 335 | Ga0209677_101109 | 3300025253 | Bacteria | 12646 |
| 336 | Ga0209148_1000250 | 3300025254 | Bacteria | 85755 |
| 337 | Ga0207666_1000299 | 3300025271 | Bacteria | 6971 |
| 338 | Ga0207666_1000533 | 3300025271 | Bacteria | 4647 |
| 339 | Ga0207666_1001484 | 3300025271 | Bacteria | 2774 |
| 340 | Ga0209455_1003028 | 3300025272 | Bacteria | 6153 |
| 341 | Ga0207673_1000059 | 3300025290 | Bacteria | 9314 |
| 342 | Ga0207673_1008504 | 3300025290 | Bacteria | 1300 |
| 343 | Ga0209758_1000324 | 3300025297 | Bacteria | 91475 |
| 344 | Ga0209758_1003697 | 3300025297 | Bacteria | 13574 |
| 345 | Ga0209050_1010239 | 3300025298 | Bacteria | 4649 |
| 346 | Ga0209050_1021379 | 3300025298 | Bacteria | 2362 |
| 347 | Ga0209257_1017678 | 3300025304 | Bacteria | 2794 |
| 348 | Ga0207697_10000045 | 3300025315 | Bacteria | 48192 |
| 349 | Ga0207697_10051041 | 3300025315 | Bacteria | 1708 |
| 350 | Ga0207697_10055013 | 3300025315 | Bacteria | 1649 |
| 351 | Ga0207697_10062771 | 3300025315 | Bacteria | 1548 |
| 352 | Ga0207653_10002120 | 3300025885 | Bacteria | 6320 |
| 353 | Ga0207653_10052775 | 3300025885 | Bacteria | 1356 |
| 354 | Ga0207682_10000046 | 3300025893 | Bacteria | 51587 |
| 355 | Ga0207692_10058031 | 3300025898 | Bacteria | 1993 |
| 356 | Ga0207642_10001337 | 3300025899 | Bacteria | 7628 |
| 357 | Ga0207710_10026906 | 3300025900 | Bacteria | 2487 |
| 358 | Ga0207688_10001093 | 3300025901 | Bacteria | 13904 |
| 359 | Ga0207688_10003856 | 3300025901 | Bacteria | 8178 |
| 360 | Ga0207680_10032025 | 3300025903 | Bacteria | 2984 |
| 361 | Ga0207647_10003053 | 3300025904 | Bacteria | 12588 |
| 362 | Ga0207647_10004820 | 3300025904 | Bacteria | 9980 |
| 363 | Ga0207647_10005779 | 3300025904 | Bacteria | 9026 |
| 364 | Ga0207647_10021233 | 3300025904 | Bacteria | 4336 |
| 365 | Ga0207647_10077094 | 3300025904 | Bacteria | 2004 |
| 366 | Ga0207645_10000275 | 3300025907 | Bacteria | 42638 |
| 367 | Ga0207645_10000660 | 3300025907 | Bacteria | 28632 |
| 368 | Ga0207645_10076803 | 3300025907 | Bacteria | 2140 |
| 369 | Ga0207643_10000025 | 3300025908 | Bacteria | 101583 |
| 370 | Ga0207705_10042352 | 3300025909 | Bacteria | 3268 |
| 371 | Ga0207684_10280909 | 3300025910 | Bacteria | 1436 |
| 372 | Ga0207654_10000936 | 3300025911 | Bacteria | 16037 |
| 373 | Ga0207654_10006602 | 3300025911 | Bacteria | 5833 |
| 374 | Ga0207707_10003161 | 3300025912 | Bacteria | 14619 |
| 375 | Ga0207707_10003472 | 3300025912 | Bacteria | 13959 |
| 376 | Ga0207707_10112695 | 3300025912 | Bacteria | 2378 |
| 377 | Ga0207707_10144059 | 3300025912 | Bacteria | 2083 |
| 378 | Ga0207707_10154879 | 3300025912 | Bacteria | 2004 |
| 379 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 380 | Ga0207695_10000497 | 3300025913 | Bacteria | 83894 |
| 381 | Ga0207695_10049534 | 3300025913 | Bacteria | 4427 |
| 382 | Ga0207695_10149619 | 3300025913 | Bacteria | 2275 |
| 383 | Ga0207695_10231601 | 3300025913 | Bacteria | 1751 |
| 384 | Ga0207695_10273296 | 3300025913 | Bacteria | 1585 |
| 385 | Ga0207671_10031326 | 3300025914 | Bacteria | 3962 |
| 386 | Ga0207671_10059362 | 3300025914 | Bacteria | 2836 |
| 387 | Ga0207671_10078747 | 3300025914 | Bacteria | 2469 |
| 388 | Ga0207671_10245325 | 3300025914 | Bacteria | 1407 |
| 389 | Ga0207693_10022068 | 3300025915 | Bacteria | 5062 |
| 390 | Ga0207693_10176565 | 3300025915 | Bacteria | 1681 |
| 391 | Ga0207663_10042485 | 3300025916 | Bacteria | 2777 |
| 392 | Ga0207663_10053001 | 3300025916 | Bacteria | 2532 |
| 393 | Ga0207663_10105254 | 3300025916 | Bacteria | 1904 |
| 394 | Ga0207660_10000131 | 3300025917 | Bacteria | 44091 |
| 395 | Ga0207660_10032857 | 3300025917 | Bacteria | 3584 |
| 396 | Ga0207660_10065575 | 3300025917 | Bacteria | 2625 |
| 397 | Ga0207660_10077988 | 3300025917 | Bacteria | 2427 |
| 398 | Ga0207662_10000657 | 3300025918 | Bacteria | 15659 |
| 399 | Ga0207662_10004565 | 3300025918 | Bacteria | 7297 |
| 400 | Ga0207662_10010788 | 3300025918 | Bacteria | 5050 |
| 401 | Ga0207662_10021581 | 3300025918 | Bacteria | 3684 |
| 402 | Ga0207657_10020330 | 3300025919 | Bacteria | 6276 |
| 403 | Ga0207657_10104039 | 3300025919 | Bacteria | 2352 |
| 404 | Ga0207649_10000048 | 3300025920 | Bacteria | 110714 |
| 405 | Ga0207649_10208564 | 3300025920 | Bacteria | 1385 |
| 406 | Ga0207652_10012172 | 3300025921 | Bacteria | 6951 |
| 407 | Ga0207652_10037233 | 3300025921 | Bacteria | 4117 |
| 408 | Ga0207652_10042364 | 3300025921 | Bacteria | 3875 |
| 409 | Ga0207646_10028080 | 3300025922 | Bacteria | 5126 |
| 410 | Ga0207681_10000131 | 3300025923 | Bacteria | 61025 |
| 411 | Ga0207694_10000758 | 3300025924 | Bacteria | 28966 |
| 412 | Ga0207694_10104829 | 3300025924 | Bacteria | 2244 |
| 413 | Ga0207694_10123547 | 3300025924 | Bacteria | 2068 |
| 414 | Ga0207650_10029200 | 3300025925 | Bacteria | 3962 |
| 415 | Ga0207650_10050251 | 3300025925 | Bacteria | 3083 |
| 416 | Ga0207650_10136739 | 3300025925 | Bacteria | 1923 |
| 417 | Ga0207650_10160432 | 3300025925 | Bacteria | 1781 |
| 418 | Ga0207659_10000040 | 3300025926 | Bacteria | 91375 |
| 419 | Ga0207659_10005182 | 3300025926 | Bacteria | 7900 |
| 420 | Ga0207659_10096906 | 3300025926 | Bacteria | 2215 |
| 421 | Ga0207687_10000122 | 3300025927 | Bacteria | 52776 |
| 422 | Ga0207700_10138396 | 3300025928 | Bacteria | 1997 |
| 423 | Ga0207700_10184105 | 3300025928 | Bacteria | 1751 |
| 424 | Ga0207664_10091123 | 3300025929 | Bacteria | 2499 |
| 425 | Ga0207644_10002729 | 3300025931 | Bacteria | 11369 |
| 426 | Ga0207690_10000512 | 3300025932 | Bacteria | 25163 |
| 427 | Ga0207690_10068525 | 3300025932 | Bacteria | 2438 |
| 428 | Ga0207706_10000311 | 3300025933 | Bacteria | 52676 |
| 429 | Ga0207706_10000535 | 3300025933 | Bacteria | 40346 |
| 430 | Ga0207706_10061527 | 3300025933 | Bacteria | 3306 |
| 431 | Ga0207706_10177652 | 3300025933 | Bacteria | 1870 |
| 432 | Ga0207686_10000377 | 3300025934 | Bacteria | 31093 |
| 433 | Ga0207709_10000585 | 3300025935 | Bacteria | 30473 |
| 434 | Ga0207709_10087871 | 3300025935 | Bacteria | 2022 |
| 435 | Ga0207670_10006912 | 3300025936 | Bacteria | 6315 |
| 436 | Ga0207670_10017549 | 3300025936 | Bacteria | 4327 |
| 437 | Ga0207670_10162598 | 3300025936 | Bacteria | 1668 |
| 438 | Ga0207670_10189711 | 3300025936 | Bacteria | 1555 |
| 439 | Ga0207669_10000102 | 3300025937 | Bacteria | 42874 |
| 440 | Ga0207669_10090364 | 3300025937 | Bacteria | 1991 |
| 441 | Ga0207669_10205131 | 3300025937 | Bacteria | 1434 |
| 442 | Ga0207669_10236277 | 3300025937 | Bacteria | 1352 |
| 443 | Ga0207704_10000071 | 3300025938 | Bacteria | 64527 |
| 444 | Ga0207704_10126595 | 3300025938 | Bacteria | 1760 |
| 445 | Ga0207665_10096749 | 3300025939 | Bacteria | 2054 |
| 446 | Ga0207665_10183292 | 3300025939 | Bacteria | 1517 |
| 447 | Ga0207691_10000257 | 3300025940 | Bacteria | 52675 |
| 448 | Ga0207711_10000847 | 3300025941 | Bacteria | 29585 |
| 449 | Ga0207689_10000134 | 3300025942 | Bacteria | 62937 |
| 450 | Ga0207689_10055501 | 3300025942 | Bacteria | 3260 |
| 451 | Ga0207661_10000204 | 3300025944 | Bacteria | 38344 |
| 452 | Ga0207661_10002220 | 3300025944 | Bacteria | 13401 |
| 453 | Ga0207679_10000090 | 3300025945 | Bacteria | 79412 |
| 454 | Ga0207679_10243649 | 3300025945 | Bacteria | 1524 |
| 455 | Ga0207667_10013081 | 3300025949 | Bacteria | 9525 |
| 456 | Ga0207667_10141238 | 3300025949 | Bacteria | 2479 |
| 457 | Ga0207667_10209765 | 3300025949 | Bacteria | 1997 |
| 458 | Ga0207667_10492247 | 3300025949 | Bacteria | 1244 |
| 459 | Ga0207651_10000017 | 3300025960 | Bacteria | 100256 |
| 460 | Ga0207712_10000114 | 3300025961 | Bacteria | 87261 |
| 461 | Ga0207668_10000139 | 3300025972 | Bacteria | 49764 |
| 462 | Ga0207668_10438672 | 3300025972 | Bacteria | 1112 |
| 463 | Ga0207640_10000221 | 3300025981 | Bacteria | 40097 |
| 464 | Ga0207640_10037391 | 3300025981 | Bacteria | 3054 |
| 465 | Ga0207640_10045732 | 3300025981 | Bacteria | 2813 |
| 466 | Ga0207640_10218038 | 3300025981 | Bacteria | 1459 |
| 467 | Ga0207658_10001766 | 3300025986 | Bacteria | 16236 |
| 468 | Ga0207658_10004653 | 3300025986 | Bacteria | 9516 |
| 469 | Ga0207658_10041453 | 3300025986 | Bacteria | 3334 |
| 470 | Ga0207677_10000989 | 3300026023 | Bacteria | 15674 |
| 471 | Ga0207677_10016104 | 3300026023 | Bacteria | 4419 |
| 472 | Ga0207703_10001230 | 3300026035 | Bacteria | 23955 |
| 473 | Ga0207703_10410850 | 3300026035 | Bacteria | 1258 |
| 474 | Ga0207639_10004381 | 3300026041 | Bacteria | 9526 |
| 475 | Ga0207639_10011092 | 3300026041 | Bacteria | 6251 |
| 476 | Ga0207639_10018076 | 3300026041 | Bacteria | 5004 |
| 477 | Ga0207639_10046610 | 3300026041 | Bacteria | 3272 |
| 478 | Ga0207639_10194950 | 3300026041 | Bacteria | 1733 |
| 479 | Ga0207639_10230685 | 3300026041 | Bacteria | 1604 |
| 480 | Ga0207639_10289028 | 3300026041 | Bacteria | 1445 |
| 481 | Ga0207639_10328878 | 3300026041 | Bacteria | 1359 |
| 482 | Ga0207678_10000131 | 3300026067 | Bacteria | 62864 |
| 483 | Ga0207678_10049697 | 3300026067 | Bacteria | 3624 |
| 484 | Ga0207708_10000192 | 3300026075 | Bacteria | 48193 |
| 485 | Ga0207708_10013145 | 3300026075 | Bacteria | 6178 |
| 486 | Ga0207702_10000198 | 3300026078 | Bacteria | 71277 |
| 487 | Ga0207702_10000429 | 3300026078 | Bacteria | 48259 |
| 488 | Ga0207702_10030049 | 3300026078 | Bacteria | 4526 |
| 489 | Ga0207702_10271425 | 3300026078 | Bacteria | 1600 |
| 490 | Ga0207702_10384921 | 3300026078 | Bacteria | 1350 |
| 491 | Ga0207641_10000246 | 3300026088 | Bacteria | 70235 |
| 492 | Ga0207648_10000483 | 3300026089 | Bacteria | 44295 |
| 493 | Ga0207676_10000372 | 3300026095 | Bacteria | 38295 |
| 494 | Ga0207674_10000355 | 3300026116 | Bacteria | 59230 |
| 495 | Ga0207674_10077004 | 3300026116 | Bacteria | 3342 |
| 496 | Ga0207674_10078457 | 3300026116 | Bacteria | 3307 |
| 497 | Ga0207674_10346519 | 3300026116 | Bacteria | 1436 |
| 498 | Ga0207674_10416117 | 3300026116 | Bacteria | 1299 |
| 499 | Ga0207675_100001557 | 3300026118 | Bacteria | 22972 |
| 500 | Ga0207675_100041544 | 3300026118 | Bacteria | 4295 |
| 501 | Ga0207675_100359745 | 3300026118 | Bacteria | 1428 |
| 502 | Ga0207683_10000512 | 3300026121 | Bacteria | 35724 |
| 503 | Ga0207683_10243077 | 3300026121 | Bacteria | 1642 |
| 504 | Ga0207698_10000524 | 3300026142 | Bacteria | 22268 |
| 505 | Ga0207698_10033426 | 3300026142 | Bacteria | 3737 |
| 506 | Ga0207698_10166053 | 3300026142 | Bacteria | 1937 |
| 507 | Ga0207698_10186437 | 3300026142 | Bacteria | 1843 |
| 508 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 509 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 510 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 511 | Ga0209489_110994 | 3300027361 | Bacteria | 9645 |
| 512 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 513 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 514 | Ga0209967_1004113 | 3300027364 | Bacteria | 1924 |
| 515 | Ga0209995_1014821 | 3300027471 | Bacteria | 1278 |
| 516 | Ga0209179_1036707 | 3300027512 | Bacteria | 1022 |
| 517 | Ga0210002_1006376 | 3300027617 | Bacteria | 1780 |
| 518 | Ga0210002_1006862 | 3300027617 | Bacteria | 1721 |
| 519 | Ga0209971_1008153 | 3300027682 | Bacteria | 2485 |
| 520 | Ga0209966_1000755 | 3300027695 | Bacteria | 6704 |
| 521 | Ga0209998_10000745 | 3300027717 | Bacteria | 8549 |
| 522 | Ga0209998_10002909 | 3300027717 | Bacteria | 3837 |
| 523 | Ga0209998_10023153 | 3300027717 | Bacteria | 1342 |
| 524 | Ga0209813_10093960 | 3300027866 | Bacteria | 1011 |
| 525 | Ga0209974_10000322 | 3300027876 | Bacteria | 15645 |
| 526 | Ga0207428_10000469 | 3300027907 | Bacteria | 48709 |
| 527 | Ga0207428_10000620 | 3300027907 | Bacteria | 41879 |
| 528 | Ga0268266_10083892 | 3300028379 | Bacteria | 2782 |
| 529 | Ga0268265_10000312 | 3300028380 | Bacteria | 53940 |
| 530 | Ga0268265_10017513 | 3300028380 | Bacteria | 4946 |
| 531 | Ga0268265_10124352 | 3300028380 | Bacteria | 2131 |
| 532 | Ga0268264_10000412 | 3300028381 | Bacteria | 60566 |
| 533 | Ga0265318_10073182 | 3300028577 | Bacteria | 1269 |
| 534 | Ga0307515_10186368 | 3300028794 | Bacteria | 2003 |
| 535 | Ga0265330_10056436 | 3300031235 | Bacteria | 1714 |
| 536 | Ga0265332_10007214 | 3300031238 | Bacteria | 5032 |
| 537 | Ga0265328_10046998 | 3300031239 | Bacteria | 1586 |
| 538 | Ga0265320_10090403 | 3300031240 | Bacteria | 1418 |
| 539 | Ga0265329_10044501 | 3300031242 | Bacteria | 1419 |
| 540 | Ga0265340_10002649 | 3300031247 | Bacteria | 10174 |
| 541 | Ga0265339_10056559 | 3300031249 | Bacteria | 2124 |
| 542 | Ga0307513_10092853 | 3300031456 | Bacteria | 3070 |
| 543 | Ga0307513_10103826 | 3300031456 | Bacteria | 2857 |
| 544 | Ga0265314_10165424 | 3300031711 | Bacteria | 1341 |
| 545 | Ga0265342_10054429 | 3300031712 | Bacteria | 2377 |
| 546 | Ga0265342_10101486 | 3300031712 | Bacteria | 1638 |
| 547 | Ga0307411_10002397 | 3300032005 | Bacteria | 8265 |
| 548 | Ga0307415_100641747 | 3300032126 | Bacteria | 951 |
| 549 | Ga0307510_10035420 | 3300033180 | Bacteria | 5575 |
| 550 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 551 | Ga0373930_0000607 | 3300034816 | Bacteria | 4961 |
| 552 | Ga0373948_0006398 | 3300034817 | Bacteria | 1946 |
| 553 | Ga0373948_0016087 | 3300034817 | Bacteria | 1379 |
| 554 | Ga0373950_0000494 | 3300034818 | Bacteria | 4833 |
| 555 | Ga0373959_0000816 | 3300034820 | Bacteria | 5331 |
| 556 | Ga0373938_0001237 | 3300034957 | Bacteria | 4111 |
| 557 | Ga0373938_0001518 | 3300034957 | Bacteria | 3726 |
| 558 | Ga0373926_0012416 | 3300035083 | Bacteria | 2879 |
| 559 | Ga0373926_0128288 | 3300035083 | Bacteria | 959 |
| 560 | Ga0373928_0000480 | 3300035084 | Bacteria | 7865 |
| 561 | Ga0373928_0010355 | 3300035084 | Bacteria | 1831 |
| 562 | Ga0373929_0000533 | 3300035085 | Bacteria | 7317 |
| 563 | Ga0373929_0002287 | 3300035085 | Bacteria | 3535 |
| 564 | Ga0373940_0000021 | 3300035088 | Bacteria | 17555 |
| 565 | Ga0373949_0001106 | 3300035090 | Bacteria | 8171 |
| 566 | Ga0373949_0001635 | 3300035090 | Bacteria | 6259 |
| 567 | Ga0373951_0000265 | 3300035091 | Bacteria | 17187 |
| 568 | Ga0373952_0000780 | 3300035092 | Bacteria | 5729 |
| 569 | Ga0373952_0007564 | 3300035092 | Bacteria | 2039 |
| 570 | Ga0373923_0017091 | 3300035111 | Bacteria | 2768 |
| 571 | Ga0373923_0019644 | 3300035111 | Bacteria | 2618 |
| 572 | Ga0373932_0000344 | 3300035112 | Bacteria | 14241 |
| 573 | Ga0373932_0001592 | 3300035112 | Bacteria | 6248 |
| 574 | Ga0373936_0044806 | 3300035113 | Bacteria | 1780 |
| 575 | Ga0373939_0001562 | 3300035114 | Bacteria | 5563 |
| 576 | Ga0373939_0001966 | 3300035114 | Bacteria | 4913 |
| 577 | Ga0373941_0000384 | 3300035115 | Bacteria | 8772 |
| 578 | Ga0373941_0001070 | 3300035115 | Bacteria | 5689 |
| 579 | Ga0373945_0011141 | 3300035116 | Bacteria | 2968 |
| 580 | Ga0373953_0001358 | 3300035117 | Bacteria | 7042 |
| 581 | Ga0373954_0001778 | 3300035118 | Bacteria | 8862 |
| 582 | Ga0373954_0008905 | 3300035118 | Bacteria | 4416 |
| 583 | Ga0373954_0043332 | 3300035118 | Bacteria | 2099 |
| 584 | Ga0373956_0005729 | 3300035119 | Bacteria | 4967 |
| 585 | Ga0373956_0037017 | 3300035119 | Bacteria | 2155 |
| 586 | Ga0373957_0002644 | 3300035120 | Bacteria | 5141 |
| 587 | Ga0373957_0022163 | 3300035120 | Bacteria | 2261 |
| 588 | Ga0373960_0000884 | 3300035121 | Bacteria | 6366 |
| 589 | Ga0373960_0007664 | 3300035121 | Bacteria | 2566 |
| 590 | Ga0373943_0001649 | 3300035170 | Bacteria | 10133 |
| 591 | Ga0373943_0224804 | 3300035170 | Bacteria | 1047 |
| 592 | Ga0373955_0001783 | 3300035172 | Bacteria | 9235 |
| 593 | Ga0373955_0016407 | 3300035172 | Bacteria | 3644 |
| 594 | Ga0373942_0000448 | 3300035207 | Bacteria | 11582 |
| 595 | Ga0373961_0000304 | 3300035241 | Bacteria | 21873 |
| 596 | Ga0373961_0002376 | 3300035241 | Bacteria | 4900 |
| 597 | Ga0373961_0037845 | 3300035241 | Bacteria | 1380 |
| 598 | Ga0373962_0000142 | 3300035242 | Bacteria | 14926 |
| 599 | Ga0373962_0002870 | 3300035242 | Bacteria | 4128 |
| 600 | Ga0373924_0005305 | 3300035410 | Bacteria | 4557 |
| 601 | Ga0373931_0000765 | 3300035691 | Bacteria | 13438 |
| 602 | Ga0373935_0059381 | 3300035692 | Bacteria | 2444 |
| 603 | Ga0373927_0124399 | 3300035695 | Bacteria | 1683 |
| 604 | Ga0373933_0001908 | 3300035724 | Bacteria | 12027 |
| 605 | Ga0373933_0032897 | 3300035724 | Bacteria | 3014 |
| 606 | Ga0373947_0025743 | 3300035725 | Bacteria | 3432 |
| 607 | Ga0373937_0015839 | 3300036401 | Bacteria | 6681 |
| 608 | Ga0373937_0024376 | 3300036401 | Bacteria | 5456 |
| 609 | Ga0373925_0008127 | 3300037068 | Bacteria | 7640 |
| 610 | Ga0373925_0027997 | 3300037068 | Bacteria | 4127 |
| 611 | Ga0373925_0029762 | 3300037068 | Bacteria | 4006 |
| 612 | Ga0373925_0418801 | 3300037068 | Bacteria | 1094 |
| 613 | Ga0395899_0014921 | 3300037312 | Bacteria | 5925 |
| 614 | Ga0395900_0001847 | 3300037418 | Bacteria | 24145 |
| 615 | Ga0395900_0440081 | 3300037418 | Bacteria | 1261 |
| 616 | Ga0395898_0025845 | 3300037466 | Bacteria | 5911 |
| 617 | Ga0395898_0078787 | 3300037466 | Bacteria | 3179 |
| 618 | Ga0395898_0093054 | 3300037466 | Bacteria | 2898 |
| 619 | Ga0395905_0009298 | 3300037471 | Bacteria | 9615 |
| 620 | Ga0395905_0020314 | 3300037471 | Bacteria | 6292 |
| 621 | Ga0436364_0200421 | 3300037853 | Bacteria | 1715 |
| 622 | Ga0436364_0631135 | 3300037853 | Bacteria | 32086 |
| 623 | Ga0436364_0886281 | 3300037853 | Bacteria | 16293 |
| 624 | Ga0436364_1085296 | 3300037853 | Bacteria | 1662 |
| 625 | Ga0436364_1097852 | 3300037853 | Bacteria | 6052 |
| 626 | Ga0395901_0184972 | 3300038443 | Bacteria | 2185 |
| 627 | Ga0395901_0459164 | 3300038443 | Bacteria | 1302 |
| 628 | Ga0242420_001691 | 3300038996 | Bacteria | 3008 |
| 629 | Ga0436365_0145779 | 3300039437 | Bacteria | 899 |
| 630 | Ga0436365_0716278 | 3300039437 | Bacteria | 6336 |
| 631 | Ga0436365_0717201 | 3300039437 | Bacteria | 1357 |
| 632 | Ga0436365_1229627 | 3300039437 | Bacteria | 1147 |
| 633 | Ga0436365_1502264 | 3300039437 | Bacteria | 1497 |
| 634 | Ga0436365_1873778 | 3300039437 | Bacteria | 12049 |
| 635 | Ga0436360_0232803 | 3300039438 | Bacteria | 1093 |
| 636 | Ga0436361_0126747 | 3300039447 | Bacteria | 5826 |
| 637 | Ga0436361_0289886 | 3300039447 | Bacteria | 3340 |
| 638 | Ga0436361_0788579 | 3300039447 | Bacteria | 46510 |
| 639 | Ga0436361_1033613 | 3300039447 | Bacteria | 1341 |
| 640 | Ga0436361_1036871 | 3300039447 | Bacteria | 3060 |
| 641 | Ga0436363_0236352 | 3300039450 | Bacteria | 1036 |
| 642 | Ga0436363_0483910 | 3300039450 | Bacteria | 6811 |
| 643 | Ga0436363_1253812 | 3300039450 | Bacteria | 1012 |
| 644 | Ga0436362_0156760 | 3300039453 | Bacteria | 1970 |
| 645 | Ga0436362_0598074 | 3300039453 | Bacteria | 1348 |
| 646 | Ga0451853_0822473 | 3300041512 | Bacteria | 1168 |
| 647 | Ga0439441_017413 | 3300042001 | Bacteria | 1290 |
| 648 | Ga0439448_0017865 | 3300042005 | Bacteria | 2169 |
| 649 | Ga0439450_042108 | 3300042008 | Bacteria | 1063 |
| 650 | Ga0439460_0010215 | 3300042461 | Bacteria | 2398 |
| 651 | Ga0439460_0034429 | 3300042461 | Bacteria | 1460 |
| 652 | Ga0466972_0000884 | 3300044658 | Bacteria | 14415 |
| 653 | Ga0466972_0021802 | 3300044658 | Bacteria | 3191 |
| 654 | Ga0466982_0076205 | 3300044672 | Bacteria | 2074 |
| 655 | Ga0466965_0006331 | 3300044683 | Bacteria | 5366 |
| 656 | Ga0466966_0000419 | 3300044684 | Bacteria | 27305 |
| 657 | Ga0466961_0000020 | 3300044693 | Bacteria | 107610 |
| 658 | Ga0466963_0023644 | 3300044694 | Bacteria | 3905 |
| 659 | Ga0466964_0106297 | 3300044706 | Bacteria | 1245 |
| 660 | Ga0453684_0006867 | 3300044712 | Bacteria | 21373 |
| 661 | Ga0453684_0166774 | 3300044712 | Bacteria | 2599 |
| 662 | Ga0453684_0533526 | 3300044712 | Bacteria | 1295 |
| 663 | Ga0466957_0075107 | 3300044842 | Bacteria | 2097 |
| 664 | Ga0466959_0013508 | 3300045049 | Bacteria | 5918 |
| 665 | Ga0451576_0007172 | 3300045051 | Bacteria | 13432 |
| 666 | Ga0451576_0021200 | 3300045051 | Bacteria | 7064 |
| 667 | Ga0451576_0030425 | 3300045051 | Bacteria | 5770 |
| 668 | Ga0451576_0107387 | 3300045051 | Bacteria | 2904 |
| 669 | Ga0466967_0034124 | 3300045976 | Bacteria | 4315 |
| 670 | Ga0495592_0005568 | 3300046454 | Bacteria | 9316 |
| 671 | Ga0495603_0029732 | 3300046455 | Bacteria | 3294 |
| 672 | Ga0495603_0039583 | 3300046455 | Bacteria | 2824 |
| 673 | Ga0495629_0000922 | 3300046459 | Bacteria | 23637 |
| 674 | Ga0495629_0001285 | 3300046459 | Bacteria | 19732 |
| 675 | Ga0495629_0044327 | 3300046459 | Bacteria | 3122 |
| 676 | Ga0495629_0136206 | 3300046459 | Bacteria | 1709 |
| 677 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 678 | Ga0495638_0005101 | 3300046460 | Bacteria | 9838 |
| 679 | Ga0495641_0201879 | 3300046461 | Bacteria | 891 |
| 680 | Ga0495651_0019485 | 3300046462 | Bacteria | 5259 |
| 681 | Ga0495651_0269106 | 3300046462 | Bacteria | 1156 |
| 682 | Ga0495653_0004517 | 3300046463 | Bacteria | 11238 |
| 683 | Ga0495653_0312506 | 3300046463 | Bacteria | 1021 |
| 684 | Ga0495580_0014157 | 3300046472 | Bacteria | 6060 |
| 685 | Ga0495582_0010213 | 3300046473 | Bacteria | 5171 |
| 686 | Ga0495582_0027896 | 3300046473 | Bacteria | 3096 |
| 687 | Ga0495639_0012054 | 3300046475 | Bacteria | 3727 |
| 688 | Ga0495662_0107376 | 3300046476 | Bacteria | 1367 |
| 689 | Ga0495664_0045546 | 3300046477 | Bacteria | 2601 |
| 690 | Ga0495607_0157454 | 3300046501 | Bacteria | 1157 |
| 691 | Ga0495606_0073214 | 3300046507 | Bacteria | 2150 |
| 692 | Ga0495606_0145265 | 3300046507 | Bacteria | 1397 |
| 693 | Ga0495608_0035885 | 3300046511 | Bacteria | 3340 |
| 694 | Ga0495618_0130222 | 3300046514 | Bacteria | 1610 |
| 695 | Ga0495628_0017379 | 3300046516 | Bacteria | 5990 |
| 696 | Ga0495628_0030476 | 3300046516 | Bacteria | 4367 |
| 697 | Ga0495630_0254695 | 3300046517 | Bacteria | 1341 |
| 698 | Ga0495632_0154696 | 3300046519 | Bacteria | 1059 |
| 699 | Ga0495643_0063902 | 3300046522 | Bacteria | 1945 |
| 700 | Ga0495648_0016592 | 3300046524 | Bacteria | 5304 |
| 701 | Ga0495652_0003125 | 3300046529 | Bacteria | 16545 |
| 702 | Ga0495652_0025506 | 3300046529 | Bacteria | 5228 |
| 703 | Ga0495652_0121345 | 3300046529 | Bacteria | 2084 |
| 704 | Ga0495652_0198134 | 3300046529 | Bacteria | 1526 |
| 705 | Ga0495665_0032194 | 3300046531 | Bacteria | 2804 |
| 706 | Ga0495640_0054173 | 3300046533 | Bacteria | 2749 |
| 707 | Ga0495586_0035255 | 3300046535 | Bacteria | 2688 |
| 708 | Ga0495587_0013911 | 3300046536 | Bacteria | 5052 |
| 709 | Ga0495622_0018941 | 3300046557 | Bacteria | 3207 |
| 710 | Ga0495667_0007856 | 3300046559 | Bacteria | 7228 |
| 711 | Ga0495656_0117874 | 3300046615 | Bacteria | 1250 |
| 712 | Ga0495668_0024294 | 3300046616 | Bacteria | 3448 |
| 713 | Ga0495668_0027247 | 3300046616 | Bacteria | 3239 |
| 714 | Ga0495634_0010895 | 3300046642 | Bacteria | 6638 |
| 715 | Ga0495634_0053940 | 3300046642 | Bacteria | 2691 |
| 716 | Ga0495634_0082401 | 3300046642 | Bacteria | 2102 |
| 717 | Ga0495635_0002149 | 3300046663 | Bacteria | 13377 |
| 718 | Ga0495635_0014588 | 3300046663 | Bacteria | 5495 |
| 719 | Ga0495635_0106601 | 3300046663 | Bacteria | 1914 |
| 720 | Ga0495657_0006772 | 3300046675 | Bacteria | 8933 |
| 721 | Ga0495657_0026686 | 3300046675 | Bacteria | 4087 |
| 722 | Ga0495599_0001827 | 3300046678 | Bacteria | 12344 |
| 723 | Ga0495599_0009838 | 3300046678 | Bacteria | 5853 |
| 724 | Ga0495599_0146659 | 3300046678 | Bacteria | 1463 |
| 725 | Ga0495623_0093506 | 3300046679 | Bacteria | 1840 |
| 726 | Ga0495646_0030846 | 3300046680 | Bacteria | 3345 |
| 727 | Ga0495658_0002947 | 3300046683 | Bacteria | 8537 |
| 728 | Ga0495658_0092947 | 3300046683 | Bacteria | 1789 |
| 729 | Ga0495669_0155818 | 3300046684 | Bacteria | 1083 |
| 730 | Ga0495613_0019718 | 3300046689 | Bacteria | 5026 |
| 731 | Ga0495613_0072027 | 3300046689 | Bacteria | 2519 |
| 732 | Ga0495600_0004830 | 3300046809 | Bacteria | 8093 |
| 733 | Ga0495600_0006396 | 3300046809 | Bacteria | 7170 |
| 734 | Ga0495600_0021619 | 3300046809 | Bacteria | 4123 |
| 735 | Ga0495660_0032799 | 3300046810 | Bacteria | 2916 |
| 736 | Ga0495581_0022831 | 3300047315 | Bacteria | 3624 |
| 737 | Ga0495581_0080469 | 3300047315 | Bacteria | 1886 |
| 738 | Ga0495581_0229750 | 3300047315 | Bacteria | 1085 |
| 739 | Ga0495581_0311969 | 3300047315 | Bacteria | 919 |
| 740 | Ga0495604_0005881 | 3300047317 | Bacteria | 9725 |
| 741 | Ga0495604_0026610 | 3300047317 | Bacteria | 4604 |
| 742 | Ga0495604_0241652 | 3300047317 | Bacteria | 1234 |
| 743 | Ga0495674_0060932 | 3300047319 | Bacteria | 3290 |
| 744 | Ga0495676_0013885 | 3300047321 | Bacteria | 7223 |
| 745 | Ga0495680_0009327 | 3300047322 | Bacteria | 8839 |
| 746 | Ga0495680_0010422 | 3300047322 | Bacteria | 8293 |
| 747 | Ga0495675_0008213 | 3300047444 | Bacteria | 6458 |
| 748 | Ga0495684_0026359 | 3300047471 | Bacteria | 4466 |
| 749 | Ga0495686_0172301 | 3300047472 | Bacteria | 1258 |
| 750 | Ga0495593_0008299 | 3300047673 | Bacteria | 6044 |
| 751 | Ga0495593_0113638 | 3300047673 | Bacteria | 1381 |
| 752 | Ga0495602_0011154 | 3300048088 | Bacteria | 9300 |
| 753 | Ga0495602_0017078 | 3300048088 | Bacteria | 7280 |
| 754 | Ga0495602_0054855 | 3300048088 | Bacteria | 3515 |
| 755 | Ga0495614_0219656 | 3300048089 | Bacteria | 864 |
| 756 | Ga0496100_0000665 | 3300048903 | Bacteria | 16320 |
| 757 | Ga0496100_0001217 | 3300048903 | Bacteria | 12503 |
| 758 | Ga0496100_0141112 | 3300048903 | Bacteria | 1708 |
| 759 | Ga0496100_0238641 | 3300048903 | Bacteria | 1340 |
| 760 | Ga0496101_0000632 | 3300048904 | Bacteria | 21355 |
| 761 | Ga0496101_0059329 | 3300048904 | Bacteria | 2773 |
| 762 | Ga0496101_0336987 | 3300048904 | Bacteria | 1184 |
| 763 | Ga0496102_0004162 | 3300048905 | Bacteria | 12244 |
| 764 | Ga0496102_0017659 | 3300048905 | Bacteria | 6252 |
| 765 | Ga0496102_0114643 | 3300048905 | Bacteria | 2514 |
| 766 | Ga0496102_0146928 | 3300048905 | Bacteria | 2213 |
| 767 | Ga0496102_0427438 | 3300048905 | Bacteria | 1244 |
| 768 | Ga0496102_0438213 | 3300048905 | Bacteria | 1226 |
| 769 | Ga0496103_0000817 | 3300048906 | Bacteria | 22840 |
| 770 | Ga0496103_0011670 | 3300048906 | Bacteria | 5212 |
| 771 | Ga0496103_0025961 | 3300048906 | Bacteria | 3544 |
| 772 | Ga0496104_0018347 | 3300048907 | Bacteria | 6384 |
| 773 | Ga0496104_0024478 | 3300048907 | Bacteria | 5553 |
| 774 | Ga0496104_0120022 | 3300048907 | Bacteria | 2524 |
| 775 | Ga0496104_0232974 | 3300048907 | Bacteria | 1753 |
| 776 | Ga0496104_0471788 | 3300048907 | Bacteria | 1166 |
| 777 | Ga0496105_0002948 | 3300048908 | Bacteria | 12498 |
| 778 | Ga0496105_0007938 | 3300048908 | Bacteria | 8247 |
| 779 | Ga0496106_0000317 | 3300048909 | Bacteria | 33879 |
| 780 | Ga0496106_0091319 | 3300048909 | Bacteria | 2351 |
| 781 | Ga0496107_0001599 | 3300048910 | Bacteria | 14100 |
| 782 | Ga0496107_0017437 | 3300048910 | Bacteria | 5052 |
| 783 | Ga0496107_0029320 | 3300048910 | Bacteria | 3914 |
| 784 | Ga0496107_0073404 | 3300048910 | Bacteria | 2488 |
| 785 | Ga0496108_0004872 | 3300048911 | Bacteria | 10839 |
| 786 | Ga0496108_0007088 | 3300048911 | Bacteria | 9077 |
| 787 | Ga0496108_0013558 | 3300048911 | Bacteria | 6652 |
| 788 | Ga0496108_0015960 | 3300048911 | Bacteria | 6121 |
| 789 | Ga0496108_0027428 | 3300048911 | Bacteria | 4703 |
| 790 | Ga0496108_0301516 | 3300048911 | Bacteria | 1396 |
| 791 | Ga0496109_0000725 | 3300048912 | Bacteria | 27459 |
| 792 | Ga0496109_0001051 | 3300048912 | Bacteria | 22839 |
| 793 | Ga0496109_0002705 | 3300048912 | Bacteria | 14857 |
| 794 | Ga0496109_0012545 | 3300048912 | Bacteria | 7316 |
| 795 | Ga0496109_0131303 | 3300048912 | Bacteria | 2338 |
| 796 | Ga0496109_0164819 | 3300048912 | Bacteria | 2077 |
| 797 | Ga0496110_0005265 | 3300048913 | Bacteria | 10125 |
| 798 | Ga0496110_0038059 | 3300048913 | Bacteria | 4184 |
| 799 | Ga0496110_0077803 | 3300048913 | Bacteria | 2951 |
| 800 | Ga0496110_0152536 | 3300048913 | Bacteria | 2092 |
| 801 | Ga0496111_0004834 | 3300048914 | Bacteria | 8545 |
| 802 | Ga0496111_0060637 | 3300048914 | Bacteria | 2742 |
| 803 | Ga0496111_0087114 | 3300048914 | Bacteria | 2285 |
| 804 | Ga0496111_0148221 | 3300048914 | Bacteria | 1740 |
| 805 | Ga0496112_0006906 | 3300048915 | Bacteria | 10015 |
| 806 | Ga0496112_0010729 | 3300048915 | Bacteria | 8329 |
| 807 | Ga0496112_0017849 | 3300048915 | Bacteria | 6678 |
| 808 | Ga0496112_0021305 | 3300048915 | Bacteria | 6162 |
| 809 | Ga0496112_0028407 | 3300048915 | Bacteria | 5399 |
| 810 | Ga0496112_0028731 | 3300048915 | Bacteria | 5371 |
| 811 | Ga0496112_0482256 | 3300048915 | Bacteria | 1176 |
| 812 | Ga0496113_0012244 | 3300048916 | Bacteria | 5759 |
| 813 | Ga0496113_0013905 | 3300048916 | Bacteria | 5470 |
| 814 | Ga0496113_0026033 | 3300048916 | Bacteria | 4179 |
| 815 | Ga0496113_0340709 | 3300048916 | Bacteria | 1202 |
| 816 | Ga0496114_0126618 | 3300048917 | Bacteria | 2202 |
| 817 | Ga0496115_0001870 | 3300048918 | Bacteria | 15064 |
| 818 | Ga0496115_0002384 | 3300048918 | Bacteria | 13476 |
| 819 | Ga0496115_0035897 | 3300048918 | Bacteria | 3924 |
| 820 | Ga0496115_0036422 | 3300048918 | Bacteria | 3896 |
| 821 | Ga0496115_0108901 | 3300048918 | Bacteria | 2275 |
| 822 | Ga0496119_0035832 | 3300048922 | Bacteria | 3245 |
| 823 | Ga0496119_0045480 | 3300048922 | Bacteria | 2751 |
| 824 | Ga0496121_0125915 | 3300048924 | Bacteria | 1926 |
| 825 | Ga0496125_0147617 | 3300048928 | Bacteria | 1622 |
| 826 | Ga0496126_0007204 | 3300048929 | Bacteria | 12234 |
| 827 | Ga0496126_0007639 | 3300048929 | Bacteria | 11802 |
| 828 | Ga0496126_0026387 | 3300048929 | Bacteria | 5570 |
| 829 | Ga0496126_0034270 | 3300048929 | Bacteria | 4769 |
| 830 | Ga0496126_0125608 | 3300048929 | Bacteria | 2220 |
| 831 | Ga0501031_0005435 | 3300049568 | Bacteria | 8294 |
| 832 | Ga0501032_0042416 | 3300049569 | Bacteria | 3086 |
| 833 | Ga0501033_0020163 | 3300049570 | Bacteria | 5040 |
| 834 | Ga0501033_0437845 | 3300049570 | Bacteria | 909 |
| 835 | Ga0501034_0000197 | 3300049571 | Bacteria | 114088 |
| 836 | Ga0501034_0030864 | 3300049571 | Bacteria | 5446 |
| 837 | Ga0501034_0260955 | 3300049571 | Bacteria | 1675 |
| 838 | Ga0501034_0342148 | 3300049571 | Bacteria | 1425 |
| 839 | Ga0501036_0033337 | 3300049572 | Bacteria | 4355 |
| 840 | Ga0501036_0039959 | 3300049572 | Bacteria | 3968 |
| 841 | Ga0501036_0053248 | 3300049572 | Bacteria | 3427 |
| 842 | Ga0501037_0018838 | 3300049573 | Bacteria | 5086 |
| 843 | Ga0501038_0007936 | 3300049574 | Bacteria | 9780 |
| 844 | Ga0501038_0039210 | 3300049574 | Bacteria | 4144 |
| 845 | Ga0501038_0092679 | 3300049574 | Bacteria | 2529 |
| 846 | Ga0501039_0023632 | 3300049575 | Bacteria | 4718 |
| 847 | Ga0501039_0034420 | 3300049575 | Bacteria | 3909 |
| 848 | Ga0501039_0113260 | 3300049575 | Bacteria | 2121 |
| 849 | Ga0501039_0249298 | 3300049575 | Bacteria | 1396 |
| 850 | Ga0501040_0120331 | 3300049576 | Bacteria | 1842 |
| 851 | Ga0501041_0240327 | 3300049577 | Bacteria | 1138 |
| 852 | Ga0501042_0155451 | 3300049578 | Bacteria | 1650 |
| 853 | Ga0501042_0410507 | 3300049578 | Bacteria | 981 |
| 854 | Ga0501043_0006548 | 3300049579 | Bacteria | 9342 |
| 855 | Ga0501043_0029976 | 3300049579 | Bacteria | 4274 |
| 856 | Ga0501043_0070381 | 3300049579 | Bacteria | 2748 |
| 857 | Ga0501046_0009112 | 3300049580 | Bacteria | 8596 |
| 858 | Ga0501046_0055460 | 3300049580 | Bacteria | 3113 |
| 859 | Ga0501046_0194485 | 3300049580 | Bacteria | 1512 |
| 860 | Ga0501047_0011383 | 3300049581 | Bacteria | 8419 |
| 861 | Ga0501047_0016856 | 3300049581 | Bacteria | 6982 |
| 862 | Ga0501047_0021447 | 3300049581 | Bacteria | 6203 |
| 863 | Ga0501047_0380131 | 3300049581 | Bacteria | 1247 |
| 864 | Ga0501048_0355364 | 3300049582 | Bacteria | 1045 |
| 865 | Ga0501068_0257252 | 3300049584 | Bacteria | 1113 |
| 866 | Ga0501069_0235170 | 3300049585 | Bacteria | 1067 |
| 867 | Ga0501070_0009868 | 3300049586 | Bacteria | 8073 |
| 868 | Ga0501070_0016140 | 3300049586 | Bacteria | 6277 |
| 869 | Ga0501070_0021109 | 3300049586 | Bacteria | 5464 |
| 870 | Ga0501070_0039121 | 3300049586 | Bacteria | 3956 |
| 871 | Ga0501072_0007366 | 3300049588 | Bacteria | 8347 |
| 872 | Ga0501072_0011676 | 3300049588 | Bacteria | 6711 |
| 873 | Ga0501073_0018856 | 3300049589 | Bacteria | 4986 |
| 874 | Ga0501073_0098901 | 3300049589 | Bacteria | 2026 |
| 875 | Ga0501074_0057588 | 3300049590 | Bacteria | 2799 |
| 876 | Ga0501074_0356802 | 3300049590 | Bacteria | 1038 |
| 877 | Ga0501075_0111860 | 3300049591 | Bacteria | 2076 |
| 878 | Ga0501075_0232452 | 3300049591 | Bacteria | 1406 |
| 879 | Ga0501077_0034959 | 3300049593 | Bacteria | 3199 |
| 880 | Ga0501257_003693 | 3300049686 | Bacteria | 3304 |
| 881 | Ga0501080_0005257 | 3300049742 | Bacteria | 11531 |
| 882 | Ga0501080_0052803 | 3300049742 | Bacteria | 3783 |
| 883 | Ga0501080_0347091 | 3300049742 | Bacteria | 1341 |
| 884 | Ga0501081_0113221 | 3300049743 | Bacteria | 1927 |
| 885 | Ga0501083_0045819 | 3300049744 | Bacteria | 2957 |
| 886 | Ga0501083_0117029 | 3300049744 | Bacteria | 1749 |
| 887 | Ga0501083_0127241 | 3300049744 | Bacteria | 1670 |
| 888 | Ga0501035_0059772 | 3300049822 | Bacteria | 3394 |
| 889 | Ga0501035_0145532 | 3300049822 | Bacteria | 2058 |
| 890 | Ga0501035_0289833 | 3300049822 | Bacteria | 1382 |
| 891 | Ga0501044_0069413 | 3300049823 | Bacteria | 3587 |
| 892 | Ga0501044_0103929 | 3300049823 | Bacteria | 2855 |
| 893 | Ga0501044_0113041 | 3300049823 | Bacteria | 2722 |
| 894 | Ga0501044_0204011 | 3300049823 | Bacteria | 1934 |
| 895 | Ga0501044_0241569 | 3300049823 | Bacteria | 1749 |
| 896 | Ga0501044_0383839 | 3300049823 | Bacteria | 1319 |
| 897 | Ga0501045_0258735 | 3300049824 | Bacteria | 1295 |
| 898 | nmdc:mga03683_83698_c1 | 3300050489 | Bacteria | 1382 |
| 899 | nmdc:mga03n38_114762_c1 | 3300050490 | Bacteria | 1317 |
| 900 | nmdc:mga03n38_173054_c1 | 3300050490 | Bacteria | 1101 |
| 901 | nmdc:mga03n38_22949_c1 | 3300050490 | Bacteria | 2533 |
| 902 | nmdc:mga0yw44_120427_c1 | 3300050492 | Bacteria | 1690 |
| 903 | nmdc:mga0yw44_80059_c1 | 3300050492 | Bacteria | 2045 |
| 904 | nmdc:mga06z11_13813_c1 | 3300050494 | Bacteria | 3560 |
| 905 | nmdc:mga06z11_237388_c1 | 3300050494 | Bacteria | 1070 |
| 906 | nmdc:mga04h51_3033_c1 | 3300050495 | Bacteria | 4043 |
| 907 | nmdc:mga07m45_13195_c2 | 3300050496 | Bacteria | 2206 |
| 908 | nmdc:mga07m45_300923_c1 | 3300050496 | Bacteria | 933 |
| 909 | nmdc:mga05p37_863312_c1 | 3300050507 | Bacteria | 981 |
| 910 | nmdc:mga05p37_9789_c1 | 3300050507 | Bacteria | 11374 |
| 911 | nmdc:mga09592_26028_c1 | 3300050508 | Bacteria | 4845 |
| 912 | nmdc:mga06r32_16557_c1 | 3300050510 | Bacteria | 6720 |
| 913 | nmdc:mga08y16_128082_c1 | 3300050511 | Bacteria | 2640 |
| 914 | nmdc:mga08y16_2535_c1 | 3300050511 | Bacteria | 18788 |
| 915 | nmdc:mga08y16_978_c1 | 3300050511 | Bacteria | 27841 |
| 916 | nmdc:mga0n895_108203_c1 | 3300050512 | Bacteria | 2794 |
| 917 | nmdc:mga0n895_12117_c1 | 3300050512 | Bacteria | 7717 |
| 918 | nmdc:mga0rr50_50740_c1 | 3300050513 | Bacteria | 3075 |
| 919 | nmdc:mga08x19_27831_c1 | 3300050514 | Bacteria | 3537 |
| 920 | nmdc:mga0a205_41963_c1 | 3300050515 | Bacteria | 4408 |
| 921 | nmdc:mga0a205_43028_c1 | 3300050515 | Bacteria | 4354 |
| 922 | Ga0495601_0042585 | 3300053077 | Bacteria | 2849 |
| 923 | Ga0500610_0089540 | 3300053079 | Bacteria | 1599 |
| 924 | Ga0495595_0003401 | 3300053084 | Bacteria | 6323 |
| 925 | Ga0495619_0011847 | 3300053085 | Bacteria | 5492 |
| 926 | Ga0500643_002019 | 3300053087 | Bacteria | 10915 |
| 927 | Ga0500583_0006517 | 3300053092 | Bacteria | 4025 |
| 928 | Ga0500566_0000008 | 3300053094 | Bacteria | 143641 |
| 929 | Ga0500566_0044788 | 3300053094 | Bacteria | 2548 |
| 930 | Ga0500566_0088477 | 3300053094 | Bacteria | 1714 |
| 931 | Ga0500640_000659 | 3300053095 | Bacteria | 9056 |
| 932 | Ga0500641_0003076 | 3300053096 | Bacteria | 5913 |
| 933 | Ga0500641_0006207 | 3300053096 | Bacteria | 4238 |
| 934 | Ga0500641_0039798 | 3300053096 | Bacteria | 1895 |
| 935 | Ga0500641_0079215 | 3300053096 | Bacteria | 1392 |
| 936 | Ga0500557_000008 | 3300053105 | Bacteria | 127284 |
| 937 | Ga0500572_001833 | 3300053111 | Bacteria | 5394 |
| 938 | Ga0500595_002758 | 3300053119 | Bacteria | 8465 |
| 939 | Ga0500607_092703 | 3300053121 | Bacteria | 1516 |
| 940 | Ga0500608_060510 | 3300053122 | Bacteria | 1811 |
| 941 | Ga0500614_002412 | 3300053123 | Bacteria | 4176 |
| 942 | Ga0500642_0000425 | 3300053130 | Bacteria | 13760 |
| 943 | Ga0500655_003943 | 3300053133 | Bacteria | 2676 |
| 944 | Ga0500658_0022985 | 3300053134 | Bacteria | 2377 |
| 945 | Ga0500559_0005921 | 3300053136 | Bacteria | 5562 |
| 946 | Ga0500603_002982 | 3300053150 | Bacteria | 3653 |
| 947 | Ga0500603_011313 | 3300053150 | Bacteria | 2029 |
| 948 | Ga0500604_0133361 | 3300053151 | Bacteria | 836 |
| 949 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 950 | Ga0500619_015230 | 3300053154 | Bacteria | 2086 |
| 951 | Ga0500622_0136791 | 3300053156 | Bacteria | 1173 |
| 952 | Ga0500627_0014558 | 3300053158 | Bacteria | 3017 |
| 953 | Ga0500630_000498 | 3300053159 | Bacteria | 17442 |
| 954 | Ga0500634_0056520 | 3300053161 | Bacteria | 2097 |
| 955 | Ga0500638_008843 | 3300053162 | Bacteria | 4318 |
| 956 | Ga0500639_000010 | 3300053163 | Bacteria | 136747 |
| 957 | Ga0500636_0001226 | 3300053177 | Bacteria | 13863 |
| 958 | Ga0500637_0000600 | 3300053178 | Bacteria | 14194 |
| 959 | Ga0500625_002917 | 3300053729 | Bacteria | 6592 |
| 960 | Ga0500596_001995 | 3300053735 | Bacteria | 4084 |
| 961 | Ga0500601_000407 | 3300053737 | Bacteria | 7272 |
| 962 | Ga0501084_0073058 | 3300054114 | Bacteria | 2872 |
| 963 | Ga0501084_0117476 | 3300054114 | Bacteria | 2236 |
| 964 | Ga0501084_0122786 | 3300054114 | Bacteria | 2184 |
| 965 | Ga0500661_012024 | 3300055283 | Bacteria | 1564 |
| 966 | Ga0587082_036112 | 3300059504 | Bacteria | 885 |
| 967 | Ga0587083_0047121 | 3300059505 | Bacteria | 926 |
| 968 | Ga0501082_0044974 | 3300060353 | Bacteria | 3808 |
| 969 | Ga0530510_0195558 | 3300061734 | Bacteria | 1501 |
| 970 | 2507510921 | 2507262055 | Bacteria | 8048963 |
| 971 | 2508544733 | 2508501009 | Bacteria | 7784016 |
| 972 | 2508697037 | 2508501042 | Bacteria | 8719808 |
| 973 | 2509147139 | 2508501128 | Bacteria | 8613869 |
| 974 | 2511394387 | 2511231028 | Bacteria | 8046582 |
| 975 | 2513649589 | 2513237095 | Bacteria | 8976980 |
| 976 | 2513654959 | 2513237096 | Bacteria | 8722461 |
| 977 | 2513671121 | 2513237098 | Bacteria | 9902361 |
| 978 | 2513861245 | 2513237137 | Bacteria | 9558895 |
| 979 | 2513874570 | 2513237139 | Bacteria | 8737671 |
| 980 | 2513894521 | 2513237141 | Bacteria | 8496279 |
| 981 | 2513916018 | 2513237145 | Bacteria | 8979722 |
| 982 | 2514015524 | 2513237161 | Bacteria | 8871253 |
| 983 | 2515625535 | 2515154112 | Bacteria | 8294334 |
| 984 | 2517894678 | 2517572143 | Bacteria | 9484767 |
| 985 | 2524464018 | 2524023210 | Bacteria | 9029266 |
| 986 | 2524534418 | 2524023228 | Bacteria | 10118060 |
| 987 | 2617350679 | 2617270735 | Bacteria | 9163226 |
| 988 | 2671119100 | 2667528175 | Bacteria | 7532676 |
| 989 | 2728747663 | 2728368998 | Bacteria | 8720350 |
| 990 | 2793071148 | 2791355197 | Bacteria | 8420563 |
| 991 | 2805916565 | 2802429603 | Bacteria | 8777136 |
| 992 | 2818238059 | 2816332527 | Bacteria | 8933356 |
| 993 | 2824675572 | 2824671348 | Bacteria | 8369588 |
| 994 | 2824692238 | 2824687955 | Bacteria | 8360029 |
| 995 | 2824698696 | 2824696289 | Bacteria | 8335049 |
| 996 | 2824778458 | 2824773399 | Bacteria | 8360218 |
| 997 | 2838127811 | 2838122688 | Bacteria | 8803140 |
| 998 | 2841943104 | 2841941048 | Bacteria | 8688029 |
| 999 | 2841956125 | 2841949485 | Bacteria | 8680857 |
| 1000 | 2841968254 | 2841966195 | Bacteria | 8673214 |
| 1001 | 2841976532 | 2841974524 | Bacteria | 8931498 |
| 1002 | 2841987908 | 2841983080 | Bacteria | 8395090 |
| 1003 | 2844317001 | 2844315083 | Bacteria | 8138177 |
| 1004 | 2847938482 | 2847930680 | Bacteria | 9342022 |
| 1005 | 2847944320 | 2847939898 | Bacteria | 8606328 |
| 1006 | 2857469434 | 2857465823 | Bacteria | 6772595 |
| 1007 | 2857512102 | 2857509624 | Bacteria | 7472071 |
| 1008 | 2857595176 | 2857591370 | Bacteria | 6569758 |
| 1009 | 2874597646 | 2874590934 | Bacteria | 8299676 |
| 1010 | 2874649210 | 2874645413 | Bacteria | 8214782 |
| 1011 | 2876767818 | 2876761206 | Bacteria | 10111113 |
| 1012 | 2876774881 | 2876771140 | Bacteria | 8287509 |
| 1013 | 2876822367 | 2876818435 | Bacteria | 8274608 |
| 1014 | 2879077969 | 2879074833 | Bacteria | 8279565 |
| 1015 | 2879088721 | 2879083081 | Bacteria | 8587928 |
| 1016 | 2879132480 | 2879127579 | Bacteria | 8294491 |
| 1017 | 2879145980 | 2879142872 | Bacteria | 8267021 |
| 1018 | 2885367012 | 2885366525 | Bacteria | 8326213 |
| 1019 | 2885382404 | 2885374607 | Bacteria | 8927485 |
| 1020 | 2885389064 | 2885383462 | Bacteria | 9473874 |
| 1021 | 2885416564 | 2885409591 | Bacteria | 9235467 |
| 1022 | 2888381624 | 2888378607 | Bacteria | 9652610 |
| 1023 | 2888389005 | 2888388044 | Bacteria | 7304136 |
| 1024 | 2903734969 | 2903727486 | Bacteria | 8281579 |
| 1025 | 2903757866 | 2903748898 | Bacteria | 9972761 |
| 1026 | 2904696988 | 2904690495 | Bacteria | 9412302 |
| 1027 | 2904705712 | |||
| 1028 | 2906604084 | 2906602504 | Bacteria | 8295279 |
| 1029 | 2906611405 | |||
| 1030 | 2906632991 | 2906626472 | Bacteria | 8826946 |
| 1031 | 2906641557 | 2906635258 | Bacteria | 8601019 |
| 1032 | 2906661261 | 2906660503 | Bacteria | 8595048 |
| 1033 | 2908744991 | 2908739725 | Bacteria | 8628932 |
| 1034 | 2908762744 | 2908756301 | Bacteria | 8864324 |
| 1035 | 2922427962 | |||
| 1036 | 2932798223 | 2932794094 | Bacteria | 7915132 |
| 1037 | 2932804018 | 2932801729 | Bacteria | 7987968 |
| 1038 | 2935612861 | 2935608549 | Bacteria | 8203142 |
| 1039 | 2935632119 | 2935630451 | Bacteria | 8169952 |
| 1040 | 2935775408 | 2935769743 | Bacteria | 7878163 |
| 1041 | 2935780310 | 2935777560 | Bacteria | 8077691 |
| 1042 | 2935790657 | 2935785616 | Bacteria | 7962367 |
| 1043 | 2935799160 | 2935793552 | Bacteria | 8012592 |
| 1044 | 2935824349 | 2935819856 | Bacteria | 8261050 |
| 1045 | 2935852506 | 2935847175 | Bacteria | 8228321 |
| 1046 | 2935884178 | 2935883170 | Bacteria | 7964738 |
| 1047 | 2935912340 | 2935908558 | Bacteria | 8568796 |
| 1048 | 2935923986 | 2935916978 | Bacteria | 9113783 |
| 1049 | 2935929369 | 2935926038 | Bacteria | 8601059 |
| 1050 | 2935936000 | 2935934488 | Bacteria | 8602579 |
| 1051 | 2935949900 | 2935942939 | Bacteria | 8599779 |
| 1052 | 2935957334 | 2935951376 | Bacteria | 8602333 |
| 1053 | 2935962147 | 2935959822 | Bacteria | 7869783 |
| 1054 | 2935968365 | 2935967501 | Bacteria | 8603075 |
| 1055 | 2935976552 | 2935975950 | Bacteria | 8347125 |
| 1056 | 2935988002 | 2935984226 | Bacteria | 8302647 |
| 1057 | 2936059441 | 2936055302 | Bacteria | 8785755 |
| 1058 | 2941508067 | 2941507105 | Bacteria | 8166816 |
| 1059 | 2941515428 | 2941515067 | Bacteria | 8166720 |
| 1060 | 2941523997 | 2941523033 | Bacteria | 8169134 |
| 1061 | 2941533786 | 2941531003 | Bacteria | 7653939 |
| 1062 | 3005477670 | 3005474847 | Bacteria | 9259049 |
| 1063 | 3005507211 | 3005506211 | Bacteria | 6943378 |
| 1064 | 3005594571 | 3005587118 | Bacteria | 7794411 |
| 1065 | 3005596645 | 3005594810 | Bacteria | 8716512 |
| 1066 | 3005712720 | 3005710791 | Bacteria | 7622528 |
| 1067 | 3005719770 | 3005718088 | Bacteria | 8283608 |
| 1068 | 8002062636 | 8002060224 | Bacteria | 4026565 |
| 1069 | 8006933548 | 8006933436 | Bacteria | 10410654 |
| 1070 | 8006983221 | 8006973647 | Bacteria | 10679141 |
| 1071 | 8016523727 | 8016522445 | Bacteria | 8156687 |
| 1072 | 8016537251 | 8016530956 | Bacteria | 8155261 |
| 1073 | 8016551742 | 8016548790 | Bacteria | 8155074 |
| 1074 | 8016566904 | 8016566248 | Bacteria | 8158151 |
| 1075 | 8016579633 | 8016575299 | Bacteria | 8154085 |
| 1076 | 8016589235 | 8016583857 | Bacteria | 10421953 |
| 1077 | 8016598050 | 8016595262 | Bacteria | 8149947 |
| 1078 | 8016604188 | 8016603502 | Bacteria | 8731218 |
| 1079 | 8016620769 | 8016613128 | Bacteria | 8794220 |
| 1080 | 8016629217 | 8016622563 | Bacteria | 7999408 |
| 1081 | 8016633742 | 8016630954 | Bacteria | 9217207 |
| 1082 | 8019536940 | 8019530166 | Bacteria | 8155624 |
| 1083 | 8019542588 | 8019538911 | Bacteria | 7872763 |
| 1084 | 8019548149 | 8019547302 | Bacteria | 7996444 |
| 1085 | 8019559473 | 8019555841 | Bacteria | 9642137 |
| 1086 | 8019569576 | 8019565922 | Bacteria | 9639779 |
| 1087 | 8019625247 | 8019619141 | Bacteria | 9218857 |
| 1088 | 8019636934 | 8019629233 | Bacteria | 8687553 |
| 1089 | 8019642674 | 8019638758 | Bacteria | 9062356 |
| 1090 | 8019649916 | 8019648815 | Bacteria | 10014479 |
| 1091 | 8019674339 | 8019668869 | Bacteria | 8791617 |
| 1092 | 8019681774 | 8019678201 | Bacteria | 8863603 |
| 1093 | 8019694004 | 8019687851 | Bacteria | 8712826 |
| 1094 | 8056695106 | 8056689827 | Bacteria | 6712655 |
| 1095 | 8056969923 | 8056967851 | Bacteria | 9038162 |
| 1096 | nmdc:mga0sz30_2522_c2 | |||
| 1097 | 2214911854 | |||
| 1098 | ARcpr5oldR_c000012 | |||
| 1099 | ARSoilYngRDRAFT_c00099 | |||
| 1100 | ARcpr5yngRDRAFT_c000214 | |||
| 1101 | ARSoilOldRDRAFT_c000006 | |||
| 1102 | ARCol0oldRDRAFT_c00072 | |||
| 1103 | ARCol0yngRDRAFT_1000024 | |||
| 1104 | JGI24032J14994_100446 | |||
| 1105 | JGI24736J21556_1004023 | |||
| 1106 | JGI24736J21556_1013778 | |||
| 1107 | JGI24746J21847_1000004 | |||
| 1108 | JGI24740J21852_10009185 | |||
| 1109 | JGI24740J21852_10011971 | |||
| 1110 | JGI24739J22299_10000221 | |||
| 1111 | JGI24739J22299_10003634 | |||
| 1112 | JGI24737J22298_10001028 | |||
| 1113 | JGI24737J22298_10001466 | |||
| 1114 | JGI24737J22298_10001696 | |||
| 1115 | JGI24737J22298_10008401 | |||
| 1116 | JGI24737J22298_10065115 | |||
| 1117 | JGI24743J22301_10000152 | |||
| 1118 | JGI24735J21928_10041745 | |||
| 1119 | JGI24750J21931_1000917 | |||
| 1120 | JGI24745J21846_1000053 | |||
| 1121 | JGI24748J21848_1000596 | |||
| 1122 | JGI24738J21930_10000058 | |||
| 1123 | JGI24738J21930_10027194 | |||
| 1124 | JGI24749J21850_1000249 | |||
| 1125 | JGI24749J21850_1003439 | |||
| 1126 | JGI24035J26624_1000075 | |||
| 1127 | JGI24033J26618_1000198 | |||
| 1128 | JGI24034J26672_10007459 | |||
| 1129 | JGI24742J22300_10000188 | |||
| 1130 | JGI24742J22300_10000399 | |||
| 1131 | JGI24751J29686_10003710 | |||
| 1132 | JGI25406J46586_10002605 | |||
| 1133 | JGI25153J46596_10002925 | |||
| 1134 | JGI25404J52841_10005249 | |||
| 1135 | JGI25405J52794_10001521 | |||
| 1136 | JGI25405J52794_10004316 | |||
| 1137 | Ga0065717_1002324 | |||
| 1138 | Ga0065716_1001675 | |||
| 1139 | Ga0065704_10113663 | |||
| 1140 | Ga0065712_10002185 | |||
| 1141 | Ga0065712_10011548 | |||
| 1142 | Ga0065712_10085453 | |||
| 1143 | Ga0065712_10093250 | |||
| 1144 | Ga0065715_10089737 | |||
| 1145 | Ga0065715_10091024 | |||
| 1146 | Ga0065715_10224033 | |||
| 1147 | Ga0065707_10090255 | |||
| 1148 | Ga0070658_10033742 | |||
| 1149 | Ga0070676_10000425 | |||
| 1150 | Ga0070676_10075394 | |||
| 1151 | Ga0070683_100000363 | |||
| 1152 | Ga0070683_100029418 | |||
| 1153 | Ga0070683_100085825 | |||
| 1154 | Ga0070690_100007589 | |||
| 1155 | Ga0070690_100036302 | |||
| 1156 | Ga0070690_100158730 | |||
| 1157 | Ga0070670_100074536 | |||
| 1158 | Ga0070670_100099748 | |||
| 1159 | Ga0070677_10000454 | |||
| 1160 | Ga0068869_100000203 | |||
| 1161 | Ga0068869_100036762 | |||
| 1162 | Ga0070666_10157831 | |||
| 1163 | Ga0070680_100015133 | |||
| 1164 | Ga0070680_100041121 | |||
| 1165 | Ga0070680_100097113 | |||
| 1166 | Ga0070682_100000328 | |||
| 1167 | Ga0068868_100538282 | |||
| 1168 | Ga0070660_100006935 | |||
| 1169 | Ga0070660_100023679 | |||
| 1170 | Ga0070660_100095121 | |||
| 1171 | Ga0070689_100008577 | |||
| 1172 | Ga0070689_100022900 | |||
| 1173 | Ga0070689_100087788 | |||
| 1174 | Ga0070691_10059636 | |||
| 1175 | Ga0070687_100000915 | |||
| 1176 | Ga0070687_100001008 | |||
| 1177 | Ga0070661_100005445 | |||
| 1178 | Ga0070692_10012884 | |||
| 1179 | Ga0070692_10030929 | |||
| 1180 | Ga0070668_100001452 | |||
| 1181 | Ga0070668_100001970 | |||
| 1182 | Ga0070668_100109141 | |||
| 1183 | Ga0070668_100369055 | |||
| 1184 | Ga0070669_100002674 | |||
| 1185 | Ga0070669_100003013 | |||
| 1186 | Ga0070669_100038147 | |||
| 1187 | Ga0070675_100000701 | |||
| 1188 | Ga0070675_100005532 | |||
| 1189 | Ga0070675_100026525 | |||
| 1190 | Ga0070671_100013070 | |||
| 1191 | Ga0070674_100000715 | |||
| 1192 | Ga0070674_100052938 | |||
| 1193 | Ga0070674_100210355 | |||
| 1194 | Ga0070673_100007600 | |||
| 1195 | Ga0070673_100320347 | |||
| 1196 | Ga0070688_100002137 | |||
| 1197 | Ga0070688_100031069 | |||
| 1198 | Ga0070688_100185897 | |||
| 1199 | Ga0070659_100000350 | |||
| 1200 | Ga0070659_100022386 | |||
| 1201 | Ga0070667_100002937 | |||
| 1202 | Ga0070667_100003352 | |||
| 1203 | Ga0070667_100127124 | |||
| 1204 | Ga0070703_10001493 | |||
| 1205 | Ga0070703_10016560 | |||
| 1206 | Ga0070709_10230963 | |||
| 1207 | Ga0070714_100153696 | |||
| 1208 | Ga0070714_100303960 | |||
| 1209 | Ga0070714_100346237 | |||
| 1210 | Ga0070713_100094913 | |||
| 1211 | Ga0070713_100343468 | |||
| 1212 | Ga0070710_10028612 | |||
| 1213 | Ga0070710_10039318 | |||
| 1214 | Ga0070701_10003358 | |||
| 1215 | Ga0070701_10016284 | |||
| 1216 | Ga0070711_100006095 | |||
| 1217 | Ga0070711_100030964 | |||
| 1218 | Ga0070711_100056134 | |||
| 1219 | Ga0070711_100078163 | |||
| 1220 | Ga0070705_100006049 | |||
| 1221 | Ga0070700_100009242 | |||
| 1222 | Ga0070700_100012827 | |||
| 1223 | Ga0070694_100006962 | |||
| 1224 | Ga0070694_100018454 | |||
| 1225 | Ga0070694_100210351 | |||
| 1226 | Ga0070708_100025760 | |||
| 1227 | Ga0070708_100138146 | |||
| 1228 | Ga0070708_100237766 | |||
| 1229 | Ga0070663_100001251 | |||
| 1230 | Ga0070663_100181379 | |||
| 1231 | Ga0070678_100000662 | |||
| 1232 | Ga0070678_100206569 | |||
| 1233 | Ga0070662_100001650 | |||
| 1234 | Ga0070662_100086690 | |||
| 1235 | Ga0070662_100166867 | |||
| 1236 | Ga0070681_10011538 | |||
| 1237 | Ga0070681_10122358 | |||
| 1238 | Ga0070681_10161762 | |||
| 1239 | Ga0070681_10189332 | |||
| 1240 | Ga0070681_10209531 | |||
| 1241 | Ga0068867_100000679 | |||
| 1242 | Ga0070685_10001744 | |||
| 1243 | Ga0070685_10021982 | |||
| 1244 | Ga0070706_100295831 | |||
| 1245 | Ga0070707_100002340 | |||
| 1246 | Ga0070698_100000476 | |||
| 1247 | Ga0070679_100000963 | |||
| 1248 | Ga0070679_100030571 | |||
| 1249 | Ga0070679_100121452 | |||
| 1250 | Ga0070679_100358036 | |||
| 1251 | Ga0070684_100000693 | |||
| 1252 | Ga0070684_100008128 | |||
| 1253 | Ga0070684_100155308 | |||
| 1254 | Ga0070697_100099620 | |||
| 1255 | Ga0068853_100010934 | |||
| 1256 | Ga0068853_100158061 | |||
| 1257 | Ga0068853_100179093 | |||
| 1258 | Ga0068853_100181525 | |||
| 1259 | Ga0070672_100000403 | |||
| 1260 | Ga0070672_100139942 | |||
| 1261 | Ga0070672_100208807 | |||
| 1262 | Ga0070686_100001759 | |||
| 1263 | Ga0070686_100013702 | |||
| 1264 | Ga0070695_100005593 | |||
| 1265 | Ga0070695_100018083 | |||
| 1266 | Ga0070696_100012376 | |||
| 1267 | Ga0070696_100015841 | |||
| 1268 | Ga0070693_100000031 | |||
| 1269 | Ga0070693_100065487 | |||
| 1270 | Ga0070704_100008423 | |||
| 1271 | Ga0070704_100022851 | |||
| 1272 | Ga0068855_100026306 | |||
| 1273 | Ga0068855_100207709 | |||
| 1274 | Ga0068855_100302568 | |||
| 1275 | Ga0070664_100004498 | |||
| 1276 | Ga0070664_100233082 | |||
| 1277 | Ga0068857_100007652 | |||
| 1278 | Ga0068857_100060044 | |||
| 1279 | Ga0068857_100124784 | |||
| 1280 | Ga0068857_100126180 | |||
| 1281 | Ga0068854_100001548 | |||
| 1282 | Ga0068854_100041518 | |||
| 1283 | Ga0068856_100006301 | |||
| 1284 | Ga0068856_100189710 | |||
| 1285 | Ga0068856_100195998 | |||
| 1286 | Ga0068856_100239630 | |||
| 1287 | Ga0070702_100000222 | |||
| 1288 | Ga0068852_100002780 | |||
| 1289 | Ga0068852_100012504 | |||
| 1290 | Ga0068859_100006131 | |||
| 1291 | Ga0068859_100041002 | |||
| 1292 | Ga0068859_100190389 | |||
| 1293 | Ga0068864_100000746 | |||
| 1294 | Ga0068864_100110396 | |||
| 1295 | Ga0068866_10000252 | |||
| 1296 | Ga0068861_100002529 | |||
| 1297 | Ga0068861_100101918 | |||
| 1298 | Ga0068851_10006094 | |||
| 1299 | Ga0068870_10000355 | |||
| 1300 | Ga0068863_100000150 | |||
| 1301 | Ga0068858_100005633 | |||
| 1302 | Ga0068858_100020291 | |||
| 1303 | Ga0068858_100290580 | |||
| 1304 | Ga0068860_100005002 | |||
| 1305 | Ga0068860_100026141 | |||
| 1306 | Ga0068860_100072103 | |||
| 1307 | Ga0068860_100250528 | |||
| 1308 | Ga0068862_100002000 | |||
| 1309 | Ga0068862_100030036 | |||
| 1310 | Ga0081455_10000185 | |||
| 1311 | Ga0081455_10021796 | |||
| 1312 | Ga0081540_1003091 | |||
| 1313 | Ga0081540_1003850 | |||
| 1314 | Ga0081540_1005107 | |||
| 1315 | Ga0081540_1009371 | |||
| 1316 | Ga0081540_1021357 | |||
| 1317 | Ga0081539_10001829 | |||
| 1318 | Ga0081539_10043867 | |||
| 1319 | Ga0070717_10064620 | |||
| 1320 | Ga0075365_10059842 | |||
| 1321 | Ga0075363_100070398 | |||
| 1322 | Ga0075363_100082851 | |||
| 1323 | Ga0075363_100186208 | |||
| 1324 | Ga0075364_10006374 | |||
| 1325 | Ga0070712_100140844 | |||
| 1326 | Ga0075362_10042011 | |||
| 1327 | Ga0075362_10052041 | |||
| 1328 | Ga0075367_10006879 | |||
| 1329 | Ga0075367_10061374 | |||
| 1330 | Ga0075367_10126797 | |||
| 1331 | Ga0075369_10083660 | |||
| 1332 | Ga0075366_10023757 | |||
| 1333 | Ga0097621_100000544 | |||
| 1334 | Ga0075370_10035636 | |||
| 1335 | Ga0075370_10055514 | |||
| 1336 | Ga0075370_10231294 | |||
| 1337 | Ga0068871_100000512 | |||
| 1338 | Ga0075428_100159543 | |||
| 1339 | Ga0075428_100220351 | |||
| 1340 | Ga0075430_100268576 | |||
| 1341 | Ga0075430_100451549 | |||
| 1342 | Ga0075431_100132466 | |||
| 1343 | Ga0075433_10042184 | |||
| 1344 | Ga0075433_10055682 | |||
| 1345 | Ga0075434_100014347 | |||
| 1346 | Ga0075434_100076189 | |||
| 1347 | Ga0068865_100000085 | |||
| 1348 | Ga0068865_100176544 | |||
| 1349 | Ga0097620_100006131 | |||
| 1350 | Ga0097620_100041002 | |||
| 1351 | Ga0097620_100190380 | |||
| 1352 | Ga0099825_1024777 | |||
| 1353 | Ga0099825_1039567 | |||
| 1354 | Ga0099824_1003225 | |||
| 1355 | Ga0099822_1005628 | |||
| 1356 | Ga0099823_1076552 | |||
| 1357 | Ga0099795_10023051 | |||
| 1358 | Ga0105244_10013947 | |||
| 1359 | Ga0105240_10014565 | |||
| 1360 | Ga0105240_10022233 | |||
| 1361 | Ga0105240_10035302 | |||
| 1362 | Ga0105240_10136986 | |||
| 1363 | Ga0105240_10396752 | |||
| 1364 | Ga0105240_10767016 | |||
| 1365 | Ga0111539_10003892 | |||
| 1366 | Ga0111539_10007488 | |||
| 1367 | Ga0111539_10095217 | |||
| 1368 | Ga0111539_11225340 | |||
| 1369 | Ga0105245_10000235 | |||
| 1370 | Ga0105247_10004099 | |||
| 1371 | Ga0105247_10082721 | |||
| 1372 | Ga0114129_10062929 | |||
| 1373 | Ga0105243_10000699 | |||
| 1374 | Ga0105243_10004332 | |||
| 1375 | Ga0105241_10002051 | |||
| 1376 | Ga0105241_10013209 | |||
| 1377 | Ga0105241_10029810 | |||
| 1378 | Ga0105242_10000134 | |||
| 1379 | Ga0105248_10005592 | |||
| 1380 | Ga0105248_10071872 | |||
| 1381 | Ga0105237_10004158 | |||
| 1382 | Ga0105237_10015363 | |||
| 1383 | Ga0105237_10039663 | |||
| 1384 | Ga0105237_10087159 | |||
| 1385 | Ga0105237_10377112 | |||
| 1386 | Ga0105237_10494275 | |||
| 1387 | Ga0105238_10005587 | |||
| 1388 | Ga0105238_10398272 | |||
| 1389 | Ga0105249_10000325 | |||
| 1390 | Ga0105249_10003708 | |||
| 1391 | Ga0105249_10147991 | |||
| 1392 | Ga0099796_10006501 | |||
| 1393 | Ga0105239_10015503 | |||
| 1394 | Ga0105239_10018609 | |||
| 1395 | Ga0105239_10026934 | |||
| 1396 | Ga0105239_10132469 | |||
| 1397 | Ga0105239_10606301 | |||
| 1398 | Ga0105239_10689771 | |||
| 1399 | Ga0105246_10000041 | |||
| 1400 | Ga0105246_10106021 | |||
| 1401 | Ga0157329_1000654 | |||
| 1402 | Ga0157373_10029849 | |||
| 1403 | Ga0157370_10117537 | |||
| 1404 | Ga0157370_10687958 | |||
| 1405 | Ga0157369_10058666 | |||
| 1406 | Ga0157369_10139062 | |||
| 1407 | Ga0157369_10433749 | |||
| 1408 | Ga0157374_10004647 | |||
| 1409 | Ga0157378_10000434 | |||
| 1410 | Ga0157378_10387741 | |||
| 1411 | Ga0163162_10000973 | |||
| 1412 | Ga0163162_10008401 | |||
| 1413 | Ga0157372_10026570 | |||
| 1414 | Ga0157375_10000181 | |||
| 1415 | Ga0157375_10024009 | |||
| 1416 | Ga0163163_10005840 | |||
| 1417 | Ga0157380_10000049 | |||
| 1418 | Ga0157380_10078389 | |||
| 1419 | Ga0157377_10003889 | |||
| 1420 | Ga0157379_10015146 | |||
| 1421 | Ga0157379_10046331 | |||
| 1422 | Ga0157376_10000142 | |||
| 1423 | Ga0163161_10000081 | |||
| 1424 | Ga0213872_10015785 | |||
| 1425 | Ga0213872_10034986 | |||
| 1426 | Ga0213876_10111209 | |||
| 1427 | Ga0213875_10026325 | |||
| 1428 | Ga0224712_10030894 | |||
| 1429 | Ga0209563_100927 | |||
| 1430 | Ga0209677_101109 | |||
| 1431 | Ga0209148_1000250 | |||
| 1432 | Ga0207666_1000299 | |||
| 1433 | Ga0207666_1000533 | |||
| 1434 | Ga0207666_1001484 | |||
| 1435 | Ga0209455_1003028 | |||
| 1436 | Ga0207673_1000059 | |||
| 1437 | Ga0207673_1008504 | |||
| 1438 | Ga0209758_1000324 | |||
| 1439 | Ga0209758_1003697 | |||
| 1440 | Ga0209050_1010239 | |||
| 1441 | Ga0209050_1021379 | |||
| 1442 | Ga0209257_1017678 | |||
| 1443 | Ga0207697_10000045 | |||
| 1444 | Ga0207697_10051041 | |||
| 1445 | Ga0207697_10055013 | |||
| 1446 | Ga0207697_10062771 | |||
| 1447 | Ga0207653_10002120 | |||
| 1448 | Ga0207653_10052775 | |||
| 1449 | Ga0207682_10000046 | |||
| 1450 | Ga0207692_10058031 | |||
| 1451 | Ga0207642_10001337 | |||
| 1452 | Ga0207710_10026906 | |||
| 1453 | Ga0207688_10001093 | |||
| 1454 | Ga0207688_10003856 | |||
| 1455 | Ga0207680_10032025 | |||
| 1456 | Ga0207647_10003053 | |||
| 1457 | Ga0207647_10004820 | |||
| 1458 | Ga0207647_10005779 | |||
| 1459 | Ga0207647_10021233 | |||
| 1460 | Ga0207647_10077094 | |||
| 1461 | Ga0207645_10000275 | |||
| 1462 | Ga0207645_10000660 | |||
| 1463 | Ga0207645_10076803 | |||
| 1464 | Ga0207643_10000025 | |||
| 1465 | Ga0207705_10042352 | |||
| 1466 | Ga0207684_10280909 | |||
| 1467 | Ga0207654_10000936 | |||
| 1468 | Ga0207654_10006602 | |||
| 1469 | Ga0207707_10003161 | |||
| 1470 | Ga0207707_10003472 | |||
| 1471 | Ga0207707_10112695 | |||
| 1472 | Ga0207707_10144059 | |||
| 1473 | Ga0207707_10154879 | |||
| 1474 | Ga0207695_10000062 | |||
| 1475 | Ga0207695_10000497 | |||
| 1476 | Ga0207695_10049534 | |||
| 1477 | Ga0207695_10149619 | |||
| 1478 | Ga0207695_10231601 | |||
| 1479 | Ga0207695_10273296 | |||
| 1480 | Ga0207671_10031326 | |||
| 1481 | Ga0207671_10059362 | |||
| 1482 | Ga0207671_10078747 | |||
| 1483 | Ga0207671_10245325 | |||
| 1484 | Ga0207693_10022068 | |||
| 1485 | Ga0207693_10176565 | |||
| 1486 | Ga0207663_10042485 | |||
| 1487 | Ga0207663_10053001 | |||
| 1488 | Ga0207663_10105254 | |||
| 1489 | Ga0207660_10000131 | |||
| 1490 | Ga0207660_10032857 | |||
| 1491 | Ga0207660_10065575 | |||
| 1492 | Ga0207660_10077988 | |||
| 1493 | Ga0207662_10000657 | |||
| 1494 | Ga0207662_10004565 | |||
| 1495 | Ga0207662_10010788 | |||
| 1496 | Ga0207662_10021581 | |||
| 1497 | Ga0207657_10020330 | |||
| 1498 | Ga0207657_10104039 | |||
| 1499 | Ga0207649_10000048 | |||
| 1500 | Ga0207649_10208564 | |||
| 1501 | Ga0207652_10012172 | |||
| 1502 | Ga0207652_10037233 | |||
| 1503 | Ga0207652_10042364 | |||
| 1504 | Ga0207646_10028080 | |||
| 1505 | Ga0207681_10000131 | |||
| 1506 | Ga0207694_10000758 | |||
| 1507 | Ga0207694_10104829 | |||
| 1508 | Ga0207694_10123547 | |||
| 1509 | Ga0207650_10029200 | |||
| 1510 | Ga0207650_10050251 | |||
| 1511 | Ga0207650_10136739 | |||
| 1512 | Ga0207650_10160432 | |||
| 1513 | Ga0207659_10000040 | |||
| 1514 | Ga0207659_10005182 | |||
| 1515 | Ga0207659_10096906 | |||
| 1516 | Ga0207687_10000122 | |||
| 1517 | Ga0207700_10138396 | |||
| 1518 | Ga0207700_10184105 | |||
| 1519 | Ga0207664_10091123 | |||
| 1520 | Ga0207644_10002729 | |||
| 1521 | Ga0207690_10000512 | |||
| 1522 | Ga0207690_10068525 | |||
| 1523 | Ga0207706_10000311 | |||
| 1524 | Ga0207706_10000535 | |||
| 1525 | Ga0207706_10061527 | |||
| 1526 | Ga0207706_10177652 | |||
| 1527 | Ga0207686_10000377 | |||
| 1528 | Ga0207709_10000585 | |||
| 1529 | Ga0207709_10087871 | |||
| 1530 | Ga0207670_10006912 | |||
| 1531 | Ga0207670_10017549 | |||
| 1532 | Ga0207670_10162598 | |||
| 1533 | Ga0207670_10189711 | |||
| 1534 | Ga0207669_10000102 | |||
| 1535 | Ga0207669_10090364 | |||
| 1536 | Ga0207669_10205131 | |||
| 1537 | Ga0207669_10236277 | |||
| 1538 | Ga0207704_10000071 | |||
| 1539 | Ga0207704_10126595 | |||
| 1540 | Ga0207665_10096749 | |||
| 1541 | Ga0207665_10183292 | |||
| 1542 | Ga0207691_10000257 | |||
| 1543 | Ga0207711_10000847 | |||
| 1544 | Ga0207689_10000134 | |||
| 1545 | Ga0207689_10055501 | |||
| 1546 | Ga0207661_10000204 | |||
| 1547 | Ga0207661_10002220 | |||
| 1548 | Ga0207679_10000090 | |||
| 1549 | Ga0207679_10243649 | |||
| 1550 | Ga0207667_10013081 | |||
| 1551 | Ga0207667_10141238 | |||
| 1552 | Ga0207667_10209765 | |||
| 1553 | Ga0207667_10492247 | |||
| 1554 | Ga0207651_10000017 | |||
| 1555 | Ga0207712_10000114 | |||
| 1556 | Ga0207668_10000139 | |||
| 1557 | Ga0207668_10438672 | |||
| 1558 | Ga0207640_10000221 | |||
| 1559 | Ga0207640_10037391 | |||
| 1560 | Ga0207640_10045732 | |||
| 1561 | Ga0207640_10218038 | |||
| 1562 | Ga0207658_10001766 | |||
| 1563 | Ga0207658_10004653 | |||
| 1564 | Ga0207658_10041453 | |||
| 1565 | Ga0207677_10000989 | |||
| 1566 | Ga0207677_10016104 | |||
| 1567 | Ga0207703_10001230 | |||
| 1568 | Ga0207703_10410850 | |||
| 1569 | Ga0207639_10004381 | |||
| 1570 | Ga0207639_10011092 | |||
| 1571 | Ga0207639_10018076 | |||
| 1572 | Ga0207639_10046610 | |||
| 1573 | Ga0207639_10194950 | |||
| 1574 | Ga0207639_10230685 | |||
| 1575 | Ga0207639_10289028 | |||
| 1576 | Ga0207639_10328878 | |||
| 1577 | Ga0207678_10000131 | |||
| 1578 | Ga0207678_10049697 | |||
| 1579 | Ga0207708_10000192 | |||
| 1580 | Ga0207708_10013145 | |||
| 1581 | Ga0207702_10000198 | |||
| 1582 | Ga0207702_10000429 | |||
| 1583 | Ga0207702_10030049 | |||
| 1584 | Ga0207702_10271425 | |||
| 1585 | Ga0207702_10384921 | |||
| 1586 | Ga0207641_10000246 | |||
| 1587 | Ga0207648_10000483 | |||
| 1588 | Ga0207676_10000372 | |||
| 1589 | Ga0207674_10000355 | |||
| 1590 | Ga0207674_10077004 | |||
| 1591 | Ga0207674_10078457 | |||
| 1592 | Ga0207674_10346519 | |||
| 1593 | Ga0207674_10416117 | |||
| 1594 | Ga0207675_100001557 | |||
| 1595 | Ga0207675_100041544 | |||
| 1596 | Ga0207675_100359745 | |||
| 1597 | Ga0207683_10000512 | |||
| 1598 | Ga0207683_10243077 | |||
| 1599 | Ga0207698_10000524 | |||
| 1600 | Ga0207698_10033426 | |||
| 1601 | Ga0207698_10166053 | |||
| 1602 | Ga0207698_10186437 | |||
| 1603 | Ga0209389_1000004 | |||
| 1604 | Ga0209589_1000006 | |||
| 1605 | Ga0209489_100007 | |||
| 1606 | Ga0209489_110994 | |||
| 1607 | Ga0209700_100008 | |||
| 1608 | Ga0209700_100013 | |||
| 1609 | Ga0209967_1004113 | |||
| 1610 | Ga0209995_1014821 | |||
| 1611 | Ga0209179_1036707 | |||
| 1612 | Ga0210002_1006376 | |||
| 1613 | Ga0210002_1006862 | |||
| 1614 | Ga0209971_1008153 | |||
| 1615 | Ga0209966_1000755 | |||
| 1616 | Ga0209998_10000745 | |||
| 1617 | Ga0209998_10002909 | |||
| 1618 | Ga0209998_10023153 | |||
| 1619 | Ga0209813_10093960 | |||
| 1620 | Ga0209974_10000322 | |||
| 1621 | Ga0207428_10000469 | |||
| 1622 | Ga0207428_10000620 | |||
| 1623 | Ga0268266_10083892 | |||
| 1624 | Ga0268265_10000312 | |||
| 1625 | Ga0268265_10017513 | |||
| 1626 | Ga0268265_10124352 | |||
| 1627 | Ga0268264_10000412 | |||
| 1628 | Ga0265318_10073182 | |||
| 1629 | Ga0307515_10186368 | |||
| 1630 | Ga0265330_10056436 | |||
| 1631 | Ga0265332_10007214 | |||
| 1632 | Ga0265328_10046998 | |||
| 1633 | Ga0265320_10090403 | |||
| 1634 | Ga0265329_10044501 | |||
| 1635 | Ga0265340_10002649 | |||
| 1636 | Ga0265339_10056559 | |||
| 1637 | Ga0307513_10092853 | |||
| 1638 | Ga0307513_10103826 | |||
| 1639 | Ga0265314_10165424 | |||
| 1640 | Ga0265342_10054429 | |||
| 1641 | Ga0265342_10101486 | |||
| 1642 | Ga0307411_10002397 | |||
| 1643 | Ga0307415_100641747 | |||
| 1644 | Ga0307510_10035420 | |||
| 1645 | Ga0315911_1000010 | |||
| 1646 | Ga0373930_0000607 | |||
| 1647 | Ga0373948_0006398 | |||
| 1648 | Ga0373948_0016087 | |||
| 1649 | Ga0373950_0000494 | |||
| 1650 | Ga0373959_0000816 | |||
| 1651 | Ga0373938_0001237 | |||
| 1652 | Ga0373938_0001518 | |||
| 1653 | Ga0373926_0012416 | |||
| 1654 | Ga0373926_0128288 | |||
| 1655 | Ga0373928_0000480 | |||
| 1656 | Ga0373928_0010355 | |||
| 1657 | Ga0373929_0000533 | |||
| 1658 | Ga0373929_0002287 | |||
| 1659 | Ga0373940_0000021 | |||
| 1660 | Ga0373949_0001106 | |||
| 1661 | Ga0373949_0001635 | |||
| 1662 | Ga0373951_0000265 | |||
| 1663 | Ga0373952_0000780 | |||
| 1664 | Ga0373952_0007564 | |||
| 1665 | Ga0373923_0017091 | |||
| 1666 | Ga0373923_0019644 | |||
| 1667 | Ga0373932_0000344 | |||
| 1668 | Ga0373932_0001592 | |||
| 1669 | Ga0373936_0044806 | |||
| 1670 | Ga0373939_0001562 | |||
| 1671 | Ga0373939_0001966 | |||
| 1672 | Ga0373941_0000384 | |||
| 1673 | Ga0373941_0001070 | |||
| 1674 | Ga0373945_0011141 | |||
| 1675 | Ga0373953_0001358 | |||
| 1676 | Ga0373954_0001778 | |||
| 1677 | Ga0373954_0008905 | |||
| 1678 | Ga0373954_0043332 | |||
| 1679 | Ga0373956_0005729 | |||
| 1680 | Ga0373956_0037017 | |||
| 1681 | Ga0373957_0002644 | |||
| 1682 | Ga0373957_0022163 | |||
| 1683 | Ga0373960_0000884 | |||
| 1684 | Ga0373960_0007664 | |||
| 1685 | Ga0373943_0001649 | |||
| 1686 | Ga0373943_0224804 | |||
| 1687 | Ga0373955_0001783 | |||
| 1688 | Ga0373955_0016407 | |||
| 1689 | Ga0373942_0000448 | |||
| 1690 | Ga0373961_0000304 | |||
| 1691 | Ga0373961_0002376 | |||
| 1692 | Ga0373961_0037845 | |||
| 1693 | Ga0373962_0000142 | |||
| 1694 | Ga0373962_0002870 | |||
| 1695 | Ga0373924_0005305 | |||
| 1696 | Ga0373931_0000765 | |||
| 1697 | Ga0373935_0059381 | |||
| 1698 | Ga0373927_0124399 | |||
| 1699 | Ga0373933_0001908 | |||
| 1700 | Ga0373933_0032897 | |||
| 1701 | Ga0373947_0025743 | |||
| 1702 | Ga0373937_0015839 | |||
| 1703 | Ga0373937_0024376 | |||
| 1704 | Ga0373925_0008127 | |||
| 1705 | Ga0373925_0027997 | |||
| 1706 | Ga0373925_0029762 | |||
| 1707 | Ga0373925_0418801 | |||
| 1708 | Ga0395899_0014921 | |||
| 1709 | Ga0395900_0001847 | |||
| 1710 | Ga0395900_0440081 | |||
| 1711 | Ga0395898_0025845 | |||
| 1712 | Ga0395898_0078787 | |||
| 1713 | Ga0395898_0093054 | |||
| 1714 | Ga0395905_0009298 | |||
| 1715 | Ga0395905_0020314 | |||
| 1716 | Ga0436364_0200421 | |||
| 1717 | Ga0436364_0631135 | |||
| 1718 | Ga0436364_0886281 | |||
| 1719 | Ga0436364_1085296 | |||
| 1720 | Ga0436364_1097852 | |||
| 1721 | Ga0395901_0184972 | |||
| 1722 | Ga0395901_0459164 | |||
| 1723 | Ga0242420_001691 | |||
| 1724 | Ga0436365_0145779 | |||
| 1725 | Ga0436365_0716278 | |||
| 1726 | Ga0436365_0717201 | |||
| 1727 | Ga0436365_1229627 | |||
| 1728 | Ga0436365_1502264 | |||
| 1729 | Ga0436365_1873778 | |||
| 1730 | Ga0436360_0232803 | |||
| 1731 | Ga0436361_0126747 | |||
| 1732 | Ga0436361_0289886 | |||
| 1733 | Ga0436361_0788579 | |||
| 1734 | Ga0436361_1033613 | |||
| 1735 | Ga0436361_1036871 | |||
| 1736 | Ga0436363_0236352 | |||
| 1737 | Ga0436363_0483910 | |||
| 1738 | Ga0436363_1253812 | |||
| 1739 | Ga0436362_0156760 | |||
| 1740 | Ga0436362_0598074 | |||
| 1741 | Ga0451853_0822473 | |||
| 1742 | Ga0439441_017413 | |||
| 1743 | Ga0439448_0017865 | |||
| 1744 | Ga0439450_042108 | |||
| 1745 | Ga0439460_0010215 | |||
| 1746 | Ga0439460_0034429 | |||
| 1747 | Ga0466972_0000884 | |||
| 1748 | Ga0466972_0021802 | |||
| 1749 | Ga0466982_0076205 | |||
| 1750 | Ga0466965_0006331 | |||
| 1751 | Ga0466966_0000419 | |||
| 1752 | Ga0466961_0000020 | |||
| 1753 | Ga0466963_0023644 | |||
| 1754 | Ga0466964_0106297 | |||
| 1755 | Ga0453684_0006867 | |||
| 1756 | Ga0453684_0166774 | |||
| 1757 | Ga0453684_0533526 | |||
| 1758 | Ga0466957_0075107 | |||
| 1759 | Ga0466959_0013508 | |||
| 1760 | Ga0451576_0007172 | |||
| 1761 | Ga0451576_0021200 | |||
| 1762 | Ga0451576_0030425 | |||
| 1763 | Ga0451576_0107387 | |||
| 1764 | Ga0466967_0034124 | |||
| 1765 | Ga0495592_0005568 | |||
| 1766 | Ga0495603_0029732 | |||
| 1767 | Ga0495603_0039583 | |||
| 1768 | Ga0495629_0000922 | |||
| 1769 | Ga0495629_0001285 | |||
| 1770 | Ga0495629_0044327 | |||
| 1771 | Ga0495629_0136206 | |||
| 1772 | Ga0495638_0000003 | |||
| 1773 | Ga0495638_0005101 | |||
| 1774 | Ga0495641_0201879 | |||
| 1775 | Ga0495651_0019485 | |||
| 1776 | Ga0495651_0269106 | |||
| 1777 | Ga0495653_0004517 | |||
| 1778 | Ga0495653_0312506 | |||
| 1779 | Ga0495580_0014157 | |||
| 1780 | Ga0495582_0010213 | |||
| 1781 | Ga0495582_0027896 | |||
| 1782 | Ga0495639_0012054 | |||
| 1783 | Ga0495662_0107376 | |||
| 1784 | Ga0495664_0045546 | |||
| 1785 | Ga0495607_0157454 | |||
| 1786 | Ga0495606_0073214 | |||
| 1787 | Ga0495606_0145265 | |||
| 1788 | Ga0495608_0035885 | |||
| 1789 | Ga0495618_0130222 | |||
| 1790 | Ga0495628_0017379 | |||
| 1791 | Ga0495628_0030476 | |||
| 1792 | Ga0495630_0254695 | |||
| 1793 | Ga0495632_0154696 | |||
| 1794 | Ga0495643_0063902 | |||
| 1795 | Ga0495648_0016592 | |||
| 1796 | Ga0495652_0003125 | |||
| 1797 | Ga0495652_0025506 | |||
| 1798 | Ga0495652_0121345 | |||
| 1799 | Ga0495652_0198134 | |||
| 1800 | Ga0495665_0032194 | |||
| 1801 | Ga0495640_0054173 | |||
| 1802 | Ga0495586_0035255 | |||
| 1803 | Ga0495587_0013911 | |||
| 1804 | Ga0495622_0018941 | |||
| 1805 | Ga0495667_0007856 | |||
| 1806 | Ga0495656_0117874 | |||
| 1807 | Ga0495668_0024294 | |||
| 1808 | Ga0495668_0027247 | |||
| 1809 | Ga0495634_0010895 | |||
| 1810 | Ga0495634_0053940 | |||
| 1811 | Ga0495634_0082401 | |||
| 1812 | Ga0495635_0002149 | |||
| 1813 | Ga0495635_0014588 | |||
| 1814 | Ga0495635_0106601 | |||
| 1815 | Ga0495657_0006772 | |||
| 1816 | Ga0495657_0026686 | |||
| 1817 | Ga0495599_0001827 | |||
| 1818 | Ga0495599_0009838 | |||
| 1819 | Ga0495599_0146659 | |||
| 1820 | Ga0495623_0093506 | |||
| 1821 | Ga0495646_0030846 | |||
| 1822 | Ga0495658_0002947 | |||
| 1823 | Ga0495658_0092947 | |||
| 1824 | Ga0495669_0155818 | |||
| 1825 | Ga0495613_0019718 | |||
| 1826 | Ga0495613_0072027 | |||
| 1827 | Ga0495600_0004830 | |||
| 1828 | Ga0495600_0006396 | |||
| 1829 | Ga0495600_0021619 | |||
| 1830 | Ga0495660_0032799 | |||
| 1831 | Ga0495581_0022831 | |||
| 1832 | Ga0495581_0080469 | |||
| 1833 | Ga0495581_0229750 | |||
| 1834 | Ga0495581_0311969 | |||
| 1835 | Ga0495604_0005881 | |||
| 1836 | Ga0495604_0026610 | |||
| 1837 | Ga0495604_0241652 | |||
| 1838 | Ga0495674_0060932 | |||
| 1839 | Ga0495676_0013885 | |||
| 1840 | Ga0495680_0009327 | |||
| 1841 | Ga0495680_0010422 | |||
| 1842 | Ga0495675_0008213 | |||
| 1843 | Ga0495684_0026359 | |||
| 1844 | Ga0495686_0172301 | |||
| 1845 | Ga0495593_0008299 | |||
| 1846 | Ga0495593_0113638 | |||
| 1847 | Ga0495602_0011154 | |||
| 1848 | Ga0495602_0017078 | |||
| 1849 | Ga0495602_0054855 | |||
| 1850 | Ga0495614_0219656 | |||
| 1851 | Ga0496100_0000665 | |||
| 1852 | Ga0496100_0001217 | |||
| 1853 | Ga0496100_0141112 | |||
| 1854 | Ga0496100_0238641 | |||
| 1855 | Ga0496101_0000632 | |||
| 1856 | Ga0496101_0059329 | |||
| 1857 | Ga0496101_0336987 | |||
| 1858 | Ga0496102_0004162 | |||
| 1859 | Ga0496102_0017659 | |||
| 1860 | Ga0496102_0114643 | |||
| 1861 | Ga0496102_0146928 | |||
| 1862 | Ga0496102_0427438 | |||
| 1863 | Ga0496102_0438213 | |||
| 1864 | Ga0496103_0000817 | |||
| 1865 | Ga0496103_0011670 | |||
| 1866 | Ga0496103_0025961 | |||
| 1867 | Ga0496104_0018347 | |||
| 1868 | Ga0496104_0024478 | |||
| 1869 | Ga0496104_0120022 | |||
| 1870 | Ga0496104_0232974 | |||
| 1871 | Ga0496104_0471788 | |||
| 1872 | Ga0496105_0002948 | |||
| 1873 | Ga0496105_0007938 | |||
| 1874 | Ga0496106_0000317 | |||
| 1875 | Ga0496106_0091319 | |||
| 1876 | Ga0496107_0001599 | |||
| 1877 | Ga0496107_0017437 | |||
| 1878 | Ga0496107_0029320 | |||
| 1879 | Ga0496107_0073404 | |||
| 1880 | Ga0496108_0004872 | |||
| 1881 | Ga0496108_0007088 | |||
| 1882 | Ga0496108_0013558 | |||
| 1883 | Ga0496108_0015960 | |||
| 1884 | Ga0496108_0027428 | |||
| 1885 | Ga0496108_0301516 | |||
| 1886 | Ga0496109_0000725 | |||
| 1887 | Ga0496109_0001051 | |||
| 1888 | Ga0496109_0002705 | |||
| 1889 | Ga0496109_0012545 | |||
| 1890 | Ga0496109_0131303 | |||
| 1891 | Ga0496109_0164819 | |||
| 1892 | Ga0496110_0005265 | |||
| 1893 | Ga0496110_0038059 | |||
| 1894 | Ga0496110_0077803 | |||
| 1895 | Ga0496110_0152536 | |||
| 1896 | Ga0496111_0004834 | |||
| 1897 | Ga0496111_0060637 | |||
| 1898 | Ga0496111_0087114 | |||
| 1899 | Ga0496111_0148221 | |||
| 1900 | Ga0496112_0006906 | |||
| 1901 | Ga0496112_0010729 | |||
| 1902 | Ga0496112_0017849 | |||
| 1903 | Ga0496112_0021305 | |||
| 1904 | Ga0496112_0028407 | |||
| 1905 | Ga0496112_0028731 | |||
| 1906 | Ga0496112_0482256 | |||
| 1907 | Ga0496113_0012244 | |||
| 1908 | Ga0496113_0013905 | |||
| 1909 | Ga0496113_0026033 | |||
| 1910 | Ga0496113_0340709 | |||
| 1911 | Ga0496114_0126618 | |||
| 1912 | Ga0496115_0001870 | |||
| 1913 | Ga0496115_0002384 | |||
| 1914 | Ga0496115_0035897 | |||
| 1915 | Ga0496115_0036422 | |||
| 1916 | Ga0496115_0108901 | |||
| 1917 | Ga0496119_0035832 | |||
| 1918 | Ga0496119_0045480 | |||
| 1919 | Ga0496121_0125915 | |||
| 1920 | Ga0496125_0147617 | |||
| 1921 | Ga0496126_0007204 | |||
| 1922 | Ga0496126_0007639 | |||
| 1923 | Ga0496126_0026387 | |||
| 1924 | Ga0496126_0034270 | |||
| 1925 | Ga0496126_0125608 | |||
| 1926 | Ga0501031_0005435 | |||
| 1927 | Ga0501032_0042416 | |||
| 1928 | Ga0501033_0020163 | |||
| 1929 | Ga0501033_0437845 | |||
| 1930 | Ga0501034_0000197 | |||
| 1931 | Ga0501034_0030864 | |||
| 1932 | Ga0501034_0260955 | |||
| 1933 | Ga0501034_0342148 | |||
| 1934 | Ga0501036_0033337 | |||
| 1935 | Ga0501036_0039959 | |||
| 1936 | Ga0501036_0053248 | |||
| 1937 | Ga0501037_0018838 | |||
| 1938 | Ga0501038_0007936 | |||
| 1939 | Ga0501038_0039210 | |||
| 1940 | Ga0501038_0092679 | |||
| 1941 | Ga0501039_0023632 | |||
| 1942 | Ga0501039_0034420 | |||
| 1943 | Ga0501039_0113260 | |||
| 1944 | Ga0501039_0249298 | |||
| 1945 | Ga0501040_0120331 | |||
| 1946 | Ga0501041_0240327 | |||
| 1947 | Ga0501042_0155451 | |||
| 1948 | Ga0501042_0410507 | |||
| 1949 | Ga0501043_0006548 | |||
| 1950 | Ga0501043_0029976 | |||
| 1951 | Ga0501043_0070381 | |||
| 1952 | Ga0501046_0009112 | |||
| 1953 | Ga0501046_0055460 | |||
| 1954 | Ga0501046_0194485 | |||
| 1955 | Ga0501047_0011383 | |||
| 1956 | Ga0501047_0016856 | |||
| 1957 | Ga0501047_0021447 | |||
| 1958 | Ga0501047_0380131 | |||
| 1959 | Ga0501048_0355364 | |||
| 1960 | Ga0501068_0257252 | |||
| 1961 | Ga0501069_0235170 | |||
| 1962 | Ga0501070_0009868 | |||
| 1963 | Ga0501070_0016140 | |||
| 1964 | Ga0501070_0021109 | |||
| 1965 | Ga0501070_0039121 | |||
| 1966 | Ga0501072_0007366 | |||
| 1967 | Ga0501072_0011676 | |||
| 1968 | Ga0501073_0018856 | |||
| 1969 | Ga0501073_0098901 | |||
| 1970 | Ga0501074_0057588 | |||
| 1971 | Ga0501074_0356802 | |||
| 1972 | Ga0501075_0111860 | |||
| 1973 | Ga0501075_0232452 | |||
| 1974 | Ga0501077_0034959 | |||
| 1975 | Ga0501257_003693 | |||
| 1976 | Ga0501080_0005257 | |||
| 1977 | Ga0501080_0052803 | |||
| 1978 | Ga0501080_0347091 | |||
| 1979 | Ga0501081_0113221 | |||
| 1980 | Ga0501083_0045819 | |||
| 1981 | Ga0501083_0117029 | |||
| 1982 | Ga0501083_0127241 | |||
| 1983 | Ga0501035_0059772 | |||
| 1984 | Ga0501035_0145532 | |||
| 1985 | Ga0501035_0289833 | |||
| 1986 | Ga0501044_0069413 | |||
| 1987 | Ga0501044_0103929 | |||
| 1988 | Ga0501044_0113041 | |||
| 1989 | Ga0501044_0204011 | |||
| 1990 | Ga0501044_0241569 | |||
| 1991 | Ga0501044_0383839 | |||
| 1992 | Ga0501045_0258735 | |||
| 1993 | nmdc:mga03683_83698_c1 | |||
| 1994 | nmdc:mga03n38_114762_c1 | |||
| 1995 | nmdc:mga03n38_173054_c1 | |||
| 1996 | nmdc:mga03n38_22949_c1 | |||
| 1997 | nmdc:mga0yw44_120427_c1 | |||
| 1998 | nmdc:mga0yw44_80059_c1 | |||
| 1999 | nmdc:mga06z11_13813_c1 | |||
| 2000 | nmdc:mga06z11_237388_c1 | |||
| 2001 | nmdc:mga04h51_3033_c1 | |||
| 2002 | nmdc:mga07m45_13195_c2 | |||
| 2003 | nmdc:mga07m45_300923_c1 | |||
| 2004 | nmdc:mga05p37_863312_c1 | |||
| 2005 | nmdc:mga05p37_9789_c1 | |||
| 2006 | nmdc:mga09592_26028_c1 | |||
| 2007 | nmdc:mga06r32_16557_c1 | |||
| 2008 | nmdc:mga08y16_128082_c1 | |||
| 2009 | nmdc:mga08y16_2535_c1 | |||
| 2010 | nmdc:mga08y16_978_c1 | |||
| 2011 | nmdc:mga0n895_108203_c1 | |||
| 2012 | nmdc:mga0n895_12117_c1 | |||
| 2013 | nmdc:mga0rr50_50740_c1 | |||
| 2014 | nmdc:mga08x19_27831_c1 | |||
| 2015 | nmdc:mga0a205_41963_c1 | |||
| 2016 | nmdc:mga0a205_43028_c1 | |||
| 2017 | Ga0495601_0042585 | |||
| 2018 | Ga0500610_0089540 | |||
| 2019 | Ga0495595_0003401 | |||
| 2020 | Ga0495619_0011847 | |||
| 2021 | Ga0500643_002019 | |||
| 2022 | Ga0500583_0006517 | |||
| 2023 | Ga0500566_0000008 | |||
| 2024 | Ga0500566_0044788 | |||
| 2025 | Ga0500566_0088477 | |||
| 2026 | Ga0500640_000659 | |||
| 2027 | Ga0500641_0003076 | |||
| 2028 | Ga0500641_0006207 | |||
| 2029 | Ga0500641_0039798 | |||
| 2030 | Ga0500641_0079215 | |||
| 2031 | Ga0500557_000008 | |||
| 2032 | Ga0500572_001833 | |||
| 2033 | Ga0500595_002758 | |||
| 2034 | Ga0500607_092703 | |||
| 2035 | Ga0500608_060510 | |||
| 2036 | Ga0500614_002412 | |||
| 2037 | Ga0500642_0000425 | |||
| 2038 | Ga0500655_003943 | |||
| 2039 | Ga0500658_0022985 | |||
| 2040 | Ga0500559_0005921 | |||
| 2041 | Ga0500603_002982 | |||
| 2042 | Ga0500603_011313 | |||
| 2043 | Ga0500604_0133361 | |||
| 2044 | Ga0500616_0000007 | |||
| 2045 | Ga0500619_015230 | |||
| 2046 | Ga0500622_0136791 | |||
| 2047 | Ga0500627_0014558 | |||
| 2048 | Ga0500630_000498 | |||
| 2049 | Ga0500634_0056520 | |||
| 2050 | Ga0500638_008843 | |||
| 2051 | Ga0500639_000010 | |||
| 2052 | Ga0500636_0001226 | |||
| 2053 | Ga0500637_0000600 | |||
| 2054 | Ga0500625_002917 | |||
| 2055 | Ga0500596_001995 | |||
| 2056 | Ga0500601_000407 | |||
| 2057 | Ga0501084_0073058 | |||
| 2058 | Ga0501084_0117476 | |||
| 2059 | Ga0501084_0122786 | |||
| 2060 | Ga0500661_012024 | |||
| 2061 | Ga0587082_036112 | |||
| 2062 | Ga0587083_0047121 | |||
| 2063 | Ga0501082_0044974 | |||
| 2064 | Ga0530510_0195558 | |||
| 2065 | 2507510921 | |||
| 2066 | 2508544733 | |||
| 2067 | 2508697037 | |||
| 2068 | 2509147139 | |||
| 2069 | 2511394387 | |||
| 2070 | 2513649589 | |||
| 2071 | 2513654959 | |||
| 2072 | 2513671121 | |||
| 2073 | 2513861245 | |||
| 2074 | 2513874570 | |||
| 2075 | 2513894521 | |||
| 2076 | 2513916018 | |||
| 2077 | 2514015524 | |||
| 2078 | 2515625535 | |||
| 2079 | 2517894678 | |||
| 2080 | 2524464018 | |||
| 2081 | 2524534418 | |||
| 2082 | 2617350679 | |||
| 2083 | 2671119100 | |||
| 2084 | 2728747663 | |||
| 2085 | 2793071148 | |||
| 2086 | 2805916565 | |||
| 2087 | 2818238059 | |||
| 2088 | 2824675572 | |||
| 2089 | 2824692238 | |||
| 2090 | 2824698696 | |||
| 2091 | 2824778458 | |||
| 2092 | 2838127811 | |||
| 2093 | 2841943104 | |||
| 2094 | 2841956125 | |||
| 2095 | 2841968254 | |||
| 2096 | 2841976532 | |||
| 2097 | 2841987908 | |||
| 2098 | 2844317001 | |||
| 2099 | 2847938482 | |||
| 2100 | 2847944320 | |||
| 2101 | 2857469434 | |||
| 2102 | 2857512102 | |||
| 2103 | 2857595176 | |||
| 2104 | 2874597646 | |||
| 2105 | 2874649210 | |||
| 2106 | 2876767818 | |||
| 2107 | 2876774881 | |||
| 2108 | 2876822367 | |||
| 2109 | 2879077969 | |||
| 2110 | 2879088721 | |||
| 2111 | 2879132480 | |||
| 2112 | 2879145980 | |||
| 2113 | 2885367012 | |||
| 2114 | 2885382404 | |||
| 2115 | 2885389064 | |||
| 2116 | 2885416564 | |||
| 2117 | 2888381624 | |||
| 2118 | 2888389005 | |||
| 2119 | 2903734969 | |||
| 2120 | 2903757866 | |||
| 2121 | 2904696988 | |||
| 2122 | 2904705712 | |||
| 2123 | 2906604084 | |||
| 2124 | 2906611405 | |||
| 2125 | 2906632991 | |||
| 2126 | 2906641557 | |||
| 2127 | 2906661261 | |||
| 2128 | 2908744991 | |||
| 2129 | 2908762744 | |||
| 2130 | 2922427962 | |||
| 2131 | 2932798223 | |||
| 2132 | 2932804018 | |||
| 2133 | 2935612861 | |||
| 2134 | 2935632119 | |||
| 2135 | 2935775408 | |||
| 2136 | 2935780310 | |||
| 2137 | 2935790657 | |||
| 2138 | 2935799160 | |||
| 2139 | 2935824349 | |||
| 2140 | 2935852506 | |||
| 2141 | 2935884178 | |||
| 2142 | 2935912340 | |||
| 2143 | 2935923986 | |||
| 2144 | 2935929369 | |||
| 2145 | 2935936000 | |||
| 2146 | 2935949900 | |||
| 2147 | 2935957334 | |||
| 2148 | 2935962147 | |||
| 2149 | 2935968365 | |||
| 2150 | 2935976552 | |||
| 2151 | 2935988002 | |||
| 2152 | 2936059441 | |||
| 2153 | 2941508067 | |||
| 2154 | 2941515428 | |||
| 2155 | 2941523997 | |||
| 2156 | 2941533786 | |||
| 2157 | 3005477670 | |||
| 2158 | 3005507211 | |||
| 2159 | 3005594571 | |||
| 2160 | 3005596645 | |||
| 2161 | 3005712720 | |||
| 2162 | 3005719770 | |||
| 2163 | 8002062636 | |||
| 2164 | 8006933548 | |||
| 2165 | 8006983221 | |||
| 2166 | 8016523727 | |||
| 2167 | 8016537251 | |||
| 2168 | 8016551742 | |||
| 2169 | 8016566904 | |||
| 2170 | 8016579633 | |||
| 2171 | 8016589235 | |||
| 2172 | 8016598050 | |||
| 2173 | 8016604188 | |||
| 2174 | 8016620769 | |||
| 2175 | 8016629217 | |||
| 2176 | 8016633742 | |||
| 2177 | 8019536940 | |||
| 2178 | 8019542588 | |||
| 2179 | 8019548149 | |||
| 2180 | 8019559473 | |||
| 2181 | 8019569576 | |||
| 2182 | 8019625247 | |||
| 2183 | 8019636934 | |||
| 2184 | 8019642674 | |||
| 2185 | 8019649916 | |||
| 2186 | 8019674339 | |||
| 2187 | 8019681774 | |||
| 2188 | 8019694004 | |||
| 2189 | 8056695106 | |||
| 2190 | 8056969923 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ix6-assembly1.cif.gz_A | crystal structure of thymidylate synthase thya from brucella melitensis | 0.9668 | 2 | 244 |
| 4h0u-assembly1.cif.gz_B | crystal structure of thymidylate synthase from corynebacterium glutamicum in complex with dump | 0.9643 | 2 | 252 |
| 1bp0-assembly1.cif.gz_A-2 | thymidylate synthase r23i mutant | 0.9633 | 2 | 257 |
| 3bfi-assembly1.cif.gz_A-2 | e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump | 0.963 | 2 | 257 |
| 4fog-assembly2.cif.gz_B | crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid | 0.963 | 2 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9615 | 2 | 244 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.958 | 2 | 257 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9508 | 2 | 257 | 3.30.572.10 |
| 3dgaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9458 | 4 | 252 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9452 | 2 | 255 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E8YSB0-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9884 | 138 | 257 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A1J4YZP9-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9842 | 136 | 257 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A352HMS8-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9827 | 143 | 257 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A2E8YSB0-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9804 | 138 | 257 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A094MMM1-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9793 | 144 | 255 |
GO:0004799
GO:0005739 GO:0005829 GO:0006231 GO:0006235 GO:0032259 |