F489975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1096 | 588 | 1008 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300005440|Ga0070705_100101052|Ga0070705_1001010523 |
| Length | 190 |
| Sequence | MASRRPARAPAARSIRRRPRRPRSTGVPPAGLRIGCGADAHALRPGRRLVLGGVEIPHAAGLLGHSDADVLSHALCDALLGALGLPDMGTRFPDSDETLRDRSSLYFLQDVMREVRARGFEILNVDAVVLAEAPRLQPHLETIRASLAAALGVPPSSVGLKAKRLEGLGAVGRQEGIMAQAVALLSGPRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 3 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 4 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 5 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 6 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 7 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 8 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 9 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 10 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 11 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 12 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 13 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 14 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 15 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 16 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 17 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 18 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 19 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 20 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 21 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 22 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 23 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 24 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 25 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 26 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 27 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 28 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 29 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 30 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 31 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 32 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 33 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 34 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 35 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 36 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 37 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 38 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 39 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 40 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 41 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 42 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 43 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 44 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 45 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 46 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 47 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 48 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 49 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 50 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 51 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 52 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 53 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 54 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 55 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 56 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 57 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 58 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 59 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 60 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 61 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 62 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 63 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 64 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 65 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 66 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 67 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 68 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 69 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 70 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 71 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 72 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 73 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 74 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 75 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 76 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 77 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 78 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 79 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 80 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 81 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 82 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 83 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 84 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 85 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 86 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 87 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 88 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 89 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 90 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 91 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 92 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 93 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 94 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 95 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 96 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 97 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 98 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 99 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 100 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 101 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 102 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 103 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 104 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 105 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 106 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 107 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 108 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 109 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 110 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 111 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 112 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 113 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 117 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 120 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 121 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 123 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 125 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 135 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 144 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 147 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 148 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 149 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 152 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 153 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 155 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 159 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 160 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 162 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 163 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 164 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 165 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 166 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 167 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 168 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 169 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 170 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 171 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 172 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 173 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 174 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 175 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 176 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 177 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 178 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 179 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 180 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 181 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 182 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 183 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 184 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 185 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 186 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 188 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 189 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 190 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 191 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 192 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 193 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 194 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 195 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 196 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 197 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 199 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 225 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 231 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 233 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 234 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 235 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 240 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 243 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 300 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 318 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 320 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 321 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 322 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 323 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 324 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 325 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 326 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 327 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 328 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 329 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 330 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 331 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 332 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 333 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 334 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 335 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 336 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 337 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 338 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 339 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 340 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 341 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 342 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 347 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 348 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 349 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 350 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 351 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 352 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 353 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 354 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 355 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 356 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 357 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 358 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 359 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 360 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 361 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 362 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 363 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 364 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 365 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 366 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 367 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 368 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 369 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 370 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 371 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 372 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 373 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 374 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 375 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 376 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 377 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 378 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 379 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 380 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 381 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 382 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 383 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 384 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 385 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 386 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 387 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 388 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 389 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 390 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 391 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 392 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 393 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 394 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 395 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 396 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 397 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 398 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 399 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 400 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 437 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 438 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 439 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 440 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 441 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 442 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 444 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 445 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 446 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 447 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 448 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 449 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 450 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 451 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 452 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 453 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 454 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 455 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 456 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 457 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 458 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 459 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 460 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 461 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 463 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 464 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 465 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 466 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 467 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 468 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 469 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 470 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 471 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 496 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 497 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 498 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 499 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 500 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 501 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 502 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 503 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 504 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 505 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 506 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 507 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 508 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 509 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 510 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 511 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 512 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 513 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 514 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 515 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 516 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 517 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 518 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 519 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 520 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 521 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 522 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 523 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 524 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 529 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 530 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 531 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 532 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 533 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 534 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 535 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 536 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 537 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 538 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 539 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 540 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 542 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 543 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 544 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 545 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 546 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 547 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 548 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 549 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 550 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 554 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 555 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 556 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 557 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 558 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 561 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 562 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 563 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 564 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 565 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 566 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 567 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 568 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 570 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 571 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 572 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 573 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 574 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 575 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 576 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 577 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 580 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 581 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 582 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 583 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 584 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 585 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 586 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 587 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 588 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.88 |
| Metatranscriptomes | 1.09 |
| Isolates | 8.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.96 |
| Nodule | 0.27 |
| Rhizoplane | 4.01 |
| Rhizosphere | 69.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214782462 | 2209111006 | Unclassified | 757 |
| 2 | JGI24740J21852_10022978 | 3300001979 | Bacteria | 2137 |
| 3 | JGI24740J21852_10035018 | 3300001979 | Bacteria | 1574 |
| 4 | JGI24740J21852_10041916 | 3300001979 | Bacteria | 1376 |
| 5 | JGI24739J22299_10073669 | 3300001989 | Bacteria | 1059 |
| 6 | JGI25152J39213_1009363 | 3300002773 | Bacteria | 2333 |
| 7 | JGI25152J39213_1013311 | 3300002773 | Bacteria | 1720 |
| 8 | JGI25150J39212_1002663 | 3300002774 | Bacteria | 4366 |
| 9 | JGI25150J39212_1028980 | 3300002774 | Bacteria | 781 |
| 10 | JGI25159J45721_1000455 | 3300002987 | Bacteria | 18924 |
| 11 | JGI25159J45721_1008909 | 3300002987 | Bacteria | 2701 |
| 12 | JGI25159J45721_1008941 | 3300002987 | Bacteria | 2692 |
| 13 | JGI25151J46595_10002393 | 3300003187 | Bacteria | 11356 |
| 14 | JGI25151J46595_10009236 | 3300003187 | Bacteria | 4685 |
| 15 | JGI25151J46595_10013010 | 3300003187 | Bacteria | 3760 |
| 16 | JGI25151J46595_10024635 | 3300003187 | Bacteria | 2459 |
| 17 | JGI25151J46595_10035559 | 3300003187 | Bacteria | 1890 |
| 18 | JGI25151J46595_10048721 | 3300003187 | Bacteria | 1461 |
| 19 | JGI25151J46595_10106259 | 3300003187 | Bacteria | 744 |
| 20 | JGI25151J46595_10125314 | 3300003187 | Bacteria | 648 |
| 21 | JGI25153J46596_10020886 | 3300003215 | Bacteria | 2459 |
| 22 | rootH1_10000848 | 3300003316 | Bacteria | 58943 |
| 23 | rootH1_10026606 | 3300003316 | Bacteria | 3175 |
| 24 | rootH2_10177648 | 3300003320 | Bacteria | 5131 |
| 25 | rootL2_10052955 | 3300003322 | Bacteria | 32035 |
| 26 | rootH1_10042628 | 3300003323 | Bacteria | 2035 |
| 27 | rootH1_10084694 | 3300003323 | Bacteria | 1405 |
| 28 | JGI25160J50197_1000148 | 3300003354 | Bacteria | 61871 |
| 29 | JGI25160J50197_1000822 | 3300003354 | Bacteria | 16614 |
| 30 | JGI25160J50197_1021441 | 3300003354 | Bacteria | 1919 |
| 31 | JGI25160J50197_1021448 | 3300003354 | Bacteria | 1919 |
| 32 | JGI26145J50221_1005807 | 3300003371 | Unclassified | 1022 |
| 33 | JGI25161J50226_1000111 | 3300003374 | Bacteria | 63577 |
| 34 | JGI25161J50226_1004523 | 3300003374 | Bacteria | 2896 |
| 35 | JGI25161J50226_1004914 | 3300003374 | Bacteria | 2713 |
| 36 | Ga0006562J51391_1060112 | 3300003578 | Bacteria | 4170 |
| 37 | Ga0055535_1000653 | 3300003761 | Bacteria | 27554 |
| 38 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 39 | Ga0055526_1017208 | 3300003771 | Bacteria | 2777 |
| 40 | Ga0055526_1017238 | 3300003771 | Bacteria | 2772 |
| 41 | Ga0055537_1007008 | 3300003773 | Bacteria | 2777 |
| 42 | Ga0055524_1015487 | 3300003775 | Bacteria | 2777 |
| 43 | Ga0055524_1015518 | 3300003775 | Bacteria | 2772 |
| 44 | Ga0055536_1010162 | 3300003781 | Bacteria | 3775 |
| 45 | Ga0055536_1013833 | 3300003781 | Bacteria | 2877 |
| 46 | Ga0055534_1003507 | 3300003784 | Bacteria | 4908 |
| 47 | Ga0055534_1008619 | 3300003784 | Bacteria | 2293 |
| 48 | Ga0055534_1009764 | 3300003784 | Bacteria | 2057 |
| 49 | Ga0055528_1001614 | 3300003790 | Bacteria | 13323 |
| 50 | Ga0055528_1015323 | 3300003790 | Bacteria | 2777 |
| 51 | Ga0055530_10013554 | 3300003791 | Bacteria | 2775 |
| 52 | Ga0055530_10016612 | 3300003791 | Bacteria | 2342 |
| 53 | Ga0055530_10046609 | 3300003791 | Bacteria | 1028 |
| 54 | Ga0055540_1008365 | 3300003792 | Bacteria | 3733 |
| 55 | Ga0055540_1013006 | 3300003792 | Bacteria | 2570 |
| 56 | Ga0055540_1017000 | 3300003792 | Bacteria | 2045 |
| 57 | Ga0055531_10025953 | 3300003794 | Bacteria | 2107 |
| 58 | Ga0055531_10026712 | 3300003794 | Bacteria | 2049 |
| 59 | Ga0055543_1000302 | 3300004625 | Bacteria | 34707 |
| 60 | Ga0055543_1005187 | 3300004625 | Bacteria | 3372 |
| 61 | Ga0055543_1010513 | 3300004625 | Bacteria | 1936 |
| 62 | Ga0065165_1012873 | 3300005262 | Bacteria | 3372 |
| 63 | Ga0065165_1013194 | 3300005262 | Bacteria | 3303 |
| 64 | Ga0065165_1038578 | 3300005262 | Bacteria | 1439 |
| 65 | Ga0065165_1051908 | 3300005262 | Bacteria | 1160 |
| 66 | Ga0065165_1051909 | 3300005262 | Bacteria | 1160 |
| 67 | Ga0065716_1007454 | 3300005277 | Unclassified | 754 |
| 68 | Ga0065712_10037862 | 3300005290 | Bacteria | 1070 |
| 69 | Ga0065712_10204418 | 3300005290 | Bacteria | 1096 |
| 70 | Ga0065715_10663414 | 3300005293 | Unclassified | 670 |
| 71 | Ga0065707_10283295 | 3300005295 | Bacteria | 1031 |
| 72 | Ga0070658_10021990 | 3300005327 | Bacteria | 5115 |
| 73 | Ga0070676_10005793 | 3300005328 | Bacteria | 6585 |
| 74 | Ga0070683_100327982 | 3300005329 | Bacteria | 1457 |
| 75 | Ga0070683_100342633 | 3300005329 | Bacteria | 1423 |
| 76 | Ga0070690_100002862 | 3300005330 | Bacteria | 9304 |
| 77 | Ga0070670_100163642 | 3300005331 | Bacteria | 1929 |
| 78 | Ga0070670_100680692 | 3300005331 | Bacteria | 924 |
| 79 | Ga0070677_10146803 | 3300005333 | Bacteria | 1094 |
| 80 | Ga0068869_100086862 | 3300005334 | Bacteria | 2345 |
| 81 | Ga0070680_100342976 | 3300005336 | Bacteria | 1269 |
| 82 | Ga0070680_100397577 | 3300005336 | Bacteria | 1174 |
| 83 | Ga0070682_100040563 | 3300005337 | Bacteria | 2865 |
| 84 | Ga0068868_100403166 | 3300005338 | Bacteria | 1181 |
| 85 | Ga0068868_101542837 | 3300005338 | Bacteria | 623 |
| 86 | Ga0070660_100012591 | 3300005339 | Bacteria | 6042 |
| 87 | Ga0070689_100032573 | 3300005340 | Bacteria | 3966 |
| 88 | Ga0070689_100036552 | 3300005340 | Bacteria | 3757 |
| 89 | Ga0070689_100043278 | 3300005340 | Bacteria | 3460 |
| 90 | Ga0070689_100356682 | 3300005340 | Bacteria | 1228 |
| 91 | Ga0070691_10092099 | 3300005341 | Bacteria | 1496 |
| 92 | Ga0070691_10281962 | 3300005341 | Bacteria | 902 |
| 93 | Ga0070691_10562724 | 3300005341 | Bacteria | 668 |
| 94 | Ga0070687_100009408 | 3300005343 | Bacteria | 4186 |
| 95 | Ga0070661_100015451 | 3300005344 | Bacteria | 5388 |
| 96 | Ga0070661_100421463 | 3300005344 | Bacteria | 1058 |
| 97 | Ga0070668_100039790 | 3300005347 | Bacteria | 3596 |
| 98 | Ga0070668_100543027 | 3300005347 | Bacteria | 1011 |
| 99 | Ga0070668_100973966 | 3300005347 | Bacteria | 761 |
| 100 | Ga0070669_101151513 | 3300005353 | Bacteria | 669 |
| 101 | Ga0070675_100053318 | 3300005354 | Bacteria | 3326 |
| 102 | Ga0070675_100067435 | 3300005354 | Bacteria | 2961 |
| 103 | Ga0070675_100248687 | 3300005354 | Bacteria | 1555 |
| 104 | Ga0070675_100263060 | 3300005354 | Bacteria | 1512 |
| 105 | Ga0070671_100029499 | 3300005355 | Bacteria | 4523 |
| 106 | Ga0070674_100020216 | 3300005356 | Bacteria | 4247 |
| 107 | Ga0070674_100087957 | 3300005356 | Bacteria | 2235 |
| 108 | Ga0070674_100398528 | 3300005356 | Bacteria | 1124 |
| 109 | Ga0070674_100452183 | 3300005356 | Bacteria | 1060 |
| 110 | Ga0070673_100001859 | 3300005364 | Bacteria | 12618 |
| 111 | Ga0070673_100272093 | 3300005364 | Bacteria | 1483 |
| 112 | Ga0070673_100800191 | 3300005364 | Unclassified | 870 |
| 113 | Ga0070688_100009181 | 3300005365 | Bacteria | 5396 |
| 114 | Ga0070688_100223670 | 3300005365 | Bacteria | 1328 |
| 115 | Ga0070659_100640407 | 3300005366 | Bacteria | 916 |
| 116 | Ga0070659_100950387 | 3300005366 | Bacteria | 753 |
| 117 | Ga0070667_100232651 | 3300005367 | Bacteria | 1644 |
| 118 | Ga0070709_10395096 | 3300005434 | Bacteria | 1031 |
| 119 | Ga0070713_100248526 | 3300005436 | Bacteria | 1622 |
| 120 | Ga0070710_10429423 | 3300005437 | Bacteria | 891 |
| 121 | Ga0070711_100000002 | 3300005439 | Bacteria | 263148 |
| 122 | Ga0070711_100239150 | 3300005439 | Bacteria | 1419 |
| 123 | Ga0070705_100101052 | 3300005440 | Bacteria | 1821 |
| 124 | Ga0070700_100169617 | 3300005441 | Bacteria | 1510 |
| 125 | Ga0070700_100373090 | 3300005441 | Bacteria | 1065 |
| 126 | Ga0070700_100432080 | 3300005441 | Bacteria | 997 |
| 127 | Ga0070694_100202628 | 3300005444 | Bacteria | 1480 |
| 128 | Ga0070694_100552054 | 3300005444 | Bacteria | 922 |
| 129 | Ga0070678_100001693 | 3300005456 | Bacteria | 11821 |
| 130 | Ga0070678_101403506 | 3300005456 | Bacteria | 652 |
| 131 | Ga0070662_100463818 | 3300005457 | Bacteria | 1053 |
| 132 | Ga0070662_100463851 | 3300005457 | Bacteria | 1053 |
| 133 | Ga0070662_100644280 | 3300005457 | Bacteria | 893 |
| 134 | Ga0070662_101248175 | 3300005457 | Bacteria | 639 |
| 135 | Ga0070662_101487611 | 3300005457 | Bacteria | 584 |
| 136 | Ga0070681_10039712 | 3300005458 | Bacteria | 4716 |
| 137 | Ga0068867_100021614 | 3300005459 | Bacteria | 4593 |
| 138 | Ga0068867_100038577 | 3300005459 | Bacteria | 3478 |
| 139 | Ga0068867_100969909 | 3300005459 | Bacteria | 769 |
| 140 | Ga0070685_10023806 | 3300005466 | Bacteria | 3356 |
| 141 | Ga0070685_10865894 | 3300005466 | Bacteria | 670 |
| 142 | Ga0070707_100340899 | 3300005468 | Bacteria | 1456 |
| 143 | Ga0070699_100000104 | 3300005518 | Bacteria | 78991 |
| 144 | Ga0070679_100009608 | 3300005530 | Bacteria | 9151 |
| 145 | Ga0068853_100111334 | 3300005539 | Bacteria | 2432 |
| 146 | Ga0068853_100239267 | 3300005539 | Bacteria | 1663 |
| 147 | Ga0070672_100016405 | 3300005543 | Bacteria | 5303 |
| 148 | Ga0070672_101289465 | 3300005543 | Bacteria | 652 |
| 149 | Ga0070686_100003042 | 3300005544 | Bacteria | 9191 |
| 150 | Ga0070686_101009210 | 3300005544 | Bacteria | 683 |
| 151 | Ga0070695_100261035 | 3300005545 | Bacteria | 1265 |
| 152 | Ga0070695_100419337 | 3300005545 | Bacteria | 1019 |
| 153 | Ga0070695_100542787 | 3300005545 | Bacteria | 905 |
| 154 | Ga0070696_100001805 | 3300005546 | Bacteria | 14046 |
| 155 | Ga0070696_100029720 | 3300005546 | Bacteria | 3738 |
| 156 | Ga0070696_100301740 | 3300005546 | Bacteria | 1227 |
| 157 | Ga0070665_100172663 | 3300005548 | Bacteria | 2163 |
| 158 | Ga0070704_100168405 | 3300005549 | Bacteria | 1739 |
| 159 | Ga0070704_100330680 | 3300005549 | Bacteria | 1280 |
| 160 | Ga0068855_100064760 | 3300005563 | Bacteria | 4262 |
| 161 | Ga0068855_100523264 | 3300005563 | Bacteria | 1286 |
| 162 | Ga0070664_100000430 | 3300005564 | Bacteria | 31417 |
| 163 | Ga0070664_100760103 | 3300005564 | Bacteria | 905 |
| 164 | Ga0068857_100066981 | 3300005577 | Bacteria | 3195 |
| 165 | Ga0068857_100177189 | 3300005577 | Bacteria | 1939 |
| 166 | Ga0068857_100931650 | 3300005577 | Bacteria | 834 |
| 167 | Ga0068854_100328265 | 3300005578 | Bacteria | 1246 |
| 168 | Ga0068856_100291104 | 3300005614 | Bacteria | 1650 |
| 169 | Ga0068852_100165443 | 3300005616 | Bacteria | 2069 |
| 170 | Ga0068859_100901228 | 3300005617 | Bacteria | 969 |
| 171 | Ga0068864_100482785 | 3300005618 | Bacteria | 1190 |
| 172 | Ga0068864_100862419 | 3300005618 | Unclassified | 893 |
| 173 | Ga0068864_100949208 | 3300005618 | Bacteria | 851 |
| 174 | Ga0068866_10093269 | 3300005718 | Bacteria | 1644 |
| 175 | Ga0068866_10168033 | 3300005718 | Bacteria | 1285 |
| 176 | Ga0068861_100573971 | 3300005719 | Bacteria | 1031 |
| 177 | Ga0068851_10078152 | 3300005834 | Bacteria | 1724 |
| 178 | Ga0068870_10356743 | 3300005840 | Unclassified | 940 |
| 179 | Ga0068863_100209106 | 3300005841 | Bacteria | 1879 |
| 180 | Ga0068863_100303849 | 3300005841 | Bacteria | 1548 |
| 181 | Ga0068858_101576729 | 3300005842 | Bacteria | 648 |
| 182 | Ga0068860_100063011 | 3300005843 | Bacteria | 3523 |
| 183 | Ga0068862_100090041 | 3300005844 | Bacteria | 2670 |
| 184 | Ga0081455_10004599 | 3300005937 | Bacteria | 15408 |
| 185 | Ga0081455_10054757 | 3300005937 | Bacteria | 3397 |
| 186 | Ga0075365_10001831 | 3300006038 | Bacteria | 9955 |
| 187 | Ga0075363_100027696 | 3300006048 | Bacteria | 2908 |
| 188 | Ga0075364_10590058 | 3300006051 | Bacteria | 759 |
| 189 | Ga0075432_10013954 | 3300006058 | Bacteria | 2734 |
| 190 | Ga0075432_10124953 | 3300006058 | Bacteria | 969 |
| 191 | Ga0070715_10319561 | 3300006163 | Bacteria | 837 |
| 192 | Ga0070715_10378055 | 3300006163 | Bacteria | 781 |
| 193 | Ga0070716_100180931 | 3300006173 | Bacteria | 1384 |
| 194 | Ga0070716_100623156 | 3300006173 | Bacteria | 814 |
| 195 | Ga0075362_10055705 | 3300006177 | Bacteria | 1778 |
| 196 | Ga0075362_10166821 | 3300006177 | Bacteria | 1062 |
| 197 | Ga0075367_10314179 | 3300006178 | Bacteria | 987 |
| 198 | Ga0075367_10315957 | 3300006178 | Bacteria | 984 |
| 199 | Ga0075369_10174422 | 3300006186 | Bacteria | 988 |
| 200 | Ga0075369_10208070 | 3300006186 | Bacteria | 904 |
| 201 | Ga0075366_10030633 | 3300006195 | Bacteria | 3164 |
| 202 | Ga0075366_10057535 | 3300006195 | Bacteria | 2311 |
| 203 | Ga0075366_10110160 | 3300006195 | Bacteria | 1656 |
| 204 | Ga0097621_100142532 | 3300006237 | Bacteria | 2049 |
| 205 | Ga0097621_100160022 | 3300006237 | Bacteria | 1935 |
| 206 | Ga0075370_10049640 | 3300006353 | Bacteria | 2379 |
| 207 | Ga0075370_10123572 | 3300006353 | Bacteria | 1507 |
| 208 | Ga0068871_100643023 | 3300006358 | Bacteria | 968 |
| 209 | Ga0075428_100490345 | 3300006844 | Bacteria | 1315 |
| 210 | Ga0075430_100091643 | 3300006846 | Bacteria | 2541 |
| 211 | Ga0075430_100160493 | 3300006846 | Bacteria | 1871 |
| 212 | Ga0075431_100044850 | 3300006847 | Bacteria | 4559 |
| 213 | Ga0075431_100053508 | 3300006847 | Bacteria | 4162 |
| 214 | Ga0075433_10353195 | 3300006852 | Bacteria | 1299 |
| 215 | Ga0075434_100065777 | 3300006871 | Bacteria | 3611 |
| 216 | Ga0075434_100121079 | 3300006871 | Bacteria | 2632 |
| 217 | Ga0075434_100289416 | 3300006871 | Bacteria | 1658 |
| 218 | Ga0075434_100499387 | 3300006871 | Bacteria | 1237 |
| 219 | Ga0075434_100745518 | 3300006871 | Unclassified | 996 |
| 220 | Ga0075429_100001369 | 3300006880 | Bacteria | 19955 |
| 221 | Ga0075429_100017168 | 3300006880 | Bacteria | 6259 |
| 222 | Ga0068865_100002482 | 3300006881 | Bacteria | 10922 |
| 223 | Ga0068865_100962220 | 3300006881 | Bacteria | 746 |
| 224 | Ga0075436_100010987 | 3300006914 | Bacteria | 6216 |
| 225 | Ga0075436_100023346 | 3300006914 | Bacteria | 4248 |
| 226 | Ga0075436_100244633 | 3300006914 | Bacteria | 1276 |
| 227 | Ga0075436_100484642 | 3300006914 | Unclassified | 903 |
| 228 | Ga0097620_100901147 | 3300006931 | Bacteria | 969 |
| 229 | Ga0075435_100212559 | 3300007076 | Unclassified | 1641 |
| 230 | Ga0075435_100215699 | 3300007076 | Bacteria | 1629 |
| 231 | Ga0105244_10007321 | 3300009036 | Bacteria | 7021 |
| 232 | Ga0105244_10207471 | 3300009036 | Bacteria | 922 |
| 233 | Ga0105240_11103818 | 3300009093 | Unclassified | 844 |
| 234 | Ga0105245_10003141 | 3300009098 | Bacteria | 14785 |
| 235 | Ga0105245_10067283 | 3300009098 | Bacteria | 3244 |
| 236 | Ga0114129_10046873 | 3300009147 | Bacteria | 6074 |
| 237 | Ga0114129_10173690 | 3300009147 | Bacteria | 2936 |
| 238 | Ga0114129_10188831 | 3300009147 | Bacteria | 2799 |
| 239 | Ga0114129_10354786 | 3300009147 | Bacteria | 1942 |
| 240 | Ga0114129_10599091 | 3300009147 | Bacteria | 1428 |
| 241 | Ga0114129_11605601 | 3300009147 | Bacteria | 796 |
| 242 | Ga0105243_10000301 | 3300009148 | Bacteria | 54622 |
| 243 | Ga0105243_10014671 | 3300009148 | Bacteria | 5930 |
| 244 | Ga0105243_10021819 | 3300009148 | Bacteria | 4861 |
| 245 | Ga0105243_10440913 | 3300009148 | Bacteria | 1219 |
| 246 | Ga0105241_10013744 | 3300009174 | Bacteria | 5930 |
| 247 | Ga0105242_10003077 | 3300009176 | Bacteria | 13015 |
| 248 | Ga0105242_10012170 | 3300009176 | Bacteria | 6619 |
| 249 | Ga0105242_10533661 | 3300009176 | Bacteria | 1122 |
| 250 | Ga0105248_11987252 | 3300009177 | Bacteria | 660 |
| 251 | Ga0105237_10324226 | 3300009545 | Bacteria | 1544 |
| 252 | Ga0105237_10500865 | 3300009545 | Bacteria | 1221 |
| 253 | Ga0105238_10730239 | 3300009551 | Bacteria | 1003 |
| 254 | Ga0105249_10019658 | 3300009553 | Bacteria | 6028 |
| 255 | Ga0105249_10302536 | 3300009553 | Bacteria | 1605 |
| 256 | Ga0105239_10033289 | 3300010375 | Bacteria | 5661 |
| 257 | Ga0105239_10065273 | 3300010375 | Bacteria | 3997 |
| 258 | Ga0105239_10908435 | 3300010375 | Bacteria | 1011 |
| 259 | Ga0105246_10000077 | 3300011119 | Bacteria | 41151 |
| 260 | Ga0105246_10071589 | 3300011119 | Bacteria | 2442 |
| 261 | Ga0157373_10128168 | 3300013100 | Bacteria | 1784 |
| 262 | Ga0157371_10062595 | 3300013102 | Bacteria | 2637 |
| 263 | Ga0157371_10088719 | 3300013102 | Bacteria | 2190 |
| 264 | Ga0157370_10294022 | 3300013104 | Bacteria | 1500 |
| 265 | Ga0157370_10474521 | 3300013104 | Bacteria | 1150 |
| 266 | Ga0157370_10770339 | 3300013104 | Bacteria | 876 |
| 267 | Ga0157369_10015992 | 3300013105 | Bacteria | 8443 |
| 268 | Ga0157369_10254642 | 3300013105 | Bacteria | 1832 |
| 269 | Ga0157374_10042041 | 3300013296 | Bacteria | 4215 |
| 270 | Ga0157374_10056971 | 3300013296 | Bacteria | 3650 |
| 271 | Ga0157378_10000237 | 3300013297 | Bacteria | 53846 |
| 272 | Ga0157378_10157967 | 3300013297 | Bacteria | 2118 |
| 273 | Ga0163162_10294911 | 3300013306 | Bacteria | 1753 |
| 274 | Ga0163162_10550954 | 3300013306 | Bacteria | 1281 |
| 275 | Ga0163162_10939198 | 3300013306 | Bacteria | 976 |
| 276 | Ga0157372_10066231 | 3300013307 | Bacteria | 4058 |
| 277 | Ga0157372_10209898 | 3300013307 | Bacteria | 2256 |
| 278 | Ga0157372_10382990 | 3300013307 | Bacteria | 1639 |
| 279 | Ga0157375_10159127 | 3300013308 | Bacteria | 2399 |
| 280 | Ga0157375_10175253 | 3300013308 | Bacteria | 2294 |
| 281 | Ga0157375_10775914 | 3300013308 | Bacteria | 1108 |
| 282 | Ga0157380_10743637 | 3300014326 | Bacteria | 991 |
| 283 | Ga0157380_11261979 | 3300014326 | Bacteria | 785 |
| 284 | Ga0157377_10034484 | 3300014745 | Bacteria | 2769 |
| 285 | Ga0157376_10010301 | 3300014969 | Bacteria | 6828 |
| 286 | Ga0157376_10230330 | 3300014969 | Bacteria | 1721 |
| 287 | Ga0182007_10009286 | 3300015262 | Bacteria | 3977 |
| 288 | Ga0163161_10811448 | 3300017792 | Bacteria | 787 |
| 289 | Ga0209436_112914 | 3300025208 | Bacteria | 1394 |
| 290 | Ga0209672_100531 | 3300025228 | Bacteria | 20822 |
| 291 | Ga0209147_101412 | 3300025229 | Bacteria | 8787 |
| 292 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 293 | Ga0207425_1001080 | 3300025245 | Bacteria | 12404 |
| 294 | Ga0207425_1001242 | 3300025245 | Bacteria | 11189 |
| 295 | Ga0207425_1010314 | 3300025245 | Bacteria | 2279 |
| 296 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 297 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 298 | Ga0209129_1002508 | 3300025258 | Bacteria | 8948 |
| 299 | Ga0209129_1026336 | 3300025258 | Bacteria | 1005 |
| 300 | Ga0209565_1000125 | 3300025263 | Bacteria | 110485 |
| 301 | Ga0209565_1000565 | 3300025263 | Bacteria | 25494 |
| 302 | Ga0209565_1001097 | 3300025263 | Bacteria | 13368 |
| 303 | Ga0209565_1005206 | 3300025263 | Bacteria | 3819 |
| 304 | Ga0209673_1000192 | 3300025273 | Bacteria | 123155 |
| 305 | Ga0209673_1002278 | 3300025273 | Bacteria | 13748 |
| 306 | Ga0209673_1002969 | 3300025273 | Bacteria | 10598 |
| 307 | Ga0209130_1000069 | 3300025284 | Bacteria | 179177 |
| 308 | Ga0209130_1000110 | 3300025284 | Bacteria | 133258 |
| 309 | Ga0209130_1000479 | 3300025284 | Bacteria | 41174 |
| 310 | Ga0209130_1002183 | 3300025284 | Bacteria | 10312 |
| 311 | Ga0209130_1033863 | 3300025284 | Bacteria | 1032 |
| 312 | Ga0209675_1000427 | 3300025291 | Bacteria | 34021 |
| 313 | Ga0209675_1000614 | 3300025291 | Bacteria | 25547 |
| 314 | Ga0209675_1005042 | 3300025291 | Bacteria | 5653 |
| 315 | Ga0209675_1009288 | 3300025291 | Bacteria | 3489 |
| 316 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 317 | Ga0209676_1000285 | 3300025292 | Bacteria | 104459 |
| 318 | Ga0209676_1000614 | 3300025292 | Bacteria | 52075 |
| 319 | Ga0209676_1024428 | 3300025292 | Bacteria | 1957 |
| 320 | Ga0209025_1000316 | 3300025294 | Bacteria | 107447 |
| 321 | Ga0209025_1000652 | 3300025294 | Bacteria | 60620 |
| 322 | Ga0209025_1004758 | 3300025294 | Bacteria | 11524 |
| 323 | Ga0209025_1012895 | 3300025294 | Bacteria | 5313 |
| 324 | Ga0209025_1030280 | 3300025294 | Bacteria | 2594 |
| 325 | Ga0209025_1055514 | 3300025294 | Bacteria | 1530 |
| 326 | Ga0209025_1118901 | 3300025294 | Bacteria | 793 |
| 327 | Ga0209025_1145213 | 3300025294 | Bacteria | 665 |
| 328 | Ga0209564_1000270 | 3300025295 | Bacteria | 108503 |
| 329 | Ga0209564_1000791 | 3300025295 | Bacteria | 43583 |
| 330 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 331 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 332 | Ga0209050_1013270 | 3300025298 | Bacteria | 3676 |
| 333 | Ga0209050_1014859 | 3300025298 | Bacteria | 3318 |
| 334 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 335 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 336 | Ga0209256_1012544 | 3300025299 | Bacteria | 3228 |
| 337 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 338 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 339 | Ga0207426_1000061 | 3300025302 | Bacteria | 362507 |
| 340 | Ga0207426_1020714 | 3300025302 | Bacteria | 2283 |
| 341 | Ga0207426_1075332 | 3300025302 | Bacteria | 929 |
| 342 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 343 | Ga0209051_1000711 | 3300025303 | Bacteria | 36515 |
| 344 | Ga0209051_1012743 | 3300025303 | Bacteria | 4049 |
| 345 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 346 | Ga0209257_1006768 | 3300025304 | Bacteria | 7222 |
| 347 | Ga0207655_1039403 | 3300025728 | Bacteria | 2052 |
| 348 | Ga0207655_1105711 | 3300025728 | Bacteria | 961 |
| 349 | Ga0207655_1105720 | 3300025728 | Bacteria | 961 |
| 350 | Ga0207713_1002717 | 3300025735 | Bacteria | 12617 |
| 351 | Ga0207682_10019567 | 3300025893 | Bacteria | 2651 |
| 352 | Ga0207692_10150134 | 3300025898 | Bacteria | 1334 |
| 353 | Ga0207642_10012814 | 3300025899 | Bacteria | 3039 |
| 354 | Ga0207710_10070718 | 3300025900 | Bacteria | 1600 |
| 355 | Ga0207688_10031016 | 3300025901 | Bacteria | 2949 |
| 356 | Ga0207688_10184774 | 3300025901 | Bacteria | 1244 |
| 357 | Ga0207688_10304188 | 3300025901 | Bacteria | 975 |
| 358 | Ga0207699_10445200 | 3300025906 | Bacteria | 928 |
| 359 | Ga0207645_10001024 | 3300025907 | Bacteria | 23114 |
| 360 | Ga0207705_10052616 | 3300025909 | Bacteria | 2932 |
| 361 | Ga0207707_10120621 | 3300025912 | Bacteria | 2292 |
| 362 | Ga0207695_10425568 | 3300025913 | Bacteria | 1212 |
| 363 | Ga0207671_10049792 | 3300025914 | Bacteria | 3102 |
| 364 | Ga0207663_10000003 | 3300025916 | Bacteria | 458807 |
| 365 | Ga0207663_10196324 | 3300025916 | Bacteria | 1453 |
| 366 | Ga0207660_10087893 | 3300025917 | Bacteria | 2297 |
| 367 | Ga0207660_10213142 | 3300025917 | Bacteria | 1513 |
| 368 | Ga0207662_10042794 | 3300025918 | Bacteria | 2670 |
| 369 | Ga0207662_10151927 | 3300025918 | Bacteria | 1473 |
| 370 | Ga0207657_10123803 | 3300025919 | Bacteria | 2125 |
| 371 | Ga0207649_10077751 | 3300025920 | Bacteria | 2139 |
| 372 | Ga0207649_10361740 | 3300025920 | Bacteria | 1077 |
| 373 | Ga0207652_10028701 | 3300025921 | Bacteria | 4645 |
| 374 | Ga0207646_10788528 | 3300025922 | Bacteria | 847 |
| 375 | Ga0207650_10302755 | 3300025925 | Bacteria | 1306 |
| 376 | Ga0207650_10608222 | 3300025925 | Unclassified | 919 |
| 377 | Ga0207659_10243353 | 3300025926 | Bacteria | 1456 |
| 378 | Ga0207659_10283819 | 3300025926 | Bacteria | 1354 |
| 379 | Ga0207659_10501770 | 3300025926 | Bacteria | 1027 |
| 380 | Ga0207659_10512974 | 3300025926 | Bacteria | 1016 |
| 381 | Ga0207659_10595912 | 3300025926 | Bacteria | 942 |
| 382 | Ga0207700_10555566 | 3300025928 | Bacteria | 1019 |
| 383 | Ga0207644_10273012 | 3300025931 | Bacteria | 1355 |
| 384 | Ga0207690_10397896 | 3300025932 | Bacteria | 1098 |
| 385 | Ga0207690_10804518 | 3300025932 | Bacteria | 777 |
| 386 | Ga0207706_10001021 | 3300025933 | Bacteria | 28541 |
| 387 | Ga0207706_11074493 | 3300025933 | Bacteria | 673 |
| 388 | Ga0207686_10035606 | 3300025934 | Bacteria | 2989 |
| 389 | Ga0207686_10159391 | 3300025934 | Bacteria | 1580 |
| 390 | Ga0207686_10317011 | 3300025934 | Bacteria | 1163 |
| 391 | Ga0207686_10363628 | 3300025934 | Bacteria | 1093 |
| 392 | Ga0207709_10000019 | 3300025935 | Bacteria | 402225 |
| 393 | Ga0207709_10002077 | 3300025935 | Bacteria | 12914 |
| 394 | Ga0207709_10162701 | 3300025935 | Bacteria | 1558 |
| 395 | Ga0207670_10185151 | 3300025936 | Bacteria | 1571 |
| 396 | Ga0207670_10248056 | 3300025936 | Bacteria | 1375 |
| 397 | Ga0207669_10327095 | 3300025937 | Bacteria | 1175 |
| 398 | Ga0207669_10412968 | 3300025937 | Bacteria | 1060 |
| 399 | Ga0207669_10936025 | 3300025937 | Bacteria | 725 |
| 400 | Ga0207704_10411091 | 3300025938 | Bacteria | 1070 |
| 401 | Ga0207665_10222472 | 3300025939 | Bacteria | 1384 |
| 402 | Ga0207665_10972856 | 3300025939 | Bacteria | 675 |
| 403 | Ga0207691_10031036 | 3300025940 | Bacteria | 4991 |
| 404 | Ga0207691_10036214 | 3300025940 | Bacteria | 4572 |
| 405 | Ga0207691_10473153 | 3300025940 | Bacteria | 1065 |
| 406 | Ga0207689_10018342 | 3300025942 | Bacteria | 5905 |
| 407 | Ga0207661_10220622 | 3300025944 | Bacteria | 1676 |
| 408 | Ga0207679_10012799 | 3300025945 | Bacteria | 5483 |
| 409 | Ga0207679_10644868 | 3300025945 | Unclassified | 957 |
| 410 | Ga0207667_10284138 | 3300025949 | Bacteria | 1691 |
| 411 | Ga0207667_10686534 | 3300025949 | Bacteria | 1027 |
| 412 | Ga0207651_10014674 | 3300025960 | Bacteria | 4532 |
| 413 | Ga0207651_10240702 | 3300025960 | Bacteria | 1474 |
| 414 | Ga0207712_10446610 | 3300025961 | Bacteria | 1096 |
| 415 | Ga0207668_10028226 | 3300025972 | Bacteria | 3667 |
| 416 | Ga0207668_11022438 | 3300025972 | Bacteria | 739 |
| 417 | Ga0207640_10131115 | 3300025981 | Unclassified | 1812 |
| 418 | Ga0207640_10426350 | 3300025981 | Bacteria | 1087 |
| 419 | Ga0207640_10926583 | 3300025981 | Bacteria | 762 |
| 420 | Ga0207658_10075944 | 3300025986 | Bacteria | 2558 |
| 421 | Ga0207658_10189089 | 3300025986 | Bacteria | 1710 |
| 422 | Ga0207677_10146091 | 3300026023 | Bacteria | 1817 |
| 423 | Ga0207677_10181784 | 3300026023 | Bacteria | 1655 |
| 424 | Ga0207703_10119885 | 3300026035 | Bacteria | 2257 |
| 425 | Ga0207639_10062321 | 3300026041 | Bacteria | 2883 |
| 426 | Ga0207639_10078109 | 3300026041 | Bacteria | 2612 |
| 427 | Ga0207639_10838726 | 3300026041 | Bacteria | 858 |
| 428 | Ga0207708_10005900 | 3300026075 | Bacteria | 9060 |
| 429 | Ga0207708_10172472 | 3300026075 | Bacteria | 1714 |
| 430 | Ga0207708_10526614 | 3300026075 | Bacteria | 994 |
| 431 | Ga0207641_10148875 | 3300026088 | Bacteria | 2119 |
| 432 | Ga0207641_10870886 | 3300026088 | Bacteria | 893 |
| 433 | Ga0207648_10003922 | 3300026089 | Bacteria | 15499 |
| 434 | Ga0207648_10082026 | 3300026089 | Bacteria | 2812 |
| 435 | Ga0207648_10146577 | 3300026089 | Bacteria | 2082 |
| 436 | Ga0207676_10097826 | 3300026095 | Bacteria | 2425 |
| 437 | Ga0207676_10127492 | 3300026095 | Bacteria | 2158 |
| 438 | Ga0207676_10611411 | 3300026095 | Bacteria | 1048 |
| 439 | Ga0207674_10216525 | 3300026116 | Bacteria | 1863 |
| 440 | Ga0207674_10396465 | 3300026116 | Bacteria | 1334 |
| 441 | Ga0207675_100075897 | 3300026118 | Bacteria | 3147 |
| 442 | Ga0207675_100461321 | 3300026118 | Bacteria | 1260 |
| 443 | Ga0207683_10000099 | 3300026121 | Bacteria | 71651 |
| 444 | Ga0207683_10058809 | 3300026121 | Bacteria | 3375 |
| 445 | Ga0207683_10095683 | 3300026121 | Bacteria | 2648 |
| 446 | Ga0207683_10568684 | 3300026121 | Bacteria | 1048 |
| 447 | Ga0207698_10151332 | 3300026142 | Bacteria | 2014 |
| 448 | Ga0207698_10485297 | 3300026142 | Unclassified | 1199 |
| 449 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 450 | Ga0209973_1003358 | 3300027252 | Unclassified | 1570 |
| 451 | Ga0209969_1000858 | 3300027360 | Bacteria | 4096 |
| 452 | Ga0209967_1000509 | 3300027364 | Bacteria | 5101 |
| 453 | Ga0209967_1001172 | 3300027364 | Bacteria | 3349 |
| 454 | Ga0209981_1000079 | 3300027378 | Bacteria | 10601 |
| 455 | Ga0209996_1000168 | 3300027395 | Bacteria | 8408 |
| 456 | Ga0209984_1001063 | 3300027424 | Bacteria | 2939 |
| 457 | Ga0210000_1000123 | 3300027462 | Bacteria | 10931 |
| 458 | Ga0210000_1028995 | 3300027462 | Bacteria | 862 |
| 459 | Ga0210000_1038406 | 3300027462 | Bacteria | 757 |
| 460 | Ga0209995_1000415 | 3300027471 | Bacteria | 6623 |
| 461 | Ga0209968_1000017 | 3300027526 | Bacteria | 33515 |
| 462 | Ga0209999_1000109 | 3300027543 | Bacteria | 10144 |
| 463 | Ga0209982_1000025 | 3300027552 | Bacteria | 13339 |
| 464 | Ga0210002_1000130 | 3300027617 | Bacteria | 11718 |
| 465 | Ga0210002_1049344 | 3300027617 | Bacteria | 724 |
| 466 | Ga0209983_1001431 | 3300027665 | Bacteria | 5304 |
| 467 | Ga0209971_1000327 | 3300027682 | Bacteria | 13110 |
| 468 | Ga0209971_1016486 | 3300027682 | Bacteria | 1751 |
| 469 | Ga0209966_1000186 | 3300027695 | Bacteria | 25632 |
| 470 | Ga0209998_10000065 | 3300027717 | Bacteria | 42399 |
| 471 | Ga0209974_10000064 | 3300027876 | Bacteria | 28215 |
| 472 | Ga0209974_10000274 | 3300027876 | Bacteria | 16780 |
| 473 | Ga0209974_10010272 | 3300027876 | Bacteria | 3160 |
| 474 | Ga0209974_10037812 | 3300027876 | Bacteria | 1603 |
| 475 | Ga0207428_10005062 | 3300027907 | Bacteria | 12387 |
| 476 | Ga0207428_10069386 | 3300027907 | Bacteria | 2771 |
| 477 | Ga0268264_10327564 | 3300028381 | Bacteria | 1450 |
| 478 | Ga0265323_10003513 | 3300028653 | Bacteria | 6904 |
| 479 | Ga0307515_10233464 | 3300028794 | Bacteria | 1626 |
| 480 | Ga0265324_10079231 | 3300029957 | Bacteria | 1118 |
| 481 | Ga0265327_10014639 | 3300031251 | Bacteria | 5120 |
| 482 | Ga0265327_10016476 | 3300031251 | Bacteria | 4690 |
| 483 | Ga0265327_10293133 | 3300031251 | Bacteria | 717 |
| 484 | Ga0307513_10170463 | 3300031456 | Bacteria | 2055 |
| 485 | Ga0307513_10238820 | 3300031456 | Bacteria | 1624 |
| 486 | Ga0307513_10643423 | 3300031456 | Bacteria | 768 |
| 487 | Ga0307408_100030541 | 3300031548 | Bacteria | 3742 |
| 488 | Ga0307408_100042562 | 3300031548 | Bacteria | 3227 |
| 489 | Ga0307408_100064337 | 3300031548 | Bacteria | 2686 |
| 490 | Ga0307408_100280274 | 3300031548 | Bacteria | 1388 |
| 491 | Ga0307408_100888051 | 3300031548 | Bacteria | 815 |
| 492 | Ga0316575_10021290 | 3300031665 | Bacteria | 2494 |
| 493 | Ga0316575_10057190 | 3300031665 | Bacteria | 1554 |
| 494 | Ga0316575_10111687 | 3300031665 | Bacteria | 1115 |
| 495 | Ga0316575_10215105 | 3300031665 | Bacteria | 802 |
| 496 | Ga0316579_10003640 | 3300031691 | Bacteria | 6055 |
| 497 | Ga0316579_10006147 | 3300031691 | Bacteria | 4882 |
| 498 | Ga0316579_10224917 | 3300031691 | Bacteria | 907 |
| 499 | Ga0265314_10238935 | 3300031711 | Bacteria | 1049 |
| 500 | Ga0316576_10004692 | 3300031727 | Bacteria | 8247 |
| 501 | Ga0316576_10091931 | 3300031727 | Bacteria | 2261 |
| 502 | Ga0316576_10166444 | 3300031727 | Bacteria | 1663 |
| 503 | Ga0316576_10442004 | 3300031727 | Bacteria | 961 |
| 504 | Ga0316576_10657522 | 3300031727 | Unclassified | 762 |
| 505 | Ga0316578_10004409 | 3300031728 | Bacteria | 6646 |
| 506 | Ga0316578_10021277 | 3300031728 | Bacteria | 3599 |
| 507 | Ga0316578_10096183 | 3300031728 | Bacteria | 1772 |
| 508 | Ga0316578_10173081 | 3300031728 | Bacteria | 1301 |
| 509 | Ga0316578_10205734 | 3300031728 | Bacteria | 1184 |
| 510 | Ga0316578_10656132 | 3300031728 | Unclassified | 612 |
| 511 | Ga0307516_10003661 | 3300031730 | Bacteria | 19536 |
| 512 | Ga0307405_10123021 | 3300031731 | Bacteria | 1778 |
| 513 | Ga0316577_10003896 | 3300031733 | Bacteria | 7612 |
| 514 | Ga0316577_10007336 | 3300031733 | Bacteria | 5883 |
| 515 | Ga0316577_10019420 | 3300031733 | Bacteria | 3760 |
| 516 | Ga0316577_10089544 | 3300031733 | Bacteria | 1722 |
| 517 | Ga0316577_10177082 | 3300031733 | Bacteria | 1204 |
| 518 | Ga0307413_10110526 | 3300031824 | Bacteria | 1839 |
| 519 | Ga0307407_10153186 | 3300031903 | Bacteria | 1500 |
| 520 | Ga0307407_10923514 | 3300031903 | Bacteria | 671 |
| 521 | Ga0307407_11066934 | 3300031903 | Bacteria | 627 |
| 522 | Ga0307412_10009620 | 3300031911 | Bacteria | 5552 |
| 523 | Ga0307412_10026010 | 3300031911 | Bacteria | 3632 |
| 524 | Ga0307412_10450903 | 3300031911 | Bacteria | 1060 |
| 525 | Ga0307412_11722463 | 3300031911 | Bacteria | 575 |
| 526 | Ga0307409_100085198 | 3300031995 | Bacteria | 2568 |
| 527 | Ga0307416_100054918 | 3300032002 | Bacteria | 3204 |
| 528 | Ga0307416_100441685 | 3300032002 | Bacteria | 1351 |
| 529 | Ga0307416_100641004 | 3300032002 | Bacteria | 1146 |
| 530 | Ga0307416_100684642 | 3300032002 | Bacteria | 1113 |
| 531 | Ga0307416_101842131 | 3300032002 | Unclassified | 709 |
| 532 | Ga0307411_10345649 | 3300032005 | Bacteria | 1210 |
| 533 | Ga0316583_10002461 | 3300032133 | Bacteria | 6430 |
| 534 | Ga0316583_10005516 | 3300032133 | Bacteria | 4538 |
| 535 | Ga0316583_10006071 | 3300032133 | Bacteria | 4343 |
| 536 | Ga0316583_10013425 | 3300032133 | Bacteria | 2955 |
| 537 | Ga0316583_10014002 | 3300032133 | Bacteria | 2893 |
| 538 | Ga0316583_10021900 | 3300032133 | Bacteria | 2290 |
| 539 | Ga0316585_10004285 | 3300032137 | Bacteria | 3961 |
| 540 | Ga0316585_10038483 | 3300032137 | Bacteria | 1520 |
| 541 | Ga0316585_10109149 | 3300032137 | Bacteria | 909 |
| 542 | Ga0316580_10005429 | 3300032139 | Bacteria | 3719 |
| 543 | Ga0316580_10019260 | 3300032139 | Bacteria | 2100 |
| 544 | Ga0316580_10024094 | 3300032139 | Bacteria | 1880 |
| 545 | Ga0316580_10050846 | 3300032139 | Bacteria | 1277 |
| 546 | Ga0316580_10088339 | 3300032139 | Bacteria | 948 |
| 547 | Ga0316593_10073963 | 3300032168 | Bacteria | 1181 |
| 548 | Ga0316593_10141548 | 3300032168 | Unclassified | 871 |
| 549 | Ga0316592_1035586 | 3300033524 | Bacteria | 1092 |
| 550 | Ga0316592_1041734 | 3300033524 | Bacteria | 1016 |
| 551 | Ga0316592_1052280 | 3300033524 | Bacteria | 913 |
| 552 | Ga0316588_1083830 | 3300033528 | Bacteria | 791 |
| 553 | Ga0316596_1085741 | 3300033541 | Bacteria | 848 |
| 554 | Ga0373930_0147247 | 3300034816 | Unclassified | 589 |
| 555 | Ga0373940_0118784 | 3300035088 | Bacteria | 818 |
| 556 | Ga0373952_0027441 | 3300035092 | Bacteria | 1243 |
| 557 | Ga0373923_0174511 | 3300035111 | Bacteria | 985 |
| 558 | Ga0373941_0039210 | 3300035115 | Bacteria | 1455 |
| 559 | Ga0373941_0213074 | 3300035115 | Unclassified | 739 |
| 560 | Ga0373941_0329374 | 3300035115 | Bacteria | 616 |
| 561 | Ga0373954_0290706 | 3300035118 | Bacteria | 806 |
| 562 | Ga0316574_0036726 | 3300035398 | Bacteria | 3000 |
| 563 | Ga0316574_0105574 | 3300035398 | Bacteria | 1804 |
| 564 | Ga0316574_0116100 | 3300035398 | Bacteria | 1717 |
| 565 | Ga0316574_0151079 | 3300035398 | Bacteria | 1496 |
| 566 | Ga0316574_0162686 | 3300035398 | Bacteria | 1437 |
| 567 | Ga0316574_0189279 | 3300035398 | Bacteria | 1323 |
| 568 | Ga0316574_0270134 | 3300035398 | Bacteria | 1085 |
| 569 | Ga0316574_0438427 | 3300035398 | Bacteria | 819 |
| 570 | Ga0316574_0515542 | 3300035398 | Bacteria | 744 |
| 571 | Ga0373931_0223720 | 3300035691 | Unclassified | 1134 |
| 572 | Ga0373931_0600640 | 3300035691 | Bacteria | 719 |
| 573 | Ga0373927_0556784 | 3300035695 | Bacteria | 758 |
| 574 | Ga0373937_0555560 | 3300036401 | Bacteria | 1090 |
| 575 | Ga0373937_1069036 | 3300036401 | Archaea | 756 |
| 576 | Ga0316582_0036724 | 3300036647 | Bacteria | 3033 |
| 577 | Ga0316582_0064647 | 3300036647 | Bacteria | 2354 |
| 578 | Ga0316582_0080866 | 3300036647 | Bacteria | 2121 |
| 579 | Ga0316582_0093134 | 3300036647 | Bacteria | 1986 |
| 580 | Ga0316582_0104022 | 3300036647 | Bacteria | 1883 |
| 581 | Ga0316582_0401464 | 3300036647 | Bacteria | 944 |
| 582 | Ga0316582_0883827 | 3300036647 | Unclassified | 611 |
| 583 | Ga0316584_0009856 | 3300036712 | Bacteria | 6651 |
| 584 | Ga0316584_0018788 | 3300036712 | Bacteria | 4990 |
| 585 | Ga0316584_0026007 | 3300036712 | Bacteria | 4297 |
| 586 | Ga0316584_0037213 | 3300036712 | Bacteria | 3614 |
| 587 | Ga0316584_0043982 | 3300036712 | Bacteria | 3330 |
| 588 | Ga0316584_0098986 | 3300036712 | Bacteria | 2183 |
| 589 | Ga0316584_0135460 | 3300036712 | Bacteria | 1838 |
| 590 | Ga0316584_0136021 | 3300036712 | Bacteria | 1834 |
| 591 | Ga0316584_0266050 | 3300036712 | Bacteria | 1249 |
| 592 | Ga0395900_0753905 | 3300037418 | Bacteria | 904 |
| 593 | Ga0395898_0005965 | 3300037466 | Bacteria | 13081 |
| 594 | Ga0395898_0205352 | 3300037466 | Bacteria | 1880 |
| 595 | Ga0395905_0679799 | 3300037471 | Bacteria | 932 |
| 596 | Ga0395901_0101708 | 3300038443 | Bacteria | 3015 |
| 597 | Ga0395901_0350332 | 3300038443 | Bacteria | 1524 |
| 598 | Ga0395901_0353941 | 3300038443 | Bacteria | 1515 |
| 599 | Ga0400490_12262 | 3300038726 | Bacteria | 1525 |
| 600 | Ga0400490_24805 | 3300038726 | Bacteria | 2130 |
| 601 | Ga0400490_26858 | 3300038726 | Unclassified | 2612 |
| 602 | Ga0400490_53122 | 3300038726 | Bacteria | 6480 |
| 603 | Ga0400491_06308 | 3300038727 | Bacteria | 1921 |
| 604 | Ga0400483_003518 | 3300039062 | Bacteria | 1858 |
| 605 | Ga0400483_066915 | 3300039062 | Bacteria | 1517 |
| 606 | Ga0400483_172963 | 3300039062 | Bacteria | 9206 |
| 607 | Ga0400483_197737 | 3300039062 | Bacteria | 1441 |
| 608 | Ga0400483_199463 | 3300039062 | Bacteria | 1164 |
| 609 | Ga0400483_207579 | 3300039062 | Bacteria | 1015 |
| 610 | Ga0400489_49933 | 3300039093 | Bacteria | 10562 |
| 611 | Ga0400487_54724 | 3300039110 | Bacteria | 11185 |
| 612 | Ga0436361_0302838 | 3300039447 | Bacteria | 665 |
| 613 | Ga0451791_0443858 | 3300041451 | Bacteria | 514 |
| 614 | Ga0451795_0018265 | 3300041456 | Bacteria | 670 |
| 615 | Ga0451795_0051390 | 3300041456 | Bacteria | 661 |
| 616 | Ga0451795_0303860 | 3300041456 | Bacteria | 2944 |
| 617 | Ga0451795_0439762 | 3300041456 | Bacteria | 752 |
| 618 | Ga0451795_1456898 | 3300041456 | Bacteria | 548 |
| 619 | Ga0451795_1520285 | 3300041456 | Bacteria | 950 |
| 620 | Ga0451802_0956397 | 3300041460 | Bacteria | 1729 |
| 621 | Ga0451855_0074105 | 3300041511 | Bacteria | 588 |
| 622 | Ga0451855_0453732 | 3300041511 | Bacteria | 670 |
| 623 | Ga0451855_0602217 | 3300041511 | Bacteria | 1235 |
| 624 | Ga0451855_0666493 | 3300041511 | Bacteria | 862 |
| 625 | Ga0451855_1110680 | 3300041511 | Bacteria | 766 |
| 626 | Ga0451855_1286470 | 3300041511 | Bacteria | 1694 |
| 627 | Ga0451855_1506058 | 3300041511 | Bacteria | 935 |
| 628 | Ga0451855_1518801 | 3300041511 | Bacteria | 1577 |
| 629 | Ga0439437_040284 | 3300042000 | Bacteria | 604 |
| 630 | Ga0439441_107532 | 3300042001 | Bacteria | 630 |
| 631 | Ga0439445_0070523 | 3300042004 | Bacteria | 966 |
| 632 | Ga0439448_0066351 | 3300042005 | Bacteria | 1198 |
| 633 | Ga0439432_061153 | 3300042006 | Bacteria | 1161 |
| 634 | Ga0439449_0002400 | 3300042007 | Bacteria | 7330 |
| 635 | Ga0439452_030038 | 3300042010 | Bacteria | 1344 |
| 636 | Ga0439454_023090 | 3300042011 | Unclassified | 931 |
| 637 | Ga0450911_000112 | 3300042115 | Bacteria | 33288 |
| 638 | Ga0450923_111061 | 3300042125 | Unclassified | 640 |
| 639 | Ga0450902_040902 | 3300042137 | Bacteria | 789 |
| 640 | Ga0439446_0104052 | 3300042156 | Bacteria | 900 |
| 641 | Ga0439434_0108609 | 3300042435 | Bacteria | 897 |
| 642 | Ga0439435_0193902 | 3300042436 | Unclassified | 667 |
| 643 | Ga0439444_0074380 | 3300042437 | Bacteria | 733 |
| 644 | Ga0439464_0284124 | 3300042439 | Bacteria | 538 |
| 645 | Ga0439460_0005773 | 3300042461 | Bacteria | 3049 |
| 646 | Ga0439460_0284735 | 3300042461 | Bacteria | 576 |
| 647 | Ga0450893_0016930 | 3300042532 | Bacteria | 1237 |
| 648 | Ga0451577_0000006 | 3300042876 | Bacteria | 709265 |
| 649 | Ga0451577_0015345 | 3300042876 | Bacteria | 7129 |
| 650 | Ga0451577_0052660 | 3300042876 | Bacteria | 3634 |
| 651 | Ga0451577_0058339 | 3300042876 | Bacteria | 3441 |
| 652 | Ga0451577_0166504 | 3300042876 | Bacteria | 1986 |
| 653 | Ga0451577_0237062 | 3300042876 | Bacteria | 1650 |
| 654 | Ga0451577_0346600 | 3300042876 | Bacteria | 1347 |
| 655 | Ga0451577_0388942 | 3300042876 | Bacteria | 1266 |
| 656 | Ga0451577_0527293 | 3300042876 | Bacteria | 1072 |
| 657 | Ga0466969_0021149 | 3300044656 | Bacteria | 3366 |
| 658 | Ga0453683_0000088 | 3300044673 | Bacteria | 138620 |
| 659 | Ga0453683_0003232 | 3300044673 | Bacteria | 12116 |
| 660 | Ga0453683_0046720 | 3300044673 | Bacteria | 2714 |
| 661 | Ga0453683_0054011 | 3300044673 | Bacteria | 2515 |
| 662 | Ga0453683_0308841 | 3300044673 | Unclassified | 1012 |
| 663 | Ga0453683_0684241 | 3300044673 | Bacteria | 672 |
| 664 | Ga0466966_0048015 | 3300044684 | Bacteria | 2720 |
| 665 | Ga0466961_0028067 | 3300044693 | Bacteria | 3619 |
| 666 | Ga0466963_0362968 | 3300044694 | Bacteria | 1020 |
| 667 | Ga0453684_0000037 | 3300044712 | Bacteria | 709327 |
| 668 | Ga0453684_0002361 | 3300044712 | Bacteria | 46138 |
| 669 | Ga0453684_0016369 | 3300044712 | Bacteria | 11604 |
| 670 | Ga0453684_0033391 | 3300044712 | Bacteria | 7177 |
| 671 | Ga0453684_0033906 | 3300044712 | Bacteria | 7102 |
| 672 | Ga0453684_0081385 | 3300044712 | Bacteria | 4039 |
| 673 | Ga0453684_0103528 | 3300044712 | Bacteria | 3478 |
| 674 | Ga0453684_0104957 | 3300044712 | Bacteria | 3448 |
| 675 | Ga0453684_0149331 | 3300044712 | Bacteria | 2779 |
| 676 | Ga0453684_0587797 | 3300044712 | Bacteria | 1222 |
| 677 | Ga0453684_0942742 | 3300044712 | Bacteria | 922 |
| 678 | Ga0466959_0025497 | 3300045049 | Bacteria | 4382 |
| 679 | Ga0466959_0325229 | 3300045049 | Bacteria | 1051 |
| 680 | Ga0451576_0000653 | 3300045051 | Bacteria | 71614 |
| 681 | Ga0451576_0001014 | 3300045051 | Bacteria | 51909 |
| 682 | Ga0451576_0001923 | 3300045051 | Bacteria | 33277 |
| 683 | Ga0451576_0006556 | 3300045051 | Bacteria | 14245 |
| 684 | Ga0451576_0012858 | 3300045051 | Bacteria | 9387 |
| 685 | Ga0451576_0018765 | 3300045051 | Bacteria | 7564 |
| 686 | Ga0451576_0036104 | 3300045051 | Bacteria | 5242 |
| 687 | Ga0451576_0130847 | 3300045051 | Bacteria | 2616 |
| 688 | Ga0451576_0133900 | 3300045051 | Bacteria | 2584 |
| 689 | Ga0451576_0230206 | 3300045051 | Bacteria | 1935 |
| 690 | Ga0466967_0081188 | 3300045976 | Bacteria | 2928 |
| 691 | Ga0495627_009631 | 3300046453 | Bacteria | 3546 |
| 692 | Ga0495592_0143979 | 3300046454 | Bacteria | 1655 |
| 693 | Ga0495603_0588880 | 3300046455 | Bacteria | 637 |
| 694 | Ga0495629_0062223 | 3300046459 | Bacteria | 2608 |
| 695 | Ga0495629_0194736 | 3300046459 | Unclassified | 1402 |
| 696 | Ga0495629_0291499 | 3300046459 | Unclassified | 1118 |
| 697 | Ga0495641_0001023 | 3300046461 | Bacteria | 24018 |
| 698 | Ga0495650_0000223 | 3300046471 | Bacteria | 118162 |
| 699 | Ga0495582_0527091 | 3300046473 | Bacteria | 683 |
| 700 | Ga0495605_0271752 | 3300046474 | Unclassified | 722 |
| 701 | Ga0495639_0004293 | 3300046475 | Bacteria | 6111 |
| 702 | Ga0495584_0054471 | 3300046491 | Bacteria | 2013 |
| 703 | Ga0495585_0167098 | 3300046492 | Bacteria | 1138 |
| 704 | Ga0495594_0713223 | 3300046499 | Bacteria | 567 |
| 705 | Ga0495606_0172047 | 3300046507 | Bacteria | 1256 |
| 706 | Ga0495616_0012572 | 3300046513 | Bacteria | 4799 |
| 707 | Ga0495637_0110525 | 3300046520 | Bacteria | 1066 |
| 708 | Ga0495644_0041092 | 3300046523 | Bacteria | 1742 |
| 709 | Ga0495663_0020640 | 3300046525 | Bacteria | 1892 |
| 710 | Ga0495642_0013795 | 3300046528 | Bacteria | 3131 |
| 711 | Ga0495654_0007735 | 3300046530 | Bacteria | 5982 |
| 712 | Ga0495621_0018835 | 3300046539 | Bacteria | 2247 |
| 713 | Ga0495597_0000509 | 3300046542 | Bacteria | 32286 |
| 714 | Ga0495622_0072498 | 3300046557 | Bacteria | 1589 |
| 715 | Ga0495633_0002712 | 3300046558 | Bacteria | 12283 |
| 716 | Ga0495633_0097948 | 3300046558 | Bacteria | 1362 |
| 717 | Ga0495656_0212365 | 3300046615 | Bacteria | 965 |
| 718 | Ga0495656_0276365 | 3300046615 | Bacteria | 855 |
| 719 | Ga0495659_0014635 | 3300046664 | Bacteria | 2571 |
| 720 | Ga0495661_0476559 | 3300046665 | Bacteria | 598 |
| 721 | Ga0495588_0141435 | 3300046674 | Bacteria | 1271 |
| 722 | Ga0495657_0093215 | 3300046675 | Bacteria | 1928 |
| 723 | Ga0495658_0010228 | 3300046683 | Bacteria | 4690 |
| 724 | Ga0495658_0149588 | 3300046683 | Bacteria | 1433 |
| 725 | Ga0495624_0246937 | 3300046690 | Bacteria | 1080 |
| 726 | Ga0495671_0006838 | 3300046692 | Bacteria | 6555 |
| 727 | Ga0495681_0382064 | 3300047470 | Bacteria | 530 |
| 728 | Ga0495686_0000003 | 3300047472 | Bacteria | 899502 |
| 729 | Ga0495686_0250066 | 3300047472 | Unclassified | 996 |
| 730 | Ga0495614_0222909 | 3300048089 | Bacteria | 857 |
| 731 | Ga0496100_0002768 | 3300048903 | Bacteria | 8964 |
| 732 | Ga0496100_0022683 | 3300048903 | Bacteria | 3801 |
| 733 | Ga0496100_0061173 | 3300048903 | Bacteria | 2481 |
| 734 | Ga0496101_0000838 | 3300048904 | Bacteria | 18079 |
| 735 | Ga0496101_0001878 | 3300048904 | Bacteria | 12687 |
| 736 | Ga0496101_0697824 | 3300048904 | Bacteria | 801 |
| 737 | Ga0496102_0015405 | 3300048905 | Bacteria | 6658 |
| 738 | Ga0496103_0001500 | 3300048906 | Bacteria | 15621 |
| 739 | Ga0496104_0001186 | 3300048907 | Bacteria | 22389 |
| 740 | Ga0496104_0069098 | 3300048907 | Bacteria | 3357 |
| 741 | Ga0496105_0000964 | 3300048908 | Bacteria | 19760 |
| 742 | Ga0496105_0001878 | 3300048908 | Bacteria | 15073 |
| 743 | Ga0496106_0000361 | 3300048909 | Bacteria | 32313 |
| 744 | Ga0496106_0116109 | 3300048909 | Bacteria | 2088 |
| 745 | Ga0496107_0000282 | 3300048910 | Bacteria | 26883 |
| 746 | Ga0496108_0002791 | 3300048911 | Bacteria | 13997 |
| 747 | Ga0496108_0036317 | 3300048911 | Bacteria | 4100 |
| 748 | Ga0496108_0284652 | 3300048911 | Bacteria | 1439 |
| 749 | Ga0496109_0003897 | 3300048912 | Bacteria | 12466 |
| 750 | Ga0496109_0059902 | 3300048912 | Bacteria | 3478 |
| 751 | Ga0496110_0002382 | 3300048913 | Bacteria | 14089 |
| 752 | Ga0496110_0039387 | 3300048913 | Bacteria | 4114 |
| 753 | Ga0496110_0068524 | 3300048913 | Bacteria | 3140 |
| 754 | Ga0496110_1917535 | 3300048913 | Bacteria | 502 |
| 755 | Ga0496111_0006540 | 3300048914 | Bacteria | 7579 |
| 756 | Ga0496112_0008872 | 3300048915 | Bacteria | 9022 |
| 757 | Ga0496112_0198073 | 3300048915 | Bacteria | 1969 |
| 758 | Ga0496113_0050340 | 3300048916 | Bacteria | 3105 |
| 759 | Ga0496113_0152039 | 3300048916 | Bacteria | 1827 |
| 760 | Ga0496113_0324079 | 3300048916 | Bacteria | 1235 |
| 761 | Ga0496114_0032784 | 3300048917 | Bacteria | 4278 |
| 762 | Ga0496114_1725220 | 3300048917 | Bacteria | 514 |
| 763 | Ga0496115_1226661 | 3300048918 | Bacteria | 562 |
| 764 | Ga0496116_0001255 | 3300048919 | Bacteria | 29451 |
| 765 | Ga0496116_0001671 | 3300048919 | Bacteria | 24360 |
| 766 | Ga0496116_0043436 | 3300048919 | Bacteria | 3062 |
| 767 | Ga0496117_0037922 | 3300048920 | Bacteria | 3583 |
| 768 | Ga0496117_0053150 | 3300048920 | Bacteria | 2848 |
| 769 | Ga0496118_0009508 | 3300048921 | Bacteria | 9798 |
| 770 | Ga0496118_0020495 | 3300048921 | Bacteria | 5859 |
| 771 | Ga0496118_0136369 | 3300048921 | Bacteria | 1565 |
| 772 | Ga0496119_0005344 | 3300048922 | Bacteria | 12354 |
| 773 | Ga0496120_0038206 | 3300048923 | Bacteria | 2842 |
| 774 | Ga0496121_0002127 | 3300048924 | Bacteria | 31127 |
| 775 | Ga0496121_0016530 | 3300048924 | Bacteria | 7612 |
| 776 | Ga0496121_0069806 | 3300048924 | Bacteria | 2833 |
| 777 | Ga0496121_0158928 | 3300048924 | Bacteria | 1655 |
| 778 | Ga0496121_0177285 | 3300048924 | Bacteria | 1542 |
| 779 | Ga0496122_0000228 | 3300048925 | Bacteria | 125699 |
| 780 | Ga0496122_0007350 | 3300048925 | Bacteria | 12285 |
| 781 | Ga0496122_0023463 | 3300048925 | Bacteria | 5437 |
| 782 | Ga0496122_0132526 | 3300048925 | Bacteria | 1580 |
| 783 | Ga0496122_0233749 | 3300048925 | Bacteria | 1043 |
| 784 | Ga0496123_0004637 | 3300048926 | Bacteria | 14282 |
| 785 | Ga0496123_0035234 | 3300048926 | Bacteria | 3570 |
| 786 | Ga0496123_0098794 | 3300048926 | Bacteria | 1706 |
| 787 | Ga0496123_0147137 | 3300048926 | Bacteria | 1277 |
| 788 | Ga0496123_0245581 | 3300048926 | Bacteria | 886 |
| 789 | Ga0496124_0069625 | 3300048927 | Bacteria | 2921 |
| 790 | Ga0496124_0105095 | 3300048927 | Bacteria | 2282 |
| 791 | Ga0496124_0202684 | 3300048927 | Bacteria | 1507 |
| 792 | Ga0496124_0461952 | 3300048927 | Bacteria | 862 |
| 793 | Ga0496125_0006133 | 3300048928 | Bacteria | 13115 |
| 794 | Ga0496125_0008450 | 3300048928 | Bacteria | 10775 |
| 795 | Ga0496125_0045061 | 3300048928 | Bacteria | 3718 |
| 796 | Ga0496125_0073841 | 3300048928 | Bacteria | 2648 |
| 797 | Ga0496125_0076835 | 3300048928 | Bacteria | 2577 |
| 798 | Ga0496125_0079445 | 3300048928 | Bacteria | 2516 |
| 799 | Ga0496125_0146944 | 3300048928 | Bacteria | 1627 |
| 800 | Ga0496125_0261144 | 3300048928 | Bacteria | 1085 |
| 801 | Ga0496126_0000290 | 3300048929 | Bacteria | 106499 |
| 802 | Ga0496126_0005295 | 3300048929 | Bacteria | 14809 |
| 803 | Ga0496126_0026546 | 3300048929 | Bacteria | 5550 |
| 804 | Ga0496126_0178880 | 3300048929 | Bacteria | 1803 |
| 805 | Ga0496126_0210730 | 3300048929 | Bacteria | 1636 |
| 806 | Ga0501305_045330 | 3300049161 | Bacteria | 726 |
| 807 | Ga0501290_002057 | 3300049513 | Bacteria | 2640 |
| 808 | Ga0501291_000079 | 3300049514 | Bacteria | 11678 |
| 809 | Ga0501292_000089 | 3300049515 | Bacteria | 16685 |
| 810 | Ga0501293_001643 | 3300049516 | Bacteria | 1684 |
| 811 | Ga0501294_000183 | 3300049517 | Bacteria | 7685 |
| 812 | Ga0501295_001213 | 3300049518 | Bacteria | 2582 |
| 813 | Ga0501296_000565 | 3300049519 | Bacteria | 3634 |
| 814 | Ga0501298_000382 | 3300049521 | Bacteria | 5998 |
| 815 | Ga0501298_060035 | 3300049521 | Bacteria | 804 |
| 816 | Ga0501299_000156 | 3300049522 | Bacteria | 7716 |
| 817 | Ga0501315_022282 | 3300049531 | Bacteria | 863 |
| 818 | Ga0501321_018430 | 3300049537 | Bacteria | 847 |
| 819 | Ga0501031_0002920 | 3300049568 | Bacteria | 10934 |
| 820 | Ga0501031_0022187 | 3300049568 | Bacteria | 4135 |
| 821 | Ga0501031_0023129 | 3300049568 | Bacteria | 4053 |
| 822 | Ga0501031_0032889 | 3300049568 | Bacteria | 3382 |
| 823 | Ga0501031_0448490 | 3300049568 | Bacteria | 833 |
| 824 | Ga0501032_0006582 | 3300049569 | Bacteria | 8530 |
| 825 | Ga0501032_0013433 | 3300049569 | Bacteria | 5824 |
| 826 | Ga0501032_0062468 | 3300049569 | Bacteria | 2495 |
| 827 | Ga0501032_0223515 | 3300049569 | Bacteria | 1225 |
| 828 | Ga0501032_0250476 | 3300049569 | Bacteria | 1150 |
| 829 | Ga0501033_0001825 | 3300049570 | Bacteria | 18567 |
| 830 | Ga0501033_0033434 | 3300049570 | Bacteria | 3860 |
| 831 | Ga0501034_0000271 | 3300049571 | Bacteria | 93642 |
| 832 | Ga0501034_0137335 | 3300049571 | Bacteria | 2425 |
| 833 | Ga0501034_0303890 | 3300049571 | Bacteria | 1531 |
| 834 | Ga0501036_0000327 | 3300049572 | Bacteria | 33144 |
| 835 | Ga0501036_0010858 | 3300049572 | Bacteria | 7524 |
| 836 | Ga0501036_0036953 | 3300049572 | Bacteria | 4131 |
| 837 | Ga0501036_0260444 | 3300049572 | Unclassified | 1453 |
| 838 | Ga0501036_0743637 | 3300049572 | Unclassified | 809 |
| 839 | Ga0501036_1060805 | 3300049572 | Bacteria | 662 |
| 840 | Ga0501036_1662475 | 3300049572 | Bacteria | 515 |
| 841 | Ga0501037_0002561 | 3300049573 | Bacteria | 13135 |
| 842 | Ga0501037_0011288 | 3300049573 | Bacteria | 6574 |
| 843 | Ga0501037_0034755 | 3300049573 | Bacteria | 3718 |
| 844 | Ga0501037_0087534 | 3300049573 | Bacteria | 2254 |
| 845 | Ga0501038_0009050 | 3300049574 | Bacteria | 9139 |
| 846 | Ga0501038_0010326 | 3300049574 | Bacteria | 8541 |
| 847 | Ga0501039_0019159 | 3300049575 | Bacteria | 5251 |
| 848 | Ga0501039_0038148 | 3300049575 | Bacteria | 3711 |
| 849 | Ga0501039_0050789 | 3300049575 | Bacteria | 3208 |
| 850 | Ga0501039_0096625 | 3300049575 | Bacteria | 2303 |
| 851 | Ga0501039_0096823 | 3300049575 | Bacteria | 2301 |
| 852 | Ga0501040_0163992 | 3300049576 | Bacteria | 1572 |
| 853 | Ga0501040_1193584 | 3300049576 | Unclassified | 552 |
| 854 | Ga0501041_0007620 | 3300049577 | Bacteria | 6358 |
| 855 | Ga0501041_0027827 | 3300049577 | Bacteria | 3408 |
| 856 | Ga0501041_0088434 | 3300049577 | Bacteria | 1912 |
| 857 | Ga0501041_0109031 | 3300049577 | Bacteria | 1717 |
| 858 | Ga0501041_0343536 | 3300049577 | Unclassified | 943 |
| 859 | Ga0501042_0000917 | 3300049578 | Bacteria | 16532 |
| 860 | Ga0501042_0010054 | 3300049578 | Bacteria | 6326 |
| 861 | Ga0501042_0023574 | 3300049578 | Bacteria | 4308 |
| 862 | Ga0501042_0866102 | 3300049578 | Unclassified | 658 |
| 863 | Ga0501043_0000828 | 3300049579 | Bacteria | 27461 |
| 864 | Ga0501043_0031724 | 3300049579 | Bacteria | 4153 |
| 865 | Ga0501043_0097392 | 3300049579 | Bacteria | 2313 |
| 866 | Ga0501043_0225767 | 3300049579 | Bacteria | 1448 |
| 867 | Ga0501043_0538177 | 3300049579 | Unclassified | 869 |
| 868 | Ga0501043_0807282 | 3300049579 | Bacteria | 678 |
| 869 | Ga0501046_0002954 | 3300049580 | Bacteria | 15734 |
| 870 | Ga0501046_0006900 | 3300049580 | Bacteria | 10009 |
| 871 | Ga0501046_0008109 | 3300049580 | Bacteria | 9178 |
| 872 | Ga0501046_0960468 | 3300049580 | Unclassified | 594 |
| 873 | Ga0501047_0014841 | 3300049581 | Bacteria | 7416 |
| 874 | Ga0501047_0118072 | 3300049581 | Bacteria | 2534 |
| 875 | Ga0501047_0335325 | 3300049581 | Bacteria | 1350 |
| 876 | Ga0501048_0000904 | 3300049582 | Bacteria | 21878 |
| 877 | Ga0501048_0092568 | 3300049582 | Bacteria | 2132 |
| 878 | Ga0501048_0950224 | 3300049582 | Bacteria | 618 |
| 879 | Ga0501067_0053866 | 3300049583 | Bacteria | 2229 |
| 880 | Ga0501068_0043117 | 3300049584 | Bacteria | 2714 |
| 881 | Ga0501068_0612531 | 3300049584 | Unclassified | 710 |
| 882 | Ga0501071_0017323 | 3300049587 | Bacteria | 4966 |
| 883 | Ga0501071_0024606 | 3300049587 | Bacteria | 4211 |
| 884 | Ga0501071_0048033 | 3300049587 | Bacteria | 3068 |
| 885 | Ga0501071_0048526 | 3300049587 | Bacteria | 3054 |
| 886 | Ga0501071_0428191 | 3300049587 | Bacteria | 1012 |
| 887 | Ga0501072_0020273 | 3300049588 | Bacteria | 5150 |
| 888 | Ga0501072_1371593 | 3300049588 | Bacteria | 547 |
| 889 | Ga0501073_0438572 | 3300049589 | Unclassified | 903 |
| 890 | Ga0501074_0025240 | 3300049590 | Bacteria | 4317 |
| 891 | Ga0501076_0091481 | 3300049592 | Bacteria | 2447 |
| 892 | Ga0501076_0607308 | 3300049592 | Bacteria | 902 |
| 893 | Ga0501076_0785609 | 3300049592 | Unclassified | 786 |
| 894 | Ga0501198_004802 | 3300049649 | Bacteria | 1888 |
| 895 | Ga0501198_092441 | 3300049649 | Bacteria | 602 |
| 896 | Ga0501199_001420 | 3300049650 | Bacteria | 2169 |
| 897 | Ga0501202_000879 | 3300049652 | Bacteria | 4576 |
| 898 | Ga0501206_000174 | 3300049653 | Bacteria | 7078 |
| 899 | Ga0501207_008793 | 3300049654 | Bacteria | 1465 |
| 900 | Ga0501208_045654 | 3300049655 | Bacteria | 823 |
| 901 | Ga0501209_005740 | 3300049656 | Bacteria | 2264 |
| 902 | Ga0501211_003197 | 3300049658 | Bacteria | 1696 |
| 903 | Ga0501214_031099 | 3300049659 | Bacteria | 733 |
| 904 | Ga0501217_109927 | 3300049661 | Bacteria | 791 |
| 905 | Ga0501227_039298 | 3300049665 | Bacteria | 1164 |
| 906 | Ga0501228_002783 | 3300049666 | Bacteria | 1397 |
| 907 | Ga0501235_010481 | 3300049669 | Bacteria | 2025 |
| 908 | Ga0501239_001777 | 3300049672 | Bacteria | 1896 |
| 909 | Ga0501247_025930 | 3300049677 | Bacteria | 781 |
| 910 | Ga0501249_000272 | 3300049679 | Bacteria | 14779 |
| 911 | Ga0501251_000114 | 3300049681 | Bacteria | 6532 |
| 912 | Ga0501255_000792 | 3300049684 | Bacteria | 2320 |
| 913 | Ga0501256_010439 | 3300049685 | Bacteria | 886 |
| 914 | Ga0501257_001912 | 3300049686 | Bacteria | 4333 |
| 915 | Ga0501259_010291 | 3300049688 | Bacteria | 1527 |
| 916 | Ga0501260_000129 | 3300049689 | Bacteria | 5425 |
| 917 | Ga0501261_000625 | 3300049690 | Bacteria | 4487 |
| 918 | Ga0501219_001317 | 3300049703 | Bacteria | 2535 |
| 919 | Ga0501221_000163 | 3300049704 | Bacteria | 9011 |
| 920 | Ga0501225_0004309 | 3300049705 | Bacteria | 4254 |
| 921 | Ga0501229_005230 | 3300049706 | Bacteria | 1589 |
| 922 | Ga0501234_000770 | 3300049707 | Bacteria | 4982 |
| 923 | Ga0501245_000167 | 3300049708 | Bacteria | 7152 |
| 924 | Ga0501079_0122109 | 3300049741 | Bacteria | 2026 |
| 925 | Ga0501079_1071898 | 3300049741 | Bacteria | 635 |
| 926 | Ga0501080_0033173 | 3300049742 | Bacteria | 4819 |
| 927 | Ga0501080_0186548 | 3300049742 | Bacteria | 1907 |
| 928 | Ga0501080_0665970 | 3300049742 | Unclassified | 920 |
| 929 | Ga0501081_0148462 | 3300049743 | Bacteria | 1683 |
| 930 | Ga0501081_0287978 | 3300049743 | Unclassified | 1204 |
| 931 | Ga0501081_0902209 | 3300049743 | Unclassified | 666 |
| 932 | Ga0501083_0009799 | 3300049744 | Bacteria | 6764 |
| 933 | Ga0501241_060507 | 3300049758 | Bacteria | 760 |
| 934 | Ga0501266_005449 | 3300049763 | Bacteria | 1581 |
| 935 | Ga0501268_001028 | 3300049765 | Bacteria | 3330 |
| 936 | Ga0501270_000726 | 3300049767 | Bacteria | 2919 |
| 937 | Ga0501271_000056 | 3300049768 | Bacteria | 8419 |
| 938 | Ga0501272_001584 | 3300049769 | Bacteria | 2180 |
| 939 | Ga0501273_002115 | 3300049770 | Bacteria | 1993 |
| 940 | Ga0501278_000356 | 3300049774 | Bacteria | 3533 |
| 941 | Ga0501279_012795 | 3300049775 | Bacteria | 1143 |
| 942 | Ga0501281_01917 | 3300049777 | Bacteria | 1559 |
| 943 | Ga0501282_004434 | 3300049778 | Bacteria | 1505 |
| 944 | Ga0501283_000150 | 3300049779 | Bacteria | 8887 |
| 945 | Ga0501035_0000973 | 3300049822 | Bacteria | 30267 |
| 946 | Ga0501035_0001442 | 3300049822 | Bacteria | 24365 |
| 947 | Ga0501035_0276014 | 3300049822 | Bacteria | 1421 |
| 948 | Ga0501044_0002872 | 3300049823 | Bacteria | 19620 |
| 949 | Ga0501045_0075363 | 3300049824 | Bacteria | 2485 |
| 950 | Ga0501045_0096219 | 3300049824 | Bacteria | 2191 |
| 951 | Ga0501045_0325322 | 3300049824 | Unclassified | 1144 |
| 952 | Ga0501226_001260 | 3300049853 | Bacteria | 3278 |
| 953 | nmdc:mga03683_215138_c1 | 3300050489 | Bacteria | 885 |
| 954 | nmdc:mga03683_52557_c1 | 3300050489 | Bacteria | 1703 |
| 955 | nmdc:mga03683_54619_c1 | 3300050489 | Bacteria | 1675 |
| 956 | nmdc:mga03n38_65449_c1 | 3300050490 | Bacteria | 1667 |
| 957 | nmdc:mga00v17_422526_c1 | 3300050491 | Bacteria | 866 |
| 958 | nmdc:mga0k408_3497_c1 | 3300050493 | Bacteria | 3125 |
| 959 | nmdc:mga0k408_48886_c1 | 3300050493 | Bacteria | 2448 |
| 960 | nmdc:mga06z11_151902_c1 | 3300050494 | Bacteria | 1317 |
| 961 | nmdc:mga07m45_13717_c1 | 3300050496 | Bacteria | 4304 |
| 962 | nmdc:mga05p37_214906_c1 | 3300050507 | Bacteria | 2323 |
| 963 | nmdc:mga05p37_63362_c1 | 3300050507 | Bacteria | 4549 |
| 964 | nmdc:mga05p37_793288_c1 | 3300050507 | Bacteria | 1037 |
| 965 | nmdc:mga05p37_975655_c1 | 3300050507 | Unclassified | 904 |
| 966 | nmdc:mga09592_199729_c1 | 3300050508 | Bacteria | 1732 |
| 967 | nmdc:mga09592_24168_c1 | 3300050508 | Bacteria | 5024 |
| 968 | nmdc:mga09592_486594_c1 | 3300050508 | Bacteria | 1063 |
| 969 | nmdc:mga09592_4984_c1 | 3300050508 | Bacteria | 10764 |
| 970 | nmdc:mga0qj67_185306_c1 | 3300050509 | Bacteria | 1691 |
| 971 | nmdc:mga0qj67_360472_c1 | 3300050509 | Bacteria | 1175 |
| 972 | nmdc:mga0qj67_4550_c1 | 3300050509 | Bacteria | 10050 |
| 973 | nmdc:mga06r32_70368_c1 | 3300050510 | Bacteria | 3383 |
| 974 | nmdc:mga08y16_15713_c1 | 3300050511 | Bacteria | 7962 |
| 975 | nmdc:mga0n895_109332_c1 | 3300050512 | Bacteria | 2780 |
| 976 | nmdc:mga0n895_273122_c1 | 3300050512 | Bacteria | 1715 |
| 977 | nmdc:mga0n895_282768_c1 | 3300050512 | Bacteria | 1682 |
| 978 | nmdc:mga0n895_300554_c1 | 3300050512 | Bacteria | 1627 |
| 979 | nmdc:mga0rr50_29699_c1 | 3300050513 | Bacteria | 3860 |
| 980 | nmdc:mga0rr50_76224_c1 | 3300050513 | Bacteria | 2574 |
| 981 | nmdc:mga08x19_158371_c1 | 3300050514 | Bacteria | 1537 |
| 982 | nmdc:mga08x19_257680_c1 | 3300050514 | Bacteria | 1205 |
| 983 | nmdc:mga08x19_431462_c1 | 3300050514 | Bacteria | 926 |
| 984 | Ga0495601_0793509 | 3300053077 | Bacteria | 601 |
| 985 | Ga0495612_0507157 | 3300053078 | Bacteria | 554 |
| 986 | Ga0500651_0000259 | 3300053093 | Bacteria | 31610 |
| 987 | Ga0500651_0209568 | 3300053093 | Bacteria | 1147 |
| 988 | Ga0500566_0254454 | 3300053094 | Bacteria | 852 |
| 989 | Ga0500569_123858 | 3300053109 | Bacteria | 862 |
| 990 | Ga0500593_014233 | 3300053117 | Bacteria | 3408 |
| 991 | Ga0500593_077226 | 3300053117 | Bacteria | 1434 |
| 992 | Ga0500607_119260 | 3300053121 | Bacteria | 1279 |
| 993 | Ga0500618_041356 | 3300053125 | Bacteria | 1058 |
| 994 | Ga0500628_007390 | 3300053129 | Bacteria | 1883 |
| 995 | Ga0500655_003197 | 3300053133 | Bacteria | 2971 |
| 996 | Ga0500658_0024735 | 3300053134 | Bacteria | 2302 |
| 997 | Ga0500564_003072 | 3300053138 | Bacteria | 6378 |
| 998 | Ga0500574_097406 | 3300053141 | Bacteria | 871 |
| 999 | Ga0500600_0010721 | 3300053149 | Bacteria | 5552 |
| 1000 | Ga0500616_0006338 | 3300053153 | Bacteria | 7767 |
| 1001 | Ga0500627_0018916 | 3300053158 | Bacteria | 2735 |
| 1002 | Ga0500634_0013690 | 3300053161 | Bacteria | 4262 |
| 1003 | Ga0500638_089184 | 3300053162 | Bacteria | 1454 |
| 1004 | Ga0501084_0149372 | 3300054114 | Bacteria | 1969 |
| 1005 | Ga0587067_053520 | 3300059640 | Bacteria | 825 |
| 1006 | Ga0501082_0377009 | 3300060353 | Bacteria | 1238 |
| 1007 | Ga0501082_0850599 | 3300060353 | Unclassified | 798 |
| 1008 | Ga0530510_1158073 | 3300061734 | Bacteria | 593 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_1917535 | Ga0496110_1917535_53_463 | 134 |
| 2 | 3300049592 | Ga0501076_0607308 | Ga0501076_0607308_421_870 | 136 |
| 3 | 3300005364 | Ga0070673_100800191 | Ga0070673_1008001912 | 137 |
| 4 | 3300035398 | Ga0316574_0515542 | Ga0316574_0515542_43_468 | 138 |
| 5 | 3300041511 | Ga0451855_0074105 | Ga0451855_0074105_161_577 | 138 |
| 6 | 3300041511 | Ga0451855_1518801 | Ga0451855_1518801_1122_1538 | 138 |
| 7 | 3300049572 | Ga0501036_1060805 | Ga0501036_1060805_208_633 | 138 |
| 8 | 3300049655 | Ga0501208_045654 | Ga0501208_045654_277_756 | 138 |
| 9 | 3300027876 | Ga0209974_10037812 | Ga0209974_100378123 | 139 |
| 10 | 3300005937 | Ga0081455_10004599 | Ga0081455_1000459910 | 140 |
| 11 | 3300042439 | Ga0439464_0284124 | Ga0439464_0284124_12_434 | 140 |
| 12 | 3300003187 | JGI25151J46595_10002393 | JGI25151J46595_1000239311 | 143 |
| 13 | 3300003316 | rootH1_10000848 | rootH1_100008489 | 143 |
| 14 | 3300003320 | rootH2_10177648 | rootH2_101776485 | 143 |
| 15 | 3300003322 | rootL2_10052955 | rootL2_100529559 | 143 |
| 16 | 3300003790 | Ga0055528_1001614 | Ga0055528_10016142 | 143 |
| 17 | 3300005354 | Ga0070675_100067435 | Ga0070675_1000674352 | 143 |
| 18 | 3300005355 | Ga0070671_100029499 | Ga0070671_1000294992 | 143 |
| 19 | 3300005356 | Ga0070674_100452183 | Ga0070674_1004521832 | 143 |
| 20 | 3300005466 | Ga0070685_10865894 | Ga0070685_108658942 | 143 |
| 21 | 3300005543 | Ga0070672_100016405 | Ga0070672_1000164053 | 143 |
| 22 | 3300005618 | Ga0068864_100482785 | Ga0068864_1004827852 | 143 |
| 23 | 3300006163 | Ga0070715_10378055 | Ga0070715_103780552 | 143 |
| 24 | 3300009098 | Ga0105245_10067283 | Ga0105245_100672833 | 143 |
| 25 | 3300009147 | Ga0114129_10173690 | Ga0114129_101736904 | 143 |
| 26 | 3300009148 | Ga0105243_10000301 | Ga0105243_1000030162 | 143 |
| 27 | 3300009176 | Ga0105242_10003077 | Ga0105242_100030774 | 143 |
| 28 | 3300010375 | Ga0105239_10033289 | Ga0105239_100332894 | 143 |
| 29 | 3300011119 | Ga0105246_10000077 | Ga0105246_100000772 | 143 |
| 30 | 3300013297 | Ga0157378_10000237 | Ga0157378_1000023761 | 143 |
| 31 | 3300013307 | Ga0157372_10066231 | Ga0157372_100662313 | 143 |
| 32 | 3300014969 | Ga0157376_10010301 | Ga0157376_100103016 | 143 |
| 33 | 3300025273 | Ga0209673_1002278 | Ga0209673_10022784 | 143 |
| 34 | 3300025294 | Ga0209025_1055514 | Ga0209025_10555142 | 143 |
| 35 | 3300025302 | Ga0207426_1020714 | Ga0207426_10207142 | 143 |
| 36 | 3300025728 | Ga0207655_1105711 | Ga0207655_11057111 | 143 |
| 37 | 3300025728 | Ga0207655_1105720 | Ga0207655_11057201 | 143 |
| 38 | 3300025735 | Ga0207713_1002717 | Ga0207713_10027173 | 143 |
| 39 | 3300025900 | Ga0207710_10070718 | Ga0207710_100707182 | 143 |
| 40 | 3300025926 | Ga0207659_10243353 | Ga0207659_102433531 | 143 |
| 41 | 3300025931 | Ga0207644_10273012 | Ga0207644_102730123 | 143 |
| 42 | 3300025934 | Ga0207686_10035606 | Ga0207686_100356061 | 143 |
| 43 | 3300025935 | Ga0207709_10002077 | Ga0207709_100020778 | 143 |
| 44 | 3300025937 | Ga0207669_10412968 | Ga0207669_104129682 | 143 |
| 45 | 3300025940 | Ga0207691_10031036 | Ga0207691_100310362 | 143 |
| 46 | 3300031548 | Ga0307408_100042562 | Ga0307408_1000425623 | 143 |
| 47 | 3300032002 | Ga0307416_100054918 | Ga0307416_1000549183 | 143 |
| 48 | 3300046491 | Ga0495584_0054471 | Ga0495584_0054471_901_1380 | 143 |
| 49 | 3300046492 | Ga0495585_0167098 | Ga0495585_0167098_378_857 | 143 |
| 50 | 3300046507 | Ga0495606_0172047 | Ga0495606_0172047_136_615 | 143 |
| 51 | 3300046557 | Ga0495622_0072498 | Ga0495622_0072498_790_1269 | 143 |
| 52 | 3300046558 | Ga0495633_0097948 | Ga0495633_0097948_42_521 | 143 |
| 53 | 3300048903 | Ga0496100_0002768 | Ga0496100_0002768_3167_3646 | 143 |
| 54 | 3300048904 | Ga0496101_0001878 | Ga0496101_0001878_3821_4300 | 143 |
| 55 | 3300048906 | Ga0496103_0001500 | Ga0496103_0001500_14699_15178 | 143 |
| 56 | 3300048907 | Ga0496104_0001186 | Ga0496104_0001186_16954_17433 | 143 |
| 57 | 3300048908 | Ga0496105_0000964 | Ga0496105_0000964_9499_9978 | 143 |
| 58 | 3300048909 | Ga0496106_0000361 | Ga0496106_0000361_9498_9977 | 143 |
| 59 | 3300048910 | Ga0496107_0000282 | Ga0496107_0000282_16945_17424 | 143 |
| 60 | 3300048911 | Ga0496108_0002791 | Ga0496108_0002791_3949_4428 | 143 |
| 61 | 3300048912 | Ga0496109_0003897 | Ga0496109_0003897_7927_8406 | 143 |
| 62 | 3300048913 | Ga0496110_0002382 | Ga0496110_0002382_150_629 | 143 |
| 63 | 3300048914 | Ga0496111_0006540 | Ga0496111_0006540_3167_3646 | 143 |
| 64 | 3300048915 | Ga0496112_0008872 | Ga0496112_0008872_3353_3832 | 143 |
| 65 | 3300048916 | Ga0496113_0050340 | Ga0496113_0050340_2439_2918 | 143 |
| 66 | 3300048919 | Ga0496116_0001671 | Ga0496116_0001671_14210_14689 | 143 |
| 67 | 3300048920 | Ga0496117_0037922 | Ga0496117_0037922_131_610 | 143 |
| 68 | 3300048921 | Ga0496118_0020495 | Ga0496118_0020495_4353_4832 | 143 |
| 69 | 3300048922 | Ga0496119_0005344 | Ga0496119_0005344_2378_2857 | 143 |
| 70 | 3300048923 | Ga0496120_0038206 | Ga0496120_0038206_1532_2011 | 143 |
| 71 | 3300048924 | Ga0496121_0158928 | Ga0496121_0158928_910_1389 | 143 |
| 72 | 3300048925 | Ga0496122_0007350 | Ga0496122_0007350_5319_5798 | 143 |
| 73 | 3300048926 | Ga0496123_0004637 | Ga0496123_0004637_11958_12437 | 143 |
| 74 | 3300048927 | Ga0496124_0105095 | Ga0496124_0105095_156_635 | 143 |
| 75 | 3300048928 | Ga0496125_0008450 | Ga0496125_0008450_6414_6893 | 143 |
| 76 | 3300048929 | Ga0496126_0005295 | Ga0496126_0005295_14172_14651 | 143 |
| 77 | 3300049537 | Ga0501321_018430 | Ga0501321_018430_350_829 | 143 |
| 78 | 3300049649 | Ga0501198_092441 | Ga0501198_092441_69_548 | 143 |
| 79 | 3300050507 | nmdc:mga05p37_63362_c1 | nmdc:mga05p37_63362_c1_1833_2318 | 143 |
| 80 | 3300026089 | Ga0207648_10146577 | Ga0207648_101465773 | 144 |
| 81 | 3300036647 | Ga0316582_0401464 | Ga0316582_0401464_172_621 | 144 |
| 82 | 3300036712 | Ga0316584_0136021 | Ga0316584_0136021_608_1057 | 144 |
| 83 | 3300041451 | Ga0451791_0443858 | Ga0451791_0443858_14_448 | 144 |
| 84 | 3300009176 | Ga0105242_10533661 | Ga0105242_105336612 | 146 |
| 85 | 3300025934 | Ga0207686_10159391 | Ga0207686_101593912 | 146 |
| 86 | 3300028653 | Ga0265323_10003513 | Ga0265323_100035133 | 146 |
| 87 | 3300038726 | Ga0400490_12262 | Ga0400490_12262_1052_1501 | 146 |
| 88 | 3300009148 | Ga0105243_10440913 | Ga0105243_104409132 | 147 |
| 89 | 3300041456 | Ga0451795_1456898 | Ga0451795_1456898_11_457 | 147 |
| 90 | 3300049568 | Ga0501031_0023129 | Ga0501031_0023129_3214_3699 | 147 |
| 91 | 3300049569 | Ga0501032_0013433 | Ga0501032_0013433_2351_2836 | 147 |
| 92 | 3300049572 | Ga0501036_0010858 | Ga0501036_0010858_3063_3548 | 147 |
| 93 | 3300049573 | Ga0501037_0011288 | Ga0501037_0011288_2988_3473 | 147 |
| 94 | 3300049575 | Ga0501039_0050789 | Ga0501039_0050789_2058_2543 | 147 |
| 95 | 3300049577 | Ga0501041_0007620 | Ga0501041_0007620_3559_4044 | 147 |
| 96 | 3300049578 | Ga0501042_0000917 | Ga0501042_0000917_14541_15026 | 147 |
| 97 | 3300049579 | Ga0501043_0538177 | Ga0501043_0538177_261_746 | 147 |
| 98 | 3300049580 | Ga0501046_0002954 | Ga0501046_0002954_7584_8069 | 147 |
| 99 | 3300049582 | Ga0501048_0000904 | Ga0501048_0000904_18533_19018 | 147 |
| 100 | 3300049587 | Ga0501071_0017323 | Ga0501071_0017323_2644_3129 | 147 |
| 101 | 3300049822 | Ga0501035_0001442 | Ga0501035_0001442_11323_11808 | 147 |
| 102 | 3300054114 | Ga0501084_0149372 | Ga0501084_0149372_220_705 | 147 |
| 103 | 3300031456 | Ga0307513_10170463 | Ga0307513_101704632 | 148 |
| 104 | 3300003187 | JGI25151J46595_10009236 | JGI25151J46595_100092363 | 149 |
| 105 | 3300005366 | Ga0070659_100950387 | Ga0070659_1009503872 | 149 |
| 106 | 3300025901 | Ga0207688_10184774 | Ga0207688_101847742 | 149 |
| 107 | 3300039447 | Ga0436361_0302838 | Ga0436361_0302838_33_518 | 149 |
| 108 | 3300042436 | Ga0439435_0193902 | Ga0439435_0193902_15_464 | 149 |
| 109 | 3300042876 | Ga0451577_0058339 | Ga0451577_0058339_2868_3356 | 149 |
| 110 | 3300044712 | Ga0453684_0081385 | Ga0453684_0081385_1799_2290 | 149 |
| 111 | 3300049775 | Ga0501279_012795 | Ga0501279_012795_15_464 | 149 |
| 112 | 3300025294 | Ga0209025_1000652 | Ga0209025_100065237 | 151 |
| 113 | 3300035118 | Ga0373954_0290706 | Ga0373954_0290706_272_754 | 151 |
| 114 | 3300036401 | Ga0373937_1069036 | Ga0373937_1069036_76_558 | 151 |
| 115 | 3300037466 | Ga0395898_0205352 | Ga0395898_0205352_1169_1654 | 151 |
| 116 | 3300038443 | Ga0395901_0350332 | Ga0395901_0350332_393_878 | 151 |
| 117 | 3300046675 | Ga0495657_0093215 | Ga0495657_0093215_242_724 | 151 |
| 118 | 3300025945 | Ga0207679_10012799 | Ga0207679_100127996 | 152 |
| 119 | 3300041456 | Ga0451795_0439762 | Ga0451795_0439762_230_688 | 152 |
| 120 | 3300041511 | Ga0451855_0602217 | Ga0451855_0602217_101_559 | 152 |
| 121 | 3300041511 | Ga0451855_1110680 | Ga0451855_1110680_279_737 | 152 |
| 122 | 3300041511 | Ga0451855_1286470 | Ga0451855_1286470_1219_1677 | 152 |
| 123 | 3300039062 | Ga0400483_003518 | Ga0400483_003518_751_1236 | 153 |
| 124 | 3300041511 | Ga0451855_0453732 | Ga0451855_0453732_33_497 | 153 |
| 125 | iso_pu_bacteria | 2551306519 | 2553395078 | 154 |
| 126 | iso_pu_bacteria | 2643221729 | 2644705758 | 154 |
| 127 | iso_pu_bacteria | 2643221730 | 2644713279 | 154 |
| 128 | iso_pu_bacteria | 2671180330 | 2672333560 | 154 |
| 129 | iso_pu_bacteria | 2684622632 | 2685148235 | 154 |
| 130 | iso_pu_bacteria | 2695420987 | 2698319660 | 154 |
| 131 | iso_pu_bacteria | 2703719227 | 2705991981 | 154 |
| 132 | iso_pu_bacteria | 2718218445 | 2721503408 | 154 |
| 133 | iso_pu_bacteria | 2738541299 | 2738838967 | 154 |
| 134 | iso_pu_bacteria | 2738541358 | 2739160137 | 154 |
| 135 | iso_pu_bacteria | 2738543006 | 2739212611 | 154 |
| 136 | iso_pu_bacteria | 2738543010 | 2739234663 | 154 |
| 137 | iso_pu_bacteria | 2808606364 | 2808871150 | 154 |
| 138 | iso_pu_bacteria | 2816332186 | 2816866408 | 154 |
| 139 | iso_pu_bacteria | 2818991443 | 2819585009 | 154 |
| 140 | iso_pu_bacteria | 2842682962 | 2842688245 | 154 |
| 141 | iso_pu_bacteria | 2843690924 | 2843694486 | 154 |
| 142 | iso_pu_bacteria | 2849139964 | 2849144939 | 154 |
| 143 | iso_pu_bacteria | 2857581216 | 2857586512 | 154 |
| 144 | iso_pu_bacteria | 2929233124 | 2929233234 | 154 |
| 145 | iso_pu_bacteria | 2938917290 | 2938917404 | 154 |
| 146 | iso_pu_bacteria | 2947426588 | 2947426702 | 154 |
| 147 | iso_pu_bacteria | 2956897341 | 2956900770 | 154 |
| 148 | iso_pu_bacteria | 2965761152 | 2965761294 | 154 |
| 149 | iso_pu_bacteria | 2969765954 | 2969766281 | 154 |
| 150 | iso_pu_bacteria | 2979083700 | 2979083712 | 154 |
| 151 | iso_pu_bacteria | 3006826541 | 3006831027 | 154 |
| 152 | iso_pu_bacteria | 3006988479 | 3006993242 | 154 |
| 153 | iso_pu_bacteria | 8022621104 | 8022621187 | 154 |
| 154 | iso_pu_bacteria | 8022653035 | 8022655849 | 154 |
| 155 | iso_pu_bacteria | 8023438354 | 8023439783 | 154 |
| 156 | iso_pu_bacteria | 8023444577 | 8023447362 | 154 |
| 157 | iso_pu_bacteria | 8057582654 | 8057582769 | 154 |
| 158 | 3300005331 | Ga0070670_100680692 | Ga0070670_1006806922 | 155 |
| 159 | 3300005338 | Ga0068868_101542837 | Ga0068868_1015428371 | 155 |
| 160 | 3300005340 | Ga0070689_100032573 | Ga0070689_1000325732 | 155 |
| 161 | 3300005341 | Ga0070691_10281962 | Ga0070691_102819622 | 155 |
| 162 | 3300005353 | Ga0070669_101151513 | Ga0070669_1011515131 | 155 |
| 163 | 3300005354 | Ga0070675_100053318 | Ga0070675_1000533182 | 155 |
| 164 | 3300005356 | Ga0070674_100087957 | Ga0070674_1000879572 | 155 |
| 165 | 3300005365 | Ga0070688_100009181 | Ga0070688_1000091814 | 155 |
| 166 | 3300005436 | Ga0070713_100248526 | Ga0070713_1002485262 | 155 |
| 167 | 3300005437 | Ga0070710_10429423 | Ga0070710_104294232 | 155 |
| 168 | 3300005439 | Ga0070711_100239150 | Ga0070711_1002391502 | 155 |
| 169 | 3300005441 | Ga0070700_100373090 | Ga0070700_1003730902 | 155 |
| 170 | 3300005457 | Ga0070662_100463818 | Ga0070662_1004638181 | 155 |
| 171 | 3300005459 | Ga0068867_100038577 | Ga0068867_1000385772 | 155 |
| 172 | 3300005466 | Ga0070685_10023806 | Ga0070685_100238062 | 155 |
| 173 | 3300005539 | Ga0068853_100239267 | Ga0068853_1002392672 | 155 |
| 174 | 3300005543 | Ga0070672_101289465 | Ga0070672_1012894652 | 155 |
| 175 | 3300005544 | Ga0070686_101009210 | Ga0070686_1010092101 | 155 |
| 176 | 3300005545 | Ga0070695_100542787 | Ga0070695_1005427872 | 155 |
| 177 | 3300005563 | Ga0068855_100523264 | Ga0068855_1005232642 | 155 |
| 178 | 3300005564 | Ga0070664_100760103 | Ga0070664_1007601032 | 155 |
| 179 | 3300005577 | Ga0068857_100931650 | Ga0068857_1009316502 | 155 |
| 180 | 3300005617 | Ga0068859_100901228 | Ga0068859_1009012282 | 155 |
| 181 | 3300005618 | Ga0068864_100949208 | Ga0068864_1009492082 | 155 |
| 182 | 3300005718 | Ga0068866_10168033 | Ga0068866_101680332 | 155 |
| 183 | 3300005841 | Ga0068863_100209106 | Ga0068863_1002091062 | 155 |
| 184 | 3300006058 | Ga0075432_10013954 | Ga0075432_100139541 | 155 |
| 185 | 3300006177 | Ga0075362_10166821 | Ga0075362_101668212 | 155 |
| 186 | 3300006195 | Ga0075366_10030633 | Ga0075366_100306333 | 155 |
| 187 | 3300006871 | Ga0075434_100065777 | Ga0075434_1000657773 | 155 |
| 188 | 3300006881 | Ga0068865_100962220 | Ga0068865_1009622202 | 155 |
| 189 | 3300006931 | Ga0097620_100901147 | Ga0097620_1009011472 | 155 |
| 190 | 3300009147 | Ga0114129_11605601 | Ga0114129_116056011 | 155 |
| 191 | 3300013104 | Ga0157370_10770339 | Ga0157370_107703392 | 155 |
| 192 | 3300013307 | Ga0157372_10209898 | Ga0157372_102098983 | 155 |
| 193 | 3300013308 | Ga0157375_10175253 | Ga0157375_101752533 | 155 |
| 194 | 3300014326 | Ga0157380_10743637 | Ga0157380_107436372 | 155 |
| 195 | 3300017792 | Ga0163161_10811448 | Ga0163161_108114482 | 155 |
| 196 | 3300025898 | Ga0207692_10150134 | Ga0207692_101501342 | 155 |
| 197 | 3300025901 | Ga0207688_10304188 | Ga0207688_103041882 | 155 |
| 198 | 3300025913 | Ga0207695_10425568 | Ga0207695_104255682 | 155 |
| 199 | 3300025916 | Ga0207663_10196324 | Ga0207663_101963242 | 155 |
| 200 | 3300025926 | Ga0207659_10501770 | Ga0207659_105017702 | 155 |
| 201 | 3300025928 | Ga0207700_10555566 | Ga0207700_105555661 | 155 |
| 202 | 3300025934 | Ga0207686_10363628 | Ga0207686_103636281 | 155 |
| 203 | 3300025937 | Ga0207669_10936025 | Ga0207669_109360252 | 155 |
| 204 | 3300025940 | Ga0207691_10036214 | Ga0207691_100362144 | 155 |
| 205 | 3300025949 | Ga0207667_10284138 | Ga0207667_102841383 | 155 |
| 206 | 3300025981 | Ga0207640_10426350 | Ga0207640_104263502 | 155 |
| 207 | 3300026035 | Ga0207703_10119885 | Ga0207703_101198853 | 155 |
| 208 | 3300026041 | Ga0207639_10078109 | Ga0207639_100781093 | 155 |
| 209 | 3300026075 | Ga0207708_10526614 | Ga0207708_105266142 | 155 |
| 210 | 3300026088 | Ga0207641_10148875 | Ga0207641_101488752 | 155 |
| 211 | 3300026089 | Ga0207648_10082026 | Ga0207648_100820263 | 155 |
| 212 | 3300026095 | Ga0207676_10611411 | Ga0207676_106114111 | 155 |
| 213 | 3300026116 | Ga0207674_10396465 | Ga0207674_103964652 | 155 |
| 214 | 3300026118 | Ga0207675_100075897 | Ga0207675_1000758972 | 155 |
| 215 | 3300026142 | Ga0207698_10151332 | Ga0207698_101513323 | 155 |
| 216 | 3300031456 | Ga0307513_10643423 | Ga0307513_106434232 | 155 |
| 217 | 3300031548 | Ga0307408_100888051 | Ga0307408_1008880512 | 155 |
| 218 | 3300031665 | Ga0316575_10057190 | Ga0316575_100571902 | 155 |
| 219 | 3300031691 | Ga0316579_10003640 | Ga0316579_100036405 | 155 |
| 220 | 3300031727 | Ga0316576_10091931 | Ga0316576_100919312 | 155 |
| 221 | 3300031728 | Ga0316578_10173081 | Ga0316578_101730812 | 155 |
| 222 | 3300031730 | Ga0307516_10003661 | Ga0307516_1000366114 | 155 |
| 223 | 3300031733 | Ga0316577_10003896 | Ga0316577_100038964 | 155 |
| 224 | 3300032002 | Ga0307416_100641004 | Ga0307416_1006410042 | 155 |
| 225 | 3300032133 | Ga0316583_10014002 | Ga0316583_100140022 | 155 |
| 226 | 3300032137 | Ga0316585_10038483 | Ga0316585_100384832 | 155 |
| 227 | 3300032139 | Ga0316580_10050846 | Ga0316580_100508462 | 155 |
| 228 | 3300035398 | Ga0316574_0116100 | Ga0316574_0116100_591_1058 | 155 |
| 229 | 3300035398 | Ga0316574_0151079 | Ga0316574_0151079_336_848 | 155 |
| 230 | 3300035695 | Ga0373927_0556784 | Ga0373927_0556784_124_597 | 155 |
| 231 | 3300036647 | Ga0316582_0104022 | Ga0316582_0104022_1262_1774 | 155 |
| 232 | 3300036647 | Ga0316582_0883827 | Ga0316582_0883827_76_543 | 155 |
| 233 | 3300036712 | Ga0316584_0018788 | Ga0316584_0018788_1709_2176 | 155 |
| 234 | 3300036712 | Ga0316584_0037213 | Ga0316584_0037213_2863_3375 | 155 |
| 235 | 3300037418 | Ga0395900_0753905 | Ga0395900_0753905_62_550 | 155 |
| 236 | 3300037471 | Ga0395905_0679799 | Ga0395905_0679799_205_693 | 155 |
| 237 | 3300041456 | Ga0451795_0018265 | Ga0451795_0018265_59_529 | 155 |
| 238 | 3300041460 | Ga0451802_0956397 | Ga0451802_0956397_416_898 | 155 |
| 239 | 3300045051 | Ga0451576_0000653 | Ga0451576_0000653_51205_51699 | 155 |
| 240 | 3300045051 | Ga0451576_0130847 | Ga0451576_0130847_425_892 | 155 |
| 241 | 3300046454 | Ga0495592_0143979 | Ga0495592_0143979_1048_1521 | 155 |
| 242 | 3300050489 | nmdc:mga03683_54619_c1 | nmdc:mga03683_54619_c1_725_1198 | 155 |
| 243 | 3300050493 | nmdc:mga0k408_3497_c1 | nmdc:mga0k408_3497_c1_1077_1550 | 155 |
| 244 | 3300050512 | nmdc:mga0n895_300554_c1 | nmdc:mga0n895_300554_c1_1077_1544 | 155 |
| 245 | 3300053078 | Ga0495612_0507157 | Ga0495612_0507157_42_527 | 155 |
| 246 | 3300053093 | Ga0500651_0209568 | Ga0500651_0209568_670_1137 | 155 |
| 247 | 3300053109 | Ga0500569_123858 | Ga0500569_123858_96_578 | 155 |
| 248 | 3300053117 | Ga0500593_077226 | Ga0500593_077226_614_1096 | 155 |
| 249 | iso_pu_bacteria | 2643221609 | 2644062108 | 155 |
| 250 | iso_pu_bacteria | 2643221611 | 2644070399 | 155 |
| 251 | iso_pu_bacteria | 2643221717 | 2644648949 | 155 |
| 252 | iso_pu_bacteria | 2643221731 | 2644721369 | 155 |
| 253 | iso_pu_bacteria | 2643221732 | 2644723354 | 155 |
| 254 | iso_pu_bacteria | 2721755523 | 2722884513 | 155 |
| 255 | iso_pu_bacteria | 2738543012 | 2739243947 | 155 |
| 256 | iso_pu_bacteria | 2818991465 | 2819711970 | 155 |
| 257 | iso_pu_bacteria | 2839138175 | 2839143109 | 155 |
| 258 | iso_pu_bacteria | 2842882022 | 2842887753 | 155 |
| 259 | iso_pu_bacteria | 2881101125 | 2881105023 | 155 |
| 260 | iso_pu_bacteria | 2904524088 | 2904530137 | 155 |
| 261 | iso_pu_bacteria | 2919143609 | 2919149606 | 155 |
| 262 | iso_pu_bacteria | 2919517244 | 2919523221 | 155 |
| 263 | iso_pu_bacteria | 2919720352 | 2919726442 | 155 |
| 264 | iso_pu_bacteria | 2928093941 | 2928099885 | 155 |
| 265 | iso_pu_bacteria | 2960319331 | 2960324313 | 155 |
| 266 | iso_pu_bacteria | 8022893055 | 8022893405 | 155 |
| 267 | iso_pu_bacteria | 8022914991 | 8022917945 | 155 |
| 268 | 3300001979 | JGI24740J21852_10022978 | JGI24740J21852_100229783 | 156 |
| 269 | 3300001979 | JGI24740J21852_10035018 | JGI24740J21852_100350183 | 156 |
| 270 | 3300001979 | JGI24740J21852_10041916 | JGI24740J21852_100419162 | 156 |
| 271 | 3300001989 | JGI24739J22299_10073669 | JGI24739J22299_100736692 | 156 |
| 272 | 3300002773 | JGI25152J39213_1009363 | JGI25152J39213_10093632 | 156 |
| 273 | 3300002773 | JGI25152J39213_1013311 | JGI25152J39213_10133112 | 156 |
| 274 | 3300002774 | JGI25150J39212_1002663 | JGI25150J39212_10026632 | 156 |
| 275 | 3300002774 | JGI25150J39212_1028980 | JGI25150J39212_10289802 | 156 |
| 276 | 3300002987 | JGI25159J45721_1000455 | JGI25159J45721_10004556 | 156 |
| 277 | 3300002987 | JGI25159J45721_1008909 | JGI25159J45721_10089092 | 156 |
| 278 | 3300002987 | JGI25159J45721_1008941 | JGI25159J45721_10089412 | 156 |
| 279 | 3300003187 | JGI25151J46595_10013010 | JGI25151J46595_100130103 | 156 |
| 280 | 3300003187 | JGI25151J46595_10024635 | JGI25151J46595_100246353 | 156 |
| 281 | 3300003187 | JGI25151J46595_10035559 | JGI25151J46595_100355592 | 156 |
| 282 | 3300003187 | JGI25151J46595_10106259 | JGI25151J46595_101062591 | 156 |
| 283 | 3300003215 | JGI25153J46596_10020886 | JGI25153J46596_100208863 | 156 |
| 284 | 3300003316 | rootH1_10026606 | rootH1_100266063 | 156 |
| 285 | 3300003323 | rootH1_10042628 | rootH1_100426283 | 156 |
| 286 | 3300003323 | rootH1_10084694 | rootH1_100846942 | 156 |
| 287 | 3300003354 | JGI25160J50197_1000148 | JGI25160J50197_100014813 | 156 |
| 288 | 3300003354 | JGI25160J50197_1000822 | JGI25160J50197_10008223 | 156 |
| 289 | 3300003354 | JGI25160J50197_1021441 | JGI25160J50197_10214412 | 156 |
| 290 | 3300003354 | JGI25160J50197_1021448 | JGI25160J50197_10214482 | 156 |
| 291 | 3300003374 | JGI25161J50226_1000111 | JGI25161J50226_100011140 | 156 |
| 292 | 3300003374 | JGI25161J50226_1004523 | JGI25161J50226_10045232 | 156 |
| 293 | 3300003374 | JGI25161J50226_1004914 | JGI25161J50226_10049143 | 156 |
| 294 | 3300003578 | Ga0006562J51391_1060112 | Ga0006562J51391_10601121 | 156 |
| 295 | 3300003761 | Ga0055535_1000653 | Ga0055535_100065324 | 156 |
| 296 | 3300003762 | Ga0055542_1000004 | Ga0055542_100000466 | 156 |
| 297 | 3300003771 | Ga0055526_1017208 | Ga0055526_10172082 | 156 |
| 298 | 3300003771 | Ga0055526_1017238 | Ga0055526_10172382 | 156 |
| 299 | 3300003773 | Ga0055537_1007008 | Ga0055537_10070082 | 156 |
| 300 | 3300003775 | Ga0055524_1015487 | Ga0055524_10154872 | 156 |
| 301 | 3300003775 | Ga0055524_1015518 | Ga0055524_10155182 | 156 |
| 302 | 3300003781 | Ga0055536_1010162 | Ga0055536_10101623 | 156 |
| 303 | 3300003781 | Ga0055536_1013833 | Ga0055536_10138333 | 156 |
| 304 | 3300003784 | Ga0055534_1003507 | Ga0055534_10035073 | 156 |
| 305 | 3300003784 | Ga0055534_1008619 | Ga0055534_10086192 | 156 |
| 306 | 3300003784 | Ga0055534_1009764 | Ga0055534_10097642 | 156 |
| 307 | 3300003790 | Ga0055528_1015323 | Ga0055528_10153232 | 156 |
| 308 | 3300003791 | Ga0055530_10013554 | Ga0055530_100135542 | 156 |
| 309 | 3300003791 | Ga0055530_10016612 | Ga0055530_100166123 | 156 |
| 310 | 3300003791 | Ga0055530_10046609 | Ga0055530_100466092 | 156 |
| 311 | 3300003792 | Ga0055540_1008365 | Ga0055540_10083653 | 156 |
| 312 | 3300003792 | Ga0055540_1013006 | Ga0055540_10130063 | 156 |
| 313 | 3300003792 | Ga0055540_1017000 | Ga0055540_10170002 | 156 |
| 314 | 3300003794 | Ga0055531_10025953 | Ga0055531_100259532 | 156 |
| 315 | 3300003794 | Ga0055531_10026712 | Ga0055531_100267122 | 156 |
| 316 | 3300004625 | Ga0055543_1000302 | Ga0055543_100030214 | 156 |
| 317 | 3300004625 | Ga0055543_1005187 | Ga0055543_10051873 | 156 |
| 318 | 3300004625 | Ga0055543_1010513 | Ga0055543_10105132 | 156 |
| 319 | 3300005262 | Ga0065165_1012873 | Ga0065165_10128733 | 156 |
| 320 | 3300005262 | Ga0065165_1013194 | Ga0065165_10131943 | 156 |
| 321 | 3300005262 | Ga0065165_1038578 | Ga0065165_10385782 | 156 |
| 322 | 3300005262 | Ga0065165_1051908 | Ga0065165_10519082 | 156 |
| 323 | 3300005262 | Ga0065165_1051909 | Ga0065165_10519092 | 156 |
| 324 | 3300005331 | Ga0070670_100163642 | Ga0070670_1001636422 | 156 |
| 325 | 3300005340 | Ga0070689_100043278 | Ga0070689_1000432783 | 156 |
| 326 | 3300005347 | Ga0070668_100973966 | Ga0070668_1009739661 | 156 |
| 327 | 3300005356 | Ga0070674_100398528 | Ga0070674_1003985282 | 156 |
| 328 | 3300005456 | Ga0070678_101403506 | Ga0070678_1014035062 | 156 |
| 329 | 3300005457 | Ga0070662_100463851 | Ga0070662_1004638511 | 156 |
| 330 | 3300005539 | Ga0068853_100111334 | Ga0068853_1001113342 | 156 |
| 331 | 3300005563 | Ga0068855_100064760 | Ga0068855_1000647603 | 156 |
| 332 | 3300005577 | Ga0068857_100177189 | Ga0068857_1001771892 | 156 |
| 333 | 3300005578 | Ga0068854_100328265 | Ga0068854_1003282652 | 156 |
| 334 | 3300005834 | Ga0068851_10078152 | Ga0068851_100781522 | 156 |
| 335 | 3300006177 | Ga0075362_10055705 | Ga0075362_100557052 | 156 |
| 336 | 3300006186 | Ga0075369_10174422 | Ga0075369_101744221 | 156 |
| 337 | 3300006186 | Ga0075369_10208070 | Ga0075369_102080702 | 156 |
| 338 | 3300006195 | Ga0075366_10057535 | Ga0075366_100575352 | 156 |
| 339 | 3300006353 | Ga0075370_10123572 | Ga0075370_101235722 | 156 |
| 340 | 3300006844 | Ga0075428_100490345 | Ga0075428_1004903453 | 156 |
| 341 | 3300006880 | Ga0075429_100017168 | Ga0075429_1000171684 | 156 |
| 342 | 3300009036 | Ga0105244_10207471 | Ga0105244_102074712 | 156 |
| 343 | 3300009147 | Ga0114129_10599091 | Ga0114129_105990912 | 156 |
| 344 | 3300009545 | Ga0105237_10500865 | Ga0105237_105008652 | 156 |
| 345 | 3300010375 | Ga0105239_10908435 | Ga0105239_109084352 | 156 |
| 346 | 3300013100 | Ga0157373_10128168 | Ga0157373_101281682 | 156 |
| 347 | 3300013102 | Ga0157371_10062595 | Ga0157371_100625952 | 156 |
| 348 | 3300013104 | Ga0157370_10474521 | Ga0157370_104745212 | 156 |
| 349 | 3300013105 | Ga0157369_10015992 | Ga0157369_100159925 | 156 |
| 350 | 3300013306 | Ga0163162_10550954 | Ga0163162_105509542 | 156 |
| 351 | 3300013307 | Ga0157372_10382990 | Ga0157372_103829901 | 156 |
| 352 | 3300025208 | Ga0209436_112914 | Ga0209436_1129142 | 156 |
| 353 | 3300025228 | Ga0209672_100531 | Ga0209672_10053118 | 156 |
| 354 | 3300025229 | Ga0209147_101412 | Ga0209147_1014123 | 156 |
| 355 | 3300025242 | Ga0209258_100022 | Ga0209258_10002266 | 156 |
| 356 | 3300025245 | Ga0207425_1001080 | Ga0207425_10010803 | 156 |
| 357 | 3300025245 | Ga0207425_1001242 | Ga0207425_10012427 | 156 |
| 358 | 3300025245 | Ga0207425_1010314 | Ga0207425_10103142 | 156 |
| 359 | 3300025254 | Ga0209148_1000034 | Ga0209148_100003466 | 156 |
| 360 | 3300025258 | Ga0209129_1000023 | Ga0209129_1000023144 | 156 |
| 361 | 3300025258 | Ga0209129_1002508 | Ga0209129_10025089 | 156 |
| 362 | 3300025258 | Ga0209129_1026336 | Ga0209129_10263362 | 156 |
| 363 | 3300025263 | Ga0209565_1000125 | Ga0209565_100012560 | 156 |
| 364 | 3300025263 | Ga0209565_1000565 | Ga0209565_100056513 | 156 |
| 365 | 3300025263 | Ga0209565_1001097 | Ga0209565_10010973 | 156 |
| 366 | 3300025263 | Ga0209565_1005206 | Ga0209565_10052062 | 156 |
| 367 | 3300025273 | Ga0209673_1000192 | Ga0209673_100019264 | 156 |
| 368 | 3300025273 | Ga0209673_1002969 | Ga0209673_10029693 | 156 |
| 369 | 3300025284 | Ga0209130_1000069 | Ga0209130_1000069147 | 156 |
| 370 | 3300025284 | Ga0209130_1000110 | Ga0209130_100011031 | 156 |
| 371 | 3300025284 | Ga0209130_1000479 | Ga0209130_100047921 | 156 |
| 372 | 3300025284 | Ga0209130_1033863 | Ga0209130_10338632 | 156 |
| 373 | 3300025291 | Ga0209675_1000427 | Ga0209675_100042721 | 156 |
| 374 | 3300025291 | Ga0209675_1000614 | Ga0209675_10006149 | 156 |
| 375 | 3300025291 | Ga0209675_1005042 | Ga0209675_10050423 | 156 |
| 376 | 3300025291 | Ga0209675_1009288 | Ga0209675_10092882 | 156 |
| 377 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005657 | 156 |
| 378 | 3300025292 | Ga0209676_1000285 | Ga0209676_100028564 | 156 |
| 379 | 3300025292 | Ga0209676_1000614 | Ga0209676_100061418 | 156 |
| 380 | 3300025292 | Ga0209676_1024428 | Ga0209676_10244282 | 156 |
| 381 | 3300025294 | Ga0209025_1000316 | Ga0209025_100031687 | 156 |
| 382 | 3300025294 | Ga0209025_1004758 | Ga0209025_10047582 | 156 |
| 383 | 3300025294 | Ga0209025_1030280 | Ga0209025_10302802 | 156 |
| 384 | 3300025294 | Ga0209025_1118901 | Ga0209025_11189012 | 156 |
| 385 | 3300025295 | Ga0209564_1000270 | Ga0209564_100027038 | 156 |
| 386 | 3300025295 | Ga0209564_1000791 | Ga0209564_100079138 | 156 |
| 387 | 3300025297 | Ga0209758_1000064 | Ga0209758_100006445 | 156 |
| 388 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007440 | 156 |
| 389 | 3300025298 | Ga0209050_1013270 | Ga0209050_10132703 | 156 |
| 390 | 3300025298 | Ga0209050_1014859 | Ga0209050_10148593 | 156 |
| 391 | 3300025299 | Ga0209256_1000020 | Ga0209256_1000020416 | 156 |
| 392 | 3300025299 | Ga0209256_1000022 | Ga0209256_100002219 | 156 |
| 393 | 3300025299 | Ga0209256_1012544 | Ga0209256_10125443 | 156 |
| 394 | 3300025302 | Ga0207426_1000001 | Ga0207426_10000011051 | 156 |
| 395 | 3300025302 | Ga0207426_1000031 | Ga0207426_1000031175 | 156 |
| 396 | 3300025302 | Ga0207426_1000061 | Ga0207426_1000061271 | 156 |
| 397 | 3300025302 | Ga0207426_1075332 | Ga0207426_10753321 | 156 |
| 398 | 3300025303 | Ga0209051_1000036 | Ga0209051_10000368 | 156 |
| 399 | 3300025303 | Ga0209051_1000711 | Ga0209051_100071136 | 156 |
| 400 | 3300025303 | Ga0209051_1012743 | Ga0209051_10127432 | 156 |
| 401 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011631 | 156 |
| 402 | 3300025304 | Ga0209257_1006768 | Ga0209257_10067685 | 156 |
| 403 | 3300025914 | Ga0207671_10049792 | Ga0207671_100497923 | 156 |
| 404 | 3300025925 | Ga0207650_10302755 | Ga0207650_103027552 | 156 |
| 405 | 3300025949 | Ga0207667_10686534 | Ga0207667_106865342 | 156 |
| 406 | 3300025972 | Ga0207668_11022438 | Ga0207668_110224381 | 156 |
| 407 | 3300025981 | Ga0207640_10926583 | Ga0207640_109265832 | 156 |
| 408 | 3300026041 | Ga0207639_10062321 | Ga0207639_100623212 | 156 |
| 409 | 3300026041 | Ga0207639_10838726 | Ga0207639_108387262 | 156 |
| 410 | 3300026121 | Ga0207683_10058809 | Ga0207683_100588093 | 156 |
| 411 | 3300026121 | Ga0207683_10568684 | Ga0207683_105686842 | 156 |
| 412 | 3300031251 | Ga0265327_10016476 | Ga0265327_100164763 | 156 |
| 413 | 3300031548 | Ga0307408_100280274 | Ga0307408_1002802742 | 156 |
| 414 | 3300031727 | Ga0316576_10004692 | Ga0316576_100046923 | 156 |
| 415 | 3300031903 | Ga0307407_11066934 | Ga0307407_110669341 | 156 |
| 416 | 3300031911 | Ga0307412_10026010 | Ga0307412_100260103 | 156 |
| 417 | 3300031911 | Ga0307412_10450903 | Ga0307412_104509032 | 156 |
| 418 | 3300031911 | Ga0307412_11722463 | Ga0307412_117224631 | 156 |
| 419 | 3300035398 | Ga0316574_0162686 | Ga0316574_0162686_30_518 | 156 |
| 420 | 3300036712 | Ga0316584_0009856 | Ga0316584_0009856_186_674 | 156 |
| 421 | 3300038443 | Ga0395901_0353941 | Ga0395901_0353941_277_774 | 156 |
| 422 | 3300041456 | Ga0451795_0051390 | Ga0451795_0051390_35_505 | 156 |
| 423 | 3300041511 | Ga0451855_0666493 | Ga0451855_0666493_92_565 | 156 |
| 424 | 3300042000 | Ga0439437_040284 | Ga0439437_040284_52_531 | 156 |
| 425 | 3300042004 | Ga0439445_0070523 | Ga0439445_0070523_69_554 | 156 |
| 426 | 3300042006 | Ga0439432_061153 | Ga0439432_061153_586_1071 | 156 |
| 427 | 3300042007 | Ga0439449_0002400 | Ga0439449_0002400_1219_1704 | 156 |
| 428 | 3300042876 | Ga0451577_0527293 | Ga0451577_0527293_230_709 | 156 |
| 429 | 3300044712 | Ga0453684_0149331 | Ga0453684_0149331_1939_2418 | 156 |
| 430 | 3300046453 | Ga0495627_009631 | Ga0495627_009631_2631_3122 | 156 |
| 431 | 3300046513 | Ga0495616_0012572 | Ga0495616_0012572_2475_2963 | 156 |
| 432 | 3300046528 | Ga0495642_0013795 | Ga0495642_0013795_1966_2469 | 156 |
| 433 | 3300046674 | Ga0495588_0141435 | Ga0495588_0141435_355_843 | 156 |
| 434 | 3300046683 | Ga0495658_0149588 | Ga0495658_0149588_193_681 | 156 |
| 435 | 3300046690 | Ga0495624_0246937 | Ga0495624_0246937_182_670 | 156 |
| 436 | 3300046692 | Ga0495671_0006838 | Ga0495671_0006838_2673_3164 | 156 |
| 437 | 3300047470 | Ga0495681_0382064 | Ga0495681_0382064_15_515 | 156 |
| 438 | 3300048089 | Ga0495614_0222909 | Ga0495614_0222909_50_538 | 156 |
| 439 | 3300048904 | Ga0496101_0697824 | Ga0496101_0697824_269_754 | 156 |
| 440 | 3300048911 | Ga0496108_0284652 | Ga0496108_0284652_814_1302 | 156 |
| 441 | 3300048917 | Ga0496114_1725220 | Ga0496114_1725220_12_497 | 156 |
| 442 | 3300048918 | Ga0496115_1226661 | Ga0496115_1226661_43_528 | 156 |
| 443 | 3300048919 | Ga0496116_0043436 | Ga0496116_0043436_2019_2510 | 156 |
| 444 | 3300048920 | Ga0496117_0053150 | Ga0496117_0053150_1155_1646 | 156 |
| 445 | 3300048921 | Ga0496118_0009508 | Ga0496118_0009508_1465_1956 | 156 |
| 446 | 3300048921 | Ga0496118_0136369 | Ga0496118_0136369_1054_1542 | 156 |
| 447 | 3300048924 | Ga0496121_0016530 | Ga0496121_0016530_242_724 | 156 |
| 448 | 3300048924 | Ga0496121_0069806 | Ga0496121_0069806_1682_2173 | 156 |
| 449 | 3300048925 | Ga0496122_0132526 | Ga0496122_0132526_30_518 | 156 |
| 450 | 3300048926 | Ga0496123_0147137 | Ga0496123_0147137_553_1044 | 156 |
| 451 | 3300048926 | Ga0496123_0245581 | Ga0496123_0245581_265_753 | 156 |
| 452 | 3300048927 | Ga0496124_0202684 | Ga0496124_0202684_270_761 | 156 |
| 453 | 3300048927 | Ga0496124_0461952 | Ga0496124_0461952_357_845 | 156 |
| 454 | 3300048928 | Ga0496125_0079445 | Ga0496125_0079445_839_1330 | 156 |
| 455 | 3300049161 | Ga0501305_045330 | Ga0501305_045330_30_521 | 156 |
| 456 | 3300049569 | Ga0501032_0062468 | Ga0501032_0062468_1347_1817 | 156 |
| 457 | 3300049572 | Ga0501036_0036953 | Ga0501036_0036953_1803_2273 | 156 |
| 458 | 3300049572 | Ga0501036_1662475 | Ga0501036_1662475_11_490 | 156 |
| 459 | 3300049575 | Ga0501039_0096625 | Ga0501039_0096625_187_657 | 156 |
| 460 | 3300049575 | Ga0501039_0096823 | Ga0501039_0096823_920_1399 | 156 |
| 461 | 3300049577 | Ga0501041_0088434 | Ga0501041_0088434_901_1380 | 156 |
| 462 | 3300049579 | Ga0501043_0031724 | Ga0501043_0031724_3184_3654 | 156 |
| 463 | 3300049581 | Ga0501047_0335325 | Ga0501047_0335325_716_1186 | 156 |
| 464 | 3300049582 | Ga0501048_0092568 | Ga0501048_0092568_481_960 | 156 |
| 465 | 3300049587 | Ga0501071_0048526 | Ga0501071_0048526_1549_2019 | 156 |
| 466 | 3300049590 | Ga0501074_0025240 | Ga0501074_0025240_463_933 | 156 |
| 467 | 3300049592 | Ga0501076_0091481 | Ga0501076_0091481_592_1071 | 156 |
| 468 | 3300049742 | Ga0501080_0033173 | Ga0501080_0033173_2589_3059 | 156 |
| 469 | 3300049742 | Ga0501080_0186548 | Ga0501080_0186548_934_1413 | 156 |
| 470 | 3300049743 | Ga0501081_0148462 | Ga0501081_0148462_473_952 | 156 |
| 471 | 3300049744 | Ga0501083_0009799 | Ga0501083_0009799_3563_4033 | 156 |
| 472 | 3300049824 | Ga0501045_0075363 | Ga0501045_0075363_1221_1700 | 156 |
| 473 | 3300050489 | nmdc:mga03683_52557_c1 | nmdc:mga03683_52557_c1_1060_1545 | 156 |
| 474 | 3300050508 | nmdc:mga09592_24168_c1 | nmdc:mga09592_24168_c1_2556_3038 | 156 |
| 475 | 3300053077 | Ga0495601_0793509 | Ga0495601_0793509_92_571 | 156 |
| 476 | 3300053093 | Ga0500651_0000259 | Ga0500651_0000259_15575_16063 | 156 |
| 477 | 3300053094 | Ga0500566_0254454 | Ga0500566_0254454_255_743 | 156 |
| 478 | 3300053117 | Ga0500593_014233 | Ga0500593_014233_2004_2495 | 156 |
| 479 | 3300053121 | Ga0500607_119260 | Ga0500607_119260_307_795 | 156 |
| 480 | 3300053125 | Ga0500618_041356 | Ga0500618_041356_35_523 | 156 |
| 481 | 3300053129 | Ga0500628_007390 | Ga0500628_007390_95_583 | 156 |
| 482 | 3300053133 | Ga0500655_003197 | Ga0500655_003197_1446_1934 | 156 |
| 483 | 3300053134 | Ga0500658_0024735 | Ga0500658_0024735_623_1111 | 156 |
| 484 | 3300053138 | Ga0500564_003072 | Ga0500564_003072_1315_1803 | 156 |
| 485 | 3300053141 | Ga0500574_097406 | Ga0500574_097406_243_731 | 156 |
| 486 | 3300053158 | Ga0500627_0018916 | Ga0500627_0018916_1358_1849 | 156 |
| 487 | 3300053161 | Ga0500634_0013690 | Ga0500634_0013690_1154_1642 | 156 |
| 488 | 3300053162 | Ga0500638_089184 | Ga0500638_089184_751_1239 | 156 |
| 489 | iso_pu_bacteria | 2599185214 | 2599624444 | 156 |
| 490 | iso_pu_bacteria | 2599185226 | 2599672694 | 156 |
| 491 | iso_pu_bacteria | 2599185227 | 2599683694 | 156 |
| 492 | iso_pu_bacteria | 2599185229 | 2599694303 | 156 |
| 493 | iso_pu_bacteria | 2617270889 | 2617914587 | 156 |
| 494 | iso_pu_bacteria | 2738541277 | 2738720255 | 156 |
| 495 | iso_pu_bacteria | 2738541307 | 2738881796 | 156 |
| 496 | iso_pu_bacteria | 2738543019 | 2739279454 | 156 |
| 497 | iso_pu_bacteria | 2818991446 | 2819595859 | 156 |
| 498 | iso_pu_bacteria | 2831265667 | 2831266994 | 156 |
| 499 | iso_pu_bacteria | 2838054893 | 2838057053 | 156 |
| 500 | iso_pu_bacteria | 2885198086 | 2885198949 | 156 |
| 501 | iso_pu_bacteria | 2885211737 | 2885212788 | 156 |
| 502 | iso_pu_bacteria | 2899924645 | 2899925205 | 156 |
| 503 | iso_pu_bacteria | 2904541872 | 2904544641 | 156 |
| 504 | iso_pu_bacteria | 2913844669 | 2913848963 | 156 |
| 505 | iso_pu_bacteria | 2913939268 | 2913942421 | 156 |
| 506 | iso_pu_bacteria | 2928037797 | 2928038670 | 156 |
| 507 | iso_pu_bacteria | 2928044640 | 2928045725 | 156 |
| 508 | iso_pu_bacteria | 2928051484 | 2928053342 | 156 |
| 509 | iso_pu_bacteria | 2928064002 | 2928066947 | 156 |
| 510 | iso_pu_bacteria | 2928070936 | 2928071156 | 156 |
| 511 | iso_pu_bacteria | 2928084124 | 2928084903 | 156 |
| 512 | iso_pu_bacteria | 2929160207 | 2929163687 | 156 |
| 513 | iso_pu_bacteria | 2932422444 | 2932423567 | 156 |
| 514 | iso_pu_bacteria | 2939631187 | 2939634836 | 156 |
| 515 | iso_pu_bacteria | 2945909444 | 2945912367 | 156 |
| 516 | iso_pu_bacteria | 2945984333 | 2945985319 | 156 |
| 517 | iso_pu_bacteria | 642555144 | 642604747 | 156 |
| 518 | 2209111006 | 2214782462 | 2213805733 | 157 |
| 519 | 3300003187 | JGI25151J46595_10048721 | JGI25151J46595_100487212 | 157 |
| 520 | 3300003187 | JGI25151J46595_10125314 | JGI25151J46595_101253141 | 157 |
| 521 | 3300003371 | JGI26145J50221_1005807 | JGI26145J50221_10058072 | 157 |
| 522 | 3300005277 | Ga0065716_1007454 | Ga0065716_10074541 | 157 |
| 523 | 3300005290 | Ga0065712_10037862 | Ga0065712_100378621 | 157 |
| 524 | 3300005290 | Ga0065712_10204418 | Ga0065712_102044182 | 157 |
| 525 | 3300005293 | Ga0065715_10663414 | Ga0065715_106634141 | 157 |
| 526 | 3300005295 | Ga0065707_10283295 | Ga0065707_102832951 | 157 |
| 527 | 3300005327 | Ga0070658_10021990 | Ga0070658_100219906 | 157 |
| 528 | 3300005328 | Ga0070676_10005793 | Ga0070676_100057937 | 157 |
| 529 | 3300005329 | Ga0070683_100327982 | Ga0070683_1003279822 | 157 |
| 530 | 3300005329 | Ga0070683_100342633 | Ga0070683_1003426332 | 157 |
| 531 | 3300005330 | Ga0070690_100002862 | Ga0070690_1000028627 | 157 |
| 532 | 3300005333 | Ga0070677_10146803 | Ga0070677_101468032 | 157 |
| 533 | 3300005334 | Ga0068869_100086862 | Ga0068869_1000868622 | 157 |
| 534 | 3300005336 | Ga0070680_100342976 | Ga0070680_1003429762 | 157 |
| 535 | 3300005336 | Ga0070680_100397577 | Ga0070680_1003975772 | 157 |
| 536 | 3300005337 | Ga0070682_100040563 | Ga0070682_1000405634 | 157 |
| 537 | 3300005338 | Ga0068868_100403166 | Ga0068868_1004031662 | 157 |
| 538 | 3300005339 | Ga0070660_100012591 | Ga0070660_1000125913 | 157 |
| 539 | 3300005340 | Ga0070689_100036552 | Ga0070689_1000365524 | 157 |
| 540 | 3300005340 | Ga0070689_100356682 | Ga0070689_1003566822 | 157 |
| 541 | 3300005341 | Ga0070691_10092099 | Ga0070691_100920992 | 157 |
| 542 | 3300005341 | Ga0070691_10562724 | Ga0070691_105627242 | 157 |
| 543 | 3300005343 | Ga0070687_100009408 | Ga0070687_1000094082 | 157 |
| 544 | 3300005344 | Ga0070661_100015451 | Ga0070661_1000154513 | 157 |
| 545 | 3300005344 | Ga0070661_100421463 | Ga0070661_1004214632 | 157 |
| 546 | 3300005347 | Ga0070668_100039790 | Ga0070668_1000397902 | 157 |
| 547 | 3300005347 | Ga0070668_100543027 | Ga0070668_1005430271 | 157 |
| 548 | 3300005354 | Ga0070675_100248687 | Ga0070675_1002486872 | 157 |
| 549 | 3300005354 | Ga0070675_100263060 | Ga0070675_1002630601 | 157 |
| 550 | 3300005356 | Ga0070674_100020216 | Ga0070674_1000202165 | 157 |
| 551 | 3300005364 | Ga0070673_100001859 | Ga0070673_1000018597 | 157 |
| 552 | 3300005364 | Ga0070673_100272093 | Ga0070673_1002720933 | 157 |
| 553 | 3300005365 | Ga0070688_100223670 | Ga0070688_1002236702 | 157 |
| 554 | 3300005366 | Ga0070659_100640407 | Ga0070659_1006404072 | 157 |
| 555 | 3300005367 | Ga0070667_100232651 | Ga0070667_1002326512 | 157 |
| 556 | 3300005434 | Ga0070709_10395096 | Ga0070709_103950962 | 157 |
| 557 | 3300005439 | Ga0070711_100000002 | Ga0070711_100000002112 | 157 |
| 558 | 3300005440 | Ga0070705_100101052 | Ga0070705_1001010523 | 157 |
| 559 | 3300005441 | Ga0070700_100169617 | Ga0070700_1001696172 | 157 |
| 560 | 3300005441 | Ga0070700_100432080 | Ga0070700_1004320802 | 157 |
| 561 | 3300005444 | Ga0070694_100202628 | Ga0070694_1002026282 | 157 |
| 562 | 3300005444 | Ga0070694_100552054 | Ga0070694_1005520542 | 157 |
| 563 | 3300005456 | Ga0070678_100001693 | Ga0070678_1000016939 | 157 |
| 564 | 3300005457 | Ga0070662_100644280 | Ga0070662_1006442801 | 157 |
| 565 | 3300005457 | Ga0070662_101248175 | Ga0070662_1012481751 | 157 |
| 566 | 3300005457 | Ga0070662_101487611 | Ga0070662_1014876111 | 157 |
| 567 | 3300005458 | Ga0070681_10039712 | Ga0070681_100397124 | 157 |
| 568 | 3300005459 | Ga0068867_100021614 | Ga0068867_1000216143 | 157 |
| 569 | 3300005459 | Ga0068867_100969909 | Ga0068867_1009699091 | 157 |
| 570 | 3300005468 | Ga0070707_100340899 | Ga0070707_1003408992 | 157 |
| 571 | 3300005518 | Ga0070699_100000104 | Ga0070699_10000010445 | 157 |
| 572 | 3300005530 | Ga0070679_100009608 | Ga0070679_1000096084 | 157 |
| 573 | 3300005544 | Ga0070686_100003042 | Ga0070686_1000030424 | 157 |
| 574 | 3300005545 | Ga0070695_100261035 | Ga0070695_1002610351 | 157 |
| 575 | 3300005545 | Ga0070695_100419337 | Ga0070695_1004193372 | 157 |
| 576 | 3300005546 | Ga0070696_100001805 | Ga0070696_10000180514 | 157 |
| 577 | 3300005546 | Ga0070696_100029720 | Ga0070696_1000297203 | 157 |
| 578 | 3300005546 | Ga0070696_100301740 | Ga0070696_1003017402 | 157 |
| 579 | 3300005548 | Ga0070665_100172663 | Ga0070665_1001726632 | 157 |
| 580 | 3300005549 | Ga0070704_100168405 | Ga0070704_1001684052 | 157 |
| 581 | 3300005549 | Ga0070704_100330680 | Ga0070704_1003306802 | 157 |
| 582 | 3300005564 | Ga0070664_100000430 | Ga0070664_1000004307 | 157 |
| 583 | 3300005577 | Ga0068857_100066981 | Ga0068857_1000669813 | 157 |
| 584 | 3300005614 | Ga0068856_100291104 | Ga0068856_1002911042 | 157 |
| 585 | 3300005616 | Ga0068852_100165443 | Ga0068852_1001654433 | 157 |
| 586 | 3300005618 | Ga0068864_100862419 | Ga0068864_1008624192 | 157 |
| 587 | 3300005718 | Ga0068866_10093269 | Ga0068866_100932692 | 157 |
| 588 | 3300005719 | Ga0068861_100573971 | Ga0068861_1005739712 | 157 |
| 589 | 3300005840 | Ga0068870_10356743 | Ga0068870_103567432 | 157 |
| 590 | 3300005841 | Ga0068863_100303849 | Ga0068863_1003038492 | 157 |
| 591 | 3300005842 | Ga0068858_101576729 | Ga0068858_1015767291 | 157 |
| 592 | 3300005843 | Ga0068860_100063011 | Ga0068860_1000630114 | 157 |
| 593 | 3300005844 | Ga0068862_100090041 | Ga0068862_1000900412 | 157 |
| 594 | 3300005937 | Ga0081455_10054757 | Ga0081455_100547572 | 157 |
| 595 | 3300006038 | Ga0075365_10001831 | Ga0075365_100018315 | 157 |
| 596 | 3300006048 | Ga0075363_100027696 | Ga0075363_1000276962 | 157 |
| 597 | 3300006051 | Ga0075364_10590058 | Ga0075364_105900581 | 157 |
| 598 | 3300006058 | Ga0075432_10124953 | Ga0075432_101249532 | 157 |
| 599 | 3300006163 | Ga0070715_10319561 | Ga0070715_103195611 | 157 |
| 600 | 3300006173 | Ga0070716_100180931 | Ga0070716_1001809312 | 157 |
| 601 | 3300006173 | Ga0070716_100623156 | Ga0070716_1006231562 | 157 |
| 602 | 3300006178 | Ga0075367_10314179 | Ga0075367_103141792 | 157 |
| 603 | 3300006178 | Ga0075367_10315957 | Ga0075367_103159572 | 157 |
| 604 | 3300006195 | Ga0075366_10110160 | Ga0075366_101101602 | 157 |
| 605 | 3300006237 | Ga0097621_100142532 | Ga0097621_1001425323 | 157 |
| 606 | 3300006237 | Ga0097621_100160022 | Ga0097621_1001600222 | 157 |
| 607 | 3300006353 | Ga0075370_10049640 | Ga0075370_100496402 | 157 |
| 608 | 3300006358 | Ga0068871_100643023 | Ga0068871_1006430232 | 157 |
| 609 | 3300006846 | Ga0075430_100091643 | Ga0075430_1000916432 | 157 |
| 610 | 3300006846 | Ga0075430_100160493 | Ga0075430_1001604932 | 157 |
| 611 | 3300006847 | Ga0075431_100044850 | Ga0075431_1000448503 | 157 |
| 612 | 3300006847 | Ga0075431_100053508 | Ga0075431_1000535082 | 157 |
| 613 | 3300006852 | Ga0075433_10353195 | Ga0075433_103531952 | 157 |
| 614 | 3300006871 | Ga0075434_100121079 | Ga0075434_1001210794 | 157 |
| 615 | 3300006871 | Ga0075434_100289416 | Ga0075434_1002894163 | 157 |
| 616 | 3300006871 | Ga0075434_100499387 | Ga0075434_1004993872 | 157 |
| 617 | 3300006871 | Ga0075434_100745518 | Ga0075434_1007455181 | 157 |
| 618 | 3300006880 | Ga0075429_100001369 | Ga0075429_10000136919 | 157 |
| 619 | 3300006881 | Ga0068865_100002482 | Ga0068865_1000024829 | 157 |
| 620 | 3300006914 | Ga0075436_100010987 | Ga0075436_1000109877 | 157 |
| 621 | 3300006914 | Ga0075436_100023346 | Ga0075436_1000233463 | 157 |
| 622 | 3300006914 | Ga0075436_100244633 | Ga0075436_1002446332 | 157 |
| 623 | 3300006914 | Ga0075436_100484642 | Ga0075436_1004846422 | 157 |
| 624 | 3300007076 | Ga0075435_100212559 | Ga0075435_1002125593 | 157 |
| 625 | 3300007076 | Ga0075435_100215699 | Ga0075435_1002156991 | 157 |
| 626 | 3300009036 | Ga0105244_10007321 | Ga0105244_100073218 | 157 |
| 627 | 3300009093 | Ga0105240_11103818 | Ga0105240_111038182 | 157 |
| 628 | 3300009098 | Ga0105245_10003141 | Ga0105245_100031414 | 157 |
| 629 | 3300009147 | Ga0114129_10046873 | Ga0114129_100468735 | 157 |
| 630 | 3300009147 | Ga0114129_10188831 | Ga0114129_101888314 | 157 |
| 631 | 3300009147 | Ga0114129_10354786 | Ga0114129_103547862 | 157 |
| 632 | 3300009148 | Ga0105243_10014671 | Ga0105243_100146714 | 157 |
| 633 | 3300009148 | Ga0105243_10021819 | Ga0105243_100218196 | 157 |
| 634 | 3300009174 | Ga0105241_10013744 | Ga0105241_100137444 | 157 |
| 635 | 3300009176 | Ga0105242_10012170 | Ga0105242_100121708 | 157 |
| 636 | 3300009177 | Ga0105248_11987252 | Ga0105248_119872522 | 157 |
| 637 | 3300009545 | Ga0105237_10324226 | Ga0105237_103242262 | 157 |
| 638 | 3300009551 | Ga0105238_10730239 | Ga0105238_107302392 | 157 |
| 639 | 3300009553 | Ga0105249_10019658 | Ga0105249_100196585 | 157 |
| 640 | 3300009553 | Ga0105249_10302536 | Ga0105249_103025362 | 157 |
| 641 | 3300010375 | Ga0105239_10065273 | Ga0105239_100652733 | 157 |
| 642 | 3300011119 | Ga0105246_10071589 | Ga0105246_100715892 | 157 |
| 643 | 3300013102 | Ga0157371_10088719 | Ga0157371_100887192 | 157 |
| 644 | 3300013104 | Ga0157370_10294022 | Ga0157370_102940222 | 157 |
| 645 | 3300013105 | Ga0157369_10254642 | Ga0157369_102546422 | 157 |
| 646 | 3300013296 | Ga0157374_10042041 | Ga0157374_100420412 | 157 |
| 647 | 3300013296 | Ga0157374_10056971 | Ga0157374_100569714 | 157 |
| 648 | 3300013297 | Ga0157378_10157967 | Ga0157378_101579673 | 157 |
| 649 | 3300013306 | Ga0163162_10294911 | Ga0163162_102949112 | 157 |
| 650 | 3300013306 | Ga0163162_10939198 | Ga0163162_109391981 | 157 |
| 651 | 3300013308 | Ga0157375_10159127 | Ga0157375_101591273 | 157 |
| 652 | 3300013308 | Ga0157375_10775914 | Ga0157375_107759142 | 157 |
| 653 | 3300014326 | Ga0157380_11261979 | Ga0157380_112619792 | 157 |
| 654 | 3300014745 | Ga0157377_10034484 | Ga0157377_100344843 | 157 |
| 655 | 3300014969 | Ga0157376_10230330 | Ga0157376_102303301 | 157 |
| 656 | 3300015262 | Ga0182007_10009286 | Ga0182007_100092863 | 157 |
| 657 | 3300025284 | Ga0209130_1002183 | Ga0209130_100218310 | 157 |
| 658 | 3300025294 | Ga0209025_1012895 | Ga0209025_10128955 | 157 |
| 659 | 3300025294 | Ga0209025_1145213 | Ga0209025_11452132 | 157 |
| 660 | 3300025728 | Ga0207655_1039403 | Ga0207655_10394032 | 157 |
| 661 | 3300025893 | Ga0207682_10019567 | Ga0207682_100195673 | 157 |
| 662 | 3300025899 | Ga0207642_10012814 | Ga0207642_100128143 | 157 |
| 663 | 3300025901 | Ga0207688_10031016 | Ga0207688_100310164 | 157 |
| 664 | 3300025906 | Ga0207699_10445200 | Ga0207699_104452002 | 157 |
| 665 | 3300025907 | Ga0207645_10001024 | Ga0207645_1000102411 | 157 |
| 666 | 3300025909 | Ga0207705_10052616 | Ga0207705_100526163 | 157 |
| 667 | 3300025912 | Ga0207707_10120621 | Ga0207707_101206213 | 157 |
| 668 | 3300025916 | Ga0207663_10000003 | Ga0207663_100000034 | 157 |
| 669 | 3300025917 | Ga0207660_10087893 | Ga0207660_100878932 | 157 |
| 670 | 3300025917 | Ga0207660_10213142 | Ga0207660_102131422 | 157 |
| 671 | 3300025918 | Ga0207662_10042794 | Ga0207662_100427944 | 157 |
| 672 | 3300025918 | Ga0207662_10151927 | Ga0207662_101519272 | 157 |
| 673 | 3300025919 | Ga0207657_10123803 | Ga0207657_101238033 | 157 |
| 674 | 3300025920 | Ga0207649_10077751 | Ga0207649_100777512 | 157 |
| 675 | 3300025920 | Ga0207649_10361740 | Ga0207649_103617402 | 157 |
| 676 | 3300025921 | Ga0207652_10028701 | Ga0207652_100287014 | 157 |
| 677 | 3300025922 | Ga0207646_10788528 | Ga0207646_107885281 | 157 |
| 678 | 3300025925 | Ga0207650_10608222 | Ga0207650_106082222 | 157 |
| 679 | 3300025926 | Ga0207659_10283819 | Ga0207659_102838192 | 157 |
| 680 | 3300025926 | Ga0207659_10512974 | Ga0207659_105129742 | 157 |
| 681 | 3300025926 | Ga0207659_10595912 | Ga0207659_105959121 | 157 |
| 682 | 3300025932 | Ga0207690_10397896 | Ga0207690_103978961 | 157 |
| 683 | 3300025932 | Ga0207690_10804518 | Ga0207690_108045182 | 157 |
| 684 | 3300025933 | Ga0207706_10001021 | Ga0207706_1000102115 | 157 |
| 685 | 3300025933 | Ga0207706_11074493 | Ga0207706_110744931 | 157 |
| 686 | 3300025934 | Ga0207686_10317011 | Ga0207686_103170112 | 157 |
| 687 | 3300025935 | Ga0207709_10000019 | Ga0207709_10000019110 | 157 |
| 688 | 3300025935 | Ga0207709_10162701 | Ga0207709_101627012 | 157 |
| 689 | 3300025936 | Ga0207670_10185151 | Ga0207670_101851512 | 157 |
| 690 | 3300025936 | Ga0207670_10248056 | Ga0207670_102480562 | 157 |
| 691 | 3300025937 | Ga0207669_10327095 | Ga0207669_103270952 | 157 |
| 692 | 3300025938 | Ga0207704_10411091 | Ga0207704_104110912 | 157 |
| 693 | 3300025939 | Ga0207665_10222472 | Ga0207665_102224722 | 157 |
| 694 | 3300025939 | Ga0207665_10972856 | Ga0207665_109728562 | 157 |
| 695 | 3300025940 | Ga0207691_10473153 | Ga0207691_104731532 | 157 |
| 696 | 3300025942 | Ga0207689_10018342 | Ga0207689_100183427 | 157 |
| 697 | 3300025944 | Ga0207661_10220622 | Ga0207661_102206222 | 157 |
| 698 | 3300025945 | Ga0207679_10644868 | Ga0207679_106448682 | 157 |
| 699 | 3300025960 | Ga0207651_10014674 | Ga0207651_100146747 | 157 |
| 700 | 3300025960 | Ga0207651_10240702 | Ga0207651_102407022 | 157 |
| 701 | 3300025961 | Ga0207712_10446610 | Ga0207712_104466102 | 157 |
| 702 | 3300025972 | Ga0207668_10028226 | Ga0207668_100282264 | 157 |
| 703 | 3300025981 | Ga0207640_10131115 | Ga0207640_101311152 | 157 |
| 704 | 3300025986 | Ga0207658_10075944 | Ga0207658_100759442 | 157 |
| 705 | 3300025986 | Ga0207658_10189089 | Ga0207658_101890891 | 157 |
| 706 | 3300026023 | Ga0207677_10146091 | Ga0207677_101460912 | 157 |
| 707 | 3300026023 | Ga0207677_10181784 | Ga0207677_101817842 | 157 |
| 708 | 3300026075 | Ga0207708_10005900 | Ga0207708_100059004 | 157 |
| 709 | 3300026075 | Ga0207708_10172472 | Ga0207708_101724722 | 157 |
| 710 | 3300026088 | Ga0207641_10870886 | Ga0207641_108708861 | 157 |
| 711 | 3300026089 | Ga0207648_10003922 | Ga0207648_1000392211 | 157 |
| 712 | 3300026095 | Ga0207676_10097826 | Ga0207676_100978263 | 157 |
| 713 | 3300026095 | Ga0207676_10127492 | Ga0207676_101274922 | 157 |
| 714 | 3300026116 | Ga0207674_10216525 | Ga0207674_102165253 | 157 |
| 715 | 3300026118 | Ga0207675_100461321 | Ga0207675_1004613211 | 157 |
| 716 | 3300026121 | Ga0207683_10000099 | Ga0207683_1000009919 | 157 |
| 717 | 3300026121 | Ga0207683_10095683 | Ga0207683_100956833 | 157 |
| 718 | 3300026142 | Ga0207698_10485297 | Ga0207698_104852972 | 157 |
| 719 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005247 | 157 |
| 720 | 3300027252 | Ga0209973_1003358 | Ga0209973_10033582 | 157 |
| 721 | 3300027360 | Ga0209969_1000858 | Ga0209969_10008582 | 157 |
| 722 | 3300027364 | Ga0209967_1000509 | Ga0209967_10005094 | 157 |
| 723 | 3300027364 | Ga0209967_1001172 | Ga0209967_10011722 | 157 |
| 724 | 3300027378 | Ga0209981_1000079 | Ga0209981_100007912 | 157 |
| 725 | 3300027395 | Ga0209996_1000168 | Ga0209996_10001682 | 157 |
| 726 | 3300027424 | Ga0209984_1001063 | Ga0209984_10010634 | 157 |
| 727 | 3300027462 | Ga0210000_1000123 | Ga0210000_100012310 | 157 |
| 728 | 3300027462 | Ga0210000_1028995 | Ga0210000_10289951 | 157 |
| 729 | 3300027462 | Ga0210000_1038406 | Ga0210000_10384062 | 157 |
| 730 | 3300027471 | Ga0209995_1000415 | Ga0209995_10004152 | 157 |
| 731 | 3300027526 | Ga0209968_1000017 | Ga0209968_100001726 | 157 |
| 732 | 3300027543 | Ga0209999_1000109 | Ga0209999_10001092 | 157 |
| 733 | 3300027552 | Ga0209982_1000025 | Ga0209982_10000258 | 157 |
| 734 | 3300027617 | Ga0210002_1000130 | Ga0210002_100013011 | 157 |
| 735 | 3300027617 | Ga0210002_1049344 | Ga0210002_10493442 | 157 |
| 736 | 3300027665 | Ga0209983_1001431 | Ga0209983_10014313 | 157 |
| 737 | 3300027682 | Ga0209971_1000327 | Ga0209971_100032714 | 157 |
| 738 | 3300027682 | Ga0209971_1016486 | Ga0209971_10164861 | 157 |
| 739 | 3300027695 | Ga0209966_1000186 | Ga0209966_100018613 | 157 |
| 740 | 3300027717 | Ga0209998_10000065 | Ga0209998_1000006535 | 157 |
| 741 | 3300027876 | Ga0209974_10000064 | Ga0209974_1000006420 | 157 |
| 742 | 3300027876 | Ga0209974_10000274 | Ga0209974_1000027413 | 157 |
| 743 | 3300027876 | Ga0209974_10010272 | Ga0209974_100102723 | 157 |
| 744 | 3300027907 | Ga0207428_10005062 | Ga0207428_1000506213 | 157 |
| 745 | 3300027907 | Ga0207428_10069386 | Ga0207428_100693863 | 157 |
| 746 | 3300028381 | Ga0268264_10327564 | Ga0268264_103275642 | 157 |
| 747 | 3300028794 | Ga0307515_10233464 | Ga0307515_102334642 | 157 |
| 748 | 3300029957 | Ga0265324_10079231 | Ga0265324_100792312 | 157 |
| 749 | 3300031251 | Ga0265327_10014639 | Ga0265327_100146393 | 157 |
| 750 | 3300031251 | Ga0265327_10293133 | Ga0265327_102931331 | 157 |
| 751 | 3300031456 | Ga0307513_10238820 | Ga0307513_102388202 | 157 |
| 752 | 3300031548 | Ga0307408_100030541 | Ga0307408_1000305413 | 157 |
| 753 | 3300031548 | Ga0307408_100064337 | Ga0307408_1000643372 | 157 |
| 754 | 3300031665 | Ga0316575_10021290 | Ga0316575_100212902 | 157 |
| 755 | 3300031665 | Ga0316575_10111687 | Ga0316575_101116871 | 157 |
| 756 | 3300031665 | Ga0316575_10215105 | Ga0316575_102151051 | 157 |
| 757 | 3300031691 | Ga0316579_10006147 | Ga0316579_100061473 | 157 |
| 758 | 3300031691 | Ga0316579_10224917 | Ga0316579_102249171 | 157 |
| 759 | 3300031711 | Ga0265314_10238935 | Ga0265314_102389352 | 157 |
| 760 | 3300031727 | Ga0316576_10166444 | Ga0316576_101664442 | 157 |
| 761 | 3300031727 | Ga0316576_10442004 | Ga0316576_104420042 | 157 |
| 762 | 3300031727 | Ga0316576_10657522 | Ga0316576_106575222 | 157 |
| 763 | 3300031728 | Ga0316578_10004409 | Ga0316578_100044093 | 157 |
| 764 | 3300031728 | Ga0316578_10021277 | Ga0316578_100212772 | 157 |
| 765 | 3300031728 | Ga0316578_10096183 | Ga0316578_100961831 | 157 |
| 766 | 3300031728 | Ga0316578_10205734 | Ga0316578_102057342 | 157 |
| 767 | 3300031728 | Ga0316578_10656132 | Ga0316578_106561321 | 157 |
| 768 | 3300031731 | Ga0307405_10123021 | Ga0307405_101230212 | 157 |
| 769 | 3300031733 | Ga0316577_10007336 | Ga0316577_100073362 | 157 |
| 770 | 3300031733 | Ga0316577_10019420 | Ga0316577_100194201 | 157 |
| 771 | 3300031733 | Ga0316577_10089544 | Ga0316577_100895442 | 157 |
| 772 | 3300031733 | Ga0316577_10177082 | Ga0316577_101770822 | 157 |
| 773 | 3300031824 | Ga0307413_10110526 | Ga0307413_101105263 | 157 |
| 774 | 3300031903 | Ga0307407_10153186 | Ga0307407_101531862 | 157 |
| 775 | 3300031903 | Ga0307407_10923514 | Ga0307407_109235141 | 157 |
| 776 | 3300031911 | Ga0307412_10009620 | Ga0307412_100096202 | 157 |
| 777 | 3300031995 | Ga0307409_100085198 | Ga0307409_1000851983 | 157 |
| 778 | 3300032002 | Ga0307416_100441685 | Ga0307416_1004416852 | 157 |
| 779 | 3300032002 | Ga0307416_100684642 | Ga0307416_1006846422 | 157 |
| 780 | 3300032002 | Ga0307416_101842131 | Ga0307416_1018421311 | 157 |
| 781 | 3300032005 | Ga0307411_10345649 | Ga0307411_103456492 | 157 |
| 782 | 3300032133 | Ga0316583_10002461 | Ga0316583_100024612 | 157 |
| 783 | 3300032133 | Ga0316583_10005516 | Ga0316583_100055162 | 157 |
| 784 | 3300032133 | Ga0316583_10006071 | Ga0316583_100060712 | 157 |
| 785 | 3300032133 | Ga0316583_10013425 | Ga0316583_100134252 | 157 |
| 786 | 3300032133 | Ga0316583_10021900 | Ga0316583_100219001 | 157 |
| 787 | 3300032137 | Ga0316585_10004285 | Ga0316585_100042853 | 157 |
| 788 | 3300032137 | Ga0316585_10109149 | Ga0316585_101091491 | 157 |
| 789 | 3300032139 | Ga0316580_10005429 | Ga0316580_100054292 | 157 |
| 790 | 3300032139 | Ga0316580_10019260 | Ga0316580_100192602 | 157 |
| 791 | 3300032139 | Ga0316580_10024094 | Ga0316580_100240942 | 157 |
| 792 | 3300032139 | Ga0316580_10088339 | Ga0316580_100883391 | 157 |
| 793 | 3300032168 | Ga0316593_10073963 | Ga0316593_100739631 | 157 |
| 794 | 3300032168 | Ga0316593_10141548 | Ga0316593_101415481 | 157 |
| 795 | 3300033524 | Ga0316592_1035586 | Ga0316592_10355862 | 157 |
| 796 | 3300033524 | Ga0316592_1041734 | Ga0316592_10417341 | 157 |
| 797 | 3300033524 | Ga0316592_1052280 | Ga0316592_10522802 | 157 |
| 798 | 3300033528 | Ga0316588_1083830 | Ga0316588_10838301 | 157 |
| 799 | 3300033541 | Ga0316596_1085741 | Ga0316596_10857411 | 157 |
| 800 | 3300034816 | Ga0373930_0147247 | Ga0373930_0147247_94_567 | 157 |
| 801 | 3300035088 | Ga0373940_0118784 | Ga0373940_0118784_266_739 | 157 |
| 802 | 3300035092 | Ga0373952_0027441 | Ga0373952_0027441_18_491 | 157 |
| 803 | 3300035111 | Ga0373923_0174511 | Ga0373923_0174511_387_869 | 157 |
| 804 | 3300035115 | Ga0373941_0039210 | Ga0373941_0039210_288_761 | 157 |
| 805 | 3300035115 | Ga0373941_0213074 | Ga0373941_0213074_30_503 | 157 |
| 806 | 3300035115 | Ga0373941_0329374 | Ga0373941_0329374_70_606 | 157 |
| 807 | 3300035398 | Ga0316574_0036726 | Ga0316574_0036726_1901_2383 | 157 |
| 808 | 3300035398 | Ga0316574_0105574 | Ga0316574_0105574_1140_1640 | 157 |
| 809 | 3300035398 | Ga0316574_0189279 | Ga0316574_0189279_396_902 | 157 |
| 810 | 3300035398 | Ga0316574_0270134 | Ga0316574_0270134_116_604 | 157 |
| 811 | 3300035398 | Ga0316574_0438427 | Ga0316574_0438427_135_617 | 157 |
| 812 | 3300035691 | Ga0373931_0223720 | Ga0373931_0223720_250_723 | 157 |
| 813 | 3300035691 | Ga0373931_0600640 | Ga0373931_0600640_108_581 | 157 |
| 814 | 3300036401 | Ga0373937_0555560 | Ga0373937_0555560_594_1076 | 157 |
| 815 | 3300036647 | Ga0316582_0036724 | Ga0316582_0036724_2365_2871 | 157 |
| 816 | 3300036647 | Ga0316582_0064647 | Ga0316582_0064647_1770_2243 | 157 |
| 817 | 3300036647 | Ga0316582_0080866 | Ga0316582_0080866_70_552 | 157 |
| 818 | 3300036647 | Ga0316582_0093134 | Ga0316582_0093134_771_1253 | 157 |
| 819 | 3300036712 | Ga0316584_0026007 | Ga0316584_0026007_1611_2093 | 157 |
| 820 | 3300036712 | Ga0316584_0043982 | Ga0316584_0043982_2229_2729 | 157 |
| 821 | 3300036712 | Ga0316584_0098986 | Ga0316584_0098986_1184_1666 | 157 |
| 822 | 3300036712 | Ga0316584_0135460 | Ga0316584_0135460_18_500 | 157 |
| 823 | 3300036712 | Ga0316584_0266050 | Ga0316584_0266050_380_853 | 157 |
| 824 | 3300037466 | Ga0395898_0005965 | Ga0395898_0005965_10059_10556 | 157 |
| 825 | 3300038443 | Ga0395901_0101708 | Ga0395901_0101708_1493_1990 | 157 |
| 826 | 3300038726 | Ga0400490_24805 | Ga0400490_24805_100_588 | 157 |
| 827 | 3300038726 | Ga0400490_26858 | Ga0400490_26858_421_915 | 157 |
| 828 | 3300038726 | Ga0400490_53122 | Ga0400490_53122_1389_1877 | 157 |
| 829 | 3300038727 | Ga0400491_06308 | Ga0400491_06308_404_892 | 157 |
| 830 | 3300039062 | Ga0400483_066915 | Ga0400483_066915_169_654 | 157 |
| 831 | 3300039062 | Ga0400483_172963 | Ga0400483_172963_5999_6496 | 157 |
| 832 | 3300039062 | Ga0400483_197737 | Ga0400483_197737_641_1138 | 157 |
| 833 | 3300039062 | Ga0400483_199463 | Ga0400483_199463_115_612 | 157 |
| 834 | 3300039062 | Ga0400483_207579 | Ga0400483_207579_115_612 | 157 |
| 835 | 3300039093 | Ga0400489_49933 | Ga0400489_49933_4267_4749 | 157 |
| 836 | 3300039110 | Ga0400487_54724 | Ga0400487_54724_276_752 | 157 |
| 837 | 3300041456 | Ga0451795_0303860 | Ga0451795_0303860_2357_2833 | 157 |
| 838 | 3300041456 | Ga0451795_1520285 | Ga0451795_1520285_370_846 | 157 |
| 839 | 3300041511 | Ga0451855_1506058 | Ga0451855_1506058_152_631 | 157 |
| 840 | 3300042001 | Ga0439441_107532 | Ga0439441_107532_26_511 | 157 |
| 841 | 3300042005 | Ga0439448_0066351 | Ga0439448_0066351_48_521 | 157 |
| 842 | 3300042010 | Ga0439452_030038 | Ga0439452_030038_470_943 | 157 |
| 843 | 3300042011 | Ga0439454_023090 | Ga0439454_023090_257_730 | 157 |
| 844 | 3300042115 | Ga0450911_000112 | Ga0450911_000112_25072_25554 | 157 |
| 845 | 3300042125 | Ga0450923_111061 | Ga0450923_111061_133_606 | 157 |
| 846 | 3300042137 | Ga0450902_040902 | Ga0450902_040902_182_664 | 157 |
| 847 | 3300042156 | Ga0439446_0104052 | Ga0439446_0104052_178_651 | 157 |
| 848 | 3300042435 | Ga0439434_0108609 | Ga0439434_0108609_352_825 | 157 |
| 849 | 3300042437 | Ga0439444_0074380 | Ga0439444_0074380_106_591 | 157 |
| 850 | 3300042461 | Ga0439460_0005773 | Ga0439460_0005773_421_894 | 157 |
| 851 | 3300042461 | Ga0439460_0284735 | Ga0439460_0284735_11_484 | 157 |
| 852 | 3300042532 | Ga0450893_0016930 | Ga0450893_0016930_530_1003 | 157 |
| 853 | 3300042876 | Ga0451577_0000006 | Ga0451577_0000006_456249_456722 | 157 |
| 854 | 3300042876 | Ga0451577_0015345 | Ga0451577_0015345_2965_3465 | 157 |
| 855 | 3300042876 | Ga0451577_0052660 | Ga0451577_0052660_1658_2140 | 157 |
| 856 | 3300042876 | Ga0451577_0166504 | Ga0451577_0166504_794_1279 | 157 |
| 857 | 3300042876 | Ga0451577_0237062 | Ga0451577_0237062_258_758 | 157 |
| 858 | 3300042876 | Ga0451577_0346600 | Ga0451577_0346600_275_757 | 157 |
| 859 | 3300042876 | Ga0451577_0388942 | Ga0451577_0388942_600_1073 | 157 |
| 860 | 3300044656 | Ga0466969_0021149 | Ga0466969_0021149_77_556 | 157 |
| 861 | 3300044673 | Ga0453683_0000088 | Ga0453683_0000088_100385_100858 | 157 |
| 862 | 3300044673 | Ga0453683_0003232 | Ga0453683_0003232_6222_6695 | 157 |
| 863 | 3300044673 | Ga0453683_0046720 | Ga0453683_0046720_505_1002 | 157 |
| 864 | 3300044673 | Ga0453683_0054011 | Ga0453683_0054011_538_1038 | 157 |
| 865 | 3300044673 | Ga0453683_0308841 | Ga0453683_0308841_494_988 | 157 |
| 866 | 3300044673 | Ga0453683_0684241 | Ga0453683_0684241_79_555 | 157 |
| 867 | 3300044684 | Ga0466966_0048015 | Ga0466966_0048015_2228_2707 | 157 |
| 868 | 3300044693 | Ga0466961_0028067 | Ga0466961_0028067_61_540 | 157 |
| 869 | 3300044694 | Ga0466963_0362968 | Ga0466963_0362968_165_650 | 157 |
| 870 | 3300044712 | Ga0453684_0000037 | Ga0453684_0000037_456244_456717 | 157 |
| 871 | 3300044712 | Ga0453684_0002361 | Ga0453684_0002361_41840_42313 | 157 |
| 872 | 3300044712 | Ga0453684_0016369 | Ga0453684_0016369_3306_3788 | 157 |
| 873 | 3300044712 | Ga0453684_0033391 | Ga0453684_0033391_2263_2745 | 157 |
| 874 | 3300044712 | Ga0453684_0033906 | Ga0453684_0033906_6330_6950 | 157 |
| 875 | 3300044712 | Ga0453684_0103528 | Ga0453684_0103528_1958_2449 | 157 |
| 876 | 3300044712 | Ga0453684_0104957 | Ga0453684_0104957_625_1125 | 157 |
| 877 | 3300044712 | Ga0453684_0587797 | Ga0453684_0587797_589_1089 | 157 |
| 878 | 3300044712 | Ga0453684_0942742 | Ga0453684_0942742_282_773 | 157 |
| 879 | 3300045049 | Ga0466959_0025497 | Ga0466959_0025497_1773_2252 | 157 |
| 880 | 3300045049 | Ga0466959_0325229 | Ga0466959_0325229_26_526 | 157 |
| 881 | 3300045051 | Ga0451576_0001014 | Ga0451576_0001014_8427_8900 | 157 |
| 882 | 3300045051 | Ga0451576_0001923 | Ga0451576_0001923_2265_2738 | 157 |
| 883 | 3300045051 | Ga0451576_0006556 | Ga0451576_0006556_12117_12617 | 157 |
| 884 | 3300045051 | Ga0451576_0012858 | Ga0451576_0012858_2295_2795 | 157 |
| 885 | 3300045051 | Ga0451576_0018765 | Ga0451576_0018765_4223_4696 | 157 |
| 886 | 3300045051 | Ga0451576_0036104 | Ga0451576_0036104_2402_2875 | 157 |
| 887 | 3300045051 | Ga0451576_0133900 | Ga0451576_0133900_1092_1580 | 157 |
| 888 | 3300045051 | Ga0451576_0230206 | Ga0451576_0230206_809_1282 | 157 |
| 889 | 3300045976 | Ga0466967_0081188 | Ga0466967_0081188_1083_1568 | 157 |
| 890 | 3300046455 | Ga0495603_0588880 | Ga0495603_0588880_22_507 | 157 |
| 891 | 3300046459 | Ga0495629_0062223 | Ga0495629_0062223_208_717 | 157 |
| 892 | 3300046459 | Ga0495629_0194736 | Ga0495629_0194736_30_536 | 157 |
| 893 | 3300046459 | Ga0495629_0291499 | Ga0495629_0291499_459_941 | 157 |
| 894 | 3300046461 | Ga0495641_0001023 | Ga0495641_0001023_20643_21125 | 157 |
| 895 | 3300046471 | Ga0495650_0000223 | Ga0495650_0000223_67587_68069 | 157 |
| 896 | 3300046473 | Ga0495582_0527091 | Ga0495582_0527091_80_589 | 157 |
| 897 | 3300046474 | Ga0495605_0271752 | Ga0495605_0271752_202_675 | 157 |
| 898 | 3300046475 | Ga0495639_0004293 | Ga0495639_0004293_2880_3389 | 157 |
| 899 | 3300046499 | Ga0495594_0713223 | Ga0495594_0713223_48_557 | 157 |
| 900 | 3300046520 | Ga0495637_0110525 | Ga0495637_0110525_567_1040 | 157 |
| 901 | 3300046523 | Ga0495644_0041092 | Ga0495644_0041092_249_746 | 157 |
| 902 | 3300046525 | Ga0495663_0020640 | Ga0495663_0020640_1297_1794 | 157 |
| 903 | 3300046530 | Ga0495654_0007735 | Ga0495654_0007735_1526_2005 | 157 |
| 904 | 3300046539 | Ga0495621_0018835 | Ga0495621_0018835_642_1151 | 157 |
| 905 | 3300046542 | Ga0495597_0000509 | Ga0495597_0000509_3515_4003 | 157 |
| 906 | 3300046558 | Ga0495633_0002712 | Ga0495633_0002712_7741_8229 | 157 |
| 907 | 3300046615 | Ga0495656_0212365 | Ga0495656_0212365_62_571 | 157 |
| 908 | 3300046615 | Ga0495656_0276365 | Ga0495656_0276365_150_647 | 157 |
| 909 | 3300046664 | Ga0495659_0014635 | Ga0495659_0014635_312_785 | 157 |
| 910 | 3300046665 | Ga0495661_0476559 | Ga0495661_0476559_91_588 | 157 |
| 911 | 3300046683 | Ga0495658_0010228 | Ga0495658_0010228_3481_3963 | 157 |
| 912 | 3300047472 | Ga0495686_0000003 | Ga0495686_0000003_67100_67597 | 157 |
| 913 | 3300047472 | Ga0495686_0250066 | Ga0495686_0250066_134_631 | 157 |
| 914 | 3300048903 | Ga0496100_0022683 | Ga0496100_0022683_1854_2363 | 157 |
| 915 | 3300048903 | Ga0496100_0061173 | Ga0496100_0061173_1469_1975 | 157 |
| 916 | 3300048904 | Ga0496101_0000838 | Ga0496101_0000838_8944_9453 | 157 |
| 917 | 3300048905 | Ga0496102_0015405 | Ga0496102_0015405_3496_4005 | 157 |
| 918 | 3300048907 | Ga0496104_0069098 | Ga0496104_0069098_2737_3246 | 157 |
| 919 | 3300048908 | Ga0496105_0001878 | Ga0496105_0001878_11237_11746 | 157 |
| 920 | 3300048909 | Ga0496106_0116109 | Ga0496106_0116109_309_818 | 157 |
| 921 | 3300048911 | Ga0496108_0036317 | Ga0496108_0036317_3562_4071 | 157 |
| 922 | 3300048912 | Ga0496109_0059902 | Ga0496109_0059902_2015_2524 | 157 |
| 923 | 3300048913 | Ga0496110_0039387 | Ga0496110_0039387_2546_3043 | 157 |
| 924 | 3300048913 | Ga0496110_0068524 | Ga0496110_0068524_2493_3002 | 157 |
| 925 | 3300048915 | Ga0496112_0198073 | Ga0496112_0198073_771_1280 | 157 |
| 926 | 3300048916 | Ga0496113_0152039 | Ga0496113_0152039_607_1116 | 157 |
| 927 | 3300048916 | Ga0496113_0324079 | Ga0496113_0324079_416_913 | 157 |
| 928 | 3300048917 | Ga0496114_0032784 | Ga0496114_0032784_1087_1596 | 157 |
| 929 | 3300048919 | Ga0496116_0001255 | Ga0496116_0001255_11149_11712 | 157 |
| 930 | 3300048924 | Ga0496121_0002127 | Ga0496121_0002127_3972_4454 | 157 |
| 931 | 3300048924 | Ga0496121_0177285 | Ga0496121_0177285_683_1177 | 157 |
| 932 | 3300048925 | Ga0496122_0000228 | Ga0496122_0000228_99443_100000 | 157 |
| 933 | 3300048925 | Ga0496122_0023463 | Ga0496122_0023463_1355_1837 | 157 |
| 934 | 3300048925 | Ga0496122_0233749 | Ga0496122_0233749_86_589 | 157 |
| 935 | 3300048926 | Ga0496123_0035234 | Ga0496123_0035234_2179_2661 | 157 |
| 936 | 3300048926 | Ga0496123_0098794 | Ga0496123_0098794_737_1231 | 157 |
| 937 | 3300048927 | Ga0496124_0069625 | Ga0496124_0069625_898_1380 | 157 |
| 938 | 3300048928 | Ga0496125_0006133 | Ga0496125_0006133_1735_2217 | 157 |
| 939 | 3300048928 | Ga0496125_0045061 | Ga0496125_0045061_2939_3421 | 157 |
| 940 | 3300048928 | Ga0496125_0073841 | Ga0496125_0073841_2000_2482 | 157 |
| 941 | 3300048928 | Ga0496125_0076835 | Ga0496125_0076835_1975_2469 | 157 |
| 942 | 3300048928 | Ga0496125_0146944 | Ga0496125_0146944_764_1246 | 157 |
| 943 | 3300048928 | Ga0496125_0261144 | Ga0496125_0261144_97_654 | 157 |
| 944 | 3300048929 | Ga0496126_0000290 | Ga0496126_0000290_80332_80889 | 157 |
| 945 | 3300048929 | Ga0496126_0026546 | Ga0496126_0026546_1449_1931 | 157 |
| 946 | 3300048929 | Ga0496126_0178880 | Ga0496126_0178880_898_1380 | 157 |
| 947 | 3300048929 | Ga0496126_0210730 | Ga0496126_0210730_417_899 | 157 |
| 948 | 3300049513 | Ga0501290_002057 | Ga0501290_002057_1251_1724 | 157 |
| 949 | 3300049514 | Ga0501291_000079 | Ga0501291_000079_8995_9468 | 157 |
| 950 | 3300049515 | Ga0501292_000089 | Ga0501292_000089_5674_6147 | 157 |
| 951 | 3300049516 | Ga0501293_001643 | Ga0501293_001643_889_1362 | 157 |
| 952 | 3300049517 | Ga0501294_000183 | Ga0501294_000183_708_1181 | 157 |
| 953 | 3300049518 | Ga0501295_001213 | Ga0501295_001213_893_1366 | 157 |
| 954 | 3300049519 | Ga0501296_000565 | Ga0501296_000565_156_629 | 157 |
| 955 | 3300049521 | Ga0501298_000382 | Ga0501298_000382_3579_4052 | 157 |
| 956 | 3300049521 | Ga0501298_060035 | Ga0501298_060035_277_777 | 157 |
| 957 | 3300049522 | Ga0501299_000156 | Ga0501299_000156_421_894 | 157 |
| 958 | 3300049531 | Ga0501315_022282 | Ga0501315_022282_214_711 | 157 |
| 959 | 3300049568 | Ga0501031_0002920 | Ga0501031_0002920_1755_2246 | 157 |
| 960 | 3300049568 | Ga0501031_0022187 | Ga0501031_0022187_1877_2362 | 157 |
| 961 | 3300049568 | Ga0501031_0032889 | Ga0501031_0032889_2406_2888 | 157 |
| 962 | 3300049568 | Ga0501031_0448490 | Ga0501031_0448490_97_588 | 157 |
| 963 | 3300049569 | Ga0501032_0006582 | Ga0501032_0006582_1635_2126 | 157 |
| 964 | 3300049569 | Ga0501032_0223515 | Ga0501032_0223515_502_984 | 157 |
| 965 | 3300049569 | Ga0501032_0250476 | Ga0501032_0250476_92_583 | 157 |
| 966 | 3300049570 | Ga0501033_0001825 | Ga0501033_0001825_10743_11234 | 157 |
| 967 | 3300049570 | Ga0501033_0033434 | Ga0501033_0033434_2882_3373 | 157 |
| 968 | 3300049571 | Ga0501034_0000271 | Ga0501034_0000271_41253_41735 | 157 |
| 969 | 3300049571 | Ga0501034_0137335 | Ga0501034_0137335_124_615 | 157 |
| 970 | 3300049571 | Ga0501034_0303890 | Ga0501034_0303890_391_882 | 157 |
| 971 | 3300049572 | Ga0501036_0000327 | Ga0501036_0000327_28345_28836 | 157 |
| 972 | 3300049572 | Ga0501036_0260444 | Ga0501036_0260444_362_835 | 157 |
| 973 | 3300049572 | Ga0501036_0743637 | Ga0501036_0743637_189_668 | 157 |
| 974 | 3300049573 | Ga0501037_0002561 | Ga0501037_0002561_10529_11020 | 157 |
| 975 | 3300049573 | Ga0501037_0034755 | Ga0501037_0034755_826_1311 | 157 |
| 976 | 3300049573 | Ga0501037_0087534 | Ga0501037_0087534_189_680 | 157 |
| 977 | 3300049574 | Ga0501038_0009050 | Ga0501038_0009050_1551_2036 | 157 |
| 978 | 3300049574 | Ga0501038_0010326 | Ga0501038_0010326_5121_5612 | 157 |
| 979 | 3300049575 | Ga0501039_0019159 | Ga0501039_0019159_3739_4221 | 157 |
| 980 | 3300049575 | Ga0501039_0038148 | Ga0501039_0038148_1774_2259 | 157 |
| 981 | 3300049576 | Ga0501040_0163992 | Ga0501040_0163992_593_1066 | 157 |
| 982 | 3300049576 | Ga0501040_1193584 | Ga0501040_1193584_22_495 | 157 |
| 983 | 3300049577 | Ga0501041_0027827 | Ga0501041_0027827_426_911 | 157 |
| 984 | 3300049577 | Ga0501041_0109031 | Ga0501041_0109031_431_913 | 157 |
| 985 | 3300049577 | Ga0501041_0343536 | Ga0501041_0343536_418_897 | 157 |
| 986 | 3300049578 | Ga0501042_0010054 | Ga0501042_0010054_5724_6206 | 157 |
| 987 | 3300049578 | Ga0501042_0023574 | Ga0501042_0023574_845_1330 | 157 |
| 988 | 3300049578 | Ga0501042_0866102 | Ga0501042_0866102_21_494 | 157 |
| 989 | 3300049579 | Ga0501043_0000828 | Ga0501043_0000828_11205_11696 | 157 |
| 990 | 3300049579 | Ga0501043_0097392 | Ga0501043_0097392_780_1271 | 157 |
| 991 | 3300049579 | Ga0501043_0225767 | Ga0501043_0225767_716_1189 | 157 |
| 992 | 3300049579 | Ga0501043_0807282 | Ga0501043_0807282_180_662 | 157 |
| 993 | 3300049580 | Ga0501046_0006900 | Ga0501046_0006900_118_603 | 157 |
| 994 | 3300049580 | Ga0501046_0008109 | Ga0501046_0008109_4866_5357 | 157 |
| 995 | 3300049580 | Ga0501046_0960468 | Ga0501046_0960468_74_547 | 157 |
| 996 | 3300049581 | Ga0501047_0014841 | Ga0501047_0014841_263_754 | 157 |
| 997 | 3300049581 | Ga0501047_0118072 | Ga0501047_0118072_680_1159 | 157 |
| 998 | 3300049582 | Ga0501048_0950224 | Ga0501048_0950224_55_534 | 157 |
| 999 | 3300049583 | Ga0501067_0053866 | Ga0501067_0053866_1432_1905 | 157 |
| 1000 | 3300049584 | Ga0501068_0043117 | Ga0501068_0043117_928_1401 | 157 |
| 1001 | 3300049584 | Ga0501068_0612531 | Ga0501068_0612531_139_612 | 157 |
| 1002 | 3300049587 | Ga0501071_0024606 | Ga0501071_0024606_26_499 | 157 |
| 1003 | 3300049587 | Ga0501071_0048033 | Ga0501071_0048033_1377_1859 | 157 |
| 1004 | 3300049587 | Ga0501071_0428191 | Ga0501071_0428191_200_673 | 157 |
| 1005 | 3300049588 | Ga0501072_0020273 | Ga0501072_0020273_299_781 | 157 |
| 1006 | 3300049588 | Ga0501072_1371593 | Ga0501072_1371593_12_494 | 157 |
| 1007 | 3300049589 | Ga0501073_0438572 | Ga0501073_0438572_416_889 | 157 |
| 1008 | 3300049592 | Ga0501076_0785609 | Ga0501076_0785609_243_725 | 157 |
| 1009 | 3300049649 | Ga0501198_004802 | Ga0501198_004802_901_1374 | 157 |
| 1010 | 3300049650 | Ga0501199_001420 | Ga0501199_001420_779_1252 | 157 |
| 1011 | 3300049652 | Ga0501202_000879 | Ga0501202_000879_3288_3761 | 157 |
| 1012 | 3300049653 | Ga0501206_000174 | Ga0501206_000174_6460_6933 | 157 |
| 1013 | 3300049654 | Ga0501207_008793 | Ga0501207_008793_781_1254 | 157 |
| 1014 | 3300049656 | Ga0501209_005740 | Ga0501209_005740_1109_1582 | 157 |
| 1015 | 3300049658 | Ga0501211_003197 | Ga0501211_003197_920_1393 | 157 |
| 1016 | 3300049659 | Ga0501214_031099 | Ga0501214_031099_239_712 | 157 |
| 1017 | 3300049661 | Ga0501217_109927 | Ga0501217_109927_29_502 | 157 |
| 1018 | 3300049665 | Ga0501227_039298 | Ga0501227_039298_93_566 | 157 |
| 1019 | 3300049666 | Ga0501228_002783 | Ga0501228_002783_638_1111 | 157 |
| 1020 | 3300049669 | Ga0501235_010481 | Ga0501235_010481_1037_1510 | 157 |
| 1021 | 3300049672 | Ga0501239_001777 | Ga0501239_001777_553_1026 | 157 |
| 1022 | 3300049677 | Ga0501247_025930 | Ga0501247_025930_244_717 | 157 |
| 1023 | 3300049679 | Ga0501249_000272 | Ga0501249_000272_7406_7879 | 157 |
| 1024 | 3300049681 | Ga0501251_000114 | Ga0501251_000114_109_582 | 157 |
| 1025 | 3300049684 | Ga0501255_000792 | Ga0501255_000792_1101_1574 | 157 |
| 1026 | 3300049685 | Ga0501256_010439 | Ga0501256_010439_336_809 | 157 |
| 1027 | 3300049686 | Ga0501257_001912 | Ga0501257_001912_3116_3589 | 157 |
| 1028 | 3300049688 | Ga0501259_010291 | Ga0501259_010291_1025_1498 | 157 |
| 1029 | 3300049689 | Ga0501260_000129 | Ga0501260_000129_525_998 | 157 |
| 1030 | 3300049690 | Ga0501261_000625 | Ga0501261_000625_443_916 | 157 |
| 1031 | 3300049703 | Ga0501219_001317 | Ga0501219_001317_860_1333 | 157 |
| 1032 | 3300049704 | Ga0501221_000163 | Ga0501221_000163_3235_3708 | 157 |
| 1033 | 3300049705 | Ga0501225_0004309 | Ga0501225_0004309_3338_3811 | 157 |
| 1034 | 3300049706 | Ga0501229_005230 | Ga0501229_005230_682_1155 | 157 |
| 1035 | 3300049707 | Ga0501234_000770 | Ga0501234_000770_3762_4235 | 157 |
| 1036 | 3300049708 | Ga0501245_000167 | Ga0501245_000167_239_712 | 157 |
| 1037 | 3300049741 | Ga0501079_0122109 | Ga0501079_0122109_895_1377 | 157 |
| 1038 | 3300049741 | Ga0501079_1071898 | Ga0501079_1071898_142_621 | 157 |
| 1039 | 3300049742 | Ga0501080_0665970 | Ga0501080_0665970_62_535 | 157 |
| 1040 | 3300049743 | Ga0501081_0287978 | Ga0501081_0287978_482_967 | 157 |
| 1041 | 3300049743 | Ga0501081_0902209 | Ga0501081_0902209_56_529 | 157 |
| 1042 | 3300049758 | Ga0501241_060507 | Ga0501241_060507_252_725 | 157 |
| 1043 | 3300049763 | Ga0501266_005449 | Ga0501266_005449_262_741 | 157 |
| 1044 | 3300049765 | Ga0501268_001028 | Ga0501268_001028_2098_2571 | 157 |
| 1045 | 3300049767 | Ga0501270_000726 | Ga0501270_000726_2237_2710 | 157 |
| 1046 | 3300049768 | Ga0501271_000056 | Ga0501271_000056_4048_4521 | 157 |
| 1047 | 3300049769 | Ga0501272_001584 | Ga0501272_001584_750_1223 | 157 |
| 1048 | 3300049770 | Ga0501273_002115 | Ga0501273_002115_647_1120 | 157 |
| 1049 | 3300049774 | Ga0501278_000356 | Ga0501278_000356_2282_2755 | 157 |
| 1050 | 3300049777 | Ga0501281_01917 | Ga0501281_01917_769_1242 | 157 |
| 1051 | 3300049778 | Ga0501282_004434 | Ga0501282_004434_515_988 | 157 |
| 1052 | 3300049779 | Ga0501283_000150 | Ga0501283_000150_6430_6903 | 157 |
| 1053 | 3300049822 | Ga0501035_0000973 | Ga0501035_0000973_5054_5545 | 157 |
| 1054 | 3300049822 | Ga0501035_0276014 | Ga0501035_0276014_820_1305 | 157 |
| 1055 | 3300049823 | Ga0501044_0002872 | Ga0501044_0002872_15380_15871 | 157 |
| 1056 | 3300049824 | Ga0501045_0096219 | Ga0501045_0096219_514_996 | 157 |
| 1057 | 3300049824 | Ga0501045_0325322 | Ga0501045_0325322_262_735 | 157 |
| 1058 | 3300049853 | Ga0501226_001260 | Ga0501226_001260_1674_2147 | 157 |
| 1059 | 3300050489 | nmdc:mga03683_215138_c1 | nmdc:mga03683_215138_c1_12_497 | 157 |
| 1060 | 3300050490 | nmdc:mga03n38_65449_c1 | nmdc:mga03n38_65449_c1_607_1098 | 157 |
| 1061 | 3300050491 | nmdc:mga00v17_422526_c1 | nmdc:mga00v17_422526_c1_222_713 | 157 |
| 1062 | 3300050493 | nmdc:mga0k408_48886_c1 | nmdc:mga0k408_48886_c1_563_1054 | 157 |
| 1063 | 3300050494 | nmdc:mga06z11_151902_c1 | nmdc:mga06z11_151902_c1_685_1176 | 157 |
| 1064 | 3300050496 | nmdc:mga07m45_13717_c1 | nmdc:mga07m45_13717_c1_3544_4035 | 157 |
| 1065 | 3300050507 | nmdc:mga05p37_214906_c1 | nmdc:mga05p37_214906_c1_1095_1568 | 157 |
| 1066 | 3300050507 | nmdc:mga05p37_793288_c1 | nmdc:mga05p37_793288_c1_274_747 | 157 |
| 1067 | 3300050507 | nmdc:mga05p37_975655_c1 | nmdc:mga05p37_975655_c1_269_742 | 157 |
| 1068 | 3300050508 | nmdc:mga09592_199729_c1 | nmdc:mga09592_199729_c1_839_1312 | 157 |
| 1069 | 3300050508 | nmdc:mga09592_486594_c1 | nmdc:mga09592_486594_c1_83_556 | 157 |
| 1070 | 3300050508 | nmdc:mga09592_4984_c1 | nmdc:mga09592_4984_c1_4210_4683 | 157 |
| 1071 | 3300050509 | nmdc:mga0qj67_185306_c1 | nmdc:mga0qj67_185306_c1_290_763 | 157 |
| 1072 | 3300050509 | nmdc:mga0qj67_360472_c1 | nmdc:mga0qj67_360472_c1_150_623 | 157 |
| 1073 | 3300050509 | nmdc:mga0qj67_4550_c1 | nmdc:mga0qj67_4550_c1_1593_2066 | 157 |
| 1074 | 3300050510 | nmdc:mga06r32_70368_c1 | nmdc:mga06r32_70368_c1_950_1423 | 157 |
| 1075 | 3300050511 | nmdc:mga08y16_15713_c1 | nmdc:mga08y16_15713_c1_4972_5460 | 157 |
| 1076 | 3300050512 | nmdc:mga0n895_109332_c1 | nmdc:mga0n895_109332_c1_1511_1984 | 157 |
| 1077 | 3300050512 | nmdc:mga0n895_273122_c1 | nmdc:mga0n895_273122_c1_348_821 | 157 |
| 1078 | 3300050512 | nmdc:mga0n895_282768_c1 | nmdc:mga0n895_282768_c1_1162_1647 | 157 |
| 1079 | 3300050513 | nmdc:mga0rr50_29699_c1 | nmdc:mga0rr50_29699_c1_3024_3497 | 157 |
| 1080 | 3300050513 | nmdc:mga0rr50_76224_c1 | nmdc:mga0rr50_76224_c1_1172_1645 | 157 |
| 1081 | 3300050514 | nmdc:mga08x19_158371_c1 | nmdc:mga08x19_158371_c1_155_628 | 157 |
| 1082 | 3300050514 | nmdc:mga08x19_257680_c1 | nmdc:mga08x19_257680_c1_480_965 | 157 |
| 1083 | 3300050514 | nmdc:mga08x19_431462_c1 | nmdc:mga08x19_431462_c1_140_625 | 157 |
| 1084 | 3300053149 | Ga0500600_0010721 | Ga0500600_0010721_2128_2616 | 157 |
| 1085 | 3300053153 | Ga0500616_0006338 | Ga0500616_0006338_1680_2171 | 157 |
| 1086 | 3300059640 | Ga0587067_053520 | Ga0587067_053520_43_540 | 157 |
| 1087 | 3300060353 | Ga0501082_0377009 | Ga0501082_0377009_302_784 | 157 |
| 1088 | 3300060353 | Ga0501082_0850599 | Ga0501082_0850599_139_612 | 157 |
| 1089 | 3300061734 | Ga0530510_1158073 | Ga0530510_1158073_66_539 | 157 |
| 1090 | iso_pu_bacteria | 2526164512 | 2526210683 | 157 |
| 1091 | iso_pu_bacteria | 2574179768 | 2574433172 | 157 |
| 1092 | iso_pu_bacteria | 2739367655 | 2739612137 | 157 |
| 1093 | iso_pu_bacteria | 2842733646 | 2842735461 | 157 |
| 1094 | iso_pu_bacteria | 2891633521 | 2891634615 | 157 |
| 1095 | iso_pu_bacteria | 2894023352 | 2894026590 | 157 |
| 1096 | iso_pu_bacteria | 639633007 | 639786830 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k2x-assembly1.cif.gz_A | crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine | 0.9935 | 2 | 154 |
| 5l12-assembly1.cif.gz_A | crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant | 0.9924 | 2 | 154 |
| 3iew-assembly1.cif.gz_A | crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp | 0.9917 | 2 | 157 |
| 3mbm-assembly1.cif.gz_C | crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine and fol fragment 717, imidazo[2,1-b][1,3]thiazol-6-ylmethanol | 0.9909 | 2 | 154 |
| 5iwx-assembly1.cif.gz_A | crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis | 0.9899 | 2 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6TL41_66_225_3.30.1330.50 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.99 | 2 | 157 | 3.30.1330.50 |
| af_B6TL41_66_225_3.30.1330.50 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9776 | 2 | 157 | 3.30.1330.50 |
| 5b8fC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9692 | 2 | 157 | 3.30.1330.50 |
| 1w55A02 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9688 | 2 | 157 | 3.30.1330.50 |
| 3t80F00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9633 | 2 | 155 | 3.30.1330.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533XV57-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 1.002 | 1 | 157 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A525VM64-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 1.001 | 1 | 156 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-E1YIT0-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 1.001 | 1 | 155 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-R5A4P8-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 1.001 | 2 | 155 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 GO:0070567 |
| AF-A0A1F3J1S4-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 1 | 2 | 156 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar