F489975

General Info

Members Datasets Scaffolds Average Seq Length
1096 588 1008 159

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100101052|Ga0070705_1001010523
Length 190
Sequence MASRRPARAPAARSIRRRPRRPRSTGVPPAGLRIGCGADAHALRPGRRLVLGGVEIPHAAGLLGHSDADVLSHALCDALLGALGLPDMGTRFPDSDETLRDRSSLYFLQDVMREVRARGFEILNVDAVVLAEAPRLQPHLETIRASLAAALGVPPSSVGLKAKRLEGLGAVGRQEGIMAQAVALLSGPRA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
3 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
4 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221717 Acidovorax sp. Root267 Isolate Unclassified
13 2643221729 Bacillus sp. Root11 Isolate Unclassified
14 2643221730 Bacillus sp. Root131 Isolate Unclassified
15 2643221731 Bacillus sp. Root147 Isolate Unclassified
16 2643221732 Bacillus sp. Root239 Isolate Unclassified
17 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
18 2684622632 Bacillus cereus 905 Isolate Unclassified
19 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
20 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
21 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
22 2721755523 Delftia sp. HK171 Isolate Unclassified
23 2738541277 Variovorax sp. GV051 Isolate Unclassified
24 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
25 2738541307 Variovorax sp. GV008 Isolate Unclassified
26 2738541358 Bacillus sp. OV752 Isolate Unclassified
27 2738543006 Bacillus sp. OK077 Isolate Unclassified
28 2738543010 Bacillus sp. YR335 Isolate Unclassified
29 2738543012 Acidovorax sp. CF301 Isolate Unclassified
30 2738543019 Variovorax sp. GV040 Isolate Unclassified
31 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
32 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
33 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
34 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
35 2818991446 Variovorax sp. 1180 Isolate Unclassified
36 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
37 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
38 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
39 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
40 2842682962 Bacillus sp. R-72492 Isolate Unclassified
41 2842733646 Variovorax sp. R-72446 Isolate Unclassified
42 2842882022 Bacillus sp. R-71893 Isolate Unclassified
43 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
44 2849139964 Bacillus sp. R-71875 Isolate Unclassified
45 2857581216 Bacillus sp. R-71922 Isolate Unclassified
46 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
47 2885198086 Variovorax sp. 679 Isolate Unclassified
48 2885211737 Variovorax sp. 553 Isolate Unclassified
49 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
50 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
51 2899924645 Variovorax sp. 369 Isolate Unclassified
52 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
53 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
54 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
55 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
56 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
57 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
58 2919720352 Priestia megaterium 4340 Isolate Unclassified
59 2928037797 Variovorax sp. 1126 Isolate Unclassified
60 2928044640 Variovorax sp. 1128 Isolate Unclassified
61 2928051484 Variovorax sp. 1133 Isolate Unclassified
62 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
63 2928070936 Variovorax gossypii 1167 Isolate Unclassified
64 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
65 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
66 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
67 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
68 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
69 2938917290 Bacillus sp. CR71 Isolate Unclassified
70 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
71 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
72 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
73 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
74 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
75 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
76 2965761152 Bacillus sp. COPE52 Isolate Unclassified
77 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
78 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
79 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
80 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
81 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
82 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
83 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
84 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
85 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
86 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
87 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
88 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
89 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
90 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
91 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
92 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
93 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
94 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
95 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
96 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
97 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
98 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
99 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
100 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
101 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
102 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
103 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
104 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
105 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
106 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
107 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
108 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
109 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
110 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
111 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
112 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
113 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
114 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
115 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
116 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
117 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
118 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
119 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
120 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
121 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
122 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
123 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
124 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
125 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
126 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
127 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
128 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
129 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
130 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
131 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
132 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
133 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
134 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
135 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
136 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
137 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
138 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
139 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
140 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
141 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
142 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
143 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
144 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
145 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
146 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
147 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
148 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
149 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
150 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
151 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
152 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
153 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
154 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
155 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
156 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
159 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
160 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
161 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
162 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
163 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
164 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
165 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
166 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
167 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
168 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
169 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
170 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
171 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
172 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
173 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
174 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
175 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
176 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
177 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
178 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
179 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
180 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
181 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
182 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
183 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
184 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
185 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
186 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
188 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
189 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
190 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
191 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
192 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
193 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
194 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
195 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
196 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
197 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
198 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
199 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
200 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
201 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
202 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
204 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
205 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
206 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
207 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
208 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
209 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
210 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
211 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
212 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
213 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
214 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
215 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
216 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
217 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
218 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
219 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
220 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
221 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
222 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
223 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
224 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
225 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
226 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
227 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
231 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
233 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
236 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
239 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
241 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
243 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
244 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
300 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
303 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
305 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
306 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
307 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
308 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
309 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
310 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
312 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
318 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
320 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
321 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
322 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
323 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
324 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
325 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
326 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
327 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
328 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
329 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
330 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
331 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
332 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
333 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
334 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
335 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
336 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
337 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
338 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
339 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
340 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
341 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
342 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
347 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
348 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
349 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
350 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
351 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
352 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
353 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
354 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
355 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
356 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
357 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
358 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
359 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
360 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
361 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
362 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
363 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
364 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
365 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
366 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
367 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
368 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
369 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
370 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
371 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
372 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
373 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
374 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
375 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
376 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
377 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
378 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
379 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
380 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
381 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
382 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
383 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
384 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
385 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
386 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
387 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
388 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
389 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
390 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
391 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
392 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
393 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
394 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
395 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
396 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
397 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
398 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
399 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
400 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
401 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
402 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
403 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
404 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
405 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
406 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
407 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
408 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
409 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
410 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
411 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
412 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
413 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
414 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
415 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
416 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
417 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
418 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
419 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
420 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
421 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
422 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
423 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
424 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
425 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
426 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
427 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
428 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
429 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
430 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
431 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
432 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
433 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
434 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
435 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
436 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
437 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
438 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
439 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
440 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
441 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
442 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
443 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
444 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
445 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
446 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
447 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
448 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
449 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
450 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
451 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
452 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
453 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
454 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
455 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
456 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
457 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
458 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
459 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
460 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
461 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
463 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
464 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
465 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
466 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
467 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
468 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
469 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
470 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
471 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
479 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
480 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
481 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
482 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
489 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
490 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
491 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
492 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
493 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
494 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
495 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
496 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
497 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
498 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
499 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
500 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
501 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
502 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
503 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
504 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
505 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
506 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
507 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
508 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
509 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
510 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
511 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
512 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
513 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
514 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
515 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
516 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
517 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
518 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
519 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
520 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
521 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
522 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
523 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
524 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
525 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
526 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
527 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
528 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
529 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
530 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
531 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
532 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
533 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
534 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
535 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
536 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
537 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
538 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
539 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
540 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
542 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
543 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
544 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
545 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
546 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
547 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
548 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
549 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
550 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
551 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
552 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
553 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
554 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
555 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
556 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
557 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
558 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
559 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
560 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
561 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
562 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
563 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
564 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
565 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
566 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
567 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
568 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
569 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
570 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
571 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
572 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
573 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
574 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
575 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
576 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
577 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
579 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
580 639633007 Azoarcus olearius BH72 Isolate Unclassified
581 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
582 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
583 8022653035 Bacillus sp. Rc4 Isolate Unclassified
584 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
585 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
586 8023438354 Bacillus sp. BH2 Isolate Unclassified
587 8023444577 Bacillus sp. BH32 Isolate Unclassified
588 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.88
Metatranscriptomes 1.09
Isolates 8.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.96
Nodule 0.27
Rhizoplane 4.01
Rhizosphere 69.62
Stem 0
Stem Tuber 0
Unclassified 12.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214782462 2209111006 Unclassified 757
2 JGI24740J21852_10022978 3300001979 Bacteria 2137
3 JGI24740J21852_10035018 3300001979 Bacteria 1574
4 JGI24740J21852_10041916 3300001979 Bacteria 1376
5 JGI24739J22299_10073669 3300001989 Bacteria 1059
6 JGI25152J39213_1009363 3300002773 Bacteria 2333
7 JGI25152J39213_1013311 3300002773 Bacteria 1720
8 JGI25150J39212_1002663 3300002774 Bacteria 4366
9 JGI25150J39212_1028980 3300002774 Bacteria 781
10 JGI25159J45721_1000455 3300002987 Bacteria 18924
11 JGI25159J45721_1008909 3300002987 Bacteria 2701
12 JGI25159J45721_1008941 3300002987 Bacteria 2692
13 JGI25151J46595_10002393 3300003187 Bacteria 11356
14 JGI25151J46595_10009236 3300003187 Bacteria 4685
15 JGI25151J46595_10013010 3300003187 Bacteria 3760
16 JGI25151J46595_10024635 3300003187 Bacteria 2459
17 JGI25151J46595_10035559 3300003187 Bacteria 1890
18 JGI25151J46595_10048721 3300003187 Bacteria 1461
19 JGI25151J46595_10106259 3300003187 Bacteria 744
20 JGI25151J46595_10125314 3300003187 Bacteria 648
21 JGI25153J46596_10020886 3300003215 Bacteria 2459
22 rootH1_10000848 3300003316 Bacteria 58943
23 rootH1_10026606 3300003316 Bacteria 3175
24 rootH2_10177648 3300003320 Bacteria 5131
25 rootL2_10052955 3300003322 Bacteria 32035
26 rootH1_10042628 3300003323 Bacteria 2035
27 rootH1_10084694 3300003323 Bacteria 1405
28 JGI25160J50197_1000148 3300003354 Bacteria 61871
29 JGI25160J50197_1000822 3300003354 Bacteria 16614
30 JGI25160J50197_1021441 3300003354 Bacteria 1919
31 JGI25160J50197_1021448 3300003354 Bacteria 1919
32 JGI26145J50221_1005807 3300003371 Unclassified 1022
33 JGI25161J50226_1000111 3300003374 Bacteria 63577
34 JGI25161J50226_1004523 3300003374 Bacteria 2896
35 JGI25161J50226_1004914 3300003374 Bacteria 2713
36 Ga0006562J51391_1060112 3300003578 Bacteria 4170
37 Ga0055535_1000653 3300003761 Bacteria 27554
38 Ga0055542_1000004 3300003762 Bacteria 553532
39 Ga0055526_1017208 3300003771 Bacteria 2777
40 Ga0055526_1017238 3300003771 Bacteria 2772
41 Ga0055537_1007008 3300003773 Bacteria 2777
42 Ga0055524_1015487 3300003775 Bacteria 2777
43 Ga0055524_1015518 3300003775 Bacteria 2772
44 Ga0055536_1010162 3300003781 Bacteria 3775
45 Ga0055536_1013833 3300003781 Bacteria 2877
46 Ga0055534_1003507 3300003784 Bacteria 4908
47 Ga0055534_1008619 3300003784 Bacteria 2293
48 Ga0055534_1009764 3300003784 Bacteria 2057
49 Ga0055528_1001614 3300003790 Bacteria 13323
50 Ga0055528_1015323 3300003790 Bacteria 2777
51 Ga0055530_10013554 3300003791 Bacteria 2775
52 Ga0055530_10016612 3300003791 Bacteria 2342
53 Ga0055530_10046609 3300003791 Bacteria 1028
54 Ga0055540_1008365 3300003792 Bacteria 3733
55 Ga0055540_1013006 3300003792 Bacteria 2570
56 Ga0055540_1017000 3300003792 Bacteria 2045
57 Ga0055531_10025953 3300003794 Bacteria 2107
58 Ga0055531_10026712 3300003794 Bacteria 2049
59 Ga0055543_1000302 3300004625 Bacteria 34707
60 Ga0055543_1005187 3300004625 Bacteria 3372
61 Ga0055543_1010513 3300004625 Bacteria 1936
62 Ga0065165_1012873 3300005262 Bacteria 3372
63 Ga0065165_1013194 3300005262 Bacteria 3303
64 Ga0065165_1038578 3300005262 Bacteria 1439
65 Ga0065165_1051908 3300005262 Bacteria 1160
66 Ga0065165_1051909 3300005262 Bacteria 1160
67 Ga0065716_1007454 3300005277 Unclassified 754
68 Ga0065712_10037862 3300005290 Bacteria 1070
69 Ga0065712_10204418 3300005290 Bacteria 1096
70 Ga0065715_10663414 3300005293 Unclassified 670
71 Ga0065707_10283295 3300005295 Bacteria 1031
72 Ga0070658_10021990 3300005327 Bacteria 5115
73 Ga0070676_10005793 3300005328 Bacteria 6585
74 Ga0070683_100327982 3300005329 Bacteria 1457
75 Ga0070683_100342633 3300005329 Bacteria 1423
76 Ga0070690_100002862 3300005330 Bacteria 9304
77 Ga0070670_100163642 3300005331 Bacteria 1929
78 Ga0070670_100680692 3300005331 Bacteria 924
79 Ga0070677_10146803 3300005333 Bacteria 1094
80 Ga0068869_100086862 3300005334 Bacteria 2345
81 Ga0070680_100342976 3300005336 Bacteria 1269
82 Ga0070680_100397577 3300005336 Bacteria 1174
83 Ga0070682_100040563 3300005337 Bacteria 2865
84 Ga0068868_100403166 3300005338 Bacteria 1181
85 Ga0068868_101542837 3300005338 Bacteria 623
86 Ga0070660_100012591 3300005339 Bacteria 6042
87 Ga0070689_100032573 3300005340 Bacteria 3966
88 Ga0070689_100036552 3300005340 Bacteria 3757
89 Ga0070689_100043278 3300005340 Bacteria 3460
90 Ga0070689_100356682 3300005340 Bacteria 1228
91 Ga0070691_10092099 3300005341 Bacteria 1496
92 Ga0070691_10281962 3300005341 Bacteria 902
93 Ga0070691_10562724 3300005341 Bacteria 668
94 Ga0070687_100009408 3300005343 Bacteria 4186
95 Ga0070661_100015451 3300005344 Bacteria 5388
96 Ga0070661_100421463 3300005344 Bacteria 1058
97 Ga0070668_100039790 3300005347 Bacteria 3596
98 Ga0070668_100543027 3300005347 Bacteria 1011
99 Ga0070668_100973966 3300005347 Bacteria 761
100 Ga0070669_101151513 3300005353 Bacteria 669
101 Ga0070675_100053318 3300005354 Bacteria 3326
102 Ga0070675_100067435 3300005354 Bacteria 2961
103 Ga0070675_100248687 3300005354 Bacteria 1555
104 Ga0070675_100263060 3300005354 Bacteria 1512
105 Ga0070671_100029499 3300005355 Bacteria 4523
106 Ga0070674_100020216 3300005356 Bacteria 4247
107 Ga0070674_100087957 3300005356 Bacteria 2235
108 Ga0070674_100398528 3300005356 Bacteria 1124
109 Ga0070674_100452183 3300005356 Bacteria 1060
110 Ga0070673_100001859 3300005364 Bacteria 12618
111 Ga0070673_100272093 3300005364 Bacteria 1483
112 Ga0070673_100800191 3300005364 Unclassified 870
113 Ga0070688_100009181 3300005365 Bacteria 5396
114 Ga0070688_100223670 3300005365 Bacteria 1328
115 Ga0070659_100640407 3300005366 Bacteria 916
116 Ga0070659_100950387 3300005366 Bacteria 753
117 Ga0070667_100232651 3300005367 Bacteria 1644
118 Ga0070709_10395096 3300005434 Bacteria 1031
119 Ga0070713_100248526 3300005436 Bacteria 1622
120 Ga0070710_10429423 3300005437 Bacteria 891
121 Ga0070711_100000002 3300005439 Bacteria 263148
122 Ga0070711_100239150 3300005439 Bacteria 1419
123 Ga0070705_100101052 3300005440 Bacteria 1821
124 Ga0070700_100169617 3300005441 Bacteria 1510
125 Ga0070700_100373090 3300005441 Bacteria 1065
126 Ga0070700_100432080 3300005441 Bacteria 997
127 Ga0070694_100202628 3300005444 Bacteria 1480
128 Ga0070694_100552054 3300005444 Bacteria 922
129 Ga0070678_100001693 3300005456 Bacteria 11821
130 Ga0070678_101403506 3300005456 Bacteria 652
131 Ga0070662_100463818 3300005457 Bacteria 1053
132 Ga0070662_100463851 3300005457 Bacteria 1053
133 Ga0070662_100644280 3300005457 Bacteria 893
134 Ga0070662_101248175 3300005457 Bacteria 639
135 Ga0070662_101487611 3300005457 Bacteria 584
136 Ga0070681_10039712 3300005458 Bacteria 4716
137 Ga0068867_100021614 3300005459 Bacteria 4593
138 Ga0068867_100038577 3300005459 Bacteria 3478
139 Ga0068867_100969909 3300005459 Bacteria 769
140 Ga0070685_10023806 3300005466 Bacteria 3356
141 Ga0070685_10865894 3300005466 Bacteria 670
142 Ga0070707_100340899 3300005468 Bacteria 1456
143 Ga0070699_100000104 3300005518 Bacteria 78991
144 Ga0070679_100009608 3300005530 Bacteria 9151
145 Ga0068853_100111334 3300005539 Bacteria 2432
146 Ga0068853_100239267 3300005539 Bacteria 1663
147 Ga0070672_100016405 3300005543 Bacteria 5303
148 Ga0070672_101289465 3300005543 Bacteria 652
149 Ga0070686_100003042 3300005544 Bacteria 9191
150 Ga0070686_101009210 3300005544 Bacteria 683
151 Ga0070695_100261035 3300005545 Bacteria 1265
152 Ga0070695_100419337 3300005545 Bacteria 1019
153 Ga0070695_100542787 3300005545 Bacteria 905
154 Ga0070696_100001805 3300005546 Bacteria 14046
155 Ga0070696_100029720 3300005546 Bacteria 3738
156 Ga0070696_100301740 3300005546 Bacteria 1227
157 Ga0070665_100172663 3300005548 Bacteria 2163
158 Ga0070704_100168405 3300005549 Bacteria 1739
159 Ga0070704_100330680 3300005549 Bacteria 1280
160 Ga0068855_100064760 3300005563 Bacteria 4262
161 Ga0068855_100523264 3300005563 Bacteria 1286
162 Ga0070664_100000430 3300005564 Bacteria 31417
163 Ga0070664_100760103 3300005564 Bacteria 905
164 Ga0068857_100066981 3300005577 Bacteria 3195
165 Ga0068857_100177189 3300005577 Bacteria 1939
166 Ga0068857_100931650 3300005577 Bacteria 834
167 Ga0068854_100328265 3300005578 Bacteria 1246
168 Ga0068856_100291104 3300005614 Bacteria 1650
169 Ga0068852_100165443 3300005616 Bacteria 2069
170 Ga0068859_100901228 3300005617 Bacteria 969
171 Ga0068864_100482785 3300005618 Bacteria 1190
172 Ga0068864_100862419 3300005618 Unclassified 893
173 Ga0068864_100949208 3300005618 Bacteria 851
174 Ga0068866_10093269 3300005718 Bacteria 1644
175 Ga0068866_10168033 3300005718 Bacteria 1285
176 Ga0068861_100573971 3300005719 Bacteria 1031
177 Ga0068851_10078152 3300005834 Bacteria 1724
178 Ga0068870_10356743 3300005840 Unclassified 940
179 Ga0068863_100209106 3300005841 Bacteria 1879
180 Ga0068863_100303849 3300005841 Bacteria 1548
181 Ga0068858_101576729 3300005842 Bacteria 648
182 Ga0068860_100063011 3300005843 Bacteria 3523
183 Ga0068862_100090041 3300005844 Bacteria 2670
184 Ga0081455_10004599 3300005937 Bacteria 15408
185 Ga0081455_10054757 3300005937 Bacteria 3397
186 Ga0075365_10001831 3300006038 Bacteria 9955
187 Ga0075363_100027696 3300006048 Bacteria 2908
188 Ga0075364_10590058 3300006051 Bacteria 759
189 Ga0075432_10013954 3300006058 Bacteria 2734
190 Ga0075432_10124953 3300006058 Bacteria 969
191 Ga0070715_10319561 3300006163 Bacteria 837
192 Ga0070715_10378055 3300006163 Bacteria 781
193 Ga0070716_100180931 3300006173 Bacteria 1384
194 Ga0070716_100623156 3300006173 Bacteria 814
195 Ga0075362_10055705 3300006177 Bacteria 1778
196 Ga0075362_10166821 3300006177 Bacteria 1062
197 Ga0075367_10314179 3300006178 Bacteria 987
198 Ga0075367_10315957 3300006178 Bacteria 984
199 Ga0075369_10174422 3300006186 Bacteria 988
200 Ga0075369_10208070 3300006186 Bacteria 904
201 Ga0075366_10030633 3300006195 Bacteria 3164
202 Ga0075366_10057535 3300006195 Bacteria 2311
203 Ga0075366_10110160 3300006195 Bacteria 1656
204 Ga0097621_100142532 3300006237 Bacteria 2049
205 Ga0097621_100160022 3300006237 Bacteria 1935
206 Ga0075370_10049640 3300006353 Bacteria 2379
207 Ga0075370_10123572 3300006353 Bacteria 1507
208 Ga0068871_100643023 3300006358 Bacteria 968
209 Ga0075428_100490345 3300006844 Bacteria 1315
210 Ga0075430_100091643 3300006846 Bacteria 2541
211 Ga0075430_100160493 3300006846 Bacteria 1871
212 Ga0075431_100044850 3300006847 Bacteria 4559
213 Ga0075431_100053508 3300006847 Bacteria 4162
214 Ga0075433_10353195 3300006852 Bacteria 1299
215 Ga0075434_100065777 3300006871 Bacteria 3611
216 Ga0075434_100121079 3300006871 Bacteria 2632
217 Ga0075434_100289416 3300006871 Bacteria 1658
218 Ga0075434_100499387 3300006871 Bacteria 1237
219 Ga0075434_100745518 3300006871 Unclassified 996
220 Ga0075429_100001369 3300006880 Bacteria 19955
221 Ga0075429_100017168 3300006880 Bacteria 6259
222 Ga0068865_100002482 3300006881 Bacteria 10922
223 Ga0068865_100962220 3300006881 Bacteria 746
224 Ga0075436_100010987 3300006914 Bacteria 6216
225 Ga0075436_100023346 3300006914 Bacteria 4248
226 Ga0075436_100244633 3300006914 Bacteria 1276
227 Ga0075436_100484642 3300006914 Unclassified 903
228 Ga0097620_100901147 3300006931 Bacteria 969
229 Ga0075435_100212559 3300007076 Unclassified 1641
230 Ga0075435_100215699 3300007076 Bacteria 1629
231 Ga0105244_10007321 3300009036 Bacteria 7021
232 Ga0105244_10207471 3300009036 Bacteria 922
233 Ga0105240_11103818 3300009093 Unclassified 844
234 Ga0105245_10003141 3300009098 Bacteria 14785
235 Ga0105245_10067283 3300009098 Bacteria 3244
236 Ga0114129_10046873 3300009147 Bacteria 6074
237 Ga0114129_10173690 3300009147 Bacteria 2936
238 Ga0114129_10188831 3300009147 Bacteria 2799
239 Ga0114129_10354786 3300009147 Bacteria 1942
240 Ga0114129_10599091 3300009147 Bacteria 1428
241 Ga0114129_11605601 3300009147 Bacteria 796
242 Ga0105243_10000301 3300009148 Bacteria 54622
243 Ga0105243_10014671 3300009148 Bacteria 5930
244 Ga0105243_10021819 3300009148 Bacteria 4861
245 Ga0105243_10440913 3300009148 Bacteria 1219
246 Ga0105241_10013744 3300009174 Bacteria 5930
247 Ga0105242_10003077 3300009176 Bacteria 13015
248 Ga0105242_10012170 3300009176 Bacteria 6619
249 Ga0105242_10533661 3300009176 Bacteria 1122
250 Ga0105248_11987252 3300009177 Bacteria 660
251 Ga0105237_10324226 3300009545 Bacteria 1544
252 Ga0105237_10500865 3300009545 Bacteria 1221
253 Ga0105238_10730239 3300009551 Bacteria 1003
254 Ga0105249_10019658 3300009553 Bacteria 6028
255 Ga0105249_10302536 3300009553 Bacteria 1605
256 Ga0105239_10033289 3300010375 Bacteria 5661
257 Ga0105239_10065273 3300010375 Bacteria 3997
258 Ga0105239_10908435 3300010375 Bacteria 1011
259 Ga0105246_10000077 3300011119 Bacteria 41151
260 Ga0105246_10071589 3300011119 Bacteria 2442
261 Ga0157373_10128168 3300013100 Bacteria 1784
262 Ga0157371_10062595 3300013102 Bacteria 2637
263 Ga0157371_10088719 3300013102 Bacteria 2190
264 Ga0157370_10294022 3300013104 Bacteria 1500
265 Ga0157370_10474521 3300013104 Bacteria 1150
266 Ga0157370_10770339 3300013104 Bacteria 876
267 Ga0157369_10015992 3300013105 Bacteria 8443
268 Ga0157369_10254642 3300013105 Bacteria 1832
269 Ga0157374_10042041 3300013296 Bacteria 4215
270 Ga0157374_10056971 3300013296 Bacteria 3650
271 Ga0157378_10000237 3300013297 Bacteria 53846
272 Ga0157378_10157967 3300013297 Bacteria 2118
273 Ga0163162_10294911 3300013306 Bacteria 1753
274 Ga0163162_10550954 3300013306 Bacteria 1281
275 Ga0163162_10939198 3300013306 Bacteria 976
276 Ga0157372_10066231 3300013307 Bacteria 4058
277 Ga0157372_10209898 3300013307 Bacteria 2256
278 Ga0157372_10382990 3300013307 Bacteria 1639
279 Ga0157375_10159127 3300013308 Bacteria 2399
280 Ga0157375_10175253 3300013308 Bacteria 2294
281 Ga0157375_10775914 3300013308 Bacteria 1108
282 Ga0157380_10743637 3300014326 Bacteria 991
283 Ga0157380_11261979 3300014326 Bacteria 785
284 Ga0157377_10034484 3300014745 Bacteria 2769
285 Ga0157376_10010301 3300014969 Bacteria 6828
286 Ga0157376_10230330 3300014969 Bacteria 1721
287 Ga0182007_10009286 3300015262 Bacteria 3977
288 Ga0163161_10811448 3300017792 Bacteria 787
289 Ga0209436_112914 3300025208 Bacteria 1394
290 Ga0209672_100531 3300025228 Bacteria 20822
291 Ga0209147_101412 3300025229 Bacteria 8787
292 Ga0209258_100022 3300025242 Bacteria 553584
293 Ga0207425_1001080 3300025245 Bacteria 12404
294 Ga0207425_1001242 3300025245 Bacteria 11189
295 Ga0207425_1010314 3300025245 Bacteria 2279
296 Ga0209148_1000034 3300025254 Bacteria 553584
297 Ga0209129_1000023 3300025258 Bacteria 420646
298 Ga0209129_1002508 3300025258 Bacteria 8948
299 Ga0209129_1026336 3300025258 Bacteria 1005
300 Ga0209565_1000125 3300025263 Bacteria 110485
301 Ga0209565_1000565 3300025263 Bacteria 25494
302 Ga0209565_1001097 3300025263 Bacteria 13368
303 Ga0209565_1005206 3300025263 Bacteria 3819
304 Ga0209673_1000192 3300025273 Bacteria 123155
305 Ga0209673_1002278 3300025273 Bacteria 13748
306 Ga0209673_1002969 3300025273 Bacteria 10598
307 Ga0209130_1000069 3300025284 Bacteria 179177
308 Ga0209130_1000110 3300025284 Bacteria 133258
309 Ga0209130_1000479 3300025284 Bacteria 41174
310 Ga0209130_1002183 3300025284 Bacteria 10312
311 Ga0209130_1033863 3300025284 Bacteria 1032
312 Ga0209675_1000427 3300025291 Bacteria 34021
313 Ga0209675_1000614 3300025291 Bacteria 25547
314 Ga0209675_1005042 3300025291 Bacteria 5653
315 Ga0209675_1009288 3300025291 Bacteria 3489
316 Ga0209676_1000005 3300025292 Bacteria 1076001
317 Ga0209676_1000285 3300025292 Bacteria 104459
318 Ga0209676_1000614 3300025292 Bacteria 52075
319 Ga0209676_1024428 3300025292 Bacteria 1957
320 Ga0209025_1000316 3300025294 Bacteria 107447
321 Ga0209025_1000652 3300025294 Bacteria 60620
322 Ga0209025_1004758 3300025294 Bacteria 11524
323 Ga0209025_1012895 3300025294 Bacteria 5313
324 Ga0209025_1030280 3300025294 Bacteria 2594
325 Ga0209025_1055514 3300025294 Bacteria 1530
326 Ga0209025_1118901 3300025294 Bacteria 793
327 Ga0209025_1145213 3300025294 Bacteria 665
328 Ga0209564_1000270 3300025295 Bacteria 108503
329 Ga0209564_1000791 3300025295 Bacteria 43583
330 Ga0209758_1000064 3300025297 Bacteria 311812
331 Ga0209050_1000007 3300025298 Bacteria 1187891
332 Ga0209050_1013270 3300025298 Bacteria 3676
333 Ga0209050_1014859 3300025298 Bacteria 3318
334 Ga0209256_1000020 3300025299 Bacteria 542402
335 Ga0209256_1000022 3300025299 Bacteria 481843
336 Ga0209256_1012544 3300025299 Bacteria 3228
337 Ga0207426_1000001 3300025302 Bacteria 1341301
338 Ga0207426_1000031 3300025302 Bacteria 460699
339 Ga0207426_1000061 3300025302 Bacteria 362507
340 Ga0207426_1020714 3300025302 Bacteria 2283
341 Ga0207426_1075332 3300025302 Bacteria 929
342 Ga0209051_1000036 3300025303 Bacteria 339863
343 Ga0209051_1000711 3300025303 Bacteria 36515
344 Ga0209051_1012743 3300025303 Bacteria 4049
345 Ga0209257_1000011 3300025304 Bacteria 1112630
346 Ga0209257_1006768 3300025304 Bacteria 7222
347 Ga0207655_1039403 3300025728 Bacteria 2052
348 Ga0207655_1105711 3300025728 Bacteria 961
349 Ga0207655_1105720 3300025728 Bacteria 961
350 Ga0207713_1002717 3300025735 Bacteria 12617
351 Ga0207682_10019567 3300025893 Bacteria 2651
352 Ga0207692_10150134 3300025898 Bacteria 1334
353 Ga0207642_10012814 3300025899 Bacteria 3039
354 Ga0207710_10070718 3300025900 Bacteria 1600
355 Ga0207688_10031016 3300025901 Bacteria 2949
356 Ga0207688_10184774 3300025901 Bacteria 1244
357 Ga0207688_10304188 3300025901 Bacteria 975
358 Ga0207699_10445200 3300025906 Bacteria 928
359 Ga0207645_10001024 3300025907 Bacteria 23114
360 Ga0207705_10052616 3300025909 Bacteria 2932
361 Ga0207707_10120621 3300025912 Bacteria 2292
362 Ga0207695_10425568 3300025913 Bacteria 1212
363 Ga0207671_10049792 3300025914 Bacteria 3102
364 Ga0207663_10000003 3300025916 Bacteria 458807
365 Ga0207663_10196324 3300025916 Bacteria 1453
366 Ga0207660_10087893 3300025917 Bacteria 2297
367 Ga0207660_10213142 3300025917 Bacteria 1513
368 Ga0207662_10042794 3300025918 Bacteria 2670
369 Ga0207662_10151927 3300025918 Bacteria 1473
370 Ga0207657_10123803 3300025919 Bacteria 2125
371 Ga0207649_10077751 3300025920 Bacteria 2139
372 Ga0207649_10361740 3300025920 Bacteria 1077
373 Ga0207652_10028701 3300025921 Bacteria 4645
374 Ga0207646_10788528 3300025922 Bacteria 847
375 Ga0207650_10302755 3300025925 Bacteria 1306
376 Ga0207650_10608222 3300025925 Unclassified 919
377 Ga0207659_10243353 3300025926 Bacteria 1456
378 Ga0207659_10283819 3300025926 Bacteria 1354
379 Ga0207659_10501770 3300025926 Bacteria 1027
380 Ga0207659_10512974 3300025926 Bacteria 1016
381 Ga0207659_10595912 3300025926 Bacteria 942
382 Ga0207700_10555566 3300025928 Bacteria 1019
383 Ga0207644_10273012 3300025931 Bacteria 1355
384 Ga0207690_10397896 3300025932 Bacteria 1098
385 Ga0207690_10804518 3300025932 Bacteria 777
386 Ga0207706_10001021 3300025933 Bacteria 28541
387 Ga0207706_11074493 3300025933 Bacteria 673
388 Ga0207686_10035606 3300025934 Bacteria 2989
389 Ga0207686_10159391 3300025934 Bacteria 1580
390 Ga0207686_10317011 3300025934 Bacteria 1163
391 Ga0207686_10363628 3300025934 Bacteria 1093
392 Ga0207709_10000019 3300025935 Bacteria 402225
393 Ga0207709_10002077 3300025935 Bacteria 12914
394 Ga0207709_10162701 3300025935 Bacteria 1558
395 Ga0207670_10185151 3300025936 Bacteria 1571
396 Ga0207670_10248056 3300025936 Bacteria 1375
397 Ga0207669_10327095 3300025937 Bacteria 1175
398 Ga0207669_10412968 3300025937 Bacteria 1060
399 Ga0207669_10936025 3300025937 Bacteria 725
400 Ga0207704_10411091 3300025938 Bacteria 1070
401 Ga0207665_10222472 3300025939 Bacteria 1384
402 Ga0207665_10972856 3300025939 Bacteria 675
403 Ga0207691_10031036 3300025940 Bacteria 4991
404 Ga0207691_10036214 3300025940 Bacteria 4572
405 Ga0207691_10473153 3300025940 Bacteria 1065
406 Ga0207689_10018342 3300025942 Bacteria 5905
407 Ga0207661_10220622 3300025944 Bacteria 1676
408 Ga0207679_10012799 3300025945 Bacteria 5483
409 Ga0207679_10644868 3300025945 Unclassified 957
410 Ga0207667_10284138 3300025949 Bacteria 1691
411 Ga0207667_10686534 3300025949 Bacteria 1027
412 Ga0207651_10014674 3300025960 Bacteria 4532
413 Ga0207651_10240702 3300025960 Bacteria 1474
414 Ga0207712_10446610 3300025961 Bacteria 1096
415 Ga0207668_10028226 3300025972 Bacteria 3667
416 Ga0207668_11022438 3300025972 Bacteria 739
417 Ga0207640_10131115 3300025981 Unclassified 1812
418 Ga0207640_10426350 3300025981 Bacteria 1087
419 Ga0207640_10926583 3300025981 Bacteria 762
420 Ga0207658_10075944 3300025986 Bacteria 2558
421 Ga0207658_10189089 3300025986 Bacteria 1710
422 Ga0207677_10146091 3300026023 Bacteria 1817
423 Ga0207677_10181784 3300026023 Bacteria 1655
424 Ga0207703_10119885 3300026035 Bacteria 2257
425 Ga0207639_10062321 3300026041 Bacteria 2883
426 Ga0207639_10078109 3300026041 Bacteria 2612
427 Ga0207639_10838726 3300026041 Bacteria 858
428 Ga0207708_10005900 3300026075 Bacteria 9060
429 Ga0207708_10172472 3300026075 Bacteria 1714
430 Ga0207708_10526614 3300026075 Bacteria 994
431 Ga0207641_10148875 3300026088 Bacteria 2119
432 Ga0207641_10870886 3300026088 Bacteria 893
433 Ga0207648_10003922 3300026089 Bacteria 15499
434 Ga0207648_10082026 3300026089 Bacteria 2812
435 Ga0207648_10146577 3300026089 Bacteria 2082
436 Ga0207676_10097826 3300026095 Bacteria 2425
437 Ga0207676_10127492 3300026095 Bacteria 2158
438 Ga0207676_10611411 3300026095 Bacteria 1048
439 Ga0207674_10216525 3300026116 Bacteria 1863
440 Ga0207674_10396465 3300026116 Bacteria 1334
441 Ga0207675_100075897 3300026118 Bacteria 3147
442 Ga0207675_100461321 3300026118 Bacteria 1260
443 Ga0207683_10000099 3300026121 Bacteria 71651
444 Ga0207683_10058809 3300026121 Bacteria 3375
445 Ga0207683_10095683 3300026121 Bacteria 2648
446 Ga0207683_10568684 3300026121 Bacteria 1048
447 Ga0207698_10151332 3300026142 Bacteria 2014
448 Ga0207698_10485297 3300026142 Unclassified 1199
449 Ga0209281_1000005 3300027111 Bacteria 1242284
450 Ga0209973_1003358 3300027252 Unclassified 1570
451 Ga0209969_1000858 3300027360 Bacteria 4096
452 Ga0209967_1000509 3300027364 Bacteria 5101
453 Ga0209967_1001172 3300027364 Bacteria 3349
454 Ga0209981_1000079 3300027378 Bacteria 10601
455 Ga0209996_1000168 3300027395 Bacteria 8408
456 Ga0209984_1001063 3300027424 Bacteria 2939
457 Ga0210000_1000123 3300027462 Bacteria 10931
458 Ga0210000_1028995 3300027462 Bacteria 862
459 Ga0210000_1038406 3300027462 Bacteria 757
460 Ga0209995_1000415 3300027471 Bacteria 6623
461 Ga0209968_1000017 3300027526 Bacteria 33515
462 Ga0209999_1000109 3300027543 Bacteria 10144
463 Ga0209982_1000025 3300027552 Bacteria 13339
464 Ga0210002_1000130 3300027617 Bacteria 11718
465 Ga0210002_1049344 3300027617 Bacteria 724
466 Ga0209983_1001431 3300027665 Bacteria 5304
467 Ga0209971_1000327 3300027682 Bacteria 13110
468 Ga0209971_1016486 3300027682 Bacteria 1751
469 Ga0209966_1000186 3300027695 Bacteria 25632
470 Ga0209998_10000065 3300027717 Bacteria 42399
471 Ga0209974_10000064 3300027876 Bacteria 28215
472 Ga0209974_10000274 3300027876 Bacteria 16780
473 Ga0209974_10010272 3300027876 Bacteria 3160
474 Ga0209974_10037812 3300027876 Bacteria 1603
475 Ga0207428_10005062 3300027907 Bacteria 12387
476 Ga0207428_10069386 3300027907 Bacteria 2771
477 Ga0268264_10327564 3300028381 Bacteria 1450
478 Ga0265323_10003513 3300028653 Bacteria 6904
479 Ga0307515_10233464 3300028794 Bacteria 1626
480 Ga0265324_10079231 3300029957 Bacteria 1118
481 Ga0265327_10014639 3300031251 Bacteria 5120
482 Ga0265327_10016476 3300031251 Bacteria 4690
483 Ga0265327_10293133 3300031251 Bacteria 717
484 Ga0307513_10170463 3300031456 Bacteria 2055
485 Ga0307513_10238820 3300031456 Bacteria 1624
486 Ga0307513_10643423 3300031456 Bacteria 768
487 Ga0307408_100030541 3300031548 Bacteria 3742
488 Ga0307408_100042562 3300031548 Bacteria 3227
489 Ga0307408_100064337 3300031548 Bacteria 2686
490 Ga0307408_100280274 3300031548 Bacteria 1388
491 Ga0307408_100888051 3300031548 Bacteria 815
492 Ga0316575_10021290 3300031665 Bacteria 2494
493 Ga0316575_10057190 3300031665 Bacteria 1554
494 Ga0316575_10111687 3300031665 Bacteria 1115
495 Ga0316575_10215105 3300031665 Bacteria 802
496 Ga0316579_10003640 3300031691 Bacteria 6055
497 Ga0316579_10006147 3300031691 Bacteria 4882
498 Ga0316579_10224917 3300031691 Bacteria 907
499 Ga0265314_10238935 3300031711 Bacteria 1049
500 Ga0316576_10004692 3300031727 Bacteria 8247
501 Ga0316576_10091931 3300031727 Bacteria 2261
502 Ga0316576_10166444 3300031727 Bacteria 1663
503 Ga0316576_10442004 3300031727 Bacteria 961
504 Ga0316576_10657522 3300031727 Unclassified 762
505 Ga0316578_10004409 3300031728 Bacteria 6646
506 Ga0316578_10021277 3300031728 Bacteria 3599
507 Ga0316578_10096183 3300031728 Bacteria 1772
508 Ga0316578_10173081 3300031728 Bacteria 1301
509 Ga0316578_10205734 3300031728 Bacteria 1184
510 Ga0316578_10656132 3300031728 Unclassified 612
511 Ga0307516_10003661 3300031730 Bacteria 19536
512 Ga0307405_10123021 3300031731 Bacteria 1778
513 Ga0316577_10003896 3300031733 Bacteria 7612
514 Ga0316577_10007336 3300031733 Bacteria 5883
515 Ga0316577_10019420 3300031733 Bacteria 3760
516 Ga0316577_10089544 3300031733 Bacteria 1722
517 Ga0316577_10177082 3300031733 Bacteria 1204
518 Ga0307413_10110526 3300031824 Bacteria 1839
519 Ga0307407_10153186 3300031903 Bacteria 1500
520 Ga0307407_10923514 3300031903 Bacteria 671
521 Ga0307407_11066934 3300031903 Bacteria 627
522 Ga0307412_10009620 3300031911 Bacteria 5552
523 Ga0307412_10026010 3300031911 Bacteria 3632
524 Ga0307412_10450903 3300031911 Bacteria 1060
525 Ga0307412_11722463 3300031911 Bacteria 575
526 Ga0307409_100085198 3300031995 Bacteria 2568
527 Ga0307416_100054918 3300032002 Bacteria 3204
528 Ga0307416_100441685 3300032002 Bacteria 1351
529 Ga0307416_100641004 3300032002 Bacteria 1146
530 Ga0307416_100684642 3300032002 Bacteria 1113
531 Ga0307416_101842131 3300032002 Unclassified 709
532 Ga0307411_10345649 3300032005 Bacteria 1210
533 Ga0316583_10002461 3300032133 Bacteria 6430
534 Ga0316583_10005516 3300032133 Bacteria 4538
535 Ga0316583_10006071 3300032133 Bacteria 4343
536 Ga0316583_10013425 3300032133 Bacteria 2955
537 Ga0316583_10014002 3300032133 Bacteria 2893
538 Ga0316583_10021900 3300032133 Bacteria 2290
539 Ga0316585_10004285 3300032137 Bacteria 3961
540 Ga0316585_10038483 3300032137 Bacteria 1520
541 Ga0316585_10109149 3300032137 Bacteria 909
542 Ga0316580_10005429 3300032139 Bacteria 3719
543 Ga0316580_10019260 3300032139 Bacteria 2100
544 Ga0316580_10024094 3300032139 Bacteria 1880
545 Ga0316580_10050846 3300032139 Bacteria 1277
546 Ga0316580_10088339 3300032139 Bacteria 948
547 Ga0316593_10073963 3300032168 Bacteria 1181
548 Ga0316593_10141548 3300032168 Unclassified 871
549 Ga0316592_1035586 3300033524 Bacteria 1092
550 Ga0316592_1041734 3300033524 Bacteria 1016
551 Ga0316592_1052280 3300033524 Bacteria 913
552 Ga0316588_1083830 3300033528 Bacteria 791
553 Ga0316596_1085741 3300033541 Bacteria 848
554 Ga0373930_0147247 3300034816 Unclassified 589
555 Ga0373940_0118784 3300035088 Bacteria 818
556 Ga0373952_0027441 3300035092 Bacteria 1243
557 Ga0373923_0174511 3300035111 Bacteria 985
558 Ga0373941_0039210 3300035115 Bacteria 1455
559 Ga0373941_0213074 3300035115 Unclassified 739
560 Ga0373941_0329374 3300035115 Bacteria 616
561 Ga0373954_0290706 3300035118 Bacteria 806
562 Ga0316574_0036726 3300035398 Bacteria 3000
563 Ga0316574_0105574 3300035398 Bacteria 1804
564 Ga0316574_0116100 3300035398 Bacteria 1717
565 Ga0316574_0151079 3300035398 Bacteria 1496
566 Ga0316574_0162686 3300035398 Bacteria 1437
567 Ga0316574_0189279 3300035398 Bacteria 1323
568 Ga0316574_0270134 3300035398 Bacteria 1085
569 Ga0316574_0438427 3300035398 Bacteria 819
570 Ga0316574_0515542 3300035398 Bacteria 744
571 Ga0373931_0223720 3300035691 Unclassified 1134
572 Ga0373931_0600640 3300035691 Bacteria 719
573 Ga0373927_0556784 3300035695 Bacteria 758
574 Ga0373937_0555560 3300036401 Bacteria 1090
575 Ga0373937_1069036 3300036401 Archaea 756
576 Ga0316582_0036724 3300036647 Bacteria 3033
577 Ga0316582_0064647 3300036647 Bacteria 2354
578 Ga0316582_0080866 3300036647 Bacteria 2121
579 Ga0316582_0093134 3300036647 Bacteria 1986
580 Ga0316582_0104022 3300036647 Bacteria 1883
581 Ga0316582_0401464 3300036647 Bacteria 944
582 Ga0316582_0883827 3300036647 Unclassified 611
583 Ga0316584_0009856 3300036712 Bacteria 6651
584 Ga0316584_0018788 3300036712 Bacteria 4990
585 Ga0316584_0026007 3300036712 Bacteria 4297
586 Ga0316584_0037213 3300036712 Bacteria 3614
587 Ga0316584_0043982 3300036712 Bacteria 3330
588 Ga0316584_0098986 3300036712 Bacteria 2183
589 Ga0316584_0135460 3300036712 Bacteria 1838
590 Ga0316584_0136021 3300036712 Bacteria 1834
591 Ga0316584_0266050 3300036712 Bacteria 1249
592 Ga0395900_0753905 3300037418 Bacteria 904
593 Ga0395898_0005965 3300037466 Bacteria 13081
594 Ga0395898_0205352 3300037466 Bacteria 1880
595 Ga0395905_0679799 3300037471 Bacteria 932
596 Ga0395901_0101708 3300038443 Bacteria 3015
597 Ga0395901_0350332 3300038443 Bacteria 1524
598 Ga0395901_0353941 3300038443 Bacteria 1515
599 Ga0400490_12262 3300038726 Bacteria 1525
600 Ga0400490_24805 3300038726 Bacteria 2130
601 Ga0400490_26858 3300038726 Unclassified 2612
602 Ga0400490_53122 3300038726 Bacteria 6480
603 Ga0400491_06308 3300038727 Bacteria 1921
604 Ga0400483_003518 3300039062 Bacteria 1858
605 Ga0400483_066915 3300039062 Bacteria 1517
606 Ga0400483_172963 3300039062 Bacteria 9206
607 Ga0400483_197737 3300039062 Bacteria 1441
608 Ga0400483_199463 3300039062 Bacteria 1164
609 Ga0400483_207579 3300039062 Bacteria 1015
610 Ga0400489_49933 3300039093 Bacteria 10562
611 Ga0400487_54724 3300039110 Bacteria 11185
612 Ga0436361_0302838 3300039447 Bacteria 665
613 Ga0451791_0443858 3300041451 Bacteria 514
614 Ga0451795_0018265 3300041456 Bacteria 670
615 Ga0451795_0051390 3300041456 Bacteria 661
616 Ga0451795_0303860 3300041456 Bacteria 2944
617 Ga0451795_0439762 3300041456 Bacteria 752
618 Ga0451795_1456898 3300041456 Bacteria 548
619 Ga0451795_1520285 3300041456 Bacteria 950
620 Ga0451802_0956397 3300041460 Bacteria 1729
621 Ga0451855_0074105 3300041511 Bacteria 588
622 Ga0451855_0453732 3300041511 Bacteria 670
623 Ga0451855_0602217 3300041511 Bacteria 1235
624 Ga0451855_0666493 3300041511 Bacteria 862
625 Ga0451855_1110680 3300041511 Bacteria 766
626 Ga0451855_1286470 3300041511 Bacteria 1694
627 Ga0451855_1506058 3300041511 Bacteria 935
628 Ga0451855_1518801 3300041511 Bacteria 1577
629 Ga0439437_040284 3300042000 Bacteria 604
630 Ga0439441_107532 3300042001 Bacteria 630
631 Ga0439445_0070523 3300042004 Bacteria 966
632 Ga0439448_0066351 3300042005 Bacteria 1198
633 Ga0439432_061153 3300042006 Bacteria 1161
634 Ga0439449_0002400 3300042007 Bacteria 7330
635 Ga0439452_030038 3300042010 Bacteria 1344
636 Ga0439454_023090 3300042011 Unclassified 931
637 Ga0450911_000112 3300042115 Bacteria 33288
638 Ga0450923_111061 3300042125 Unclassified 640
639 Ga0450902_040902 3300042137 Bacteria 789
640 Ga0439446_0104052 3300042156 Bacteria 900
641 Ga0439434_0108609 3300042435 Bacteria 897
642 Ga0439435_0193902 3300042436 Unclassified 667
643 Ga0439444_0074380 3300042437 Bacteria 733
644 Ga0439464_0284124 3300042439 Bacteria 538
645 Ga0439460_0005773 3300042461 Bacteria 3049
646 Ga0439460_0284735 3300042461 Bacteria 576
647 Ga0450893_0016930 3300042532 Bacteria 1237
648 Ga0451577_0000006 3300042876 Bacteria 709265
649 Ga0451577_0015345 3300042876 Bacteria 7129
650 Ga0451577_0052660 3300042876 Bacteria 3634
651 Ga0451577_0058339 3300042876 Bacteria 3441
652 Ga0451577_0166504 3300042876 Bacteria 1986
653 Ga0451577_0237062 3300042876 Bacteria 1650
654 Ga0451577_0346600 3300042876 Bacteria 1347
655 Ga0451577_0388942 3300042876 Bacteria 1266
656 Ga0451577_0527293 3300042876 Bacteria 1072
657 Ga0466969_0021149 3300044656 Bacteria 3366
658 Ga0453683_0000088 3300044673 Bacteria 138620
659 Ga0453683_0003232 3300044673 Bacteria 12116
660 Ga0453683_0046720 3300044673 Bacteria 2714
661 Ga0453683_0054011 3300044673 Bacteria 2515
662 Ga0453683_0308841 3300044673 Unclassified 1012
663 Ga0453683_0684241 3300044673 Bacteria 672
664 Ga0466966_0048015 3300044684 Bacteria 2720
665 Ga0466961_0028067 3300044693 Bacteria 3619
666 Ga0466963_0362968 3300044694 Bacteria 1020
667 Ga0453684_0000037 3300044712 Bacteria 709327
668 Ga0453684_0002361 3300044712 Bacteria 46138
669 Ga0453684_0016369 3300044712 Bacteria 11604
670 Ga0453684_0033391 3300044712 Bacteria 7177
671 Ga0453684_0033906 3300044712 Bacteria 7102
672 Ga0453684_0081385 3300044712 Bacteria 4039
673 Ga0453684_0103528 3300044712 Bacteria 3478
674 Ga0453684_0104957 3300044712 Bacteria 3448
675 Ga0453684_0149331 3300044712 Bacteria 2779
676 Ga0453684_0587797 3300044712 Bacteria 1222
677 Ga0453684_0942742 3300044712 Bacteria 922
678 Ga0466959_0025497 3300045049 Bacteria 4382
679 Ga0466959_0325229 3300045049 Bacteria 1051
680 Ga0451576_0000653 3300045051 Bacteria 71614
681 Ga0451576_0001014 3300045051 Bacteria 51909
682 Ga0451576_0001923 3300045051 Bacteria 33277
683 Ga0451576_0006556 3300045051 Bacteria 14245
684 Ga0451576_0012858 3300045051 Bacteria 9387
685 Ga0451576_0018765 3300045051 Bacteria 7564
686 Ga0451576_0036104 3300045051 Bacteria 5242
687 Ga0451576_0130847 3300045051 Bacteria 2616
688 Ga0451576_0133900 3300045051 Bacteria 2584
689 Ga0451576_0230206 3300045051 Bacteria 1935
690 Ga0466967_0081188 3300045976 Bacteria 2928
691 Ga0495627_009631 3300046453 Bacteria 3546
692 Ga0495592_0143979 3300046454 Bacteria 1655
693 Ga0495603_0588880 3300046455 Bacteria 637
694 Ga0495629_0062223 3300046459 Bacteria 2608
695 Ga0495629_0194736 3300046459 Unclassified 1402
696 Ga0495629_0291499 3300046459 Unclassified 1118
697 Ga0495641_0001023 3300046461 Bacteria 24018
698 Ga0495650_0000223 3300046471 Bacteria 118162
699 Ga0495582_0527091 3300046473 Bacteria 683
700 Ga0495605_0271752 3300046474 Unclassified 722
701 Ga0495639_0004293 3300046475 Bacteria 6111
702 Ga0495584_0054471 3300046491 Bacteria 2013
703 Ga0495585_0167098 3300046492 Bacteria 1138
704 Ga0495594_0713223 3300046499 Bacteria 567
705 Ga0495606_0172047 3300046507 Bacteria 1256
706 Ga0495616_0012572 3300046513 Bacteria 4799
707 Ga0495637_0110525 3300046520 Bacteria 1066
708 Ga0495644_0041092 3300046523 Bacteria 1742
709 Ga0495663_0020640 3300046525 Bacteria 1892
710 Ga0495642_0013795 3300046528 Bacteria 3131
711 Ga0495654_0007735 3300046530 Bacteria 5982
712 Ga0495621_0018835 3300046539 Bacteria 2247
713 Ga0495597_0000509 3300046542 Bacteria 32286
714 Ga0495622_0072498 3300046557 Bacteria 1589
715 Ga0495633_0002712 3300046558 Bacteria 12283
716 Ga0495633_0097948 3300046558 Bacteria 1362
717 Ga0495656_0212365 3300046615 Bacteria 965
718 Ga0495656_0276365 3300046615 Bacteria 855
719 Ga0495659_0014635 3300046664 Bacteria 2571
720 Ga0495661_0476559 3300046665 Bacteria 598
721 Ga0495588_0141435 3300046674 Bacteria 1271
722 Ga0495657_0093215 3300046675 Bacteria 1928
723 Ga0495658_0010228 3300046683 Bacteria 4690
724 Ga0495658_0149588 3300046683 Bacteria 1433
725 Ga0495624_0246937 3300046690 Bacteria 1080
726 Ga0495671_0006838 3300046692 Bacteria 6555
727 Ga0495681_0382064 3300047470 Bacteria 530
728 Ga0495686_0000003 3300047472 Bacteria 899502
729 Ga0495686_0250066 3300047472 Unclassified 996
730 Ga0495614_0222909 3300048089 Bacteria 857
731 Ga0496100_0002768 3300048903 Bacteria 8964
732 Ga0496100_0022683 3300048903 Bacteria 3801
733 Ga0496100_0061173 3300048903 Bacteria 2481
734 Ga0496101_0000838 3300048904 Bacteria 18079
735 Ga0496101_0001878 3300048904 Bacteria 12687
736 Ga0496101_0697824 3300048904 Bacteria 801
737 Ga0496102_0015405 3300048905 Bacteria 6658
738 Ga0496103_0001500 3300048906 Bacteria 15621
739 Ga0496104_0001186 3300048907 Bacteria 22389
740 Ga0496104_0069098 3300048907 Bacteria 3357
741 Ga0496105_0000964 3300048908 Bacteria 19760
742 Ga0496105_0001878 3300048908 Bacteria 15073
743 Ga0496106_0000361 3300048909 Bacteria 32313
744 Ga0496106_0116109 3300048909 Bacteria 2088
745 Ga0496107_0000282 3300048910 Bacteria 26883
746 Ga0496108_0002791 3300048911 Bacteria 13997
747 Ga0496108_0036317 3300048911 Bacteria 4100
748 Ga0496108_0284652 3300048911 Bacteria 1439
749 Ga0496109_0003897 3300048912 Bacteria 12466
750 Ga0496109_0059902 3300048912 Bacteria 3478
751 Ga0496110_0002382 3300048913 Bacteria 14089
752 Ga0496110_0039387 3300048913 Bacteria 4114
753 Ga0496110_0068524 3300048913 Bacteria 3140
754 Ga0496110_1917535 3300048913 Bacteria 502
755 Ga0496111_0006540 3300048914 Bacteria 7579
756 Ga0496112_0008872 3300048915 Bacteria 9022
757 Ga0496112_0198073 3300048915 Bacteria 1969
758 Ga0496113_0050340 3300048916 Bacteria 3105
759 Ga0496113_0152039 3300048916 Bacteria 1827
760 Ga0496113_0324079 3300048916 Bacteria 1235
761 Ga0496114_0032784 3300048917 Bacteria 4278
762 Ga0496114_1725220 3300048917 Bacteria 514
763 Ga0496115_1226661 3300048918 Bacteria 562
764 Ga0496116_0001255 3300048919 Bacteria 29451
765 Ga0496116_0001671 3300048919 Bacteria 24360
766 Ga0496116_0043436 3300048919 Bacteria 3062
767 Ga0496117_0037922 3300048920 Bacteria 3583
768 Ga0496117_0053150 3300048920 Bacteria 2848
769 Ga0496118_0009508 3300048921 Bacteria 9798
770 Ga0496118_0020495 3300048921 Bacteria 5859
771 Ga0496118_0136369 3300048921 Bacteria 1565
772 Ga0496119_0005344 3300048922 Bacteria 12354
773 Ga0496120_0038206 3300048923 Bacteria 2842
774 Ga0496121_0002127 3300048924 Bacteria 31127
775 Ga0496121_0016530 3300048924 Bacteria 7612
776 Ga0496121_0069806 3300048924 Bacteria 2833
777 Ga0496121_0158928 3300048924 Bacteria 1655
778 Ga0496121_0177285 3300048924 Bacteria 1542
779 Ga0496122_0000228 3300048925 Bacteria 125699
780 Ga0496122_0007350 3300048925 Bacteria 12285
781 Ga0496122_0023463 3300048925 Bacteria 5437
782 Ga0496122_0132526 3300048925 Bacteria 1580
783 Ga0496122_0233749 3300048925 Bacteria 1043
784 Ga0496123_0004637 3300048926 Bacteria 14282
785 Ga0496123_0035234 3300048926 Bacteria 3570
786 Ga0496123_0098794 3300048926 Bacteria 1706
787 Ga0496123_0147137 3300048926 Bacteria 1277
788 Ga0496123_0245581 3300048926 Bacteria 886
789 Ga0496124_0069625 3300048927 Bacteria 2921
790 Ga0496124_0105095 3300048927 Bacteria 2282
791 Ga0496124_0202684 3300048927 Bacteria 1507
792 Ga0496124_0461952 3300048927 Bacteria 862
793 Ga0496125_0006133 3300048928 Bacteria 13115
794 Ga0496125_0008450 3300048928 Bacteria 10775
795 Ga0496125_0045061 3300048928 Bacteria 3718
796 Ga0496125_0073841 3300048928 Bacteria 2648
797 Ga0496125_0076835 3300048928 Bacteria 2577
798 Ga0496125_0079445 3300048928 Bacteria 2516
799 Ga0496125_0146944 3300048928 Bacteria 1627
800 Ga0496125_0261144 3300048928 Bacteria 1085
801 Ga0496126_0000290 3300048929 Bacteria 106499
802 Ga0496126_0005295 3300048929 Bacteria 14809
803 Ga0496126_0026546 3300048929 Bacteria 5550
804 Ga0496126_0178880 3300048929 Bacteria 1803
805 Ga0496126_0210730 3300048929 Bacteria 1636
806 Ga0501305_045330 3300049161 Bacteria 726
807 Ga0501290_002057 3300049513 Bacteria 2640
808 Ga0501291_000079 3300049514 Bacteria 11678
809 Ga0501292_000089 3300049515 Bacteria 16685
810 Ga0501293_001643 3300049516 Bacteria 1684
811 Ga0501294_000183 3300049517 Bacteria 7685
812 Ga0501295_001213 3300049518 Bacteria 2582
813 Ga0501296_000565 3300049519 Bacteria 3634
814 Ga0501298_000382 3300049521 Bacteria 5998
815 Ga0501298_060035 3300049521 Bacteria 804
816 Ga0501299_000156 3300049522 Bacteria 7716
817 Ga0501315_022282 3300049531 Bacteria 863
818 Ga0501321_018430 3300049537 Bacteria 847
819 Ga0501031_0002920 3300049568 Bacteria 10934
820 Ga0501031_0022187 3300049568 Bacteria 4135
821 Ga0501031_0023129 3300049568 Bacteria 4053
822 Ga0501031_0032889 3300049568 Bacteria 3382
823 Ga0501031_0448490 3300049568 Bacteria 833
824 Ga0501032_0006582 3300049569 Bacteria 8530
825 Ga0501032_0013433 3300049569 Bacteria 5824
826 Ga0501032_0062468 3300049569 Bacteria 2495
827 Ga0501032_0223515 3300049569 Bacteria 1225
828 Ga0501032_0250476 3300049569 Bacteria 1150
829 Ga0501033_0001825 3300049570 Bacteria 18567
830 Ga0501033_0033434 3300049570 Bacteria 3860
831 Ga0501034_0000271 3300049571 Bacteria 93642
832 Ga0501034_0137335 3300049571 Bacteria 2425
833 Ga0501034_0303890 3300049571 Bacteria 1531
834 Ga0501036_0000327 3300049572 Bacteria 33144
835 Ga0501036_0010858 3300049572 Bacteria 7524
836 Ga0501036_0036953 3300049572 Bacteria 4131
837 Ga0501036_0260444 3300049572 Unclassified 1453
838 Ga0501036_0743637 3300049572 Unclassified 809
839 Ga0501036_1060805 3300049572 Bacteria 662
840 Ga0501036_1662475 3300049572 Bacteria 515
841 Ga0501037_0002561 3300049573 Bacteria 13135
842 Ga0501037_0011288 3300049573 Bacteria 6574
843 Ga0501037_0034755 3300049573 Bacteria 3718
844 Ga0501037_0087534 3300049573 Bacteria 2254
845 Ga0501038_0009050 3300049574 Bacteria 9139
846 Ga0501038_0010326 3300049574 Bacteria 8541
847 Ga0501039_0019159 3300049575 Bacteria 5251
848 Ga0501039_0038148 3300049575 Bacteria 3711
849 Ga0501039_0050789 3300049575 Bacteria 3208
850 Ga0501039_0096625 3300049575 Bacteria 2303
851 Ga0501039_0096823 3300049575 Bacteria 2301
852 Ga0501040_0163992 3300049576 Bacteria 1572
853 Ga0501040_1193584 3300049576 Unclassified 552
854 Ga0501041_0007620 3300049577 Bacteria 6358
855 Ga0501041_0027827 3300049577 Bacteria 3408
856 Ga0501041_0088434 3300049577 Bacteria 1912
857 Ga0501041_0109031 3300049577 Bacteria 1717
858 Ga0501041_0343536 3300049577 Unclassified 943
859 Ga0501042_0000917 3300049578 Bacteria 16532
860 Ga0501042_0010054 3300049578 Bacteria 6326
861 Ga0501042_0023574 3300049578 Bacteria 4308
862 Ga0501042_0866102 3300049578 Unclassified 658
863 Ga0501043_0000828 3300049579 Bacteria 27461
864 Ga0501043_0031724 3300049579 Bacteria 4153
865 Ga0501043_0097392 3300049579 Bacteria 2313
866 Ga0501043_0225767 3300049579 Bacteria 1448
867 Ga0501043_0538177 3300049579 Unclassified 869
868 Ga0501043_0807282 3300049579 Bacteria 678
869 Ga0501046_0002954 3300049580 Bacteria 15734
870 Ga0501046_0006900 3300049580 Bacteria 10009
871 Ga0501046_0008109 3300049580 Bacteria 9178
872 Ga0501046_0960468 3300049580 Unclassified 594
873 Ga0501047_0014841 3300049581 Bacteria 7416
874 Ga0501047_0118072 3300049581 Bacteria 2534
875 Ga0501047_0335325 3300049581 Bacteria 1350
876 Ga0501048_0000904 3300049582 Bacteria 21878
877 Ga0501048_0092568 3300049582 Bacteria 2132
878 Ga0501048_0950224 3300049582 Bacteria 618
879 Ga0501067_0053866 3300049583 Bacteria 2229
880 Ga0501068_0043117 3300049584 Bacteria 2714
881 Ga0501068_0612531 3300049584 Unclassified 710
882 Ga0501071_0017323 3300049587 Bacteria 4966
883 Ga0501071_0024606 3300049587 Bacteria 4211
884 Ga0501071_0048033 3300049587 Bacteria 3068
885 Ga0501071_0048526 3300049587 Bacteria 3054
886 Ga0501071_0428191 3300049587 Bacteria 1012
887 Ga0501072_0020273 3300049588 Bacteria 5150
888 Ga0501072_1371593 3300049588 Bacteria 547
889 Ga0501073_0438572 3300049589 Unclassified 903
890 Ga0501074_0025240 3300049590 Bacteria 4317
891 Ga0501076_0091481 3300049592 Bacteria 2447
892 Ga0501076_0607308 3300049592 Bacteria 902
893 Ga0501076_0785609 3300049592 Unclassified 786
894 Ga0501198_004802 3300049649 Bacteria 1888
895 Ga0501198_092441 3300049649 Bacteria 602
896 Ga0501199_001420 3300049650 Bacteria 2169
897 Ga0501202_000879 3300049652 Bacteria 4576
898 Ga0501206_000174 3300049653 Bacteria 7078
899 Ga0501207_008793 3300049654 Bacteria 1465
900 Ga0501208_045654 3300049655 Bacteria 823
901 Ga0501209_005740 3300049656 Bacteria 2264
902 Ga0501211_003197 3300049658 Bacteria 1696
903 Ga0501214_031099 3300049659 Bacteria 733
904 Ga0501217_109927 3300049661 Bacteria 791
905 Ga0501227_039298 3300049665 Bacteria 1164
906 Ga0501228_002783 3300049666 Bacteria 1397
907 Ga0501235_010481 3300049669 Bacteria 2025
908 Ga0501239_001777 3300049672 Bacteria 1896
909 Ga0501247_025930 3300049677 Bacteria 781
910 Ga0501249_000272 3300049679 Bacteria 14779
911 Ga0501251_000114 3300049681 Bacteria 6532
912 Ga0501255_000792 3300049684 Bacteria 2320
913 Ga0501256_010439 3300049685 Bacteria 886
914 Ga0501257_001912 3300049686 Bacteria 4333
915 Ga0501259_010291 3300049688 Bacteria 1527
916 Ga0501260_000129 3300049689 Bacteria 5425
917 Ga0501261_000625 3300049690 Bacteria 4487
918 Ga0501219_001317 3300049703 Bacteria 2535
919 Ga0501221_000163 3300049704 Bacteria 9011
920 Ga0501225_0004309 3300049705 Bacteria 4254
921 Ga0501229_005230 3300049706 Bacteria 1589
922 Ga0501234_000770 3300049707 Bacteria 4982
923 Ga0501245_000167 3300049708 Bacteria 7152
924 Ga0501079_0122109 3300049741 Bacteria 2026
925 Ga0501079_1071898 3300049741 Bacteria 635
926 Ga0501080_0033173 3300049742 Bacteria 4819
927 Ga0501080_0186548 3300049742 Bacteria 1907
928 Ga0501080_0665970 3300049742 Unclassified 920
929 Ga0501081_0148462 3300049743 Bacteria 1683
930 Ga0501081_0287978 3300049743 Unclassified 1204
931 Ga0501081_0902209 3300049743 Unclassified 666
932 Ga0501083_0009799 3300049744 Bacteria 6764
933 Ga0501241_060507 3300049758 Bacteria 760
934 Ga0501266_005449 3300049763 Bacteria 1581
935 Ga0501268_001028 3300049765 Bacteria 3330
936 Ga0501270_000726 3300049767 Bacteria 2919
937 Ga0501271_000056 3300049768 Bacteria 8419
938 Ga0501272_001584 3300049769 Bacteria 2180
939 Ga0501273_002115 3300049770 Bacteria 1993
940 Ga0501278_000356 3300049774 Bacteria 3533
941 Ga0501279_012795 3300049775 Bacteria 1143
942 Ga0501281_01917 3300049777 Bacteria 1559
943 Ga0501282_004434 3300049778 Bacteria 1505
944 Ga0501283_000150 3300049779 Bacteria 8887
945 Ga0501035_0000973 3300049822 Bacteria 30267
946 Ga0501035_0001442 3300049822 Bacteria 24365
947 Ga0501035_0276014 3300049822 Bacteria 1421
948 Ga0501044_0002872 3300049823 Bacteria 19620
949 Ga0501045_0075363 3300049824 Bacteria 2485
950 Ga0501045_0096219 3300049824 Bacteria 2191
951 Ga0501045_0325322 3300049824 Unclassified 1144
952 Ga0501226_001260 3300049853 Bacteria 3278
953 nmdc:mga03683_215138_c1 3300050489 Bacteria 885
954 nmdc:mga03683_52557_c1 3300050489 Bacteria 1703
955 nmdc:mga03683_54619_c1 3300050489 Bacteria 1675
956 nmdc:mga03n38_65449_c1 3300050490 Bacteria 1667
957 nmdc:mga00v17_422526_c1 3300050491 Bacteria 866
958 nmdc:mga0k408_3497_c1 3300050493 Bacteria 3125
959 nmdc:mga0k408_48886_c1 3300050493 Bacteria 2448
960 nmdc:mga06z11_151902_c1 3300050494 Bacteria 1317
961 nmdc:mga07m45_13717_c1 3300050496 Bacteria 4304
962 nmdc:mga05p37_214906_c1 3300050507 Bacteria 2323
963 nmdc:mga05p37_63362_c1 3300050507 Bacteria 4549
964 nmdc:mga05p37_793288_c1 3300050507 Bacteria 1037
965 nmdc:mga05p37_975655_c1 3300050507 Unclassified 904
966 nmdc:mga09592_199729_c1 3300050508 Bacteria 1732
967 nmdc:mga09592_24168_c1 3300050508 Bacteria 5024
968 nmdc:mga09592_486594_c1 3300050508 Bacteria 1063
969 nmdc:mga09592_4984_c1 3300050508 Bacteria 10764
970 nmdc:mga0qj67_185306_c1 3300050509 Bacteria 1691
971 nmdc:mga0qj67_360472_c1 3300050509 Bacteria 1175
972 nmdc:mga0qj67_4550_c1 3300050509 Bacteria 10050
973 nmdc:mga06r32_70368_c1 3300050510 Bacteria 3383
974 nmdc:mga08y16_15713_c1 3300050511 Bacteria 7962
975 nmdc:mga0n895_109332_c1 3300050512 Bacteria 2780
976 nmdc:mga0n895_273122_c1 3300050512 Bacteria 1715
977 nmdc:mga0n895_282768_c1 3300050512 Bacteria 1682
978 nmdc:mga0n895_300554_c1 3300050512 Bacteria 1627
979 nmdc:mga0rr50_29699_c1 3300050513 Bacteria 3860
980 nmdc:mga0rr50_76224_c1 3300050513 Bacteria 2574
981 nmdc:mga08x19_158371_c1 3300050514 Bacteria 1537
982 nmdc:mga08x19_257680_c1 3300050514 Bacteria 1205
983 nmdc:mga08x19_431462_c1 3300050514 Bacteria 926
984 Ga0495601_0793509 3300053077 Bacteria 601
985 Ga0495612_0507157 3300053078 Bacteria 554
986 Ga0500651_0000259 3300053093 Bacteria 31610
987 Ga0500651_0209568 3300053093 Bacteria 1147
988 Ga0500566_0254454 3300053094 Bacteria 852
989 Ga0500569_123858 3300053109 Bacteria 862
990 Ga0500593_014233 3300053117 Bacteria 3408
991 Ga0500593_077226 3300053117 Bacteria 1434
992 Ga0500607_119260 3300053121 Bacteria 1279
993 Ga0500618_041356 3300053125 Bacteria 1058
994 Ga0500628_007390 3300053129 Bacteria 1883
995 Ga0500655_003197 3300053133 Bacteria 2971
996 Ga0500658_0024735 3300053134 Bacteria 2302
997 Ga0500564_003072 3300053138 Bacteria 6378
998 Ga0500574_097406 3300053141 Bacteria 871
999 Ga0500600_0010721 3300053149 Bacteria 5552
1000 Ga0500616_0006338 3300053153 Bacteria 7767
1001 Ga0500627_0018916 3300053158 Bacteria 2735
1002 Ga0500634_0013690 3300053161 Bacteria 4262
1003 Ga0500638_089184 3300053162 Bacteria 1454
1004 Ga0501084_0149372 3300054114 Bacteria 1969
1005 Ga0587067_053520 3300059640 Bacteria 825
1006 Ga0501082_0377009 3300060353 Bacteria 1238
1007 Ga0501082_0850599 3300060353 Unclassified 798
1008 Ga0530510_1158073 3300061734 Bacteria 593

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_1917535 Ga0496110_1917535_53_463 134
2 3300049592 Ga0501076_0607308 Ga0501076_0607308_421_870 136
3 3300005364 Ga0070673_100800191 Ga0070673_1008001912 137
4 3300035398 Ga0316574_0515542 Ga0316574_0515542_43_468 138
5 3300041511 Ga0451855_0074105 Ga0451855_0074105_161_577 138
6 3300041511 Ga0451855_1518801 Ga0451855_1518801_1122_1538 138
7 3300049572 Ga0501036_1060805 Ga0501036_1060805_208_633 138
8 3300049655 Ga0501208_045654 Ga0501208_045654_277_756 138
9 3300027876 Ga0209974_10037812 Ga0209974_100378123 139
10 3300005937 Ga0081455_10004599 Ga0081455_1000459910 140
11 3300042439 Ga0439464_0284124 Ga0439464_0284124_12_434 140
12 3300003187 JGI25151J46595_10002393 JGI25151J46595_1000239311 143
13 3300003316 rootH1_10000848 rootH1_100008489 143
14 3300003320 rootH2_10177648 rootH2_101776485 143
15 3300003322 rootL2_10052955 rootL2_100529559 143
16 3300003790 Ga0055528_1001614 Ga0055528_10016142 143
17 3300005354 Ga0070675_100067435 Ga0070675_1000674352 143
18 3300005355 Ga0070671_100029499 Ga0070671_1000294992 143
19 3300005356 Ga0070674_100452183 Ga0070674_1004521832 143
20 3300005466 Ga0070685_10865894 Ga0070685_108658942 143
21 3300005543 Ga0070672_100016405 Ga0070672_1000164053 143
22 3300005618 Ga0068864_100482785 Ga0068864_1004827852 143
23 3300006163 Ga0070715_10378055 Ga0070715_103780552 143
24 3300009098 Ga0105245_10067283 Ga0105245_100672833 143
25 3300009147 Ga0114129_10173690 Ga0114129_101736904 143
26 3300009148 Ga0105243_10000301 Ga0105243_1000030162 143
27 3300009176 Ga0105242_10003077 Ga0105242_100030774 143
28 3300010375 Ga0105239_10033289 Ga0105239_100332894 143
29 3300011119 Ga0105246_10000077 Ga0105246_100000772 143
30 3300013297 Ga0157378_10000237 Ga0157378_1000023761 143
31 3300013307 Ga0157372_10066231 Ga0157372_100662313 143
32 3300014969 Ga0157376_10010301 Ga0157376_100103016 143
33 3300025273 Ga0209673_1002278 Ga0209673_10022784 143
34 3300025294 Ga0209025_1055514 Ga0209025_10555142 143
35 3300025302 Ga0207426_1020714 Ga0207426_10207142 143
36 3300025728 Ga0207655_1105711 Ga0207655_11057111 143
37 3300025728 Ga0207655_1105720 Ga0207655_11057201 143
38 3300025735 Ga0207713_1002717 Ga0207713_10027173 143
39 3300025900 Ga0207710_10070718 Ga0207710_100707182 143
40 3300025926 Ga0207659_10243353 Ga0207659_102433531 143
41 3300025931 Ga0207644_10273012 Ga0207644_102730123 143
42 3300025934 Ga0207686_10035606 Ga0207686_100356061 143
43 3300025935 Ga0207709_10002077 Ga0207709_100020778 143
44 3300025937 Ga0207669_10412968 Ga0207669_104129682 143
45 3300025940 Ga0207691_10031036 Ga0207691_100310362 143
46 3300031548 Ga0307408_100042562 Ga0307408_1000425623 143
47 3300032002 Ga0307416_100054918 Ga0307416_1000549183 143
48 3300046491 Ga0495584_0054471 Ga0495584_0054471_901_1380 143
49 3300046492 Ga0495585_0167098 Ga0495585_0167098_378_857 143
50 3300046507 Ga0495606_0172047 Ga0495606_0172047_136_615 143
51 3300046557 Ga0495622_0072498 Ga0495622_0072498_790_1269 143
52 3300046558 Ga0495633_0097948 Ga0495633_0097948_42_521 143
53 3300048903 Ga0496100_0002768 Ga0496100_0002768_3167_3646 143
54 3300048904 Ga0496101_0001878 Ga0496101_0001878_3821_4300 143
55 3300048906 Ga0496103_0001500 Ga0496103_0001500_14699_15178 143
56 3300048907 Ga0496104_0001186 Ga0496104_0001186_16954_17433 143
57 3300048908 Ga0496105_0000964 Ga0496105_0000964_9499_9978 143
58 3300048909 Ga0496106_0000361 Ga0496106_0000361_9498_9977 143
59 3300048910 Ga0496107_0000282 Ga0496107_0000282_16945_17424 143
60 3300048911 Ga0496108_0002791 Ga0496108_0002791_3949_4428 143
61 3300048912 Ga0496109_0003897 Ga0496109_0003897_7927_8406 143
62 3300048913 Ga0496110_0002382 Ga0496110_0002382_150_629 143
63 3300048914 Ga0496111_0006540 Ga0496111_0006540_3167_3646 143
64 3300048915 Ga0496112_0008872 Ga0496112_0008872_3353_3832 143
65 3300048916 Ga0496113_0050340 Ga0496113_0050340_2439_2918 143
66 3300048919 Ga0496116_0001671 Ga0496116_0001671_14210_14689 143
67 3300048920 Ga0496117_0037922 Ga0496117_0037922_131_610 143
68 3300048921 Ga0496118_0020495 Ga0496118_0020495_4353_4832 143
69 3300048922 Ga0496119_0005344 Ga0496119_0005344_2378_2857 143
70 3300048923 Ga0496120_0038206 Ga0496120_0038206_1532_2011 143
71 3300048924 Ga0496121_0158928 Ga0496121_0158928_910_1389 143
72 3300048925 Ga0496122_0007350 Ga0496122_0007350_5319_5798 143
73 3300048926 Ga0496123_0004637 Ga0496123_0004637_11958_12437 143
74 3300048927 Ga0496124_0105095 Ga0496124_0105095_156_635 143
75 3300048928 Ga0496125_0008450 Ga0496125_0008450_6414_6893 143
76 3300048929 Ga0496126_0005295 Ga0496126_0005295_14172_14651 143
77 3300049537 Ga0501321_018430 Ga0501321_018430_350_829 143
78 3300049649 Ga0501198_092441 Ga0501198_092441_69_548 143
79 3300050507 nmdc:mga05p37_63362_c1 nmdc:mga05p37_63362_c1_1833_2318 143
80 3300026089 Ga0207648_10146577 Ga0207648_101465773 144
81 3300036647 Ga0316582_0401464 Ga0316582_0401464_172_621 144
82 3300036712 Ga0316584_0136021 Ga0316584_0136021_608_1057 144
83 3300041451 Ga0451791_0443858 Ga0451791_0443858_14_448 144
84 3300009176 Ga0105242_10533661 Ga0105242_105336612 146
85 3300025934 Ga0207686_10159391 Ga0207686_101593912 146
86 3300028653 Ga0265323_10003513 Ga0265323_100035133 146
87 3300038726 Ga0400490_12262 Ga0400490_12262_1052_1501 146
88 3300009148 Ga0105243_10440913 Ga0105243_104409132 147
89 3300041456 Ga0451795_1456898 Ga0451795_1456898_11_457 147
90 3300049568 Ga0501031_0023129 Ga0501031_0023129_3214_3699 147
91 3300049569 Ga0501032_0013433 Ga0501032_0013433_2351_2836 147
92 3300049572 Ga0501036_0010858 Ga0501036_0010858_3063_3548 147
93 3300049573 Ga0501037_0011288 Ga0501037_0011288_2988_3473 147
94 3300049575 Ga0501039_0050789 Ga0501039_0050789_2058_2543 147
95 3300049577 Ga0501041_0007620 Ga0501041_0007620_3559_4044 147
96 3300049578 Ga0501042_0000917 Ga0501042_0000917_14541_15026 147
97 3300049579 Ga0501043_0538177 Ga0501043_0538177_261_746 147
98 3300049580 Ga0501046_0002954 Ga0501046_0002954_7584_8069 147
99 3300049582 Ga0501048_0000904 Ga0501048_0000904_18533_19018 147
100 3300049587 Ga0501071_0017323 Ga0501071_0017323_2644_3129 147
101 3300049822 Ga0501035_0001442 Ga0501035_0001442_11323_11808 147
102 3300054114 Ga0501084_0149372 Ga0501084_0149372_220_705 147
103 3300031456 Ga0307513_10170463 Ga0307513_101704632 148
104 3300003187 JGI25151J46595_10009236 JGI25151J46595_100092363 149
105 3300005366 Ga0070659_100950387 Ga0070659_1009503872 149
106 3300025901 Ga0207688_10184774 Ga0207688_101847742 149
107 3300039447 Ga0436361_0302838 Ga0436361_0302838_33_518 149
108 3300042436 Ga0439435_0193902 Ga0439435_0193902_15_464 149
109 3300042876 Ga0451577_0058339 Ga0451577_0058339_2868_3356 149
110 3300044712 Ga0453684_0081385 Ga0453684_0081385_1799_2290 149
111 3300049775 Ga0501279_012795 Ga0501279_012795_15_464 149
112 3300025294 Ga0209025_1000652 Ga0209025_100065237 151
113 3300035118 Ga0373954_0290706 Ga0373954_0290706_272_754 151
114 3300036401 Ga0373937_1069036 Ga0373937_1069036_76_558 151
115 3300037466 Ga0395898_0205352 Ga0395898_0205352_1169_1654 151
116 3300038443 Ga0395901_0350332 Ga0395901_0350332_393_878 151
117 3300046675 Ga0495657_0093215 Ga0495657_0093215_242_724 151
118 3300025945 Ga0207679_10012799 Ga0207679_100127996 152
119 3300041456 Ga0451795_0439762 Ga0451795_0439762_230_688 152
120 3300041511 Ga0451855_0602217 Ga0451855_0602217_101_559 152
121 3300041511 Ga0451855_1110680 Ga0451855_1110680_279_737 152
122 3300041511 Ga0451855_1286470 Ga0451855_1286470_1219_1677 152
123 3300039062 Ga0400483_003518 Ga0400483_003518_751_1236 153
124 3300041511 Ga0451855_0453732 Ga0451855_0453732_33_497 153
125 iso_pu_bacteria 2551306519 2553395078 154
126 iso_pu_bacteria 2643221729 2644705758 154
127 iso_pu_bacteria 2643221730 2644713279 154
128 iso_pu_bacteria 2671180330 2672333560 154
129 iso_pu_bacteria 2684622632 2685148235 154
130 iso_pu_bacteria 2695420987 2698319660 154
131 iso_pu_bacteria 2703719227 2705991981 154
132 iso_pu_bacteria 2718218445 2721503408 154
133 iso_pu_bacteria 2738541299 2738838967 154
134 iso_pu_bacteria 2738541358 2739160137 154
135 iso_pu_bacteria 2738543006 2739212611 154
136 iso_pu_bacteria 2738543010 2739234663 154
137 iso_pu_bacteria 2808606364 2808871150 154
138 iso_pu_bacteria 2816332186 2816866408 154
139 iso_pu_bacteria 2818991443 2819585009 154
140 iso_pu_bacteria 2842682962 2842688245 154
141 iso_pu_bacteria 2843690924 2843694486 154
142 iso_pu_bacteria 2849139964 2849144939 154
143 iso_pu_bacteria 2857581216 2857586512 154
144 iso_pu_bacteria 2929233124 2929233234 154
145 iso_pu_bacteria 2938917290 2938917404 154
146 iso_pu_bacteria 2947426588 2947426702 154
147 iso_pu_bacteria 2956897341 2956900770 154
148 iso_pu_bacteria 2965761152 2965761294 154
149 iso_pu_bacteria 2969765954 2969766281 154
150 iso_pu_bacteria 2979083700 2979083712 154
151 iso_pu_bacteria 3006826541 3006831027 154
152 iso_pu_bacteria 3006988479 3006993242 154
153 iso_pu_bacteria 8022621104 8022621187 154
154 iso_pu_bacteria 8022653035 8022655849 154
155 iso_pu_bacteria 8023438354 8023439783 154
156 iso_pu_bacteria 8023444577 8023447362 154
157 iso_pu_bacteria 8057582654 8057582769 154
158 3300005331 Ga0070670_100680692 Ga0070670_1006806922 155
159 3300005338 Ga0068868_101542837 Ga0068868_1015428371 155
160 3300005340 Ga0070689_100032573 Ga0070689_1000325732 155
161 3300005341 Ga0070691_10281962 Ga0070691_102819622 155
162 3300005353 Ga0070669_101151513 Ga0070669_1011515131 155
163 3300005354 Ga0070675_100053318 Ga0070675_1000533182 155
164 3300005356 Ga0070674_100087957 Ga0070674_1000879572 155
165 3300005365 Ga0070688_100009181 Ga0070688_1000091814 155
166 3300005436 Ga0070713_100248526 Ga0070713_1002485262 155
167 3300005437 Ga0070710_10429423 Ga0070710_104294232 155
168 3300005439 Ga0070711_100239150 Ga0070711_1002391502 155
169 3300005441 Ga0070700_100373090 Ga0070700_1003730902 155
170 3300005457 Ga0070662_100463818 Ga0070662_1004638181 155
171 3300005459 Ga0068867_100038577 Ga0068867_1000385772 155
172 3300005466 Ga0070685_10023806 Ga0070685_100238062 155
173 3300005539 Ga0068853_100239267 Ga0068853_1002392672 155
174 3300005543 Ga0070672_101289465 Ga0070672_1012894652 155
175 3300005544 Ga0070686_101009210 Ga0070686_1010092101 155
176 3300005545 Ga0070695_100542787 Ga0070695_1005427872 155
177 3300005563 Ga0068855_100523264 Ga0068855_1005232642 155
178 3300005564 Ga0070664_100760103 Ga0070664_1007601032 155
179 3300005577 Ga0068857_100931650 Ga0068857_1009316502 155
180 3300005617 Ga0068859_100901228 Ga0068859_1009012282 155
181 3300005618 Ga0068864_100949208 Ga0068864_1009492082 155
182 3300005718 Ga0068866_10168033 Ga0068866_101680332 155
183 3300005841 Ga0068863_100209106 Ga0068863_1002091062 155
184 3300006058 Ga0075432_10013954 Ga0075432_100139541 155
185 3300006177 Ga0075362_10166821 Ga0075362_101668212 155
186 3300006195 Ga0075366_10030633 Ga0075366_100306333 155
187 3300006871 Ga0075434_100065777 Ga0075434_1000657773 155
188 3300006881 Ga0068865_100962220 Ga0068865_1009622202 155
189 3300006931 Ga0097620_100901147 Ga0097620_1009011472 155
190 3300009147 Ga0114129_11605601 Ga0114129_116056011 155
191 3300013104 Ga0157370_10770339 Ga0157370_107703392 155
192 3300013307 Ga0157372_10209898 Ga0157372_102098983 155
193 3300013308 Ga0157375_10175253 Ga0157375_101752533 155
194 3300014326 Ga0157380_10743637 Ga0157380_107436372 155
195 3300017792 Ga0163161_10811448 Ga0163161_108114482 155
196 3300025898 Ga0207692_10150134 Ga0207692_101501342 155
197 3300025901 Ga0207688_10304188 Ga0207688_103041882 155
198 3300025913 Ga0207695_10425568 Ga0207695_104255682 155
199 3300025916 Ga0207663_10196324 Ga0207663_101963242 155
200 3300025926 Ga0207659_10501770 Ga0207659_105017702 155
201 3300025928 Ga0207700_10555566 Ga0207700_105555661 155
202 3300025934 Ga0207686_10363628 Ga0207686_103636281 155
203 3300025937 Ga0207669_10936025 Ga0207669_109360252 155
204 3300025940 Ga0207691_10036214 Ga0207691_100362144 155
205 3300025949 Ga0207667_10284138 Ga0207667_102841383 155
206 3300025981 Ga0207640_10426350 Ga0207640_104263502 155
207 3300026035 Ga0207703_10119885 Ga0207703_101198853 155
208 3300026041 Ga0207639_10078109 Ga0207639_100781093 155
209 3300026075 Ga0207708_10526614 Ga0207708_105266142 155
210 3300026088 Ga0207641_10148875 Ga0207641_101488752 155
211 3300026089 Ga0207648_10082026 Ga0207648_100820263 155
212 3300026095 Ga0207676_10611411 Ga0207676_106114111 155
213 3300026116 Ga0207674_10396465 Ga0207674_103964652 155
214 3300026118 Ga0207675_100075897 Ga0207675_1000758972 155
215 3300026142 Ga0207698_10151332 Ga0207698_101513323 155
216 3300031456 Ga0307513_10643423 Ga0307513_106434232 155
217 3300031548 Ga0307408_100888051 Ga0307408_1008880512 155
218 3300031665 Ga0316575_10057190 Ga0316575_100571902 155
219 3300031691 Ga0316579_10003640 Ga0316579_100036405 155
220 3300031727 Ga0316576_10091931 Ga0316576_100919312 155
221 3300031728 Ga0316578_10173081 Ga0316578_101730812 155
222 3300031730 Ga0307516_10003661 Ga0307516_1000366114 155
223 3300031733 Ga0316577_10003896 Ga0316577_100038964 155
224 3300032002 Ga0307416_100641004 Ga0307416_1006410042 155
225 3300032133 Ga0316583_10014002 Ga0316583_100140022 155
226 3300032137 Ga0316585_10038483 Ga0316585_100384832 155
227 3300032139 Ga0316580_10050846 Ga0316580_100508462 155
228 3300035398 Ga0316574_0116100 Ga0316574_0116100_591_1058 155
229 3300035398 Ga0316574_0151079 Ga0316574_0151079_336_848 155
230 3300035695 Ga0373927_0556784 Ga0373927_0556784_124_597 155
231 3300036647 Ga0316582_0104022 Ga0316582_0104022_1262_1774 155
232 3300036647 Ga0316582_0883827 Ga0316582_0883827_76_543 155
233 3300036712 Ga0316584_0018788 Ga0316584_0018788_1709_2176 155
234 3300036712 Ga0316584_0037213 Ga0316584_0037213_2863_3375 155
235 3300037418 Ga0395900_0753905 Ga0395900_0753905_62_550 155
236 3300037471 Ga0395905_0679799 Ga0395905_0679799_205_693 155
237 3300041456 Ga0451795_0018265 Ga0451795_0018265_59_529 155
238 3300041460 Ga0451802_0956397 Ga0451802_0956397_416_898 155
239 3300045051 Ga0451576_0000653 Ga0451576_0000653_51205_51699 155
240 3300045051 Ga0451576_0130847 Ga0451576_0130847_425_892 155
241 3300046454 Ga0495592_0143979 Ga0495592_0143979_1048_1521 155
242 3300050489 nmdc:mga03683_54619_c1 nmdc:mga03683_54619_c1_725_1198 155
243 3300050493 nmdc:mga0k408_3497_c1 nmdc:mga0k408_3497_c1_1077_1550 155
244 3300050512 nmdc:mga0n895_300554_c1 nmdc:mga0n895_300554_c1_1077_1544 155
245 3300053078 Ga0495612_0507157 Ga0495612_0507157_42_527 155
246 3300053093 Ga0500651_0209568 Ga0500651_0209568_670_1137 155
247 3300053109 Ga0500569_123858 Ga0500569_123858_96_578 155
248 3300053117 Ga0500593_077226 Ga0500593_077226_614_1096 155
249 iso_pu_bacteria 2643221609 2644062108 155
250 iso_pu_bacteria 2643221611 2644070399 155
251 iso_pu_bacteria 2643221717 2644648949 155
252 iso_pu_bacteria 2643221731 2644721369 155
253 iso_pu_bacteria 2643221732 2644723354 155
254 iso_pu_bacteria 2721755523 2722884513 155
255 iso_pu_bacteria 2738543012 2739243947 155
256 iso_pu_bacteria 2818991465 2819711970 155
257 iso_pu_bacteria 2839138175 2839143109 155
258 iso_pu_bacteria 2842882022 2842887753 155
259 iso_pu_bacteria 2881101125 2881105023 155
260 iso_pu_bacteria 2904524088 2904530137 155
261 iso_pu_bacteria 2919143609 2919149606 155
262 iso_pu_bacteria 2919517244 2919523221 155
263 iso_pu_bacteria 2919720352 2919726442 155
264 iso_pu_bacteria 2928093941 2928099885 155
265 iso_pu_bacteria 2960319331 2960324313 155
266 iso_pu_bacteria 8022893055 8022893405 155
267 iso_pu_bacteria 8022914991 8022917945 155
268 3300001979 JGI24740J21852_10022978 JGI24740J21852_100229783 156
269 3300001979 JGI24740J21852_10035018 JGI24740J21852_100350183 156
270 3300001979 JGI24740J21852_10041916 JGI24740J21852_100419162 156
271 3300001989 JGI24739J22299_10073669 JGI24739J22299_100736692 156
272 3300002773 JGI25152J39213_1009363 JGI25152J39213_10093632 156
273 3300002773 JGI25152J39213_1013311 JGI25152J39213_10133112 156
274 3300002774 JGI25150J39212_1002663 JGI25150J39212_10026632 156
275 3300002774 JGI25150J39212_1028980 JGI25150J39212_10289802 156
276 3300002987 JGI25159J45721_1000455 JGI25159J45721_10004556 156
277 3300002987 JGI25159J45721_1008909 JGI25159J45721_10089092 156
278 3300002987 JGI25159J45721_1008941 JGI25159J45721_10089412 156
279 3300003187 JGI25151J46595_10013010 JGI25151J46595_100130103 156
280 3300003187 JGI25151J46595_10024635 JGI25151J46595_100246353 156
281 3300003187 JGI25151J46595_10035559 JGI25151J46595_100355592 156
282 3300003187 JGI25151J46595_10106259 JGI25151J46595_101062591 156
283 3300003215 JGI25153J46596_10020886 JGI25153J46596_100208863 156
284 3300003316 rootH1_10026606 rootH1_100266063 156
285 3300003323 rootH1_10042628 rootH1_100426283 156
286 3300003323 rootH1_10084694 rootH1_100846942 156
287 3300003354 JGI25160J50197_1000148 JGI25160J50197_100014813 156
288 3300003354 JGI25160J50197_1000822 JGI25160J50197_10008223 156
289 3300003354 JGI25160J50197_1021441 JGI25160J50197_10214412 156
290 3300003354 JGI25160J50197_1021448 JGI25160J50197_10214482 156
291 3300003374 JGI25161J50226_1000111 JGI25161J50226_100011140 156
292 3300003374 JGI25161J50226_1004523 JGI25161J50226_10045232 156
293 3300003374 JGI25161J50226_1004914 JGI25161J50226_10049143 156
294 3300003578 Ga0006562J51391_1060112 Ga0006562J51391_10601121 156
295 3300003761 Ga0055535_1000653 Ga0055535_100065324 156
296 3300003762 Ga0055542_1000004 Ga0055542_100000466 156
297 3300003771 Ga0055526_1017208 Ga0055526_10172082 156
298 3300003771 Ga0055526_1017238 Ga0055526_10172382 156
299 3300003773 Ga0055537_1007008 Ga0055537_10070082 156
300 3300003775 Ga0055524_1015487 Ga0055524_10154872 156
301 3300003775 Ga0055524_1015518 Ga0055524_10155182 156
302 3300003781 Ga0055536_1010162 Ga0055536_10101623 156
303 3300003781 Ga0055536_1013833 Ga0055536_10138333 156
304 3300003784 Ga0055534_1003507 Ga0055534_10035073 156
305 3300003784 Ga0055534_1008619 Ga0055534_10086192 156
306 3300003784 Ga0055534_1009764 Ga0055534_10097642 156
307 3300003790 Ga0055528_1015323 Ga0055528_10153232 156
308 3300003791 Ga0055530_10013554 Ga0055530_100135542 156
309 3300003791 Ga0055530_10016612 Ga0055530_100166123 156
310 3300003791 Ga0055530_10046609 Ga0055530_100466092 156
311 3300003792 Ga0055540_1008365 Ga0055540_10083653 156
312 3300003792 Ga0055540_1013006 Ga0055540_10130063 156
313 3300003792 Ga0055540_1017000 Ga0055540_10170002 156
314 3300003794 Ga0055531_10025953 Ga0055531_100259532 156
315 3300003794 Ga0055531_10026712 Ga0055531_100267122 156
316 3300004625 Ga0055543_1000302 Ga0055543_100030214 156
317 3300004625 Ga0055543_1005187 Ga0055543_10051873 156
318 3300004625 Ga0055543_1010513 Ga0055543_10105132 156
319 3300005262 Ga0065165_1012873 Ga0065165_10128733 156
320 3300005262 Ga0065165_1013194 Ga0065165_10131943 156
321 3300005262 Ga0065165_1038578 Ga0065165_10385782 156
322 3300005262 Ga0065165_1051908 Ga0065165_10519082 156
323 3300005262 Ga0065165_1051909 Ga0065165_10519092 156
324 3300005331 Ga0070670_100163642 Ga0070670_1001636422 156
325 3300005340 Ga0070689_100043278 Ga0070689_1000432783 156
326 3300005347 Ga0070668_100973966 Ga0070668_1009739661 156
327 3300005356 Ga0070674_100398528 Ga0070674_1003985282 156
328 3300005456 Ga0070678_101403506 Ga0070678_1014035062 156
329 3300005457 Ga0070662_100463851 Ga0070662_1004638511 156
330 3300005539 Ga0068853_100111334 Ga0068853_1001113342 156
331 3300005563 Ga0068855_100064760 Ga0068855_1000647603 156
332 3300005577 Ga0068857_100177189 Ga0068857_1001771892 156
333 3300005578 Ga0068854_100328265 Ga0068854_1003282652 156
334 3300005834 Ga0068851_10078152 Ga0068851_100781522 156
335 3300006177 Ga0075362_10055705 Ga0075362_100557052 156
336 3300006186 Ga0075369_10174422 Ga0075369_101744221 156
337 3300006186 Ga0075369_10208070 Ga0075369_102080702 156
338 3300006195 Ga0075366_10057535 Ga0075366_100575352 156
339 3300006353 Ga0075370_10123572 Ga0075370_101235722 156
340 3300006844 Ga0075428_100490345 Ga0075428_1004903453 156
341 3300006880 Ga0075429_100017168 Ga0075429_1000171684 156
342 3300009036 Ga0105244_10207471 Ga0105244_102074712 156
343 3300009147 Ga0114129_10599091 Ga0114129_105990912 156
344 3300009545 Ga0105237_10500865 Ga0105237_105008652 156
345 3300010375 Ga0105239_10908435 Ga0105239_109084352 156
346 3300013100 Ga0157373_10128168 Ga0157373_101281682 156
347 3300013102 Ga0157371_10062595 Ga0157371_100625952 156
348 3300013104 Ga0157370_10474521 Ga0157370_104745212 156
349 3300013105 Ga0157369_10015992 Ga0157369_100159925 156
350 3300013306 Ga0163162_10550954 Ga0163162_105509542 156
351 3300013307 Ga0157372_10382990 Ga0157372_103829901 156
352 3300025208 Ga0209436_112914 Ga0209436_1129142 156
353 3300025228 Ga0209672_100531 Ga0209672_10053118 156
354 3300025229 Ga0209147_101412 Ga0209147_1014123 156
355 3300025242 Ga0209258_100022 Ga0209258_10002266 156
356 3300025245 Ga0207425_1001080 Ga0207425_10010803 156
357 3300025245 Ga0207425_1001242 Ga0207425_10012427 156
358 3300025245 Ga0207425_1010314 Ga0207425_10103142 156
359 3300025254 Ga0209148_1000034 Ga0209148_100003466 156
360 3300025258 Ga0209129_1000023 Ga0209129_1000023144 156
361 3300025258 Ga0209129_1002508 Ga0209129_10025089 156
362 3300025258 Ga0209129_1026336 Ga0209129_10263362 156
363 3300025263 Ga0209565_1000125 Ga0209565_100012560 156
364 3300025263 Ga0209565_1000565 Ga0209565_100056513 156
365 3300025263 Ga0209565_1001097 Ga0209565_10010973 156
366 3300025263 Ga0209565_1005206 Ga0209565_10052062 156
367 3300025273 Ga0209673_1000192 Ga0209673_100019264 156
368 3300025273 Ga0209673_1002969 Ga0209673_10029693 156
369 3300025284 Ga0209130_1000069 Ga0209130_1000069147 156
370 3300025284 Ga0209130_1000110 Ga0209130_100011031 156
371 3300025284 Ga0209130_1000479 Ga0209130_100047921 156
372 3300025284 Ga0209130_1033863 Ga0209130_10338632 156
373 3300025291 Ga0209675_1000427 Ga0209675_100042721 156
374 3300025291 Ga0209675_1000614 Ga0209675_10006149 156
375 3300025291 Ga0209675_1005042 Ga0209675_10050423 156
376 3300025291 Ga0209675_1009288 Ga0209675_10092882 156
377 3300025292 Ga0209676_1000005 Ga0209676_1000005657 156
378 3300025292 Ga0209676_1000285 Ga0209676_100028564 156
379 3300025292 Ga0209676_1000614 Ga0209676_100061418 156
380 3300025292 Ga0209676_1024428 Ga0209676_10244282 156
381 3300025294 Ga0209025_1000316 Ga0209025_100031687 156
382 3300025294 Ga0209025_1004758 Ga0209025_10047582 156
383 3300025294 Ga0209025_1030280 Ga0209025_10302802 156
384 3300025294 Ga0209025_1118901 Ga0209025_11189012 156
385 3300025295 Ga0209564_1000270 Ga0209564_100027038 156
386 3300025295 Ga0209564_1000791 Ga0209564_100079138 156
387 3300025297 Ga0209758_1000064 Ga0209758_100006445 156
388 3300025298 Ga0209050_1000007 Ga0209050_1000007440 156
389 3300025298 Ga0209050_1013270 Ga0209050_10132703 156
390 3300025298 Ga0209050_1014859 Ga0209050_10148593 156
391 3300025299 Ga0209256_1000020 Ga0209256_1000020416 156
392 3300025299 Ga0209256_1000022 Ga0209256_100002219 156
393 3300025299 Ga0209256_1012544 Ga0209256_10125443 156
394 3300025302 Ga0207426_1000001 Ga0207426_10000011051 156
395 3300025302 Ga0207426_1000031 Ga0207426_1000031175 156
396 3300025302 Ga0207426_1000061 Ga0207426_1000061271 156
397 3300025302 Ga0207426_1075332 Ga0207426_10753321 156
398 3300025303 Ga0209051_1000036 Ga0209051_10000368 156
399 3300025303 Ga0209051_1000711 Ga0209051_100071136 156
400 3300025303 Ga0209051_1012743 Ga0209051_10127432 156
401 3300025304 Ga0209257_1000011 Ga0209257_1000011631 156
402 3300025304 Ga0209257_1006768 Ga0209257_10067685 156
403 3300025914 Ga0207671_10049792 Ga0207671_100497923 156
404 3300025925 Ga0207650_10302755 Ga0207650_103027552 156
405 3300025949 Ga0207667_10686534 Ga0207667_106865342 156
406 3300025972 Ga0207668_11022438 Ga0207668_110224381 156
407 3300025981 Ga0207640_10926583 Ga0207640_109265832 156
408 3300026041 Ga0207639_10062321 Ga0207639_100623212 156
409 3300026041 Ga0207639_10838726 Ga0207639_108387262 156
410 3300026121 Ga0207683_10058809 Ga0207683_100588093 156
411 3300026121 Ga0207683_10568684 Ga0207683_105686842 156
412 3300031251 Ga0265327_10016476 Ga0265327_100164763 156
413 3300031548 Ga0307408_100280274 Ga0307408_1002802742 156
414 3300031727 Ga0316576_10004692 Ga0316576_100046923 156
415 3300031903 Ga0307407_11066934 Ga0307407_110669341 156
416 3300031911 Ga0307412_10026010 Ga0307412_100260103 156
417 3300031911 Ga0307412_10450903 Ga0307412_104509032 156
418 3300031911 Ga0307412_11722463 Ga0307412_117224631 156
419 3300035398 Ga0316574_0162686 Ga0316574_0162686_30_518 156
420 3300036712 Ga0316584_0009856 Ga0316584_0009856_186_674 156
421 3300038443 Ga0395901_0353941 Ga0395901_0353941_277_774 156
422 3300041456 Ga0451795_0051390 Ga0451795_0051390_35_505 156
423 3300041511 Ga0451855_0666493 Ga0451855_0666493_92_565 156
424 3300042000 Ga0439437_040284 Ga0439437_040284_52_531 156
425 3300042004 Ga0439445_0070523 Ga0439445_0070523_69_554 156
426 3300042006 Ga0439432_061153 Ga0439432_061153_586_1071 156
427 3300042007 Ga0439449_0002400 Ga0439449_0002400_1219_1704 156
428 3300042876 Ga0451577_0527293 Ga0451577_0527293_230_709 156
429 3300044712 Ga0453684_0149331 Ga0453684_0149331_1939_2418 156
430 3300046453 Ga0495627_009631 Ga0495627_009631_2631_3122 156
431 3300046513 Ga0495616_0012572 Ga0495616_0012572_2475_2963 156
432 3300046528 Ga0495642_0013795 Ga0495642_0013795_1966_2469 156
433 3300046674 Ga0495588_0141435 Ga0495588_0141435_355_843 156
434 3300046683 Ga0495658_0149588 Ga0495658_0149588_193_681 156
435 3300046690 Ga0495624_0246937 Ga0495624_0246937_182_670 156
436 3300046692 Ga0495671_0006838 Ga0495671_0006838_2673_3164 156
437 3300047470 Ga0495681_0382064 Ga0495681_0382064_15_515 156
438 3300048089 Ga0495614_0222909 Ga0495614_0222909_50_538 156
439 3300048904 Ga0496101_0697824 Ga0496101_0697824_269_754 156
440 3300048911 Ga0496108_0284652 Ga0496108_0284652_814_1302 156
441 3300048917 Ga0496114_1725220 Ga0496114_1725220_12_497 156
442 3300048918 Ga0496115_1226661 Ga0496115_1226661_43_528 156
443 3300048919 Ga0496116_0043436 Ga0496116_0043436_2019_2510 156
444 3300048920 Ga0496117_0053150 Ga0496117_0053150_1155_1646 156
445 3300048921 Ga0496118_0009508 Ga0496118_0009508_1465_1956 156
446 3300048921 Ga0496118_0136369 Ga0496118_0136369_1054_1542 156
447 3300048924 Ga0496121_0016530 Ga0496121_0016530_242_724 156
448 3300048924 Ga0496121_0069806 Ga0496121_0069806_1682_2173 156
449 3300048925 Ga0496122_0132526 Ga0496122_0132526_30_518 156
450 3300048926 Ga0496123_0147137 Ga0496123_0147137_553_1044 156
451 3300048926 Ga0496123_0245581 Ga0496123_0245581_265_753 156
452 3300048927 Ga0496124_0202684 Ga0496124_0202684_270_761 156
453 3300048927 Ga0496124_0461952 Ga0496124_0461952_357_845 156
454 3300048928 Ga0496125_0079445 Ga0496125_0079445_839_1330 156
455 3300049161 Ga0501305_045330 Ga0501305_045330_30_521 156
456 3300049569 Ga0501032_0062468 Ga0501032_0062468_1347_1817 156
457 3300049572 Ga0501036_0036953 Ga0501036_0036953_1803_2273 156
458 3300049572 Ga0501036_1662475 Ga0501036_1662475_11_490 156
459 3300049575 Ga0501039_0096625 Ga0501039_0096625_187_657 156
460 3300049575 Ga0501039_0096823 Ga0501039_0096823_920_1399 156
461 3300049577 Ga0501041_0088434 Ga0501041_0088434_901_1380 156
462 3300049579 Ga0501043_0031724 Ga0501043_0031724_3184_3654 156
463 3300049581 Ga0501047_0335325 Ga0501047_0335325_716_1186 156
464 3300049582 Ga0501048_0092568 Ga0501048_0092568_481_960 156
465 3300049587 Ga0501071_0048526 Ga0501071_0048526_1549_2019 156
466 3300049590 Ga0501074_0025240 Ga0501074_0025240_463_933 156
467 3300049592 Ga0501076_0091481 Ga0501076_0091481_592_1071 156
468 3300049742 Ga0501080_0033173 Ga0501080_0033173_2589_3059 156
469 3300049742 Ga0501080_0186548 Ga0501080_0186548_934_1413 156
470 3300049743 Ga0501081_0148462 Ga0501081_0148462_473_952 156
471 3300049744 Ga0501083_0009799 Ga0501083_0009799_3563_4033 156
472 3300049824 Ga0501045_0075363 Ga0501045_0075363_1221_1700 156
473 3300050489 nmdc:mga03683_52557_c1 nmdc:mga03683_52557_c1_1060_1545 156
474 3300050508 nmdc:mga09592_24168_c1 nmdc:mga09592_24168_c1_2556_3038 156
475 3300053077 Ga0495601_0793509 Ga0495601_0793509_92_571 156
476 3300053093 Ga0500651_0000259 Ga0500651_0000259_15575_16063 156
477 3300053094 Ga0500566_0254454 Ga0500566_0254454_255_743 156
478 3300053117 Ga0500593_014233 Ga0500593_014233_2004_2495 156
479 3300053121 Ga0500607_119260 Ga0500607_119260_307_795 156
480 3300053125 Ga0500618_041356 Ga0500618_041356_35_523 156
481 3300053129 Ga0500628_007390 Ga0500628_007390_95_583 156
482 3300053133 Ga0500655_003197 Ga0500655_003197_1446_1934 156
483 3300053134 Ga0500658_0024735 Ga0500658_0024735_623_1111 156
484 3300053138 Ga0500564_003072 Ga0500564_003072_1315_1803 156
485 3300053141 Ga0500574_097406 Ga0500574_097406_243_731 156
486 3300053158 Ga0500627_0018916 Ga0500627_0018916_1358_1849 156
487 3300053161 Ga0500634_0013690 Ga0500634_0013690_1154_1642 156
488 3300053162 Ga0500638_089184 Ga0500638_089184_751_1239 156
489 iso_pu_bacteria 2599185214 2599624444 156
490 iso_pu_bacteria 2599185226 2599672694 156
491 iso_pu_bacteria 2599185227 2599683694 156
492 iso_pu_bacteria 2599185229 2599694303 156
493 iso_pu_bacteria 2617270889 2617914587 156
494 iso_pu_bacteria 2738541277 2738720255 156
495 iso_pu_bacteria 2738541307 2738881796 156
496 iso_pu_bacteria 2738543019 2739279454 156
497 iso_pu_bacteria 2818991446 2819595859 156
498 iso_pu_bacteria 2831265667 2831266994 156
499 iso_pu_bacteria 2838054893 2838057053 156
500 iso_pu_bacteria 2885198086 2885198949 156
501 iso_pu_bacteria 2885211737 2885212788 156
502 iso_pu_bacteria 2899924645 2899925205 156
503 iso_pu_bacteria 2904541872 2904544641 156
504 iso_pu_bacteria 2913844669 2913848963 156
505 iso_pu_bacteria 2913939268 2913942421 156
506 iso_pu_bacteria 2928037797 2928038670 156
507 iso_pu_bacteria 2928044640 2928045725 156
508 iso_pu_bacteria 2928051484 2928053342 156
509 iso_pu_bacteria 2928064002 2928066947 156
510 iso_pu_bacteria 2928070936 2928071156 156
511 iso_pu_bacteria 2928084124 2928084903 156
512 iso_pu_bacteria 2929160207 2929163687 156
513 iso_pu_bacteria 2932422444 2932423567 156
514 iso_pu_bacteria 2939631187 2939634836 156
515 iso_pu_bacteria 2945909444 2945912367 156
516 iso_pu_bacteria 2945984333 2945985319 156
517 iso_pu_bacteria 642555144 642604747 156
518 2209111006 2214782462 2213805733 157
519 3300003187 JGI25151J46595_10048721 JGI25151J46595_100487212 157
520 3300003187 JGI25151J46595_10125314 JGI25151J46595_101253141 157
521 3300003371 JGI26145J50221_1005807 JGI26145J50221_10058072 157
522 3300005277 Ga0065716_1007454 Ga0065716_10074541 157
523 3300005290 Ga0065712_10037862 Ga0065712_100378621 157
524 3300005290 Ga0065712_10204418 Ga0065712_102044182 157
525 3300005293 Ga0065715_10663414 Ga0065715_106634141 157
526 3300005295 Ga0065707_10283295 Ga0065707_102832951 157
527 3300005327 Ga0070658_10021990 Ga0070658_100219906 157
528 3300005328 Ga0070676_10005793 Ga0070676_100057937 157
529 3300005329 Ga0070683_100327982 Ga0070683_1003279822 157
530 3300005329 Ga0070683_100342633 Ga0070683_1003426332 157
531 3300005330 Ga0070690_100002862 Ga0070690_1000028627 157
532 3300005333 Ga0070677_10146803 Ga0070677_101468032 157
533 3300005334 Ga0068869_100086862 Ga0068869_1000868622 157
534 3300005336 Ga0070680_100342976 Ga0070680_1003429762 157
535 3300005336 Ga0070680_100397577 Ga0070680_1003975772 157
536 3300005337 Ga0070682_100040563 Ga0070682_1000405634 157
537 3300005338 Ga0068868_100403166 Ga0068868_1004031662 157
538 3300005339 Ga0070660_100012591 Ga0070660_1000125913 157
539 3300005340 Ga0070689_100036552 Ga0070689_1000365524 157
540 3300005340 Ga0070689_100356682 Ga0070689_1003566822 157
541 3300005341 Ga0070691_10092099 Ga0070691_100920992 157
542 3300005341 Ga0070691_10562724 Ga0070691_105627242 157
543 3300005343 Ga0070687_100009408 Ga0070687_1000094082 157
544 3300005344 Ga0070661_100015451 Ga0070661_1000154513 157
545 3300005344 Ga0070661_100421463 Ga0070661_1004214632 157
546 3300005347 Ga0070668_100039790 Ga0070668_1000397902 157
547 3300005347 Ga0070668_100543027 Ga0070668_1005430271 157
548 3300005354 Ga0070675_100248687 Ga0070675_1002486872 157
549 3300005354 Ga0070675_100263060 Ga0070675_1002630601 157
550 3300005356 Ga0070674_100020216 Ga0070674_1000202165 157
551 3300005364 Ga0070673_100001859 Ga0070673_1000018597 157
552 3300005364 Ga0070673_100272093 Ga0070673_1002720933 157
553 3300005365 Ga0070688_100223670 Ga0070688_1002236702 157
554 3300005366 Ga0070659_100640407 Ga0070659_1006404072 157
555 3300005367 Ga0070667_100232651 Ga0070667_1002326512 157
556 3300005434 Ga0070709_10395096 Ga0070709_103950962 157
557 3300005439 Ga0070711_100000002 Ga0070711_100000002112 157
558 3300005440 Ga0070705_100101052 Ga0070705_1001010523 157
559 3300005441 Ga0070700_100169617 Ga0070700_1001696172 157
560 3300005441 Ga0070700_100432080 Ga0070700_1004320802 157
561 3300005444 Ga0070694_100202628 Ga0070694_1002026282 157
562 3300005444 Ga0070694_100552054 Ga0070694_1005520542 157
563 3300005456 Ga0070678_100001693 Ga0070678_1000016939 157
564 3300005457 Ga0070662_100644280 Ga0070662_1006442801 157
565 3300005457 Ga0070662_101248175 Ga0070662_1012481751 157
566 3300005457 Ga0070662_101487611 Ga0070662_1014876111 157
567 3300005458 Ga0070681_10039712 Ga0070681_100397124 157
568 3300005459 Ga0068867_100021614 Ga0068867_1000216143 157
569 3300005459 Ga0068867_100969909 Ga0068867_1009699091 157
570 3300005468 Ga0070707_100340899 Ga0070707_1003408992 157
571 3300005518 Ga0070699_100000104 Ga0070699_10000010445 157
572 3300005530 Ga0070679_100009608 Ga0070679_1000096084 157
573 3300005544 Ga0070686_100003042 Ga0070686_1000030424 157
574 3300005545 Ga0070695_100261035 Ga0070695_1002610351 157
575 3300005545 Ga0070695_100419337 Ga0070695_1004193372 157
576 3300005546 Ga0070696_100001805 Ga0070696_10000180514 157
577 3300005546 Ga0070696_100029720 Ga0070696_1000297203 157
578 3300005546 Ga0070696_100301740 Ga0070696_1003017402 157
579 3300005548 Ga0070665_100172663 Ga0070665_1001726632 157
580 3300005549 Ga0070704_100168405 Ga0070704_1001684052 157
581 3300005549 Ga0070704_100330680 Ga0070704_1003306802 157
582 3300005564 Ga0070664_100000430 Ga0070664_1000004307 157
583 3300005577 Ga0068857_100066981 Ga0068857_1000669813 157
584 3300005614 Ga0068856_100291104 Ga0068856_1002911042 157
585 3300005616 Ga0068852_100165443 Ga0068852_1001654433 157
586 3300005618 Ga0068864_100862419 Ga0068864_1008624192 157
587 3300005718 Ga0068866_10093269 Ga0068866_100932692 157
588 3300005719 Ga0068861_100573971 Ga0068861_1005739712 157
589 3300005840 Ga0068870_10356743 Ga0068870_103567432 157
590 3300005841 Ga0068863_100303849 Ga0068863_1003038492 157
591 3300005842 Ga0068858_101576729 Ga0068858_1015767291 157
592 3300005843 Ga0068860_100063011 Ga0068860_1000630114 157
593 3300005844 Ga0068862_100090041 Ga0068862_1000900412 157
594 3300005937 Ga0081455_10054757 Ga0081455_100547572 157
595 3300006038 Ga0075365_10001831 Ga0075365_100018315 157
596 3300006048 Ga0075363_100027696 Ga0075363_1000276962 157
597 3300006051 Ga0075364_10590058 Ga0075364_105900581 157
598 3300006058 Ga0075432_10124953 Ga0075432_101249532 157
599 3300006163 Ga0070715_10319561 Ga0070715_103195611 157
600 3300006173 Ga0070716_100180931 Ga0070716_1001809312 157
601 3300006173 Ga0070716_100623156 Ga0070716_1006231562 157
602 3300006178 Ga0075367_10314179 Ga0075367_103141792 157
603 3300006178 Ga0075367_10315957 Ga0075367_103159572 157
604 3300006195 Ga0075366_10110160 Ga0075366_101101602 157
605 3300006237 Ga0097621_100142532 Ga0097621_1001425323 157
606 3300006237 Ga0097621_100160022 Ga0097621_1001600222 157
607 3300006353 Ga0075370_10049640 Ga0075370_100496402 157
608 3300006358 Ga0068871_100643023 Ga0068871_1006430232 157
609 3300006846 Ga0075430_100091643 Ga0075430_1000916432 157
610 3300006846 Ga0075430_100160493 Ga0075430_1001604932 157
611 3300006847 Ga0075431_100044850 Ga0075431_1000448503 157
612 3300006847 Ga0075431_100053508 Ga0075431_1000535082 157
613 3300006852 Ga0075433_10353195 Ga0075433_103531952 157
614 3300006871 Ga0075434_100121079 Ga0075434_1001210794 157
615 3300006871 Ga0075434_100289416 Ga0075434_1002894163 157
616 3300006871 Ga0075434_100499387 Ga0075434_1004993872 157
617 3300006871 Ga0075434_100745518 Ga0075434_1007455181 157
618 3300006880 Ga0075429_100001369 Ga0075429_10000136919 157
619 3300006881 Ga0068865_100002482 Ga0068865_1000024829 157
620 3300006914 Ga0075436_100010987 Ga0075436_1000109877 157
621 3300006914 Ga0075436_100023346 Ga0075436_1000233463 157
622 3300006914 Ga0075436_100244633 Ga0075436_1002446332 157
623 3300006914 Ga0075436_100484642 Ga0075436_1004846422 157
624 3300007076 Ga0075435_100212559 Ga0075435_1002125593 157
625 3300007076 Ga0075435_100215699 Ga0075435_1002156991 157
626 3300009036 Ga0105244_10007321 Ga0105244_100073218 157
627 3300009093 Ga0105240_11103818 Ga0105240_111038182 157
628 3300009098 Ga0105245_10003141 Ga0105245_100031414 157
629 3300009147 Ga0114129_10046873 Ga0114129_100468735 157
630 3300009147 Ga0114129_10188831 Ga0114129_101888314 157
631 3300009147 Ga0114129_10354786 Ga0114129_103547862 157
632 3300009148 Ga0105243_10014671 Ga0105243_100146714 157
633 3300009148 Ga0105243_10021819 Ga0105243_100218196 157
634 3300009174 Ga0105241_10013744 Ga0105241_100137444 157
635 3300009176 Ga0105242_10012170 Ga0105242_100121708 157
636 3300009177 Ga0105248_11987252 Ga0105248_119872522 157
637 3300009545 Ga0105237_10324226 Ga0105237_103242262 157
638 3300009551 Ga0105238_10730239 Ga0105238_107302392 157
639 3300009553 Ga0105249_10019658 Ga0105249_100196585 157
640 3300009553 Ga0105249_10302536 Ga0105249_103025362 157
641 3300010375 Ga0105239_10065273 Ga0105239_100652733 157
642 3300011119 Ga0105246_10071589 Ga0105246_100715892 157
643 3300013102 Ga0157371_10088719 Ga0157371_100887192 157
644 3300013104 Ga0157370_10294022 Ga0157370_102940222 157
645 3300013105 Ga0157369_10254642 Ga0157369_102546422 157
646 3300013296 Ga0157374_10042041 Ga0157374_100420412 157
647 3300013296 Ga0157374_10056971 Ga0157374_100569714 157
648 3300013297 Ga0157378_10157967 Ga0157378_101579673 157
649 3300013306 Ga0163162_10294911 Ga0163162_102949112 157
650 3300013306 Ga0163162_10939198 Ga0163162_109391981 157
651 3300013308 Ga0157375_10159127 Ga0157375_101591273 157
652 3300013308 Ga0157375_10775914 Ga0157375_107759142 157
653 3300014326 Ga0157380_11261979 Ga0157380_112619792 157
654 3300014745 Ga0157377_10034484 Ga0157377_100344843 157
655 3300014969 Ga0157376_10230330 Ga0157376_102303301 157
656 3300015262 Ga0182007_10009286 Ga0182007_100092863 157
657 3300025284 Ga0209130_1002183 Ga0209130_100218310 157
658 3300025294 Ga0209025_1012895 Ga0209025_10128955 157
659 3300025294 Ga0209025_1145213 Ga0209025_11452132 157
660 3300025728 Ga0207655_1039403 Ga0207655_10394032 157
661 3300025893 Ga0207682_10019567 Ga0207682_100195673 157
662 3300025899 Ga0207642_10012814 Ga0207642_100128143 157
663 3300025901 Ga0207688_10031016 Ga0207688_100310164 157
664 3300025906 Ga0207699_10445200 Ga0207699_104452002 157
665 3300025907 Ga0207645_10001024 Ga0207645_1000102411 157
666 3300025909 Ga0207705_10052616 Ga0207705_100526163 157
667 3300025912 Ga0207707_10120621 Ga0207707_101206213 157
668 3300025916 Ga0207663_10000003 Ga0207663_100000034 157
669 3300025917 Ga0207660_10087893 Ga0207660_100878932 157
670 3300025917 Ga0207660_10213142 Ga0207660_102131422 157
671 3300025918 Ga0207662_10042794 Ga0207662_100427944 157
672 3300025918 Ga0207662_10151927 Ga0207662_101519272 157
673 3300025919 Ga0207657_10123803 Ga0207657_101238033 157
674 3300025920 Ga0207649_10077751 Ga0207649_100777512 157
675 3300025920 Ga0207649_10361740 Ga0207649_103617402 157
676 3300025921 Ga0207652_10028701 Ga0207652_100287014 157
677 3300025922 Ga0207646_10788528 Ga0207646_107885281 157
678 3300025925 Ga0207650_10608222 Ga0207650_106082222 157
679 3300025926 Ga0207659_10283819 Ga0207659_102838192 157
680 3300025926 Ga0207659_10512974 Ga0207659_105129742 157
681 3300025926 Ga0207659_10595912 Ga0207659_105959121 157
682 3300025932 Ga0207690_10397896 Ga0207690_103978961 157
683 3300025932 Ga0207690_10804518 Ga0207690_108045182 157
684 3300025933 Ga0207706_10001021 Ga0207706_1000102115 157
685 3300025933 Ga0207706_11074493 Ga0207706_110744931 157
686 3300025934 Ga0207686_10317011 Ga0207686_103170112 157
687 3300025935 Ga0207709_10000019 Ga0207709_10000019110 157
688 3300025935 Ga0207709_10162701 Ga0207709_101627012 157
689 3300025936 Ga0207670_10185151 Ga0207670_101851512 157
690 3300025936 Ga0207670_10248056 Ga0207670_102480562 157
691 3300025937 Ga0207669_10327095 Ga0207669_103270952 157
692 3300025938 Ga0207704_10411091 Ga0207704_104110912 157
693 3300025939 Ga0207665_10222472 Ga0207665_102224722 157
694 3300025939 Ga0207665_10972856 Ga0207665_109728562 157
695 3300025940 Ga0207691_10473153 Ga0207691_104731532 157
696 3300025942 Ga0207689_10018342 Ga0207689_100183427 157
697 3300025944 Ga0207661_10220622 Ga0207661_102206222 157
698 3300025945 Ga0207679_10644868 Ga0207679_106448682 157
699 3300025960 Ga0207651_10014674 Ga0207651_100146747 157
700 3300025960 Ga0207651_10240702 Ga0207651_102407022 157
701 3300025961 Ga0207712_10446610 Ga0207712_104466102 157
702 3300025972 Ga0207668_10028226 Ga0207668_100282264 157
703 3300025981 Ga0207640_10131115 Ga0207640_101311152 157
704 3300025986 Ga0207658_10075944 Ga0207658_100759442 157
705 3300025986 Ga0207658_10189089 Ga0207658_101890891 157
706 3300026023 Ga0207677_10146091 Ga0207677_101460912 157
707 3300026023 Ga0207677_10181784 Ga0207677_101817842 157
708 3300026075 Ga0207708_10005900 Ga0207708_100059004 157
709 3300026075 Ga0207708_10172472 Ga0207708_101724722 157
710 3300026088 Ga0207641_10870886 Ga0207641_108708861 157
711 3300026089 Ga0207648_10003922 Ga0207648_1000392211 157
712 3300026095 Ga0207676_10097826 Ga0207676_100978263 157
713 3300026095 Ga0207676_10127492 Ga0207676_101274922 157
714 3300026116 Ga0207674_10216525 Ga0207674_102165253 157
715 3300026118 Ga0207675_100461321 Ga0207675_1004613211 157
716 3300026121 Ga0207683_10000099 Ga0207683_1000009919 157
717 3300026121 Ga0207683_10095683 Ga0207683_100956833 157
718 3300026142 Ga0207698_10485297 Ga0207698_104852972 157
719 3300027111 Ga0209281_1000005 Ga0209281_1000005247 157
720 3300027252 Ga0209973_1003358 Ga0209973_10033582 157
721 3300027360 Ga0209969_1000858 Ga0209969_10008582 157
722 3300027364 Ga0209967_1000509 Ga0209967_10005094 157
723 3300027364 Ga0209967_1001172 Ga0209967_10011722 157
724 3300027378 Ga0209981_1000079 Ga0209981_100007912 157
725 3300027395 Ga0209996_1000168 Ga0209996_10001682 157
726 3300027424 Ga0209984_1001063 Ga0209984_10010634 157
727 3300027462 Ga0210000_1000123 Ga0210000_100012310 157
728 3300027462 Ga0210000_1028995 Ga0210000_10289951 157
729 3300027462 Ga0210000_1038406 Ga0210000_10384062 157
730 3300027471 Ga0209995_1000415 Ga0209995_10004152 157
731 3300027526 Ga0209968_1000017 Ga0209968_100001726 157
732 3300027543 Ga0209999_1000109 Ga0209999_10001092 157
733 3300027552 Ga0209982_1000025 Ga0209982_10000258 157
734 3300027617 Ga0210002_1000130 Ga0210002_100013011 157
735 3300027617 Ga0210002_1049344 Ga0210002_10493442 157
736 3300027665 Ga0209983_1001431 Ga0209983_10014313 157
737 3300027682 Ga0209971_1000327 Ga0209971_100032714 157
738 3300027682 Ga0209971_1016486 Ga0209971_10164861 157
739 3300027695 Ga0209966_1000186 Ga0209966_100018613 157
740 3300027717 Ga0209998_10000065 Ga0209998_1000006535 157
741 3300027876 Ga0209974_10000064 Ga0209974_1000006420 157
742 3300027876 Ga0209974_10000274 Ga0209974_1000027413 157
743 3300027876 Ga0209974_10010272 Ga0209974_100102723 157
744 3300027907 Ga0207428_10005062 Ga0207428_1000506213 157
745 3300027907 Ga0207428_10069386 Ga0207428_100693863 157
746 3300028381 Ga0268264_10327564 Ga0268264_103275642 157
747 3300028794 Ga0307515_10233464 Ga0307515_102334642 157
748 3300029957 Ga0265324_10079231 Ga0265324_100792312 157
749 3300031251 Ga0265327_10014639 Ga0265327_100146393 157
750 3300031251 Ga0265327_10293133 Ga0265327_102931331 157
751 3300031456 Ga0307513_10238820 Ga0307513_102388202 157
752 3300031548 Ga0307408_100030541 Ga0307408_1000305413 157
753 3300031548 Ga0307408_100064337 Ga0307408_1000643372 157
754 3300031665 Ga0316575_10021290 Ga0316575_100212902 157
755 3300031665 Ga0316575_10111687 Ga0316575_101116871 157
756 3300031665 Ga0316575_10215105 Ga0316575_102151051 157
757 3300031691 Ga0316579_10006147 Ga0316579_100061473 157
758 3300031691 Ga0316579_10224917 Ga0316579_102249171 157
759 3300031711 Ga0265314_10238935 Ga0265314_102389352 157
760 3300031727 Ga0316576_10166444 Ga0316576_101664442 157
761 3300031727 Ga0316576_10442004 Ga0316576_104420042 157
762 3300031727 Ga0316576_10657522 Ga0316576_106575222 157
763 3300031728 Ga0316578_10004409 Ga0316578_100044093 157
764 3300031728 Ga0316578_10021277 Ga0316578_100212772 157
765 3300031728 Ga0316578_10096183 Ga0316578_100961831 157
766 3300031728 Ga0316578_10205734 Ga0316578_102057342 157
767 3300031728 Ga0316578_10656132 Ga0316578_106561321 157
768 3300031731 Ga0307405_10123021 Ga0307405_101230212 157
769 3300031733 Ga0316577_10007336 Ga0316577_100073362 157
770 3300031733 Ga0316577_10019420 Ga0316577_100194201 157
771 3300031733 Ga0316577_10089544 Ga0316577_100895442 157
772 3300031733 Ga0316577_10177082 Ga0316577_101770822 157
773 3300031824 Ga0307413_10110526 Ga0307413_101105263 157
774 3300031903 Ga0307407_10153186 Ga0307407_101531862 157
775 3300031903 Ga0307407_10923514 Ga0307407_109235141 157
776 3300031911 Ga0307412_10009620 Ga0307412_100096202 157
777 3300031995 Ga0307409_100085198 Ga0307409_1000851983 157
778 3300032002 Ga0307416_100441685 Ga0307416_1004416852 157
779 3300032002 Ga0307416_100684642 Ga0307416_1006846422 157
780 3300032002 Ga0307416_101842131 Ga0307416_1018421311 157
781 3300032005 Ga0307411_10345649 Ga0307411_103456492 157
782 3300032133 Ga0316583_10002461 Ga0316583_100024612 157
783 3300032133 Ga0316583_10005516 Ga0316583_100055162 157
784 3300032133 Ga0316583_10006071 Ga0316583_100060712 157
785 3300032133 Ga0316583_10013425 Ga0316583_100134252 157
786 3300032133 Ga0316583_10021900 Ga0316583_100219001 157
787 3300032137 Ga0316585_10004285 Ga0316585_100042853 157
788 3300032137 Ga0316585_10109149 Ga0316585_101091491 157
789 3300032139 Ga0316580_10005429 Ga0316580_100054292 157
790 3300032139 Ga0316580_10019260 Ga0316580_100192602 157
791 3300032139 Ga0316580_10024094 Ga0316580_100240942 157
792 3300032139 Ga0316580_10088339 Ga0316580_100883391 157
793 3300032168 Ga0316593_10073963 Ga0316593_100739631 157
794 3300032168 Ga0316593_10141548 Ga0316593_101415481 157
795 3300033524 Ga0316592_1035586 Ga0316592_10355862 157
796 3300033524 Ga0316592_1041734 Ga0316592_10417341 157
797 3300033524 Ga0316592_1052280 Ga0316592_10522802 157
798 3300033528 Ga0316588_1083830 Ga0316588_10838301 157
799 3300033541 Ga0316596_1085741 Ga0316596_10857411 157
800 3300034816 Ga0373930_0147247 Ga0373930_0147247_94_567 157
801 3300035088 Ga0373940_0118784 Ga0373940_0118784_266_739 157
802 3300035092 Ga0373952_0027441 Ga0373952_0027441_18_491 157
803 3300035111 Ga0373923_0174511 Ga0373923_0174511_387_869 157
804 3300035115 Ga0373941_0039210 Ga0373941_0039210_288_761 157
805 3300035115 Ga0373941_0213074 Ga0373941_0213074_30_503 157
806 3300035115 Ga0373941_0329374 Ga0373941_0329374_70_606 157
807 3300035398 Ga0316574_0036726 Ga0316574_0036726_1901_2383 157
808 3300035398 Ga0316574_0105574 Ga0316574_0105574_1140_1640 157
809 3300035398 Ga0316574_0189279 Ga0316574_0189279_396_902 157
810 3300035398 Ga0316574_0270134 Ga0316574_0270134_116_604 157
811 3300035398 Ga0316574_0438427 Ga0316574_0438427_135_617 157
812 3300035691 Ga0373931_0223720 Ga0373931_0223720_250_723 157
813 3300035691 Ga0373931_0600640 Ga0373931_0600640_108_581 157
814 3300036401 Ga0373937_0555560 Ga0373937_0555560_594_1076 157
815 3300036647 Ga0316582_0036724 Ga0316582_0036724_2365_2871 157
816 3300036647 Ga0316582_0064647 Ga0316582_0064647_1770_2243 157
817 3300036647 Ga0316582_0080866 Ga0316582_0080866_70_552 157
818 3300036647 Ga0316582_0093134 Ga0316582_0093134_771_1253 157
819 3300036712 Ga0316584_0026007 Ga0316584_0026007_1611_2093 157
820 3300036712 Ga0316584_0043982 Ga0316584_0043982_2229_2729 157
821 3300036712 Ga0316584_0098986 Ga0316584_0098986_1184_1666 157
822 3300036712 Ga0316584_0135460 Ga0316584_0135460_18_500 157
823 3300036712 Ga0316584_0266050 Ga0316584_0266050_380_853 157
824 3300037466 Ga0395898_0005965 Ga0395898_0005965_10059_10556 157
825 3300038443 Ga0395901_0101708 Ga0395901_0101708_1493_1990 157
826 3300038726 Ga0400490_24805 Ga0400490_24805_100_588 157
827 3300038726 Ga0400490_26858 Ga0400490_26858_421_915 157
828 3300038726 Ga0400490_53122 Ga0400490_53122_1389_1877 157
829 3300038727 Ga0400491_06308 Ga0400491_06308_404_892 157
830 3300039062 Ga0400483_066915 Ga0400483_066915_169_654 157
831 3300039062 Ga0400483_172963 Ga0400483_172963_5999_6496 157
832 3300039062 Ga0400483_197737 Ga0400483_197737_641_1138 157
833 3300039062 Ga0400483_199463 Ga0400483_199463_115_612 157
834 3300039062 Ga0400483_207579 Ga0400483_207579_115_612 157
835 3300039093 Ga0400489_49933 Ga0400489_49933_4267_4749 157
836 3300039110 Ga0400487_54724 Ga0400487_54724_276_752 157
837 3300041456 Ga0451795_0303860 Ga0451795_0303860_2357_2833 157
838 3300041456 Ga0451795_1520285 Ga0451795_1520285_370_846 157
839 3300041511 Ga0451855_1506058 Ga0451855_1506058_152_631 157
840 3300042001 Ga0439441_107532 Ga0439441_107532_26_511 157
841 3300042005 Ga0439448_0066351 Ga0439448_0066351_48_521 157
842 3300042010 Ga0439452_030038 Ga0439452_030038_470_943 157
843 3300042011 Ga0439454_023090 Ga0439454_023090_257_730 157
844 3300042115 Ga0450911_000112 Ga0450911_000112_25072_25554 157
845 3300042125 Ga0450923_111061 Ga0450923_111061_133_606 157
846 3300042137 Ga0450902_040902 Ga0450902_040902_182_664 157
847 3300042156 Ga0439446_0104052 Ga0439446_0104052_178_651 157
848 3300042435 Ga0439434_0108609 Ga0439434_0108609_352_825 157
849 3300042437 Ga0439444_0074380 Ga0439444_0074380_106_591 157
850 3300042461 Ga0439460_0005773 Ga0439460_0005773_421_894 157
851 3300042461 Ga0439460_0284735 Ga0439460_0284735_11_484 157
852 3300042532 Ga0450893_0016930 Ga0450893_0016930_530_1003 157
853 3300042876 Ga0451577_0000006 Ga0451577_0000006_456249_456722 157
854 3300042876 Ga0451577_0015345 Ga0451577_0015345_2965_3465 157
855 3300042876 Ga0451577_0052660 Ga0451577_0052660_1658_2140 157
856 3300042876 Ga0451577_0166504 Ga0451577_0166504_794_1279 157
857 3300042876 Ga0451577_0237062 Ga0451577_0237062_258_758 157
858 3300042876 Ga0451577_0346600 Ga0451577_0346600_275_757 157
859 3300042876 Ga0451577_0388942 Ga0451577_0388942_600_1073 157
860 3300044656 Ga0466969_0021149 Ga0466969_0021149_77_556 157
861 3300044673 Ga0453683_0000088 Ga0453683_0000088_100385_100858 157
862 3300044673 Ga0453683_0003232 Ga0453683_0003232_6222_6695 157
863 3300044673 Ga0453683_0046720 Ga0453683_0046720_505_1002 157
864 3300044673 Ga0453683_0054011 Ga0453683_0054011_538_1038 157
865 3300044673 Ga0453683_0308841 Ga0453683_0308841_494_988 157
866 3300044673 Ga0453683_0684241 Ga0453683_0684241_79_555 157
867 3300044684 Ga0466966_0048015 Ga0466966_0048015_2228_2707 157
868 3300044693 Ga0466961_0028067 Ga0466961_0028067_61_540 157
869 3300044694 Ga0466963_0362968 Ga0466963_0362968_165_650 157
870 3300044712 Ga0453684_0000037 Ga0453684_0000037_456244_456717 157
871 3300044712 Ga0453684_0002361 Ga0453684_0002361_41840_42313 157
872 3300044712 Ga0453684_0016369 Ga0453684_0016369_3306_3788 157
873 3300044712 Ga0453684_0033391 Ga0453684_0033391_2263_2745 157
874 3300044712 Ga0453684_0033906 Ga0453684_0033906_6330_6950 157
875 3300044712 Ga0453684_0103528 Ga0453684_0103528_1958_2449 157
876 3300044712 Ga0453684_0104957 Ga0453684_0104957_625_1125 157
877 3300044712 Ga0453684_0587797 Ga0453684_0587797_589_1089 157
878 3300044712 Ga0453684_0942742 Ga0453684_0942742_282_773 157
879 3300045049 Ga0466959_0025497 Ga0466959_0025497_1773_2252 157
880 3300045049 Ga0466959_0325229 Ga0466959_0325229_26_526 157
881 3300045051 Ga0451576_0001014 Ga0451576_0001014_8427_8900 157
882 3300045051 Ga0451576_0001923 Ga0451576_0001923_2265_2738 157
883 3300045051 Ga0451576_0006556 Ga0451576_0006556_12117_12617 157
884 3300045051 Ga0451576_0012858 Ga0451576_0012858_2295_2795 157
885 3300045051 Ga0451576_0018765 Ga0451576_0018765_4223_4696 157
886 3300045051 Ga0451576_0036104 Ga0451576_0036104_2402_2875 157
887 3300045051 Ga0451576_0133900 Ga0451576_0133900_1092_1580 157
888 3300045051 Ga0451576_0230206 Ga0451576_0230206_809_1282 157
889 3300045976 Ga0466967_0081188 Ga0466967_0081188_1083_1568 157
890 3300046455 Ga0495603_0588880 Ga0495603_0588880_22_507 157
891 3300046459 Ga0495629_0062223 Ga0495629_0062223_208_717 157
892 3300046459 Ga0495629_0194736 Ga0495629_0194736_30_536 157
893 3300046459 Ga0495629_0291499 Ga0495629_0291499_459_941 157
894 3300046461 Ga0495641_0001023 Ga0495641_0001023_20643_21125 157
895 3300046471 Ga0495650_0000223 Ga0495650_0000223_67587_68069 157
896 3300046473 Ga0495582_0527091 Ga0495582_0527091_80_589 157
897 3300046474 Ga0495605_0271752 Ga0495605_0271752_202_675 157
898 3300046475 Ga0495639_0004293 Ga0495639_0004293_2880_3389 157
899 3300046499 Ga0495594_0713223 Ga0495594_0713223_48_557 157
900 3300046520 Ga0495637_0110525 Ga0495637_0110525_567_1040 157
901 3300046523 Ga0495644_0041092 Ga0495644_0041092_249_746 157
902 3300046525 Ga0495663_0020640 Ga0495663_0020640_1297_1794 157
903 3300046530 Ga0495654_0007735 Ga0495654_0007735_1526_2005 157
904 3300046539 Ga0495621_0018835 Ga0495621_0018835_642_1151 157
905 3300046542 Ga0495597_0000509 Ga0495597_0000509_3515_4003 157
906 3300046558 Ga0495633_0002712 Ga0495633_0002712_7741_8229 157
907 3300046615 Ga0495656_0212365 Ga0495656_0212365_62_571 157
908 3300046615 Ga0495656_0276365 Ga0495656_0276365_150_647 157
909 3300046664 Ga0495659_0014635 Ga0495659_0014635_312_785 157
910 3300046665 Ga0495661_0476559 Ga0495661_0476559_91_588 157
911 3300046683 Ga0495658_0010228 Ga0495658_0010228_3481_3963 157
912 3300047472 Ga0495686_0000003 Ga0495686_0000003_67100_67597 157
913 3300047472 Ga0495686_0250066 Ga0495686_0250066_134_631 157
914 3300048903 Ga0496100_0022683 Ga0496100_0022683_1854_2363 157
915 3300048903 Ga0496100_0061173 Ga0496100_0061173_1469_1975 157
916 3300048904 Ga0496101_0000838 Ga0496101_0000838_8944_9453 157
917 3300048905 Ga0496102_0015405 Ga0496102_0015405_3496_4005 157
918 3300048907 Ga0496104_0069098 Ga0496104_0069098_2737_3246 157
919 3300048908 Ga0496105_0001878 Ga0496105_0001878_11237_11746 157
920 3300048909 Ga0496106_0116109 Ga0496106_0116109_309_818 157
921 3300048911 Ga0496108_0036317 Ga0496108_0036317_3562_4071 157
922 3300048912 Ga0496109_0059902 Ga0496109_0059902_2015_2524 157
923 3300048913 Ga0496110_0039387 Ga0496110_0039387_2546_3043 157
924 3300048913 Ga0496110_0068524 Ga0496110_0068524_2493_3002 157
925 3300048915 Ga0496112_0198073 Ga0496112_0198073_771_1280 157
926 3300048916 Ga0496113_0152039 Ga0496113_0152039_607_1116 157
927 3300048916 Ga0496113_0324079 Ga0496113_0324079_416_913 157
928 3300048917 Ga0496114_0032784 Ga0496114_0032784_1087_1596 157
929 3300048919 Ga0496116_0001255 Ga0496116_0001255_11149_11712 157
930 3300048924 Ga0496121_0002127 Ga0496121_0002127_3972_4454 157
931 3300048924 Ga0496121_0177285 Ga0496121_0177285_683_1177 157
932 3300048925 Ga0496122_0000228 Ga0496122_0000228_99443_100000 157
933 3300048925 Ga0496122_0023463 Ga0496122_0023463_1355_1837 157
934 3300048925 Ga0496122_0233749 Ga0496122_0233749_86_589 157
935 3300048926 Ga0496123_0035234 Ga0496123_0035234_2179_2661 157
936 3300048926 Ga0496123_0098794 Ga0496123_0098794_737_1231 157
937 3300048927 Ga0496124_0069625 Ga0496124_0069625_898_1380 157
938 3300048928 Ga0496125_0006133 Ga0496125_0006133_1735_2217 157
939 3300048928 Ga0496125_0045061 Ga0496125_0045061_2939_3421 157
940 3300048928 Ga0496125_0073841 Ga0496125_0073841_2000_2482 157
941 3300048928 Ga0496125_0076835 Ga0496125_0076835_1975_2469 157
942 3300048928 Ga0496125_0146944 Ga0496125_0146944_764_1246 157
943 3300048928 Ga0496125_0261144 Ga0496125_0261144_97_654 157
944 3300048929 Ga0496126_0000290 Ga0496126_0000290_80332_80889 157
945 3300048929 Ga0496126_0026546 Ga0496126_0026546_1449_1931 157
946 3300048929 Ga0496126_0178880 Ga0496126_0178880_898_1380 157
947 3300048929 Ga0496126_0210730 Ga0496126_0210730_417_899 157
948 3300049513 Ga0501290_002057 Ga0501290_002057_1251_1724 157
949 3300049514 Ga0501291_000079 Ga0501291_000079_8995_9468 157
950 3300049515 Ga0501292_000089 Ga0501292_000089_5674_6147 157
951 3300049516 Ga0501293_001643 Ga0501293_001643_889_1362 157
952 3300049517 Ga0501294_000183 Ga0501294_000183_708_1181 157
953 3300049518 Ga0501295_001213 Ga0501295_001213_893_1366 157
954 3300049519 Ga0501296_000565 Ga0501296_000565_156_629 157
955 3300049521 Ga0501298_000382 Ga0501298_000382_3579_4052 157
956 3300049521 Ga0501298_060035 Ga0501298_060035_277_777 157
957 3300049522 Ga0501299_000156 Ga0501299_000156_421_894 157
958 3300049531 Ga0501315_022282 Ga0501315_022282_214_711 157
959 3300049568 Ga0501031_0002920 Ga0501031_0002920_1755_2246 157
960 3300049568 Ga0501031_0022187 Ga0501031_0022187_1877_2362 157
961 3300049568 Ga0501031_0032889 Ga0501031_0032889_2406_2888 157
962 3300049568 Ga0501031_0448490 Ga0501031_0448490_97_588 157
963 3300049569 Ga0501032_0006582 Ga0501032_0006582_1635_2126 157
964 3300049569 Ga0501032_0223515 Ga0501032_0223515_502_984 157
965 3300049569 Ga0501032_0250476 Ga0501032_0250476_92_583 157
966 3300049570 Ga0501033_0001825 Ga0501033_0001825_10743_11234 157
967 3300049570 Ga0501033_0033434 Ga0501033_0033434_2882_3373 157
968 3300049571 Ga0501034_0000271 Ga0501034_0000271_41253_41735 157
969 3300049571 Ga0501034_0137335 Ga0501034_0137335_124_615 157
970 3300049571 Ga0501034_0303890 Ga0501034_0303890_391_882 157
971 3300049572 Ga0501036_0000327 Ga0501036_0000327_28345_28836 157
972 3300049572 Ga0501036_0260444 Ga0501036_0260444_362_835 157
973 3300049572 Ga0501036_0743637 Ga0501036_0743637_189_668 157
974 3300049573 Ga0501037_0002561 Ga0501037_0002561_10529_11020 157
975 3300049573 Ga0501037_0034755 Ga0501037_0034755_826_1311 157
976 3300049573 Ga0501037_0087534 Ga0501037_0087534_189_680 157
977 3300049574 Ga0501038_0009050 Ga0501038_0009050_1551_2036 157
978 3300049574 Ga0501038_0010326 Ga0501038_0010326_5121_5612 157
979 3300049575 Ga0501039_0019159 Ga0501039_0019159_3739_4221 157
980 3300049575 Ga0501039_0038148 Ga0501039_0038148_1774_2259 157
981 3300049576 Ga0501040_0163992 Ga0501040_0163992_593_1066 157
982 3300049576 Ga0501040_1193584 Ga0501040_1193584_22_495 157
983 3300049577 Ga0501041_0027827 Ga0501041_0027827_426_911 157
984 3300049577 Ga0501041_0109031 Ga0501041_0109031_431_913 157
985 3300049577 Ga0501041_0343536 Ga0501041_0343536_418_897 157
986 3300049578 Ga0501042_0010054 Ga0501042_0010054_5724_6206 157
987 3300049578 Ga0501042_0023574 Ga0501042_0023574_845_1330 157
988 3300049578 Ga0501042_0866102 Ga0501042_0866102_21_494 157
989 3300049579 Ga0501043_0000828 Ga0501043_0000828_11205_11696 157
990 3300049579 Ga0501043_0097392 Ga0501043_0097392_780_1271 157
991 3300049579 Ga0501043_0225767 Ga0501043_0225767_716_1189 157
992 3300049579 Ga0501043_0807282 Ga0501043_0807282_180_662 157
993 3300049580 Ga0501046_0006900 Ga0501046_0006900_118_603 157
994 3300049580 Ga0501046_0008109 Ga0501046_0008109_4866_5357 157
995 3300049580 Ga0501046_0960468 Ga0501046_0960468_74_547 157
996 3300049581 Ga0501047_0014841 Ga0501047_0014841_263_754 157
997 3300049581 Ga0501047_0118072 Ga0501047_0118072_680_1159 157
998 3300049582 Ga0501048_0950224 Ga0501048_0950224_55_534 157
999 3300049583 Ga0501067_0053866 Ga0501067_0053866_1432_1905 157
1000 3300049584 Ga0501068_0043117 Ga0501068_0043117_928_1401 157
1001 3300049584 Ga0501068_0612531 Ga0501068_0612531_139_612 157
1002 3300049587 Ga0501071_0024606 Ga0501071_0024606_26_499 157
1003 3300049587 Ga0501071_0048033 Ga0501071_0048033_1377_1859 157
1004 3300049587 Ga0501071_0428191 Ga0501071_0428191_200_673 157
1005 3300049588 Ga0501072_0020273 Ga0501072_0020273_299_781 157
1006 3300049588 Ga0501072_1371593 Ga0501072_1371593_12_494 157
1007 3300049589 Ga0501073_0438572 Ga0501073_0438572_416_889 157
1008 3300049592 Ga0501076_0785609 Ga0501076_0785609_243_725 157
1009 3300049649 Ga0501198_004802 Ga0501198_004802_901_1374 157
1010 3300049650 Ga0501199_001420 Ga0501199_001420_779_1252 157
1011 3300049652 Ga0501202_000879 Ga0501202_000879_3288_3761 157
1012 3300049653 Ga0501206_000174 Ga0501206_000174_6460_6933 157
1013 3300049654 Ga0501207_008793 Ga0501207_008793_781_1254 157
1014 3300049656 Ga0501209_005740 Ga0501209_005740_1109_1582 157
1015 3300049658 Ga0501211_003197 Ga0501211_003197_920_1393 157
1016 3300049659 Ga0501214_031099 Ga0501214_031099_239_712 157
1017 3300049661 Ga0501217_109927 Ga0501217_109927_29_502 157
1018 3300049665 Ga0501227_039298 Ga0501227_039298_93_566 157
1019 3300049666 Ga0501228_002783 Ga0501228_002783_638_1111 157
1020 3300049669 Ga0501235_010481 Ga0501235_010481_1037_1510 157
1021 3300049672 Ga0501239_001777 Ga0501239_001777_553_1026 157
1022 3300049677 Ga0501247_025930 Ga0501247_025930_244_717 157
1023 3300049679 Ga0501249_000272 Ga0501249_000272_7406_7879 157
1024 3300049681 Ga0501251_000114 Ga0501251_000114_109_582 157
1025 3300049684 Ga0501255_000792 Ga0501255_000792_1101_1574 157
1026 3300049685 Ga0501256_010439 Ga0501256_010439_336_809 157
1027 3300049686 Ga0501257_001912 Ga0501257_001912_3116_3589 157
1028 3300049688 Ga0501259_010291 Ga0501259_010291_1025_1498 157
1029 3300049689 Ga0501260_000129 Ga0501260_000129_525_998 157
1030 3300049690 Ga0501261_000625 Ga0501261_000625_443_916 157
1031 3300049703 Ga0501219_001317 Ga0501219_001317_860_1333 157
1032 3300049704 Ga0501221_000163 Ga0501221_000163_3235_3708 157
1033 3300049705 Ga0501225_0004309 Ga0501225_0004309_3338_3811 157
1034 3300049706 Ga0501229_005230 Ga0501229_005230_682_1155 157
1035 3300049707 Ga0501234_000770 Ga0501234_000770_3762_4235 157
1036 3300049708 Ga0501245_000167 Ga0501245_000167_239_712 157
1037 3300049741 Ga0501079_0122109 Ga0501079_0122109_895_1377 157
1038 3300049741 Ga0501079_1071898 Ga0501079_1071898_142_621 157
1039 3300049742 Ga0501080_0665970 Ga0501080_0665970_62_535 157
1040 3300049743 Ga0501081_0287978 Ga0501081_0287978_482_967 157
1041 3300049743 Ga0501081_0902209 Ga0501081_0902209_56_529 157
1042 3300049758 Ga0501241_060507 Ga0501241_060507_252_725 157
1043 3300049763 Ga0501266_005449 Ga0501266_005449_262_741 157
1044 3300049765 Ga0501268_001028 Ga0501268_001028_2098_2571 157
1045 3300049767 Ga0501270_000726 Ga0501270_000726_2237_2710 157
1046 3300049768 Ga0501271_000056 Ga0501271_000056_4048_4521 157
1047 3300049769 Ga0501272_001584 Ga0501272_001584_750_1223 157
1048 3300049770 Ga0501273_002115 Ga0501273_002115_647_1120 157
1049 3300049774 Ga0501278_000356 Ga0501278_000356_2282_2755 157
1050 3300049777 Ga0501281_01917 Ga0501281_01917_769_1242 157
1051 3300049778 Ga0501282_004434 Ga0501282_004434_515_988 157
1052 3300049779 Ga0501283_000150 Ga0501283_000150_6430_6903 157
1053 3300049822 Ga0501035_0000973 Ga0501035_0000973_5054_5545 157
1054 3300049822 Ga0501035_0276014 Ga0501035_0276014_820_1305 157
1055 3300049823 Ga0501044_0002872 Ga0501044_0002872_15380_15871 157
1056 3300049824 Ga0501045_0096219 Ga0501045_0096219_514_996 157
1057 3300049824 Ga0501045_0325322 Ga0501045_0325322_262_735 157
1058 3300049853 Ga0501226_001260 Ga0501226_001260_1674_2147 157
1059 3300050489 nmdc:mga03683_215138_c1 nmdc:mga03683_215138_c1_12_497 157
1060 3300050490 nmdc:mga03n38_65449_c1 nmdc:mga03n38_65449_c1_607_1098 157
1061 3300050491 nmdc:mga00v17_422526_c1 nmdc:mga00v17_422526_c1_222_713 157
1062 3300050493 nmdc:mga0k408_48886_c1 nmdc:mga0k408_48886_c1_563_1054 157
1063 3300050494 nmdc:mga06z11_151902_c1 nmdc:mga06z11_151902_c1_685_1176 157
1064 3300050496 nmdc:mga07m45_13717_c1 nmdc:mga07m45_13717_c1_3544_4035 157
1065 3300050507 nmdc:mga05p37_214906_c1 nmdc:mga05p37_214906_c1_1095_1568 157
1066 3300050507 nmdc:mga05p37_793288_c1 nmdc:mga05p37_793288_c1_274_747 157
1067 3300050507 nmdc:mga05p37_975655_c1 nmdc:mga05p37_975655_c1_269_742 157
1068 3300050508 nmdc:mga09592_199729_c1 nmdc:mga09592_199729_c1_839_1312 157
1069 3300050508 nmdc:mga09592_486594_c1 nmdc:mga09592_486594_c1_83_556 157
1070 3300050508 nmdc:mga09592_4984_c1 nmdc:mga09592_4984_c1_4210_4683 157
1071 3300050509 nmdc:mga0qj67_185306_c1 nmdc:mga0qj67_185306_c1_290_763 157
1072 3300050509 nmdc:mga0qj67_360472_c1 nmdc:mga0qj67_360472_c1_150_623 157
1073 3300050509 nmdc:mga0qj67_4550_c1 nmdc:mga0qj67_4550_c1_1593_2066 157
1074 3300050510 nmdc:mga06r32_70368_c1 nmdc:mga06r32_70368_c1_950_1423 157
1075 3300050511 nmdc:mga08y16_15713_c1 nmdc:mga08y16_15713_c1_4972_5460 157
1076 3300050512 nmdc:mga0n895_109332_c1 nmdc:mga0n895_109332_c1_1511_1984 157
1077 3300050512 nmdc:mga0n895_273122_c1 nmdc:mga0n895_273122_c1_348_821 157
1078 3300050512 nmdc:mga0n895_282768_c1 nmdc:mga0n895_282768_c1_1162_1647 157
1079 3300050513 nmdc:mga0rr50_29699_c1 nmdc:mga0rr50_29699_c1_3024_3497 157
1080 3300050513 nmdc:mga0rr50_76224_c1 nmdc:mga0rr50_76224_c1_1172_1645 157
1081 3300050514 nmdc:mga08x19_158371_c1 nmdc:mga08x19_158371_c1_155_628 157
1082 3300050514 nmdc:mga08x19_257680_c1 nmdc:mga08x19_257680_c1_480_965 157
1083 3300050514 nmdc:mga08x19_431462_c1 nmdc:mga08x19_431462_c1_140_625 157
1084 3300053149 Ga0500600_0010721 Ga0500600_0010721_2128_2616 157
1085 3300053153 Ga0500616_0006338 Ga0500616_0006338_1680_2171 157
1086 3300059640 Ga0587067_053520 Ga0587067_053520_43_540 157
1087 3300060353 Ga0501082_0377009 Ga0501082_0377009_302_784 157
1088 3300060353 Ga0501082_0850599 Ga0501082_0850599_139_612 157
1089 3300061734 Ga0530510_1158073 Ga0530510_1158073_66_539 157
1090 iso_pu_bacteria 2526164512 2526210683 157
1091 iso_pu_bacteria 2574179768 2574433172 157
1092 iso_pu_bacteria 2739367655 2739612137 157
1093 iso_pu_bacteria 2842733646 2842735461 157
1094 iso_pu_bacteria 2891633521 2891634615 157
1095 iso_pu_bacteria 2894023352 2894026590 157
1096 iso_pu_bacteria 639633007 639786830 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

32

186

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k2x-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine 0.9935 2 154
5l12-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.9924 2 154
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.9917 2 157
3mbm-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine and fol fragment 717, imidazo[2,1-b][1,3]thiazol-6-ylmethanol 0.9909 2 154
5iwx-assembly1.cif.gz_A crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis 0.9899 2 157
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.99 2 157 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9776 2 157 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9692 2 157 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9688 2 157 3.30.1330.50
3t80F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9633 2 155 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A533XV57-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.002 1 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A525VM64-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.001 1 156 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-E1YIT0-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.001 1 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-R5A4P8-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1.001 2 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0070567
AF-A0A1F3J1S4-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1 2 156 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Feature Viewer

pLDDT pTM Quality
97 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map