F489989

General Info

Members Datasets Scaffolds Average Seq Length
1096 483 2192 235

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0000001|Ga0495583_0000001_517596_518423
Length 275
Sequence MVVSPQGASVAVATFGRYRHPAASMLSASVQHSEAMRRAERLFQIIQILRRSRQPVTADAMAAELETSKRSVYRDIAALIGQRAPIRGEAGVGYVLEAGYDMPPLMLTPDEIEAAVLGAQWVAGRGDPVLATAANDLIAKIAAAVPEELRPYVLRPATEAARAWKALPDGLDIAQARAWIHAGRKIRLDYRDEKGAVSQRVVWPVTVGYLETVRLLVAWCELRGDFRHFRTDRVEHAEFLDERHGQRPGALRARWERALEEERQRWLANNPGAGC

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
234 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
237 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
238 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
239 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
240 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
241 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
242 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
243 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
244 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
245 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
246 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
247 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
248 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
257 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
258 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
259 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
260 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
261 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
268 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
281 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
308 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
326 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
336 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
367 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
379 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
380 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
381 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
382 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
383 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
384 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
387 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
388 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
389 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
390 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
391 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
392 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
393 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
394 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
395 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
396 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
397 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
398 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
399 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
400 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
401 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
402 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
403 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
404 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
405 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
406 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
407 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
408 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
409 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
410 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
411 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
412 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
413 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
414 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
415 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
416 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
417 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
418 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
419 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
420 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
421 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
422 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
423 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
424 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
425 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
428 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
429 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
430 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
431 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
432 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
433 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
434 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
435 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
436 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
437 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
438 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
439 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
440 2643221583 Caulobacter sp. Root655 Isolate Unclassified
441 2643221584 Caulobacter sp. Root656 Isolate Unclassified
442 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
443 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
444 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
445 2643221640 Caulobacter sp. Root342 Isolate Unclassified
446 2643221642 Caulobacter sp. Root343 Isolate Unclassified
447 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
448 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
449 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
450 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
451 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
452 2818991435 Caulobacter henricii 536 Isolate Unclassified
453 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
454 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
455 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
456 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
457 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
458 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
459 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
460 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
461 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
462 2849560528 Caulobacter zeae 410 Isolate Unclassified
463 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
464 2851153111 Caulobacter radicis 736 Isolate Unclassified
465 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
466 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
467 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
468 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
469 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
470 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
471 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
472 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
473 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
474 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
475 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
476 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
477 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
478 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
479 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
480 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
481 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
482 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
483 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.71
Metatranscriptomes 0.09
Isolates 5.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26
Nodule 1.37
Rhizoplane 2.65
Rhizosphere 58.39
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0000001 3300046506 Bacteria 811973
2 ARCol0yngRDRAFT_1002743 3300000652 Bacteria 1313
3 JGI24739J22299_10082974 3300001989 Bacteria 982
4 JGI24737J22298_10001157 3300001990 Bacteria 9276
5 JGI24737J22298_10002048 3300001990 Bacteria 7217
6 JGI24737J22298_10006756 3300001990 Bacteria 3899
7 JGI24735J21928_10004802 3300002067 Bacteria 4513
8 JGI24735J21928_10011300 3300002067 Bacteria 2834
9 JGI24735J21928_10017522 3300002067 Bacteria 2215
10 JGI24735J21928_10031649 3300002067 Bacteria 1568
11 JGI24744J21845_10010918 3300002077 Bacteria 1859
12 JGI25150J39212_1001113 3300002774 Bacteria 8088
13 JGI25406J46586_10000513 3300003203 Bacteria 18124
14 JGI25165J46597_1000007 3300003214 Bacteria 518996
15 JGI25165J46597_1000165 3300003214 Bacteria 104009
16 JGI25153J46596_10000103 3300003215 Bacteria 96279
17 JGI25153J46596_10000253 3300003215 Bacteria 43821
18 JGI25153J46596_10000301 3300003215 Bacteria 36933
19 rootL2_10056079 3300003322 Bacteria 6635
20 rootL2_10085247 3300003322 Bacteria 2074
21 rootL2_10136953 3300003322 Bacteria 1186
22 JGI25160J50197_1002871 3300003354 Bacteria 7885
23 Ga0055526_1002472 3300003771 Bacteria 12489
24 Ga0055526_1023389 3300003771 Bacteria 2064
25 Ga0055526_1030086 3300003771 Bacteria 1593
26 Ga0055526_1046549 3300003771 Bacteria 1026
27 Ga0055537_1000720 3300003773 Bacteria 17131
28 Ga0055537_1001200 3300003773 Bacteria 10985
29 Ga0055537_1005264 3300003773 Bacteria 3507
30 Ga0055524_1000561 3300003775 Bacteria 27893
31 Ga0055524_1010000 3300003775 Bacteria 3811
32 Ga0055524_1051165 3300003775 Bacteria 935
33 Ga0055536_1000883 3300003781 Bacteria 19500
34 Ga0055536_1001272 3300003781 Bacteria 15547
35 Ga0055528_1007152 3300003790 Bacteria 4977
36 Ga0055530_10001417 3300003791 Bacteria 17611
37 Ga0055530_10007674 3300003791 Bacteria 4491
38 Ga0055530_10034337 3300003791 Bacteria 1297
39 Ga0055540_1003607 3300003792 Bacteria 7388
40 Ga0055531_10000274 3300003794 Bacteria 53225
41 Ga0055531_10001047 3300003794 Bacteria 21808
42 Ga0055531_10005338 3300003794 Bacteria 7540
43 Ga0055531_10022251 3300003794 Bacteria 2423
44 Ga0055531_10036703 3300003794 Bacteria 1505
45 Ga0055543_1020464 3300004625 Bacteria 1215
46 Ga0065165_1000256 3300005262 Bacteria 92230
47 Ga0065165_1001164 3300005262 Bacteria 30599
48 Ga0065165_1001167 3300005262 Bacteria 30545
49 Ga0065165_1004950 3300005262 Bacteria 7841
50 Ga0065165_1032813 3300005262 Bacteria 1623
51 Ga0065165_1058454 3300005262 Bacteria 1065
52 Ga0070658_10004018 3300005327 Bacteria 12053
53 Ga0070658_10004565 3300005327 Bacteria 11251
54 Ga0070658_10212129 3300005327 Bacteria 1636
55 Ga0070676_10000416 3300005328 Bacteria 20088
56 Ga0070670_100205126 3300005331 Bacteria 1713
57 Ga0068869_100015254 3300005334 Bacteria 5150
58 Ga0070666_10186306 3300005335 Bacteria 1457
59 Ga0070680_100017794 3300005336 Bacteria 5606
60 Ga0070682_100202918 3300005337 Bacteria 1400
61 Ga0070682_100208451 3300005337 Bacteria 1384
62 Ga0068868_100000013 3300005338 Bacteria 110536
63 Ga0068868_100667725 3300005338 Bacteria 927
64 Ga0070660_100002444 3300005339 Bacteria 12761
65 Ga0070660_100003692 3300005339 Bacteria 10562
66 Ga0070660_100019488 3300005339 Bacteria 4972
67 Ga0070660_100033044 3300005339 Bacteria 3897
68 Ga0070660_100204054 3300005339 Bacteria 1604
69 Ga0070660_100625404 3300005339 Bacteria 901
70 Ga0070661_100097802 3300005344 Bacteria 2180
71 Ga0070661_100188955 3300005344 Bacteria 1570
72 Ga0070668_100019990 3300005347 Bacteria 5049
73 Ga0070669_100765504 3300005353 Bacteria 819
74 Ga0070675_100134826 3300005354 Bacteria 2107
75 Ga0070671_100067672 3300005355 Bacteria 2978
76 Ga0070673_100000002 3300005364 Bacteria 225084
77 Ga0070673_100334229 3300005364 Bacteria 1341
78 Ga0070659_100003649 3300005366 Bacteria 10967
79 Ga0070659_100036509 3300005366 Bacteria 3831
80 Ga0070659_100077774 3300005366 Bacteria 2646
81 Ga0070659_100148389 3300005366 Bacteria 1912
82 Ga0070709_10003406 3300005434 Bacteria 8539
83 Ga0070709_10020120 3300005434 Bacteria 3868
84 Ga0070709_10045772 3300005434 Bacteria 2718
85 Ga0070714_100226508 3300005435 Bacteria 1721
86 Ga0070713_100010463 3300005436 Bacteria 6700
87 Ga0070713_100071899 3300005436 Bacteria 2925
88 Ga0070713_100222146 3300005436 Bacteria 1714
89 Ga0070713_100287196 3300005436 Bacteria 1511
90 Ga0070710_10025371 3300005437 Bacteria 3139
91 Ga0070711_100001130 3300005439 Bacteria 14272
92 Ga0070711_100002277 3300005439 Bacteria 10885
93 Ga0070711_100452971 3300005439 Bacteria 1051
94 Ga0070663_100572479 3300005455 Bacteria 947
95 Ga0070678_100010460 3300005456 Bacteria 5671
96 Ga0070662_100159029 3300005457 Bacteria 1766
97 Ga0070681_10006411 3300005458 Bacteria 11447
98 Ga0070681_10049606 3300005458 Bacteria 4191
99 Ga0070681_10087304 3300005458 Bacteria 3072
100 Ga0068867_100000012 3300005459 Bacteria 118831
101 Ga0068867_100276620 3300005459 Bacteria 1375
102 Ga0070706_100052063 3300005467 Bacteria 3780
103 Ga0070707_100092451 3300005468 Bacteria 2929
104 Ga0070679_100117260 3300005530 Bacteria 2647
105 Ga0070684_100001671 3300005535 Bacteria 16123
106 Ga0070697_100118434 3300005536 Bacteria 2213
107 Ga0068853_100009612 3300005539 Bacteria 7791
108 Ga0068853_100041194 3300005539 Bacteria 3943
109 Ga0068853_100470288 3300005539 Bacteria 1184
110 Ga0070693_100020120 3300005547 Bacteria 3514
111 Ga0070665_100001299 3300005548 Bacteria 29894
112 Ga0070665_100154706 3300005548 Bacteria 2295
113 Ga0070665_100174582 3300005548 Bacteria 2150
114 Ga0070665_100203709 3300005548 Bacteria 1979
115 Ga0070665_100535622 3300005548 Bacteria 1183
116 Ga0068855_100000095 3300005563 Bacteria 106561
117 Ga0068855_100071449 3300005563 Bacteria 4036
118 Ga0068855_100298678 3300005563 Bacteria 1784
119 Ga0068855_100498496 3300005563 Bacteria 1323
120 Ga0068857_100013087 3300005577 Bacteria 7230
121 Ga0068857_100021147 3300005577 Bacteria 5725
122 Ga0068857_100163281 3300005577 Bacteria 2022
123 Ga0068856_100000137 3300005614 Bacteria 73762
124 Ga0068856_100016744 3300005614 Bacteria 7101
125 Ga0068856_100345247 3300005614 Bacteria 1507
126 Ga0068852_100000586 3300005616 Bacteria 23996
127 Ga0068852_100088449 3300005616 Bacteria 2767
128 Ga0068859_100005156 3300005617 Bacteria 13269
129 Ga0068864_100007001 3300005618 Bacteria 9253
130 Ga0068866_10071782 3300005718 Bacteria 1832
131 Ga0068861_100207079 3300005719 Bacteria 1650
132 Ga0068851_10024349 3300005834 Bacteria 2963
133 Ga0068863_100025840 3300005841 Bacteria 5602
134 Ga0068863_100359835 3300005841 Bacteria 1418
135 Ga0068858_100000771 3300005842 Bacteria 33416
136 Ga0068858_100009417 3300005842 Bacteria 9320
137 Ga0068858_100242087 3300005842 Bacteria 1712
138 Ga0068860_100000313 3300005843 Bacteria 66545
139 Ga0068860_101020018 3300005843 Bacteria 846
140 Ga0068862_100015180 3300005844 Bacteria 6396
141 Ga0068862_100015872 3300005844 Bacteria 6258
142 Ga0081455_10002424 3300005937 Bacteria 22245
143 Ga0081455_10017304 3300005937 Bacteria 6918
144 Ga0081540_1024929 3300005983 Bacteria 3458
145 Ga0081540_1028527 3300005983 Bacteria 3132
146 Ga0081540_1059623 3300005983 Bacteria 1831
147 Ga0081540_1072041 3300005983 Bacteria 1594
148 Ga0081540_1142003 3300005983 Bacteria 962
149 Ga0081539_10000801 3300005985 Bacteria 61178
150 Ga0081539_10073132 3300005985 Bacteria 1830
151 Ga0075365_10036163 3300006038 Bacteria 3199
152 Ga0075365_10055263 3300006038 Bacteria 2634
153 Ga0075365_10164151 3300006038 Bacteria 1549
154 Ga0075365_10238357 3300006038 Bacteria 1277
155 Ga0075368_10003536 3300006042 Bacteria 5233
156 Ga0075363_100004455 3300006048 Bacteria 6132
157 Ga0075364_10012640 3300006051 Bacteria 5171
158 Ga0075364_10077984 3300006051 Bacteria 2187
159 Ga0075364_10520688 3300006051 Bacteria 813
160 Ga0070712_100009825 3300006175 Bacteria 6031
161 Ga0075362_10021637 3300006177 Bacteria 2702
162 Ga0075367_10020984 3300006178 Bacteria 3645
163 Ga0075367_10037363 3300006178 Bacteria 2821
164 Ga0075367_10039353 3300006178 Bacteria 2756
165 Ga0075369_10004680 3300006186 Bacteria 5076
166 Ga0075369_10005108 3300006186 Bacteria 4887
167 Ga0075369_10009026 3300006186 Bacteria 3859
168 Ga0075369_10106555 3300006186 Bacteria 1261
169 Ga0075369_10120009 3300006186 Bacteria 1190
170 Ga0075369_10238000 3300006186 Bacteria 844
171 Ga0075366_10008146 3300006195 Bacteria 5815
172 Ga0075366_10086221 3300006195 Bacteria 1878
173 Ga0075366_10161131 3300006195 Bacteria 1359
174 Ga0097621_100061585 3300006237 Bacteria 3078
175 Ga0097621_100144761 3300006237 Bacteria 2034
176 Ga0097621_100872561 3300006237 Bacteria 837
177 Ga0075370_10130135 3300006353 Bacteria 1468
178 Ga0075370_10169650 3300006353 Bacteria 1282
179 Ga0075370_10297882 3300006353 Bacteria 959
180 Ga0075428_100150741 3300006844 Bacteria 2526
181 Ga0075434_100023401 3300006871 Bacteria 6020
182 Ga0068865_100000004 3300006881 Bacteria 226236
183 Ga0068865_100480280 3300006881 Bacteria 1033
184 Ga0097620_100005156 3300006931 Bacteria 13269
185 Ga0075435_100411755 3300007076 Bacteria 1164
186 Ga0099794_10061546 3300007265 Bacteria 1824
187 Ga0099795_10001129 3300007788 Bacteria 5569
188 Ga0099795_10005962 3300007788 Bacteria 3288
189 Ga0099795_10067502 3300007788 Bacteria 1342
190 Ga0105240_10002463 3300009093 Bacteria 29749
191 Ga0105240_10033307 3300009093 Bacteria 6659
192 Ga0105240_10064674 3300009093 Bacteria 4544
193 Ga0105240_10071475 3300009093 Bacteria 4291
194 Ga0105240_10086052 3300009093 Bacteria 3850
195 Ga0105240_10298611 3300009093 Bacteria 1843
196 Ga0105240_10323474 3300009093 Bacteria 1757
197 Ga0105245_10001027 3300009098 Bacteria 25355
198 Ga0105245_10003725 3300009098 Bacteria 13583
199 Ga0105245_11027269 3300009098 Bacteria 869
200 Ga0105247_10043425 3300009101 Bacteria 2754
201 Ga0105247_10503386 3300009101 Bacteria 883
202 Ga0114129_10054829 3300009147 Bacteria 5588
203 Ga0105243_10000146 3300009148 Bacteria 81008
204 Ga0105242_10000497 3300009176 Bacteria 31053
205 Ga0105248_10001758 3300009177 Bacteria 24108
206 Ga0105248_10007949 3300009177 Bacteria 11658
207 Ga0105248_10042051 3300009177 Bacteria 5125
208 Ga0105248_10047211 3300009177 Bacteria 4829
209 Ga0105248_10347630 3300009177 Bacteria 1669
210 Ga0105237_10052574 3300009545 Bacteria 4088
211 Ga0105237_10053748 3300009545 Bacteria 4039
212 Ga0105237_10054084 3300009545 Bacteria 4023
213 Ga0105237_10133176 3300009545 Bacteria 2480
214 Ga0105238_10006268 3300009551 Bacteria 11820
215 Ga0105238_10022426 3300009551 Bacteria 6435
216 Ga0105238_10225558 3300009551 Bacteria 1850
217 Ga0105249_10015630 3300009553 Bacteria 6720
218 Ga0105249_10157228 3300009553 Bacteria 2193
219 Ga0105249_10179246 3300009553 Bacteria 2060
220 Ga0099796_10012567 3300010159 Bacteria 2395
221 Ga0105239_10017503 3300010375 Bacteria 7926
222 Ga0105239_10216274 3300010375 Bacteria 2149
223 Ga0105239_10851949 3300010375 Bacteria 1045
224 Ga0105246_10000138 3300011119 Bacteria 33809
225 Ga0157327_1000745 3300012512 Bacteria 1841
226 Ga0157373_10079649 3300013100 Bacteria 2311
227 Ga0157370_10000096 3300013104 Bacteria 99163
228 Ga0157370_10274931 3300013104 Bacteria 1556
229 Ga0157369_10018692 3300013105 Bacteria 7770
230 Ga0157369_10022918 3300013105 Bacteria 6962
231 Ga0157369_10053822 3300013105 Bacteria 4348
232 Ga0157374_10001104 3300013296 Bacteria 23221
233 Ga0157378_10015726 3300013297 Bacteria 6625
234 Ga0157378_10091415 3300013297 Bacteria 2767
235 Ga0163162_10004509 3300013306 Bacteria 13410
236 Ga0163162_10026231 3300013306 Bacteria 5759
237 Ga0163162_11080978 3300013306 Bacteria 908
238 Ga0157372_10034063 3300013307 Bacteria 5596
239 Ga0157372_10067956 3300013307 Bacteria 4006
240 Ga0157372_10294884 3300013307 Bacteria 1886
241 Ga0157372_10559346 3300013307 Bacteria 1333
242 Ga0157375_10000587 3300013308 Bacteria 32327
243 Ga0163163_10018900 3300014325 Bacteria 6465
244 Ga0163163_10089709 3300014325 Bacteria 3087
245 Ga0163163_10557376 3300014325 Bacteria 1209
246 Ga0157380_10122751 3300014326 Bacteria 2203
247 Ga0157380_10532302 3300014326 Bacteria 1149
248 Ga0182008_10154201 3300014497 Bacteria 1153
249 Ga0157379_10014381 3300014968 Bacteria 6944
250 Ga0157379_10027684 3300014968 Bacteria 5046
251 Ga0157379_10033261 3300014968 Bacteria 4598
252 Ga0157379_10067957 3300014968 Bacteria 3186
253 Ga0157379_10199431 3300014968 Bacteria 1809
254 Ga0157376_10000131 3300014969 Bacteria 51790
255 Ga0163161_10056570 3300017792 Bacteria 2849
256 Ga0213872_10070428 3300021361 Bacteria 1577
257 Ga0213876_10000345 3300021384 Bacteria 40189
258 Ga0213876_10038689 3300021384 Bacteria 2518
259 Ga0209436_112907 3300025208 Bacteria 1395
260 Ga0209437_106743 3300025233 Bacteria 1899
261 Ga0207425_1000094 3300025245 Bacteria 85629
262 Ga0207425_1001939 3300025245 Bacteria 7787
263 Ga0209026_1001831 3300025250 Bacteria 8716
264 Ga0209677_102422 3300025253 Bacteria 7047
265 Ga0209148_1000074 3300025254 Bacteria 314356
266 Ga0209148_1001194 3300025254 Bacteria 14881
267 Ga0209129_1001201 3300025258 Bacteria 14903
268 Ga0209233_1000026 3300025261 Bacteria 678466
269 Ga0209233_1000098 3300025261 Bacteria 294111
270 Ga0209233_1002344 3300025261 Bacteria 7057
271 Ga0209565_1000007 3300025263 Bacteria 784361
272 Ga0209565_1000618 3300025263 Bacteria 23421
273 Ga0209565_1038534 3300025263 Bacteria 899
274 Ga0209455_1000574 3300025272 Bacteria 24064
275 Ga0209455_1002785 3300025272 Bacteria 6531
276 Ga0209455_1013949 3300025272 Bacteria 1841
277 Ga0209455_1016958 3300025272 Bacteria 1545
278 Ga0209455_1036672 3300025272 Bacteria 778
279 Ga0209673_1000722 3300025273 Bacteria 45860
280 Ga0209673_1001309 3300025273 Bacteria 25209
281 Ga0209673_1016536 3300025273 Bacteria 2753
282 Ga0209673_1027785 3300025273 Bacteria 1834
283 Ga0209676_1000243 3300025292 Bacteria 117113
284 Ga0209676_1000311 3300025292 Bacteria 95478
285 Ga0209676_1004805 3300025292 Bacteria 7338
286 Ga0209025_1000630 3300025294 Bacteria 62487
287 Ga0209564_1000713 3300025295 Bacteria 48301
288 Ga0209564_1000718 3300025295 Bacteria 47576
289 Ga0209564_1000745 3300025295 Bacteria 46163
290 Ga0209564_1003160 3300025295 Bacteria 11595
291 Ga0209564_1006871 3300025295 Bacteria 6001
292 Ga0209564_1008096 3300025295 Bacteria 5260
293 Ga0209564_1009741 3300025295 Bacteria 4522
294 Ga0209564_1032344 3300025295 Bacteria 1578
295 Ga0209758_1000002 3300025297 Bacteria 1400310
296 Ga0209758_1000015 3300025297 Bacteria 851943
297 Ga0209758_1000108 3300025297 Bacteria 216541
298 Ga0209758_1000239 3300025297 Bacteria 114761
299 Ga0209758_1000252 3300025297 Bacteria 108214
300 Ga0209758_1001566 3300025297 Bacteria 26231
301 Ga0209758_1001570 3300025297 Bacteria 26195
302 Ga0209758_1004632 3300025297 Bacteria 11268
303 Ga0209758_1006280 3300025297 Bacteria 8638
304 Ga0209758_1006552 3300025297 Bacteria 8293
305 Ga0209758_1021049 3300025297 Bacteria 3057
306 Ga0209758_1022902 3300025297 Bacteria 2844
307 Ga0209758_1026731 3300025297 Bacteria 2488
308 Ga0209758_1028026 3300025297 Bacteria 2393
309 Ga0209050_1000244 3300025298 Bacteria 117105
310 Ga0209050_1000342 3300025298 Bacteria 92644
311 Ga0209050_1000375 3300025298 Bacteria 84503
312 Ga0209050_1005517 3300025298 Bacteria 7905
313 Ga0209050_1011876 3300025298 Bacteria 4069
314 Ga0209050_1014540 3300025298 Bacteria 3381
315 Ga0209256_1000008 3300025299 Bacteria 975723
316 Ga0209256_1001119 3300025299 Bacteria 30656
317 Ga0209256_1002155 3300025299 Bacteria 16982
318 Ga0209256_1002592 3300025299 Bacteria 14393
319 Ga0209256_1008041 3300025299 Bacteria 4993
320 Ga0209256_1010559 3300025299 Bacteria 3842
321 Ga0207426_1000217 3300025302 Bacteria 136180
322 Ga0207426_1000368 3300025302 Bacteria 79715
323 Ga0207426_1016643 3300025302 Bacteria 2633
324 Ga0209051_1000226 3300025303 Bacteria 94990
325 Ga0209051_1003593 3300025303 Bacteria 10081
326 Ga0209257_1000066 3300025304 Bacteria 344166
327 Ga0209257_1000140 3300025304 Bacteria 201515
328 Ga0209257_1001119 3300025304 Bacteria 34613
329 Ga0209257_1002989 3300025304 Bacteria 15349
330 Ga0209257_1003585 3300025304 Bacteria 13127
331 Ga0209257_1004459 3300025304 Bacteria 10837
332 Ga0209257_1017346 3300025304 Bacteria 2843
333 Ga0209257_1019253 3300025304 Bacteria 2579
334 Ga0209257_1023078 3300025304 Bacteria 2199
335 Ga0207692_10092668 3300025898 Bacteria 1642
336 Ga0207642_10150907 3300025899 Bacteria 1237
337 Ga0207680_10208528 3300025903 Bacteria 1335
338 Ga0207647_10025784 3300025904 Bacteria 3855
339 Ga0207647_10152771 3300025904 Bacteria 1349
340 Ga0207647_10359411 3300025904 Bacteria 824
341 Ga0207699_10019120 3300025906 Bacteria 3646
342 Ga0207699_10032628 3300025906 Bacteria 2935
343 Ga0207699_10062902 3300025906 Bacteria 2239
344 Ga0207645_10004384 3300025907 Bacteria 10452
345 Ga0207705_10000055 3300025909 Bacteria 160436
346 Ga0207705_10007178 3300025909 Bacteria 8207
347 Ga0207684_10047574 3300025910 Bacteria 3637
348 Ga0207654_10496656 3300025911 Bacteria 861
349 Ga0207707_10000143 3300025912 Bacteria 74226
350 Ga0207707_10014431 3300025912 Bacteria 6882
351 Ga0207695_10004557 3300025913 Bacteria 18841
352 Ga0207695_10005778 3300025913 Bacteria 16288
353 Ga0207695_10029272 3300025913 Bacteria 6091
354 Ga0207695_10525076 3300025913 Bacteria 1065
355 Ga0207671_10029351 3300025914 Bacteria 4106
356 Ga0207671_10061198 3300025914 Bacteria 2793
357 Ga0207671_10144019 3300025914 Bacteria 1837
358 Ga0207671_10178948 3300025914 Bacteria 1650
359 Ga0207693_10054355 3300025915 Bacteria 3141
360 Ga0207693_10166544 3300025915 Bacteria 1735
361 Ga0207663_10052117 3300025916 Bacteria 2551
362 Ga0207660_10007904 3300025917 Bacteria 6882
363 Ga0207660_10274141 3300025917 Bacteria 1337
364 Ga0207657_10004951 3300025919 Bacteria 14018
365 Ga0207657_10005482 3300025919 Bacteria 13248
366 Ga0207657_10013332 3300025919 Bacteria 8064
367 Ga0207657_10139147 3300025919 Bacteria 1984
368 Ga0207652_10024703 3300025921 Bacteria 4987
369 Ga0207646_10065090 3300025922 Bacteria 3254
370 Ga0207694_10029840 3300025924 Bacteria 4163
371 Ga0207694_10049968 3300025924 Bacteria 3238
372 Ga0207694_10050027 3300025924 Bacteria 3235
373 Ga0207694_10067102 3300025924 Bacteria 2800
374 Ga0207659_10015289 3300025926 Bacteria 4967
375 Ga0207659_10232512 3300025926 Bacteria 1487
376 Ga0207659_10510357 3300025926 Bacteria 1018
377 Ga0207687_10000755 3300025927 Bacteria 21846
378 Ga0207687_10089008 3300025927 Bacteria 2247
379 Ga0207687_10201791 3300025927 Bacteria 1555
380 Ga0207700_10034094 3300025928 Bacteria 3650
381 Ga0207700_10110658 3300025928 Bacteria 2209
382 Ga0207700_10197737 3300025928 Bacteria 1693
383 Ga0207700_10227682 3300025928 Bacteria 1583
384 Ga0207690_10004570 3300025932 Bacteria 8175
385 Ga0207690_10036500 3300025932 Bacteria 3183
386 Ga0207690_10401104 3300025932 Bacteria 1094
387 Ga0207706_10010431 3300025933 Bacteria 8489
388 Ga0207686_10067444 3300025934 Bacteria 2289
389 Ga0207709_10000314 3300025935 Bacteria 52842
390 Ga0207704_10000005 3300025938 Bacteria 225353
391 Ga0207711_10000852 3300025941 Bacteria 29486
392 Ga0207711_10004629 3300025941 Bacteria 11695
393 Ga0207711_10176891 3300025941 Bacteria 1939
394 Ga0207689_10001653 3300025942 Bacteria 21135
395 Ga0207679_10256115 3300025945 Bacteria 1490
396 Ga0207667_10000016 3300025949 Bacteria 391466
397 Ga0207667_10020014 3300025949 Bacteria 7455
398 Ga0207667_10079777 3300025949 Bacteria 3392
399 Ga0207651_10000007 3300025960 Bacteria 225286
400 Ga0207712_10007902 3300025961 Bacteria 6720
401 Ga0207712_10088953 3300025961 Bacteria 2269
402 Ga0207712_10234109 3300025961 Bacteria 1476
403 Ga0207668_10436882 3300025972 Bacteria 1114
404 Ga0207677_10000085 3300026023 Bacteria 78393
405 Ga0207703_10001689 3300026035 Bacteria 19855
406 Ga0207703_10006205 3300026035 Bacteria 9564
407 Ga0207703_10224453 3300026035 Bacteria 1681
408 Ga0207639_10038697 3300026041 Bacteria 3549
409 Ga0207639_10255690 3300026041 Bacteria 1530
410 Ga0207639_10286758 3300026041 Bacteria 1450
411 Ga0207678_10049937 3300026067 Bacteria 3615
412 Ga0207678_10746243 3300026067 Bacteria 863
413 Ga0207702_10000063 3300026078 Bacteria 123034
414 Ga0207702_10005342 3300026078 Bacteria 11261
415 Ga0207702_10423659 3300026078 Bacteria 1287
416 Ga0207641_10028640 3300026088 Bacteria 4603
417 Ga0207641_10341334 3300026088 Bacteria 1425
418 Ga0207641_10389758 3300026088 Bacteria 1336
419 Ga0207641_10518373 3300026088 Bacteria 1159
420 Ga0207648_10000005 3300026089 Bacteria 225083
421 Ga0207676_10001553 3300026095 Bacteria 16924
422 Ga0207676_10159444 3300026095 Bacteria 1953
423 Ga0207676_10369365 3300026095 Bacteria 1332
424 Ga0207674_10000989 3300026116 Bacteria 37099
425 Ga0207674_10017443 3300026116 Bacteria 7835
426 Ga0207674_10018135 3300026116 Bacteria 7658
427 Ga0207674_10484544 3300026116 Bacteria 1195
428 Ga0207675_100343902 3300026118 Bacteria 1461
429 Ga0207675_100537927 3300026118 Bacteria 1166
430 Ga0207683_10149323 3300026121 Bacteria 2108
431 Ga0207698_10000294 3300026142 Bacteria 30242
432 Ga0207698_10033871 3300026142 Bacteria 3716
433 Ga0207698_10264407 3300026142 Bacteria 1582
434 Ga0207428_10207164 3300027907 Bacteria 1474
435 Ga0268266_10000003 3300028379 Bacteria 1701703
436 Ga0268266_10126859 3300028379 Bacteria 2278
437 Ga0268266_10154418 3300028379 Bacteria 2072
438 Ga0268266_10166098 3300028379 Bacteria 2000
439 Ga0268266_10235109 3300028379 Bacteria 1689
440 Ga0268266_10545318 3300028379 Bacteria 1111
441 Ga0268265_10023564 3300028380 Bacteria 4340
442 Ga0268265_10036215 3300028380 Bacteria 3613
443 Ga0268265_10453740 3300028380 Bacteria 1198
444 Ga0268264_10000356 3300028381 Bacteria 68810
445 Ga0307517_10176599 3300028786 Bacteria 1389
446 Ga0307515_10033355 3300028794 Bacteria 8482
447 Ga0307511_10034380 3300030521 Bacteria 4450
448 Ga0307512_10191584 3300030522 Bacteria 1127
449 Ga0265330_10010731 3300031235 Bacteria 4310
450 Ga0265330_10063434 3300031235 Bacteria 1606
451 Ga0265332_10151694 3300031238 Bacteria 969
452 Ga0265320_10001345 3300031240 Bacteria 17924
453 Ga0265340_10016299 3300031247 Bacteria 3849
454 Ga0265340_10186514 3300031247 Bacteria 936
455 Ga0265331_10032239 3300031250 Bacteria 2598
456 Ga0265316_10045394 3300031344 Bacteria 3489
457 Ga0307513_10079397 3300031456 Bacteria 3390
458 Ga0307513_10270222 3300031456 Bacteria 1484
459 Ga0307513_10306911 3300031456 Bacteria 1351
460 Ga0307509_10192327 3300031507 Bacteria 1889
461 Ga0307509_10541234 3300031507 Bacteria 843
462 Ga0307408_100064798 3300031548 Bacteria 2678
463 Ga0307508_10001949 3300031616 Bacteria 22585
464 Ga0307508_10262591 3300031616 Bacteria 1321
465 Ga0265314_10071962 3300031711 Bacteria 2311
466 Ga0265314_10073784 3300031711 Bacteria 2274
467 Ga0265342_10003269 3300031712 Bacteria 13437
468 Ga0265342_10028180 3300031712 Bacteria 3502
469 Ga0265342_10089269 3300031712 Bacteria 1769
470 Ga0265342_10122932 3300031712 Bacteria 1460
471 Ga0307516_10000034 3300031730 Bacteria 155251
472 Ga0307516_10005305 3300031730 Bacteria 15512
473 Ga0307516_10126728 3300031730 Bacteria 2337
474 Ga0307405_10414785 3300031731 Bacteria 1058
475 Ga0307412_10355937 3300031911 Bacteria 1177
476 Ga0307412_10421289 3300031911 Bacteria 1092
477 Ga0307414_10021121 3300032004 Bacteria 4076
478 Ga0307414_10197404 3300032004 Bacteria 1633
479 Ga0307510_10103437 3300033180 Bacteria 2625
480 Ga0307510_10129319 3300033180 Bacteria 2204
481 Ga0307510_10167278 3300033180 Bacteria 1784
482 Ga0373934_0135557 3300035086 Bacteria 1005
483 Ga0373944_0080706 3300035089 Bacteria 1074
484 Ga0373923_0182533 3300035111 Bacteria 965
485 Ga0373936_0086972 3300035113 Bacteria 1307
486 Ga0373936_0187711 3300035113 Bacteria 909
487 Ga0373955_0449417 3300035172 Bacteria 785
488 Ga0373935_0005959 3300035692 Bacteria 7231
489 Ga0373927_0002991 3300035695 Bacteria 12261
490 Ga0373927_0014399 3300035695 Bacteria 5236
491 Ga0373927_0049450 3300035695 Bacteria 2718
492 Ga0373933_0285329 3300035724 Bacteria 1067
493 Ga0373947_0040983 3300035725 Bacteria 2760
494 Ga0373937_0047940 3300036401 Bacteria 3909
495 Ga0310112_010758 3300036458 Bacteria 1307
496 Ga0373925_0034633 3300037068 Bacteria 3722
497 Ga0373925_0317917 3300037068 Bacteria 1259
498 Ga0373925_0352501 3300037068 Bacteria 1195
499 Ga0395899_0000026 3300037312 Bacteria 345291
500 Ga0395899_0000713 3300037312 Bacteria 33291
501 Ga0395899_0098311 3300037312 Bacteria 2114
502 Ga0395899_0510502 3300037312 Bacteria 778
503 Ga0395900_0025660 3300037418 Bacteria 6032
504 Ga0395900_0200106 3300037418 Bacteria 2022
505 Ga0395898_0058714 3300037466 Bacteria 3745
506 Ga0395898_0204761 3300037466 Bacteria 1883
507 Ga0395898_0289869 3300037466 Bacteria 1561
508 Ga0395898_0443901 3300037466 Bacteria 1236
509 Ga0395905_0012102 3300037471 Bacteria 8312
510 Ga0395905_0034469 3300037471 Bacteria 4753
511 Ga0395905_0050916 3300037471 Bacteria 3879
512 Ga0395905_0061355 3300037471 Bacteria 3517
513 Ga0395905_0070375 3300037471 Bacteria 3278
514 Ga0395905_0078733 3300037471 Bacteria 3089
515 Ga0395905_0410047 3300037471 Bacteria 1250
516 Ga0395905_0876355 3300037471 Bacteria 801
517 Ga0395901_0029430 3300038443 Bacteria 5656
518 Ga0395901_0029978 3300038443 Bacteria 5604
519 Ga0395901_0104792 3300038443 Bacteria 2968
520 Ga0395901_0192446 3300038443 Bacteria 2139
521 Ga0395901_0395262 3300038443 Bacteria 1421
522 Ga0395901_0418805 3300038443 Bacteria 1374
523 Ga0395901_0688279 3300038443 Bacteria 1021
524 Ga0395901_0794163 3300038443 Bacteria 936
525 Ga0436365_0140106 3300039437 Bacteria 2084
526 Ga0436365_0449154 3300039437 Bacteria 1607
527 Ga0436365_0503144 3300039437 Bacteria 3811
528 Ga0436365_0916510 3300039437 Bacteria 28669
529 Ga0436365_1541345 3300039437 Bacteria 20116
530 Ga0436365_1602753 3300039437 Bacteria 4159
531 Ga0436360_0479997 3300039438 Bacteria 1343
532 Ga0436360_0795172 3300039438 Bacteria 791
533 Ga0436361_0108203 3300039447 Bacteria 1212
534 Ga0436361_0186477 3300039447 Bacteria 1340
535 Ga0436361_0238923 3300039447 Bacteria 2966
536 Ga0436361_0261403 3300039447 Bacteria 1358
537 Ga0436361_0546846 3300039447 Bacteria 2777
538 Ga0436361_0681592 3300039447 Bacteria 2168
539 Ga0436361_0843361 3300039447 Bacteria 817
540 Ga0436363_0168726 3300039450 Bacteria 4122
541 Ga0436363_0599359 3300039450 Bacteria 7683
542 Ga0436363_0885771 3300039450 Bacteria 980
543 Ga0439436_0018407 3300041404 Bacteria 2088
544 Ga0439461_0035617 3300041410 Bacteria 1056
545 Ga0439465_0006377 3300041413 Bacteria 3746
546 Ga0439431_0000187 3300041997 Bacteria 12043
547 Ga0439431_0010651 3300041997 Bacteria 2088
548 Ga0439442_002393 3300042002 Bacteria 3683
549 Ga0439445_0000562 3300042004 Bacteria 7575
550 Ga0439445_0069288 3300042004 Bacteria 974
551 Ga0439448_0002340 3300042005 Bacteria 5139
552 Ga0439448_0024185 3300042005 Bacteria 1898
553 Ga0439432_003177 3300042006 Bacteria 6113
554 Ga0439449_0053381 3300042007 Bacteria 1494
555 Ga0439452_021467 3300042010 Bacteria 1682
556 Ga0439455_0007335 3300042012 Bacteria 2329
557 Ga0439455_0008361 3300042012 Bacteria 2216
558 Ga0439455_0059366 3300042012 Bacteria 1012
559 Ga0439455_0071768 3300042012 Bacteria 931
560 Ga0439455_0102985 3300042012 Bacteria 790
561 Ga0439457_001532 3300042014 Bacteria 6934
562 Ga0450919_010306 3300042121 Bacteria 1070
563 Ga0450923_017278 3300042125 Bacteria 1368
564 Ga0450898_035919 3300042134 Bacteria 924
565 Ga0450910_010396 3300042147 Bacteria 1325
566 Ga0439446_0002031 3300042156 Bacteria 4791
567 Ga0439458_0000986 3300042157 Bacteria 7274
568 Ga0439458_0001013 3300042157 Bacteria 7188
569 Ga0439458_0001992 3300042157 Bacteria 5069
570 Ga0439434_0002604 3300042435 Bacteria 5251
571 Ga0439435_0012758 3300042436 Bacteria 2044
572 Ga0466972_0010990 3300044658 Bacteria 4545
573 Ga0466965_0031586 3300044683 Bacteria 2583
574 Ga0466966_0034352 3300044684 Bacteria 3279
575 Ga0466966_0058072 3300044684 Unclassified 2446
576 Ga0466966_0058718 3300044684 Bacteria 2431
577 Ga0466966_0138559 3300044684 Bacteria 1487
578 Ga0466961_0011581 3300044693 Bacteria 5637
579 Ga0466963_0037193 3300044694 Plasmid 3177
580 Ga0466963_0049597 3300044694 Bacteria 2777
581 Ga0466963_0101375 3300044694 Bacteria 1971
582 Ga0466964_0013581 3300044706 Bacteria 3089
583 Ga0466964_0085777 3300044706 Bacteria 1360
584 Ga0466971_0024553 3300044719 Bacteria 2690
585 Ga0466971_0062460 3300044719 Bacteria 1685
586 Ga0466968_0025710 3300044735 Bacteria 2413
587 Ga0466968_0029848 3300044735 Bacteria 2257
588 Ga0466970_0004968 3300044765 Bacteria 6570
589 Ga0466970_0099144 3300044765 Bacteria 1586
590 Ga0466957_0008884 3300044842 Bacteria 5725
591 Ga0466957_0195426 3300044842 Bacteria 1327
592 Ga0466957_0206052 3300044842 Bacteria 1293
593 Ga0466960_0329898 3300044901 Bacteria 866
594 Ga0466960_0374149 3300044901 Bacteria 816
595 Ga0466959_0005917 3300045049 Bacteria 8424
596 Ga0466959_0042510 3300045049 Bacteria 3352
597 Ga0466959_0075547 3300045049 Bacteria 2434
598 Ga0466959_0099323 3300045049 Bacteria 2084
599 Ga0466959_0296235 3300045049 Bacteria 1108
600 Ga0466959_0428104 3300045049 Bacteria 898
601 Ga0466958_0000048 3300045836 Bacteria 35635
602 Ga0466958_0021853 3300045836 Bacteria 3742
603 Ga0466958_0057198 3300045836 Bacteria 2370
604 Ga0466958_0093525 3300045836 Unclassified 1862
605 Ga0466958_0359931 3300045836 Bacteria 937
606 Ga0466967_0223964 3300045976 Bacteria 1788
607 Ga0466967_0291750 3300045976 Bacteria 1567
608 Ga0495627_000209 3300046453 Bacteria 63424
609 Ga0495590_0002168 3300046457 Bacteria 8231
610 Ga0495629_0418204 3300046459 Bacteria 910
611 Ga0495638_0000326 3300046460 Bacteria 60360
612 Ga0495638_0000434 3300046460 Bacteria 50529
613 Ga0495638_0005521 3300046460 Bacteria 9392
614 Ga0495638_0039729 3300046460 Bacteria 2985
615 Ga0495638_0048119 3300046460 Bacteria 2670
616 Ga0495638_0130212 3300046460 Bacteria 1478
617 Ga0495638_0291070 3300046460 Bacteria 883
618 Ga0495638_0293732 3300046460 Bacteria 878
619 Ga0495641_0159147 3300046461 Bacteria 1010
620 Ga0495651_0009405 3300046462 Bacteria 7507
621 Ga0495651_0022220 3300046462 Bacteria 4932
622 Ga0495650_0000069 3300046471 Bacteria 261124
623 Ga0495650_0031088 3300046471 Bacteria 2408
624 Ga0495650_0116783 3300046471 Bacteria 985
625 Ga0495580_0348313 3300046472 Bacteria 1004
626 Ga0495664_0277789 3300046477 Bacteria 1012
627 Ga0495585_0207160 3300046492 Bacteria 996
628 Ga0495594_0017602 3300046499 Bacteria 3778
629 Ga0495594_0134716 3300046499 Bacteria 1400
630 Ga0495607_0204649 3300046501 Bacteria 974
631 Ga0495583_0094892 3300046506 Bacteria 1280
632 Ga0495606_0016300 3300046507 Bacteria 5673
633 Ga0495606_0349636 3300046507 Bacteria 785
634 Ga0495610_0002007 3300046512 Bacteria 17407
635 Ga0495610_0004447 3300046512 Bacteria 10361
636 Ga0495610_0005291 3300046512 Bacteria 9230
637 Ga0495610_0017507 3300046512 Bacteria 4083
638 Ga0495616_0000115 3300046513 Bacteria 70371
639 Ga0495631_0001223 3300046518 Bacteria 15856
640 Ga0495631_0138305 3300046518 Bacteria 1046
641 Ga0495631_0164379 3300046518 Bacteria 952
642 Ga0495632_0012120 3300046519 Bacteria 4986
643 Ga0495643_0212575 3300046522 Bacteria 922
644 Ga0495643_0227646 3300046522 Bacteria 881
645 Ga0495648_0000165 3300046524 Bacteria 78462
646 Ga0495648_0053168 3300046524 Bacteria 2455
647 Ga0495648_0112343 3300046524 Bacteria 1480
648 Ga0495663_0025072 3300046525 Bacteria 1737
649 Ga0495654_0000024 3300046530 Bacteria 238195
650 Ga0495654_0012651 3300046530 Bacteria 4529
651 Ga0495645_0177873 3300046543 Bacteria 1460
652 Ga0495622_0005431 3300046557 Bacteria 5915
653 Ga0495668_0000456 3300046616 Bacteria 52300
654 Ga0495668_0015595 3300046616 Bacteria 4432
655 Ga0495668_0018797 3300046616 Bacteria 3993
656 Ga0495668_0023744 3300046616 Bacteria 3493
657 Ga0495668_0035943 3300046616 Bacteria 2777
658 Ga0495668_0074400 3300046616 Bacteria 1865
659 Ga0495668_0081140 3300046616 Bacteria 1780
660 Ga0495634_0326474 3300046642 Bacteria 923
661 Ga0495611_0182921 3300046648 Bacteria 979
662 Ga0495625_0000230 3300046660 Bacteria 88194
663 Ga0495625_0004316 3300046660 Bacteria 13502
664 Ga0495625_0006914 3300046660 Bacteria 10011
665 Ga0495625_0018507 3300046660 Bacteria 5436
666 Ga0495625_0039826 3300046660 Bacteria 3429
667 Ga0495625_0073657 3300046660 Bacteria 2393
668 Ga0495659_0131102 3300046664 Bacteria 994
669 Ga0495661_0012280 3300046665 Bacteria 5785
670 Ga0495588_0203650 3300046674 Bacteria 1045
671 Ga0495657_0046244 3300046675 Bacteria 2949
672 Ga0495599_0169263 3300046678 Bacteria 1348
673 Ga0495623_0012870 3300046679 Bacteria 5419
674 Ga0495613_0056042 3300046689 Bacteria 2895
675 Ga0495613_0144755 3300046689 Bacteria 1697
676 Ga0495670_0000029 3300046691 Bacteria 87662
677 Ga0495670_0012601 3300046691 Bacteria 4158
678 Ga0495671_0061171 3300046692 Bacteria 1858
679 Ga0495660_0132991 3300046810 Bacteria 1246
680 Ga0495581_0193504 3300047315 Bacteria 1190
681 Ga0495604_0105632 3300047317 Bacteria 2061
682 Ga0495604_0358796 3300047317 Bacteria 967
683 Ga0495672_0019609 3300047320 Bacteria 4457
684 Ga0495672_0145424 3300047320 Bacteria 1234
685 Ga0495677_0008628 3300047445 Bacteria 3784
686 Ga0495673_0000108 3300047469 Bacteria 168459
687 Ga0495673_0000344 3300047469 Bacteria 58803
688 Ga0495673_0003633 3300047469 Bacteria 10088
689 Ga0495686_0004056 3300047472 Bacteria 12228
690 Ga0495686_0011950 3300047472 Bacteria 6101
691 Ga0495686_0013762 3300047472 Bacteria 5605
692 Ga0495686_0036693 3300047472 Bacteria 3145
693 Ga0495686_0074651 3300047472 Bacteria 2080
694 Ga0495686_0132889 3300047472 Bacteria 1474
695 Ga0495686_0156744 3300047472 Bacteria 1333
696 Ga0495602_0194229 3300048088 Bacteria 1554
697 Ga0495626_0061575 3300048091 Bacteria 1706
698 Ga0496100_0306526 3300048903 Bacteria 1190
699 Ga0496100_0327012 3300048903 Bacteria 1153
700 Ga0496103_0174513 3300048906 Bacteria 1381
701 Ga0496104_0001606 3300048907 Bacteria 19467
702 Ga0496104_0001863 3300048907 Bacteria 18258
703 Ga0496105_0008691 3300048908 Bacteria 7902
704 Ga0496105_0443611 3300048908 Bacteria 1025
705 Ga0496106_0001358 3300048909 Bacteria 18318
706 Ga0496106_0044228 3300048909 Bacteria 3342
707 Ga0496106_0052530 3300048909 Bacteria 3075
708 Ga0496106_0736254 3300048909 Bacteria 784
709 Ga0496107_0006558 3300048910 Bacteria 8007
710 Ga0496107_0403907 3300048910 Bacteria 1016
711 Ga0496108_0204804 3300048911 Bacteria 1712
712 Ga0496108_0205223 3300048911 Bacteria 1710
713 Ga0496110_0113009 3300048913 Bacteria 2442
714 Ga0496110_0216548 3300048913 Bacteria 1741
715 Ga0496111_0294153 3300048914 Bacteria 1204
716 Ga0496111_0412806 3300048914 Bacteria 997
717 Ga0496112_0908806 3300048915 Bacteria 802
718 Ga0496113_0213646 3300048916 Bacteria 1536
719 Ga0496114_0281214 3300048917 Bacteria 1467
720 Ga0496114_0656583 3300048917 Bacteria 922
721 Ga0496115_0000921 3300048918 Bacteria 21326
722 Ga0496115_0001486 3300048918 Bacteria 16854
723 Ga0496115_0004981 3300048918 Bacteria 9641
724 Ga0496115_0020165 3300048918 Bacteria 5139
725 Ga0496115_0101425 3300048918 Bacteria 2360
726 Ga0496116_0000965 3300048919 Bacteria 35491
727 Ga0496116_0143291 3300048919 Bacteria 1340
728 Ga0496117_0013409 3300048920 Bacteria 7153
729 Ga0496117_0034522 3300048920 Bacteria 3809
730 Ga0496117_0105182 3300048920 Bacteria 1774
731 Ga0496117_0106166 3300048920 Bacteria 1763
732 Ga0496117_0144340 3300048920 Bacteria 1420
733 Ga0496117_0148732 3300048920 Bacteria 1390
734 Ga0496118_0003027 3300048921 Bacteria 21693
735 Ga0496118_0010242 3300048921 Bacteria 9306
736 Ga0496118_0020353 3300048921 Bacteria 5885
737 Ga0496118_0028559 3300048921 Bacteria 4695
738 Ga0496118_0039154 3300048921 Bacteria 3787
739 Ga0496118_0070052 3300048921 Bacteria 2535
740 Ga0496118_0084187 3300048921 Bacteria 2220
741 Ga0496118_0120085 3300048921 Bacteria 1716
742 Ga0496119_0024118 3300048922 Bacteria 4289
743 Ga0496119_0035437 3300048922 Bacteria 3270
744 Ga0496119_0051808 3300048922 Bacteria 2519
745 Ga0496119_0064646 3300048922 Bacteria 2171
746 Ga0496119_0119652 3300048922 Bacteria 1450
747 Ga0496121_0001622 3300048924 Bacteria 37285
748 Ga0496121_0007823 3300048924 Bacteria 12793
749 Ga0496121_0023791 3300048924 Bacteria 5882
750 Ga0496121_0028197 3300048924 Bacteria 5232
751 Ga0496121_0036329 3300048924 Bacteria 4392
752 Ga0496121_0126551 3300048924 Bacteria 1919
753 Ga0496121_0161432 3300048924 Bacteria 1638
754 Ga0496121_0208762 3300048924 Bacteria 1385
755 Ga0496121_0244912 3300048924 Bacteria 1247
756 Ga0496121_0289800 3300048924 Bacteria 1116
757 Ga0496121_0366225 3300048924 Bacteria 955
758 Ga0496122_0024545 3300048925 Bacteria 5272
759 Ga0496122_0036640 3300048925 Bacteria 3962
760 Ga0496122_0209236 3300048925 Bacteria 1132
761 Ga0496123_0022020 3300048926 Bacteria 4930
762 Ga0496123_0065829 3300048926 Bacteria 2299
763 Ga0496124_0002957 3300048927 Bacteria 21339
764 Ga0496124_0049091 3300048927 Bacteria 3602
765 Ga0496124_0095992 3300048927 Bacteria 2409
766 Ga0496124_0218398 3300048927 Bacteria 1436
767 Ga0496124_0231950 3300048927 Bacteria 1379
768 Ga0496124_0266812 3300048927 Bacteria 1256
769 Ga0496124_0469553 3300048927 Bacteria 853
770 Ga0496124_0526149 3300048927 Bacteria 786
771 Ga0496125_0001630 3300048928 Bacteria 31638
772 Ga0496125_0056184 3300048928 Bacteria 3199
773 Ga0496125_0083260 3300048928 Bacteria 2434
774 Ga0496125_0089991 3300048928 Bacteria 2306
775 Ga0496125_0095264 3300048928 Bacteria 2215
776 Ga0496125_0099406 3300048928 Bacteria 2149
777 Ga0496125_0137524 3300048928 Bacteria 1706
778 Ga0496125_0242362 3300048928 Bacteria 1144
779 Ga0496125_0281648 3300048928 Bacteria 1029
780 Ga0496125_0295403 3300048928 Bacteria 995
781 Ga0496126_0003803 3300048929 Bacteria 18741
782 Ga0496126_0028894 3300048929 Bacteria 5275
783 Ga0496126_0033555 3300048929 Bacteria 4827
784 Ga0496126_0070139 3300048929 Bacteria 3123
785 Ga0496126_0081503 3300048929 Bacteria 2860
786 Ga0496126_0104438 3300048929 Bacteria 2475
787 Ga0496126_0312538 3300048929 Bacteria 1293
788 Ga0496126_0373969 3300048929 Bacteria 1161
789 Ga0496126_0486006 3300048929 Bacteria 989
790 Ga0495678_003911 3300049459 Bacteria 8931
791 Ga0495682_0081120 3300049460 Bacteria 1167
792 Ga0495682_0131024 3300049460 Bacteria 897
793 Ga0501031_0003114 3300049568 Bacteria 10626
794 Ga0501031_0026710 3300049568 Bacteria 3763
795 Ga0501032_0000762 3300049569 Bacteria 26183
796 Ga0501032_0056815 3300049569 Bacteria 2630
797 Ga0501032_0071436 3300049569 Bacteria 2313
798 Ga0501033_0000136 3300049570 Bacteria 70952
799 Ga0501033_0026715 3300049570 Bacteria 4342
800 Ga0501033_0057089 3300049570 Bacteria 2886
801 Ga0501033_0098622 3300049570 Bacteria 2133
802 Ga0501033_0267830 3300049570 Bacteria 1208
803 Ga0501033_0336784 3300049570 Bacteria 1058
804 Ga0501034_0000251 3300049571 Bacteria 99406
805 Ga0501034_0008471 3300049571 Bacteria 10862
806 Ga0501034_0025849 3300049571 Bacteria 5980
807 Ga0501034_0099688 3300049571 Bacteria 2900
808 Ga0501034_0134299 3300049571 Bacteria 2456
809 Ga0501034_0146924 3300049571 Bacteria 2335
810 Ga0501036_0000036 3300049572 Bacteria 87244
811 Ga0501036_0095905 3300049572 Bacteria 2507
812 Ga0501036_0139078 3300049572 Bacteria 2049
813 Ga0501037_0000867 3300049573 Bacteria 22596
814 Ga0501037_0186696 3300049573 Bacteria 1469
815 Ga0501037_0190511 3300049573 Bacteria 1452
816 Ga0501038_0000428 3300049574 Bacteria 36623
817 Ga0501038_0036231 3300049574 Bacteria 4330
818 Ga0501038_0203480 3300049574 Bacteria 1588
819 Ga0501038_0223971 3300049574 Bacteria 1499
820 Ga0501038_0247921 3300049574 Bacteria 1412
821 Ga0501039_0000273 3300049575 Bacteria 37431
822 Ga0501039_0032382 3300049575 Bacteria 4030
823 Ga0501042_0170613 3300049578 Bacteria 1570
824 Ga0501043_0000165 3300049579 Bacteria 59980
825 Ga0501043_0027908 3300049579 Bacteria 4431
826 Ga0501043_0198896 3300049579 Bacteria 1556
827 Ga0501043_0205795 3300049579 Bacteria 1526
828 Ga0501043_0223047 3300049579 Bacteria 1457
829 Ga0501043_0289433 3300049579 Bacteria 1254
830 Ga0501043_0624811 3300049579 Bacteria 793
831 Ga0501046_0000839 3300049580 Bacteria 29959
832 Ga0501046_0516206 3300049580 Bacteria 854
833 Ga0501047_0000340 3300049581 Bacteria 53278
834 Ga0501047_0001905 3300049581 Bacteria 20058
835 Ga0501047_0003425 3300049581 Bacteria 14995
836 Ga0501047_0041364 3300049581 Bacteria 4454
837 Ga0501047_0458913 3300049581 Bacteria 1103
838 Ga0501048_0001309 3300049582 Bacteria 18872
839 Ga0501048_0046616 3300049582 Bacteria 3094
840 Ga0501067_0000457 3300049583 Bacteria 22383
841 Ga0501067_0087210 3300049583 Bacteria 1732
842 Ga0501067_0135039 3300049583 Bacteria 1373
843 Ga0501068_0000839 3300049584 Bacteria 15999
844 Ga0501068_0032662 3300049584 Bacteria 3095
845 Ga0501069_0032150 3300049585 Bacteria 2888
846 Ga0501069_0066434 3300049585 Bacteria 2017
847 Ga0501070_0000971 3300049586 Bacteria 25732
848 Ga0501070_0073648 3300049586 Bacteria 2826
849 Ga0501070_0577973 3300049586 Bacteria 897
850 Ga0501071_0079057 3300049587 Bacteria 2404
851 Ga0501072_0003301 3300049588 Bacteria 12139
852 Ga0501073_0000037 3300049589 Bacteria 87345
853 Ga0501073_0065517 3300049589 Bacteria 2533
854 Ga0501074_0000167 3300049590 Bacteria 35108
855 Ga0501074_0259375 3300049590 Bacteria 1236
856 Ga0501076_0191321 3300049592 Bacteria 1670
857 Ga0501079_0002302 3300049741 Bacteria 13814
858 Ga0501080_0006603 3300049742 Bacteria 10426
859 Ga0501080_0055199 3300049742 Bacteria 3700
860 Ga0501080_0080214 3300049742 Bacteria 3033
861 Ga0501080_0084313 3300049742 Bacteria 2952
862 Ga0501083_0001812 3300049744 Bacteria 14636
863 Ga0501083_0016896 3300049744 Bacteria 5097
864 Ga0501083_0042452 3300049744 Bacteria 3083
865 Ga0501241_006927 3300049758 Bacteria 2082
866 Ga0501035_0000142 3300049822 Bacteria 87561
867 Ga0501035_0006052 3300049822 Bacteria 11395
868 Ga0501035_0088777 3300049822 Bacteria 2723
869 Ga0501035_0185286 3300049822 Bacteria 1792
870 Ga0501035_0319208 3300049822 Bacteria 1305
871 Ga0501044_0000414 3300049823 Bacteria 52784
872 Ga0501044_0008740 3300049823 Bacteria 11085
873 Ga0501044_0013526 3300049823 Bacteria 8821
874 Ga0501044_0021563 3300049823 Bacteria 6869
875 Ga0501044_0022908 3300049823 Bacteria 6650
876 Ga0501044_0076769 3300049823 Bacteria 3389
877 Ga0501044_0083517 3300049823 Bacteria 3230
878 Ga0501044_0100473 3300049823 Bacteria 2911
879 Ga0501044_0286077 3300049823 Bacteria 1581
880 Ga0501044_0394898 3300049823 Bacteria 1296
881 Ga0501045_0002539 3300049824 Bacteria 12434
882 nmdc:mga03n38_180079_c1 3300050490 Bacteria 1082
883 nmdc:mga03n38_3129_c1 3300050490 Bacteria 5263
884 nmdc:mga00v17_26492_c1 3300050491 Bacteria 3380
885 nmdc:mga00v17_28827_c1 3300050491 Bacteria 3254
886 nmdc:mga00v17_51403_c1 3300050491 Bacteria 2506
887 nmdc:mga00v17_59417_c1 3300050491 Bacteria 2346
888 nmdc:mga00v17_69035_c1 3300050491 Bacteria 2186
889 nmdc:mga0yw44_179253_c1 3300050492 Bacteria 1394
890 nmdc:mga0yw44_23081_c1 3300050492 Bacteria 3501
891 nmdc:mga0yw44_341776_c1 3300050492 Bacteria 1007
892 nmdc:mga0yw44_4551_c1 3300050492 Bacteria 6383
893 nmdc:mga0yw44_50500_c1 3300050492 Bacteria 2515
894 nmdc:mga0yw44_7729_c1 3300050492 Bacteria 5309
895 nmdc:mga0yw44_84115_c1 3300050492 Bacteria 2000
896 nmdc:mga0k408_14464_c1 3300050493 Bacteria 4350
897 nmdc:mga0k408_199183_c1 3300050493 Bacteria 1195
898 nmdc:mga06z11_138892_c1 3300050494 Bacteria 1372
899 nmdc:mga06z11_4688_c1 3300050494 Bacteria 5399
900 nmdc:mga04h51_98496_c1 3300050495 Bacteria 1062
901 nmdc:mga07m45_32567_c1 3300050496 Bacteria 2890
902 nmdc:mga05p37_650235_c1 3300050507 Bacteria 1181
903 nmdc:mga0rr50_234301_c1 3300050513 Bacteria 1520
904 nmdc:mga08x19_86194_c1 3300050514 Bacteria 2067
905 nmdc:mga0sz30_2586_c1 3300050516 Bacteria 6435
906 nmdc:mga0sz30_4919_c1 3300050516 Bacteria 4868
907 nmdc:mga0sz30_51614_c1 3300050516 Bacteria 1745
908 nmdc:mga0sz30_75666_c1 3300050516 Bacteria 1453
909 Ga0495595_0087546 3300053084 Bacteria 1491
910 Ga0500578_0000056 3300053086 Bacteria 120189
911 Ga0500578_0113492 3300053086 Bacteria 1707
912 Ga0500578_0190611 3300053086 Bacteria 1259
913 Ga0500578_0193464 3300053086 Bacteria 1248
914 Ga0500578_0230005 3300053086 Bacteria 1124
915 Ga0500643_000048 3300053087 Bacteria 147879
916 Ga0500643_000548 3300053087 Bacteria 26252
917 Ga0500643_005672 3300053087 Bacteria 5335
918 Ga0500643_010845 3300053087 Bacteria 3365
919 Ga0500643_012763 3300053087 Bacteria 2996
920 Ga0500643_070398 3300053087 Bacteria 971
921 Ga0500644_0000089 3300053088 Bacteria 56897
922 Ga0500644_0028932 3300053088 Bacteria 1737
923 Ga0500644_0044232 3300053088 Bacteria 1494
924 Ga0500647_0093291 3300053091 Bacteria 1440
925 Ga0500647_0178970 3300053091 Bacteria 974
926 Ga0500583_0010766 3300053092 Bacteria 3412
927 Ga0500583_0060762 3300053092 Bacteria 1783
928 Ga0500651_0002004 3300053093 Bacteria 10570
929 Ga0500651_0002704 3300053093 Bacteria 9450
930 Ga0500651_0014869 3300053093 Bacteria 4768
931 Ga0500651_0215834 3300053093 Bacteria 1127
932 Ga0500566_0002605 3300053094 Bacteria 10733
933 Ga0500566_0003780 3300053094 Bacteria 9033
934 Ga0500566_0006460 3300053094 Bacteria 6955
935 Ga0500566_0075920 3300053094 Bacteria 1879
936 Ga0500641_0018004 3300053096 Bacteria 2652
937 Ga0500641_0023374 3300053096 Bacteria 2377
938 Ga0500641_0025472 3300053096 Bacteria 2289
939 Ga0500641_0032761 3300053096 Bacteria 2058
940 Ga0500641_0054141 3300053096 Bacteria 1658
941 Ga0500650_0025917 3300053098 Bacteria 2625
942 Ga0500554_041214 3300053102 Bacteria 1418
943 Ga0500555_027405 3300053103 Bacteria 1625
944 Ga0500556_0000003 3300053104 Bacteria 679379
945 Ga0500556_0001687 3300053104 Bacteria 8514
946 Ga0500562_000489 3300053108 Bacteria 9608
947 Ga0500562_006991 3300053108 Bacteria 2846
948 Ga0500562_016473 3300053108 Bacteria 1901
949 Ga0500562_027131 3300053108 Bacteria 1502
950 Ga0500594_0000724 3300053118 Bacteria 7016
951 Ga0500594_0086696 3300053118 Bacteria 944
952 Ga0500595_000333 3300053119 Bacteria 30925
953 Ga0500595_000497 3300053119 Bacteria 23997
954 Ga0500595_000553 3300053119 Bacteria 22382
955 Ga0500595_002282 3300053119 Bacteria 9644
956 Ga0500608_000207 3300053122 Bacteria 23415
957 Ga0500608_063928 3300053122 Bacteria 1756
958 Ga0500608_141759 3300053122 Bacteria 1064
959 Ga0500614_015345 3300053123 Bacteria 1707
960 Ga0500614_040520 3300053123 Bacteria 1182
961 Ga0500618_000034 3300053125 Bacteria 120560
962 Ga0500618_006607 3300053125 Bacteria 3387
963 Ga0500628_081385 3300053129 Bacteria 830
964 Ga0500642_0000015 3300053130 Bacteria 181424
965 Ga0500642_0001744 3300053130 Bacteria 6273
966 Ga0500642_0015152 3300053130 Bacteria 2890
967 Ga0500642_0133221 3300053130 Bacteria 1165
968 Ga0500642_0197676 3300053130 Bacteria 936
969 Ga0500652_010728 3300053131 Bacteria 3151
970 Ga0500652_011638 3300053131 Bacteria 3057
971 Ga0500652_083744 3300053131 Bacteria 1329
972 Ga0500655_000460 3300053133 Bacteria 8332
973 Ga0500658_0000793 3300053134 Bacteria 13099
974 Ga0500658_0001085 3300053134 Bacteria 11126
975 Ga0500658_0010451 3300053134 Bacteria 3424
976 Ga0500658_0031805 3300053134 Bacteria 2066
977 Ga0500658_0055776 3300053134 Bacteria 1628
978 Ga0500658_0165245 3300053134 Bacteria 1003
979 Ga0500559_0000112 3300053136 Bacteria 63817
980 Ga0500559_0001714 3300053136 Bacteria 12043
981 Ga0500559_0033232 3300053136 Bacteria 2220
982 Ga0500559_0081897 3300053136 Bacteria 1468
983 Ga0500559_0089806 3300053136 Bacteria 1405
984 Ga0500559_0147656 3300053136 Bacteria 1103
985 Ga0500564_000057 3300053138 Bacteria 29651
986 Ga0500564_150650 3300053138 Bacteria 992
987 Ga0500568_0000536 3300053139 Bacteria 27978
988 Ga0500568_0005756 3300053139 Bacteria 6345
989 Ga0500568_0016371 3300053139 Bacteria 3298
990 Ga0500568_0049176 3300053139 Bacteria 1665
991 Ga0500568_0077254 3300053139 Bacteria 1267
992 Ga0500568_0084110 3300053139 Bacteria 1205
993 Ga0500568_0084443 3300053139 Bacteria 1202
994 Ga0500568_0092354 3300053139 Bacteria 1141
995 Ga0500573_0067724 3300053140 Bacteria 2040
996 Ga0500586_000330 3300053145 Bacteria 9419
997 Ga0500588_0059114 3300053146 Bacteria 1222
998 Ga0500590_000163 3300053148 Bacteria 19391
999 Ga0500590_007211 3300053148 Bacteria 5474
1000 Ga0500590_031070 3300053148 Bacteria 2769
1001 Ga0500590_046959 3300053148 Bacteria 2206
1002 Ga0500603_014424 3300053150 Bacteria 1846
1003 Ga0500603_087833 3300053150 Bacteria 909
1004 Ga0500604_0053896 3300053151 Bacteria 1247
1005 Ga0500616_0000033 3300053153 Bacteria 398830
1006 Ga0500616_0001587 3300053153 Bacteria 21239
1007 Ga0500616_0030013 3300053153 Bacteria 2988
1008 Ga0500616_0118939 3300053153 Bacteria 1265
1009 Ga0500622_0001006 3300053156 Bacteria 23789
1010 Ga0500622_0001762 3300053156 Bacteria 16622
1011 Ga0500622_0006755 3300053156 Bacteria 6605
1012 Ga0500622_0017921 3300053156 Bacteria 3767
1013 Ga0500622_0023088 3300053156 Bacteria 3296
1014 Ga0500622_0026896 3300053156 Bacteria 3033
1015 Ga0500622_0141881 3300053156 Bacteria 1145
1016 Ga0500627_0043782 3300053158 Bacteria 1931
1017 Ga0500627_0081653 3300053158 Bacteria 1441
1018 Ga0500638_016198 3300053162 Bacteria 3434
1019 Ga0500639_060191 3300053163 Bacteria 1958
1020 Ga0500636_0015308 3300053177 Bacteria 4519
1021 Ga0500636_0040450 3300053177 Bacteria 2757
1022 Ga0500637_0000060 3300053178 Bacteria 38881
1023 Ga0500570_004099 3300053724 Bacteria 7619
1024 Ga0500570_077593 3300053724 Bacteria 1515
1025 Ga0500611_021920 3300053727 Bacteria 1225
1026 Ga0500611_027584 3300053727 Bacteria 1145
1027 Ga0500645_000883 3300053730 Bacteria 17431
1028 Ga0500645_029154 3300053730 Bacteria 1667
1029 Ga0500645_064013 3300053730 Bacteria 1061
1030 Ga0500609_000027 3300053731 Bacteria 21239
1031 Ga0500609_002135 3300053731 Bacteria 2832
1032 Ga0500596_001647 3300053735 Bacteria 4511
1033 Ga0500599_002351 3300053736 Bacteria 2264
1034 Ga0501084_0005116 3300054114 Bacteria 10737
1035 Ga0501084_0254685 3300054114 Bacteria 1482
1036 Ga0500661_001013 3300055283 Bacteria 5278
1037 Ga0501082_0004333 3300060353 Bacteria 12407
1038 Ga0501082_0098486 3300060353 Bacteria 2528
1039 Ga0466962_0001247 3300061719 Bacteria 11734
1040 2509151565 2508501128 Bacteria 8613869
1041 2511124191 2510917020 Bacteria 5657507
1042 2513891646 2513237141 Bacteria 8496279
1043 2517105700 2517093001 Bacteria 9002274
1044 2524435444 2524023205 Bacteria 8918781
1045 2585147145 2582581279 Bacteria 4980720
1046 2585150853 2582581280 Bacteria 5994497
1047 2585195825 2582581293 Bacteria 5907401
1048 2585259718 2582581305 Bacteria 4895574
1049 2587918018 2585428106 Bacteria 5179711
1050 2603860096 2602042107 Bacteria 6226103
1051 2643748399 2643221545 Bacteria 5083237
1052 2643780674 2643221552 Bacteria 5708754
1053 2643923880 2643221583 Bacteria 5218014
1054 2643929447 2643221584 Bacteria 5511711
1055 2643998673 2643221598 Bacteria 4578346
1056 2644087375 2643221614 Bacteria 4260023
1057 2644125726 2643221622 Bacteria 4212502
1058 2644224552 2643221640 Bacteria 5258820
1059 2644234513 2643221642 Bacteria 5357871
1060 2644344581 2643221661 Bacteria 4267604
1061 2644366735 2643221666 Bacteria 4265935
1062 2644508212 2643221691 Bacteria 5093099
1063 2745081392 2744054633 Bacteria 8678936
1064 2792458916 2791355048 Bacteria 5832535
1065 2819538598 2818991435 Bacteria 5433759
1066 2819646868 2818991454 Bacteria 5563326
1067 2824706075 2824704595 Bacteria 9667483
1068 2824760292 2824753945 Bacteria 9787441
1069 2824771531 2824763712 Bacteria 9792355
1070 2824775749 2824773399 Bacteria 8360218
1071 2841965297 2841957949 Bacteria 8652217
1072 2842044359 2842038055 Bacteria 8002051
1073 2842051652 2842045827 Bacteria 8006841
1074 2843749072 2843744320 Bacteria 5659202
1075 2849564398 2849560528 Bacteria 5393480
1076 2849575270 2849573788 Bacteria 5421256
1077 2851155526 2851153111 Bacteria 5542585
1078 2857504811 2857504554 Bacteria 5369913
1079 2857525079 2857524615 Bacteria 6615449
1080 2874622434 2874620515 Bacteria 8290088
1081 2876761700 2876761206 Bacteria 10111113
1082 2884965359 2884960567 Bacteria 5437054
1083 2893069665 2893066018 Bacteria 6158120
1084 2898330873 2898329390 Bacteria 5168154
1085 2904671559 2904666416 Bacteria 8226587
1086 2904718102 2904711408 Bacteria 9771557
1087 2919078967 2919073203 Bacteria 6531949
1088 2928532858 2928531327 Bacteria 5101314
1089 8006928840 8006926726 Bacteria 6749210
1090 8016526936 8016522445 Bacteria 8156687
1091 8016532020 8016530956 Bacteria 8155261
1092 8016556858 8016548790 Bacteria 8155074
1093 8016565211 8016557553 Bacteria 8154380
1094 8016582856 8016575299 Bacteria 8154085
1095 8016602854 8016595262 Bacteria 8149947
1096 8019531837 8019530166 Bacteria 8155624
1097 Ga0495583_0000001
1098 ARCol0yngRDRAFT_1002743
1099 JGI24739J22299_10082974
1100 JGI24737J22298_10001157
1101 JGI24737J22298_10002048
1102 JGI24737J22298_10006756
1103 JGI24735J21928_10004802
1104 JGI24735J21928_10011300
1105 JGI24735J21928_10017522
1106 JGI24735J21928_10031649
1107 JGI24744J21845_10010918
1108 JGI25150J39212_1001113
1109 JGI25406J46586_10000513
1110 JGI25165J46597_1000007
1111 JGI25165J46597_1000165
1112 JGI25153J46596_10000103
1113 JGI25153J46596_10000253
1114 JGI25153J46596_10000301
1115 rootL2_10056079
1116 rootL2_10085247
1117 rootL2_10136953
1118 JGI25160J50197_1002871
1119 Ga0055526_1002472
1120 Ga0055526_1023389
1121 Ga0055526_1030086
1122 Ga0055526_1046549
1123 Ga0055537_1000720
1124 Ga0055537_1001200
1125 Ga0055537_1005264
1126 Ga0055524_1000561
1127 Ga0055524_1010000
1128 Ga0055524_1051165
1129 Ga0055536_1000883
1130 Ga0055536_1001272
1131 Ga0055528_1007152
1132 Ga0055530_10001417
1133 Ga0055530_10007674
1134 Ga0055530_10034337
1135 Ga0055540_1003607
1136 Ga0055531_10000274
1137 Ga0055531_10001047
1138 Ga0055531_10005338
1139 Ga0055531_10022251
1140 Ga0055531_10036703
1141 Ga0055543_1020464
1142 Ga0065165_1000256
1143 Ga0065165_1001164
1144 Ga0065165_1001167
1145 Ga0065165_1004950
1146 Ga0065165_1032813
1147 Ga0065165_1058454
1148 Ga0070658_10004018
1149 Ga0070658_10004565
1150 Ga0070658_10212129
1151 Ga0070676_10000416
1152 Ga0070670_100205126
1153 Ga0068869_100015254
1154 Ga0070666_10186306
1155 Ga0070680_100017794
1156 Ga0070682_100202918
1157 Ga0070682_100208451
1158 Ga0068868_100000013
1159 Ga0068868_100667725
1160 Ga0070660_100002444
1161 Ga0070660_100003692
1162 Ga0070660_100019488
1163 Ga0070660_100033044
1164 Ga0070660_100204054
1165 Ga0070660_100625404
1166 Ga0070661_100097802
1167 Ga0070661_100188955
1168 Ga0070668_100019990
1169 Ga0070669_100765504
1170 Ga0070675_100134826
1171 Ga0070671_100067672
1172 Ga0070673_100000002
1173 Ga0070673_100334229
1174 Ga0070659_100003649
1175 Ga0070659_100036509
1176 Ga0070659_100077774
1177 Ga0070659_100148389
1178 Ga0070709_10003406
1179 Ga0070709_10020120
1180 Ga0070709_10045772
1181 Ga0070714_100226508
1182 Ga0070713_100010463
1183 Ga0070713_100071899
1184 Ga0070713_100222146
1185 Ga0070713_100287196
1186 Ga0070710_10025371
1187 Ga0070711_100001130
1188 Ga0070711_100002277
1189 Ga0070711_100452971
1190 Ga0070663_100572479
1191 Ga0070678_100010460
1192 Ga0070662_100159029
1193 Ga0070681_10006411
1194 Ga0070681_10049606
1195 Ga0070681_10087304
1196 Ga0068867_100000012
1197 Ga0068867_100276620
1198 Ga0070706_100052063
1199 Ga0070707_100092451
1200 Ga0070679_100117260
1201 Ga0070684_100001671
1202 Ga0070697_100118434
1203 Ga0068853_100009612
1204 Ga0068853_100041194
1205 Ga0068853_100470288
1206 Ga0070693_100020120
1207 Ga0070665_100001299
1208 Ga0070665_100154706
1209 Ga0070665_100174582
1210 Ga0070665_100203709
1211 Ga0070665_100535622
1212 Ga0068855_100000095
1213 Ga0068855_100071449
1214 Ga0068855_100298678
1215 Ga0068855_100498496
1216 Ga0068857_100013087
1217 Ga0068857_100021147
1218 Ga0068857_100163281
1219 Ga0068856_100000137
1220 Ga0068856_100016744
1221 Ga0068856_100345247
1222 Ga0068852_100000586
1223 Ga0068852_100088449
1224 Ga0068859_100005156
1225 Ga0068864_100007001
1226 Ga0068866_10071782
1227 Ga0068861_100207079
1228 Ga0068851_10024349
1229 Ga0068863_100025840
1230 Ga0068863_100359835
1231 Ga0068858_100000771
1232 Ga0068858_100009417
1233 Ga0068858_100242087
1234 Ga0068860_100000313
1235 Ga0068860_101020018
1236 Ga0068862_100015180
1237 Ga0068862_100015872
1238 Ga0081455_10002424
1239 Ga0081455_10017304
1240 Ga0081540_1024929
1241 Ga0081540_1028527
1242 Ga0081540_1059623
1243 Ga0081540_1072041
1244 Ga0081540_1142003
1245 Ga0081539_10000801
1246 Ga0081539_10073132
1247 Ga0075365_10036163
1248 Ga0075365_10055263
1249 Ga0075365_10164151
1250 Ga0075365_10238357
1251 Ga0075368_10003536
1252 Ga0075363_100004455
1253 Ga0075364_10012640
1254 Ga0075364_10077984
1255 Ga0075364_10520688
1256 Ga0070712_100009825
1257 Ga0075362_10021637
1258 Ga0075367_10020984
1259 Ga0075367_10037363
1260 Ga0075367_10039353
1261 Ga0075369_10004680
1262 Ga0075369_10005108
1263 Ga0075369_10009026
1264 Ga0075369_10106555
1265 Ga0075369_10120009
1266 Ga0075369_10238000
1267 Ga0075366_10008146
1268 Ga0075366_10086221
1269 Ga0075366_10161131
1270 Ga0097621_100061585
1271 Ga0097621_100144761
1272 Ga0097621_100872561
1273 Ga0075370_10130135
1274 Ga0075370_10169650
1275 Ga0075370_10297882
1276 Ga0075428_100150741
1277 Ga0075434_100023401
1278 Ga0068865_100000004
1279 Ga0068865_100480280
1280 Ga0097620_100005156
1281 Ga0075435_100411755
1282 Ga0099794_10061546
1283 Ga0099795_10001129
1284 Ga0099795_10005962
1285 Ga0099795_10067502
1286 Ga0105240_10002463
1287 Ga0105240_10033307
1288 Ga0105240_10064674
1289 Ga0105240_10071475
1290 Ga0105240_10086052
1291 Ga0105240_10298611
1292 Ga0105240_10323474
1293 Ga0105245_10001027
1294 Ga0105245_10003725
1295 Ga0105245_11027269
1296 Ga0105247_10043425
1297 Ga0105247_10503386
1298 Ga0114129_10054829
1299 Ga0105243_10000146
1300 Ga0105242_10000497
1301 Ga0105248_10001758
1302 Ga0105248_10007949
1303 Ga0105248_10042051
1304 Ga0105248_10047211
1305 Ga0105248_10347630
1306 Ga0105237_10052574
1307 Ga0105237_10053748
1308 Ga0105237_10054084
1309 Ga0105237_10133176
1310 Ga0105238_10006268
1311 Ga0105238_10022426
1312 Ga0105238_10225558
1313 Ga0105249_10015630
1314 Ga0105249_10157228
1315 Ga0105249_10179246
1316 Ga0099796_10012567
1317 Ga0105239_10017503
1318 Ga0105239_10216274
1319 Ga0105239_10851949
1320 Ga0105246_10000138
1321 Ga0157327_1000745
1322 Ga0157373_10079649
1323 Ga0157370_10000096
1324 Ga0157370_10274931
1325 Ga0157369_10018692
1326 Ga0157369_10022918
1327 Ga0157369_10053822
1328 Ga0157374_10001104
1329 Ga0157378_10015726
1330 Ga0157378_10091415
1331 Ga0163162_10004509
1332 Ga0163162_10026231
1333 Ga0163162_11080978
1334 Ga0157372_10034063
1335 Ga0157372_10067956
1336 Ga0157372_10294884
1337 Ga0157372_10559346
1338 Ga0157375_10000587
1339 Ga0163163_10018900
1340 Ga0163163_10089709
1341 Ga0163163_10557376
1342 Ga0157380_10122751
1343 Ga0157380_10532302
1344 Ga0182008_10154201
1345 Ga0157379_10014381
1346 Ga0157379_10027684
1347 Ga0157379_10033261
1348 Ga0157379_10067957
1349 Ga0157379_10199431
1350 Ga0157376_10000131
1351 Ga0163161_10056570
1352 Ga0213872_10070428
1353 Ga0213876_10000345
1354 Ga0213876_10038689
1355 Ga0209436_112907
1356 Ga0209437_106743
1357 Ga0207425_1000094
1358 Ga0207425_1001939
1359 Ga0209026_1001831
1360 Ga0209677_102422
1361 Ga0209148_1000074
1362 Ga0209148_1001194
1363 Ga0209129_1001201
1364 Ga0209233_1000026
1365 Ga0209233_1000098
1366 Ga0209233_1002344
1367 Ga0209565_1000007
1368 Ga0209565_1000618
1369 Ga0209565_1038534
1370 Ga0209455_1000574
1371 Ga0209455_1002785
1372 Ga0209455_1013949
1373 Ga0209455_1016958
1374 Ga0209455_1036672
1375 Ga0209673_1000722
1376 Ga0209673_1001309
1377 Ga0209673_1016536
1378 Ga0209673_1027785
1379 Ga0209676_1000243
1380 Ga0209676_1000311
1381 Ga0209676_1004805
1382 Ga0209025_1000630
1383 Ga0209564_1000713
1384 Ga0209564_1000718
1385 Ga0209564_1000745
1386 Ga0209564_1003160
1387 Ga0209564_1006871
1388 Ga0209564_1008096
1389 Ga0209564_1009741
1390 Ga0209564_1032344
1391 Ga0209758_1000002
1392 Ga0209758_1000015
1393 Ga0209758_1000108
1394 Ga0209758_1000239
1395 Ga0209758_1000252
1396 Ga0209758_1001566
1397 Ga0209758_1001570
1398 Ga0209758_1004632
1399 Ga0209758_1006280
1400 Ga0209758_1006552
1401 Ga0209758_1021049
1402 Ga0209758_1022902
1403 Ga0209758_1026731
1404 Ga0209758_1028026
1405 Ga0209050_1000244
1406 Ga0209050_1000342
1407 Ga0209050_1000375
1408 Ga0209050_1005517
1409 Ga0209050_1011876
1410 Ga0209050_1014540
1411 Ga0209256_1000008
1412 Ga0209256_1001119
1413 Ga0209256_1002155
1414 Ga0209256_1002592
1415 Ga0209256_1008041
1416 Ga0209256_1010559
1417 Ga0207426_1000217
1418 Ga0207426_1000368
1419 Ga0207426_1016643
1420 Ga0209051_1000226
1421 Ga0209051_1003593
1422 Ga0209257_1000066
1423 Ga0209257_1000140
1424 Ga0209257_1001119
1425 Ga0209257_1002989
1426 Ga0209257_1003585
1427 Ga0209257_1004459
1428 Ga0209257_1017346
1429 Ga0209257_1019253
1430 Ga0209257_1023078
1431 Ga0207692_10092668
1432 Ga0207642_10150907
1433 Ga0207680_10208528
1434 Ga0207647_10025784
1435 Ga0207647_10152771
1436 Ga0207647_10359411
1437 Ga0207699_10019120
1438 Ga0207699_10032628
1439 Ga0207699_10062902
1440 Ga0207645_10004384
1441 Ga0207705_10000055
1442 Ga0207705_10007178
1443 Ga0207684_10047574
1444 Ga0207654_10496656
1445 Ga0207707_10000143
1446 Ga0207707_10014431
1447 Ga0207695_10004557
1448 Ga0207695_10005778
1449 Ga0207695_10029272
1450 Ga0207695_10525076
1451 Ga0207671_10029351
1452 Ga0207671_10061198
1453 Ga0207671_10144019
1454 Ga0207671_10178948
1455 Ga0207693_10054355
1456 Ga0207693_10166544
1457 Ga0207663_10052117
1458 Ga0207660_10007904
1459 Ga0207660_10274141
1460 Ga0207657_10004951
1461 Ga0207657_10005482
1462 Ga0207657_10013332
1463 Ga0207657_10139147
1464 Ga0207652_10024703
1465 Ga0207646_10065090
1466 Ga0207694_10029840
1467 Ga0207694_10049968
1468 Ga0207694_10050027
1469 Ga0207694_10067102
1470 Ga0207659_10015289
1471 Ga0207659_10232512
1472 Ga0207659_10510357
1473 Ga0207687_10000755
1474 Ga0207687_10089008
1475 Ga0207687_10201791
1476 Ga0207700_10034094
1477 Ga0207700_10110658
1478 Ga0207700_10197737
1479 Ga0207700_10227682
1480 Ga0207690_10004570
1481 Ga0207690_10036500
1482 Ga0207690_10401104
1483 Ga0207706_10010431
1484 Ga0207686_10067444
1485 Ga0207709_10000314
1486 Ga0207704_10000005
1487 Ga0207711_10000852
1488 Ga0207711_10004629
1489 Ga0207711_10176891
1490 Ga0207689_10001653
1491 Ga0207679_10256115
1492 Ga0207667_10000016
1493 Ga0207667_10020014
1494 Ga0207667_10079777
1495 Ga0207651_10000007
1496 Ga0207712_10007902
1497 Ga0207712_10088953
1498 Ga0207712_10234109
1499 Ga0207668_10436882
1500 Ga0207677_10000085
1501 Ga0207703_10001689
1502 Ga0207703_10006205
1503 Ga0207703_10224453
1504 Ga0207639_10038697
1505 Ga0207639_10255690
1506 Ga0207639_10286758
1507 Ga0207678_10049937
1508 Ga0207678_10746243
1509 Ga0207702_10000063
1510 Ga0207702_10005342
1511 Ga0207702_10423659
1512 Ga0207641_10028640
1513 Ga0207641_10341334
1514 Ga0207641_10389758
1515 Ga0207641_10518373
1516 Ga0207648_10000005
1517 Ga0207676_10001553
1518 Ga0207676_10159444
1519 Ga0207676_10369365
1520 Ga0207674_10000989
1521 Ga0207674_10017443
1522 Ga0207674_10018135
1523 Ga0207674_10484544
1524 Ga0207675_100343902
1525 Ga0207675_100537927
1526 Ga0207683_10149323
1527 Ga0207698_10000294
1528 Ga0207698_10033871
1529 Ga0207698_10264407
1530 Ga0207428_10207164
1531 Ga0268266_10000003
1532 Ga0268266_10126859
1533 Ga0268266_10154418
1534 Ga0268266_10166098
1535 Ga0268266_10235109
1536 Ga0268266_10545318
1537 Ga0268265_10023564
1538 Ga0268265_10036215
1539 Ga0268265_10453740
1540 Ga0268264_10000356
1541 Ga0307517_10176599
1542 Ga0307515_10033355
1543 Ga0307511_10034380
1544 Ga0307512_10191584
1545 Ga0265330_10010731
1546 Ga0265330_10063434
1547 Ga0265332_10151694
1548 Ga0265320_10001345
1549 Ga0265340_10016299
1550 Ga0265340_10186514
1551 Ga0265331_10032239
1552 Ga0265316_10045394
1553 Ga0307513_10079397
1554 Ga0307513_10270222
1555 Ga0307513_10306911
1556 Ga0307509_10192327
1557 Ga0307509_10541234
1558 Ga0307408_100064798
1559 Ga0307508_10001949
1560 Ga0307508_10262591
1561 Ga0265314_10071962
1562 Ga0265314_10073784
1563 Ga0265342_10003269
1564 Ga0265342_10028180
1565 Ga0265342_10089269
1566 Ga0265342_10122932
1567 Ga0307516_10000034
1568 Ga0307516_10005305
1569 Ga0307516_10126728
1570 Ga0307405_10414785
1571 Ga0307412_10355937
1572 Ga0307412_10421289
1573 Ga0307414_10021121
1574 Ga0307414_10197404
1575 Ga0307510_10103437
1576 Ga0307510_10129319
1577 Ga0307510_10167278
1578 Ga0373934_0135557
1579 Ga0373944_0080706
1580 Ga0373923_0182533
1581 Ga0373936_0086972
1582 Ga0373936_0187711
1583 Ga0373955_0449417
1584 Ga0373935_0005959
1585 Ga0373927_0002991
1586 Ga0373927_0014399
1587 Ga0373927_0049450
1588 Ga0373933_0285329
1589 Ga0373947_0040983
1590 Ga0373937_0047940
1591 Ga0310112_010758
1592 Ga0373925_0034633
1593 Ga0373925_0317917
1594 Ga0373925_0352501
1595 Ga0395899_0000026
1596 Ga0395899_0000713
1597 Ga0395899_0098311
1598 Ga0395899_0510502
1599 Ga0395900_0025660
1600 Ga0395900_0200106
1601 Ga0395898_0058714
1602 Ga0395898_0204761
1603 Ga0395898_0289869
1604 Ga0395898_0443901
1605 Ga0395905_0012102
1606 Ga0395905_0034469
1607 Ga0395905_0050916
1608 Ga0395905_0061355
1609 Ga0395905_0070375
1610 Ga0395905_0078733
1611 Ga0395905_0410047
1612 Ga0395905_0876355
1613 Ga0395901_0029430
1614 Ga0395901_0029978
1615 Ga0395901_0104792
1616 Ga0395901_0192446
1617 Ga0395901_0395262
1618 Ga0395901_0418805
1619 Ga0395901_0688279
1620 Ga0395901_0794163
1621 Ga0436365_0140106
1622 Ga0436365_0449154
1623 Ga0436365_0503144
1624 Ga0436365_0916510
1625 Ga0436365_1541345
1626 Ga0436365_1602753
1627 Ga0436360_0479997
1628 Ga0436360_0795172
1629 Ga0436361_0108203
1630 Ga0436361_0186477
1631 Ga0436361_0238923
1632 Ga0436361_0261403
1633 Ga0436361_0546846
1634 Ga0436361_0681592
1635 Ga0436361_0843361
1636 Ga0436363_0168726
1637 Ga0436363_0599359
1638 Ga0436363_0885771
1639 Ga0439436_0018407
1640 Ga0439461_0035617
1641 Ga0439465_0006377
1642 Ga0439431_0000187
1643 Ga0439431_0010651
1644 Ga0439442_002393
1645 Ga0439445_0000562
1646 Ga0439445_0069288
1647 Ga0439448_0002340
1648 Ga0439448_0024185
1649 Ga0439432_003177
1650 Ga0439449_0053381
1651 Ga0439452_021467
1652 Ga0439455_0007335
1653 Ga0439455_0008361
1654 Ga0439455_0059366
1655 Ga0439455_0071768
1656 Ga0439455_0102985
1657 Ga0439457_001532
1658 Ga0450919_010306
1659 Ga0450923_017278
1660 Ga0450898_035919
1661 Ga0450910_010396
1662 Ga0439446_0002031
1663 Ga0439458_0000986
1664 Ga0439458_0001013
1665 Ga0439458_0001992
1666 Ga0439434_0002604
1667 Ga0439435_0012758
1668 Ga0466972_0010990
1669 Ga0466965_0031586
1670 Ga0466966_0034352
1671 Ga0466966_0058072
1672 Ga0466966_0058718
1673 Ga0466966_0138559
1674 Ga0466961_0011581
1675 Ga0466963_0037193
1676 Ga0466963_0049597
1677 Ga0466963_0101375
1678 Ga0466964_0013581
1679 Ga0466964_0085777
1680 Ga0466971_0024553
1681 Ga0466971_0062460
1682 Ga0466968_0025710
1683 Ga0466968_0029848
1684 Ga0466970_0004968
1685 Ga0466970_0099144
1686 Ga0466957_0008884
1687 Ga0466957_0195426
1688 Ga0466957_0206052
1689 Ga0466960_0329898
1690 Ga0466960_0374149
1691 Ga0466959_0005917
1692 Ga0466959_0042510
1693 Ga0466959_0075547
1694 Ga0466959_0099323
1695 Ga0466959_0296235
1696 Ga0466959_0428104
1697 Ga0466958_0000048
1698 Ga0466958_0021853
1699 Ga0466958_0057198
1700 Ga0466958_0093525
1701 Ga0466958_0359931
1702 Ga0466967_0223964
1703 Ga0466967_0291750
1704 Ga0495627_000209
1705 Ga0495590_0002168
1706 Ga0495629_0418204
1707 Ga0495638_0000326
1708 Ga0495638_0000434
1709 Ga0495638_0005521
1710 Ga0495638_0039729
1711 Ga0495638_0048119
1712 Ga0495638_0130212
1713 Ga0495638_0291070
1714 Ga0495638_0293732
1715 Ga0495641_0159147
1716 Ga0495651_0009405
1717 Ga0495651_0022220
1718 Ga0495650_0000069
1719 Ga0495650_0031088
1720 Ga0495650_0116783
1721 Ga0495580_0348313
1722 Ga0495664_0277789
1723 Ga0495585_0207160
1724 Ga0495594_0017602
1725 Ga0495594_0134716
1726 Ga0495607_0204649
1727 Ga0495583_0094892
1728 Ga0495606_0016300
1729 Ga0495606_0349636
1730 Ga0495610_0002007
1731 Ga0495610_0004447
1732 Ga0495610_0005291
1733 Ga0495610_0017507
1734 Ga0495616_0000115
1735 Ga0495631_0001223
1736 Ga0495631_0138305
1737 Ga0495631_0164379
1738 Ga0495632_0012120
1739 Ga0495643_0212575
1740 Ga0495643_0227646
1741 Ga0495648_0000165
1742 Ga0495648_0053168
1743 Ga0495648_0112343
1744 Ga0495663_0025072
1745 Ga0495654_0000024
1746 Ga0495654_0012651
1747 Ga0495645_0177873
1748 Ga0495622_0005431
1749 Ga0495668_0000456
1750 Ga0495668_0015595
1751 Ga0495668_0018797
1752 Ga0495668_0023744
1753 Ga0495668_0035943
1754 Ga0495668_0074400
1755 Ga0495668_0081140
1756 Ga0495634_0326474
1757 Ga0495611_0182921
1758 Ga0495625_0000230
1759 Ga0495625_0004316
1760 Ga0495625_0006914
1761 Ga0495625_0018507
1762 Ga0495625_0039826
1763 Ga0495625_0073657
1764 Ga0495659_0131102
1765 Ga0495661_0012280
1766 Ga0495588_0203650
1767 Ga0495657_0046244
1768 Ga0495599_0169263
1769 Ga0495623_0012870
1770 Ga0495613_0056042
1771 Ga0495613_0144755
1772 Ga0495670_0000029
1773 Ga0495670_0012601
1774 Ga0495671_0061171
1775 Ga0495660_0132991
1776 Ga0495581_0193504
1777 Ga0495604_0105632
1778 Ga0495604_0358796
1779 Ga0495672_0019609
1780 Ga0495672_0145424
1781 Ga0495677_0008628
1782 Ga0495673_0000108
1783 Ga0495673_0000344
1784 Ga0495673_0003633
1785 Ga0495686_0004056
1786 Ga0495686_0011950
1787 Ga0495686_0013762
1788 Ga0495686_0036693
1789 Ga0495686_0074651
1790 Ga0495686_0132889
1791 Ga0495686_0156744
1792 Ga0495602_0194229
1793 Ga0495626_0061575
1794 Ga0496100_0306526
1795 Ga0496100_0327012
1796 Ga0496103_0174513
1797 Ga0496104_0001606
1798 Ga0496104_0001863
1799 Ga0496105_0008691
1800 Ga0496105_0443611
1801 Ga0496106_0001358
1802 Ga0496106_0044228
1803 Ga0496106_0052530
1804 Ga0496106_0736254
1805 Ga0496107_0006558
1806 Ga0496107_0403907
1807 Ga0496108_0204804
1808 Ga0496108_0205223
1809 Ga0496110_0113009
1810 Ga0496110_0216548
1811 Ga0496111_0294153
1812 Ga0496111_0412806
1813 Ga0496112_0908806
1814 Ga0496113_0213646
1815 Ga0496114_0281214
1816 Ga0496114_0656583
1817 Ga0496115_0000921
1818 Ga0496115_0001486
1819 Ga0496115_0004981
1820 Ga0496115_0020165
1821 Ga0496115_0101425
1822 Ga0496116_0000965
1823 Ga0496116_0143291
1824 Ga0496117_0013409
1825 Ga0496117_0034522
1826 Ga0496117_0105182
1827 Ga0496117_0106166
1828 Ga0496117_0144340
1829 Ga0496117_0148732
1830 Ga0496118_0003027
1831 Ga0496118_0010242
1832 Ga0496118_0020353
1833 Ga0496118_0028559
1834 Ga0496118_0039154
1835 Ga0496118_0070052
1836 Ga0496118_0084187
1837 Ga0496118_0120085
1838 Ga0496119_0024118
1839 Ga0496119_0035437
1840 Ga0496119_0051808
1841 Ga0496119_0064646
1842 Ga0496119_0119652
1843 Ga0496121_0001622
1844 Ga0496121_0007823
1845 Ga0496121_0023791
1846 Ga0496121_0028197
1847 Ga0496121_0036329
1848 Ga0496121_0126551
1849 Ga0496121_0161432
1850 Ga0496121_0208762
1851 Ga0496121_0244912
1852 Ga0496121_0289800
1853 Ga0496121_0366225
1854 Ga0496122_0024545
1855 Ga0496122_0036640
1856 Ga0496122_0209236
1857 Ga0496123_0022020
1858 Ga0496123_0065829
1859 Ga0496124_0002957
1860 Ga0496124_0049091
1861 Ga0496124_0095992
1862 Ga0496124_0218398
1863 Ga0496124_0231950
1864 Ga0496124_0266812
1865 Ga0496124_0469553
1866 Ga0496124_0526149
1867 Ga0496125_0001630
1868 Ga0496125_0056184
1869 Ga0496125_0083260
1870 Ga0496125_0089991
1871 Ga0496125_0095264
1872 Ga0496125_0099406
1873 Ga0496125_0137524
1874 Ga0496125_0242362
1875 Ga0496125_0281648
1876 Ga0496125_0295403
1877 Ga0496126_0003803
1878 Ga0496126_0028894
1879 Ga0496126_0033555
1880 Ga0496126_0070139
1881 Ga0496126_0081503
1882 Ga0496126_0104438
1883 Ga0496126_0312538
1884 Ga0496126_0373969
1885 Ga0496126_0486006
1886 Ga0495678_003911
1887 Ga0495682_0081120
1888 Ga0495682_0131024
1889 Ga0501031_0003114
1890 Ga0501031_0026710
1891 Ga0501032_0000762
1892 Ga0501032_0056815
1893 Ga0501032_0071436
1894 Ga0501033_0000136
1895 Ga0501033_0026715
1896 Ga0501033_0057089
1897 Ga0501033_0098622
1898 Ga0501033_0267830
1899 Ga0501033_0336784
1900 Ga0501034_0000251
1901 Ga0501034_0008471
1902 Ga0501034_0025849
1903 Ga0501034_0099688
1904 Ga0501034_0134299
1905 Ga0501034_0146924
1906 Ga0501036_0000036
1907 Ga0501036_0095905
1908 Ga0501036_0139078
1909 Ga0501037_0000867
1910 Ga0501037_0186696
1911 Ga0501037_0190511
1912 Ga0501038_0000428
1913 Ga0501038_0036231
1914 Ga0501038_0203480
1915 Ga0501038_0223971
1916 Ga0501038_0247921
1917 Ga0501039_0000273
1918 Ga0501039_0032382
1919 Ga0501042_0170613
1920 Ga0501043_0000165
1921 Ga0501043_0027908
1922 Ga0501043_0198896
1923 Ga0501043_0205795
1924 Ga0501043_0223047
1925 Ga0501043_0289433
1926 Ga0501043_0624811
1927 Ga0501046_0000839
1928 Ga0501046_0516206
1929 Ga0501047_0000340
1930 Ga0501047_0001905
1931 Ga0501047_0003425
1932 Ga0501047_0041364
1933 Ga0501047_0458913
1934 Ga0501048_0001309
1935 Ga0501048_0046616
1936 Ga0501067_0000457
1937 Ga0501067_0087210
1938 Ga0501067_0135039
1939 Ga0501068_0000839
1940 Ga0501068_0032662
1941 Ga0501069_0032150
1942 Ga0501069_0066434
1943 Ga0501070_0000971
1944 Ga0501070_0073648
1945 Ga0501070_0577973
1946 Ga0501071_0079057
1947 Ga0501072_0003301
1948 Ga0501073_0000037
1949 Ga0501073_0065517
1950 Ga0501074_0000167
1951 Ga0501074_0259375
1952 Ga0501076_0191321
1953 Ga0501079_0002302
1954 Ga0501080_0006603
1955 Ga0501080_0055199
1956 Ga0501080_0080214
1957 Ga0501080_0084313
1958 Ga0501083_0001812
1959 Ga0501083_0016896
1960 Ga0501083_0042452
1961 Ga0501241_006927
1962 Ga0501035_0000142
1963 Ga0501035_0006052
1964 Ga0501035_0088777
1965 Ga0501035_0185286
1966 Ga0501035_0319208
1967 Ga0501044_0000414
1968 Ga0501044_0008740
1969 Ga0501044_0013526
1970 Ga0501044_0021563
1971 Ga0501044_0022908
1972 Ga0501044_0076769
1973 Ga0501044_0083517
1974 Ga0501044_0100473
1975 Ga0501044_0286077
1976 Ga0501044_0394898
1977 Ga0501045_0002539
1978 nmdc:mga03n38_180079_c1
1979 nmdc:mga03n38_3129_c1
1980 nmdc:mga00v17_26492_c1
1981 nmdc:mga00v17_28827_c1
1982 nmdc:mga00v17_51403_c1
1983 nmdc:mga00v17_59417_c1
1984 nmdc:mga00v17_69035_c1
1985 nmdc:mga0yw44_179253_c1
1986 nmdc:mga0yw44_23081_c1
1987 nmdc:mga0yw44_341776_c1
1988 nmdc:mga0yw44_4551_c1
1989 nmdc:mga0yw44_50500_c1
1990 nmdc:mga0yw44_7729_c1
1991 nmdc:mga0yw44_84115_c1
1992 nmdc:mga0k408_14464_c1
1993 nmdc:mga0k408_199183_c1
1994 nmdc:mga06z11_138892_c1
1995 nmdc:mga06z11_4688_c1
1996 nmdc:mga04h51_98496_c1
1997 nmdc:mga07m45_32567_c1
1998 nmdc:mga05p37_650235_c1
1999 nmdc:mga0rr50_234301_c1
2000 nmdc:mga08x19_86194_c1
2001 nmdc:mga0sz30_2586_c1
2002 nmdc:mga0sz30_4919_c1
2003 nmdc:mga0sz30_51614_c1
2004 nmdc:mga0sz30_75666_c1
2005 Ga0495595_0087546
2006 Ga0500578_0000056
2007 Ga0500578_0113492
2008 Ga0500578_0190611
2009 Ga0500578_0193464
2010 Ga0500578_0230005
2011 Ga0500643_000048
2012 Ga0500643_000548
2013 Ga0500643_005672
2014 Ga0500643_010845
2015 Ga0500643_012763
2016 Ga0500643_070398
2017 Ga0500644_0000089
2018 Ga0500644_0028932
2019 Ga0500644_0044232
2020 Ga0500647_0093291
2021 Ga0500647_0178970
2022 Ga0500583_0010766
2023 Ga0500583_0060762
2024 Ga0500651_0002004
2025 Ga0500651_0002704
2026 Ga0500651_0014869
2027 Ga0500651_0215834
2028 Ga0500566_0002605
2029 Ga0500566_0003780
2030 Ga0500566_0006460
2031 Ga0500566_0075920
2032 Ga0500641_0018004
2033 Ga0500641_0023374
2034 Ga0500641_0025472
2035 Ga0500641_0032761
2036 Ga0500641_0054141
2037 Ga0500650_0025917
2038 Ga0500554_041214
2039 Ga0500555_027405
2040 Ga0500556_0000003
2041 Ga0500556_0001687
2042 Ga0500562_000489
2043 Ga0500562_006991
2044 Ga0500562_016473
2045 Ga0500562_027131
2046 Ga0500594_0000724
2047 Ga0500594_0086696
2048 Ga0500595_000333
2049 Ga0500595_000497
2050 Ga0500595_000553
2051 Ga0500595_002282
2052 Ga0500608_000207
2053 Ga0500608_063928
2054 Ga0500608_141759
2055 Ga0500614_015345
2056 Ga0500614_040520
2057 Ga0500618_000034
2058 Ga0500618_006607
2059 Ga0500628_081385
2060 Ga0500642_0000015
2061 Ga0500642_0001744
2062 Ga0500642_0015152
2063 Ga0500642_0133221
2064 Ga0500642_0197676
2065 Ga0500652_010728
2066 Ga0500652_011638
2067 Ga0500652_083744
2068 Ga0500655_000460
2069 Ga0500658_0000793
2070 Ga0500658_0001085
2071 Ga0500658_0010451
2072 Ga0500658_0031805
2073 Ga0500658_0055776
2074 Ga0500658_0165245
2075 Ga0500559_0000112
2076 Ga0500559_0001714
2077 Ga0500559_0033232
2078 Ga0500559_0081897
2079 Ga0500559_0089806
2080 Ga0500559_0147656
2081 Ga0500564_000057
2082 Ga0500564_150650
2083 Ga0500568_0000536
2084 Ga0500568_0005756
2085 Ga0500568_0016371
2086 Ga0500568_0049176
2087 Ga0500568_0077254
2088 Ga0500568_0084110
2089 Ga0500568_0084443
2090 Ga0500568_0092354
2091 Ga0500573_0067724
2092 Ga0500586_000330
2093 Ga0500588_0059114
2094 Ga0500590_000163
2095 Ga0500590_007211
2096 Ga0500590_031070
2097 Ga0500590_046959
2098 Ga0500603_014424
2099 Ga0500603_087833
2100 Ga0500604_0053896
2101 Ga0500616_0000033
2102 Ga0500616_0001587
2103 Ga0500616_0030013
2104 Ga0500616_0118939
2105 Ga0500622_0001006
2106 Ga0500622_0001762
2107 Ga0500622_0006755
2108 Ga0500622_0017921
2109 Ga0500622_0023088
2110 Ga0500622_0026896
2111 Ga0500622_0141881
2112 Ga0500627_0043782
2113 Ga0500627_0081653
2114 Ga0500638_016198
2115 Ga0500639_060191
2116 Ga0500636_0015308
2117 Ga0500636_0040450
2118 Ga0500637_0000060
2119 Ga0500570_004099
2120 Ga0500570_077593
2121 Ga0500611_021920
2122 Ga0500611_027584
2123 Ga0500645_000883
2124 Ga0500645_029154
2125 Ga0500645_064013
2126 Ga0500609_000027
2127 Ga0500609_002135
2128 Ga0500596_001647
2129 Ga0500599_002351
2130 Ga0501084_0005116
2131 Ga0501084_0254685
2132 Ga0500661_001013
2133 Ga0501082_0004333
2134 Ga0501082_0098486
2135 Ga0466962_0001247
2136 2509151565
2137 2511124191
2138 2513891646
2139 2517105700
2140 2524435444
2141 2585147145
2142 2585150853
2143 2585195825
2144 2585259718
2145 2587918018
2146 2603860096
2147 2643748399
2148 2643780674
2149 2643923880
2150 2643929447
2151 2643998673
2152 2644087375
2153 2644125726
2154 2644224552
2155 2644234513
2156 2644344581
2157 2644366735
2158 2644508212
2159 2745081392
2160 2792458916
2161 2819538598
2162 2819646868
2163 2824706075
2164 2824760292
2165 2824771531
2166 2824775749
2167 2841965297
2168 2842044359
2169 2842051652
2170 2843749072
2171 2849564398
2172 2849575270
2173 2851155526
2174 2857504811
2175 2857525079
2176 2874622434
2177 2876761700
2178 2884965359
2179 2893069665
2180 2898330873
2181 2904671559
2182 2904718102
2183 2919078967
2184 2928532858
2185 8006928840
2186 8016526936
2187 8016532020
2188 8016556858
2189 8016565211
2190 8016582856
2191 8016602854
2192 8019531837

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08279

HTH_11

HTH domain

41

95

0.99

PF13280

WYL

WYL domain

172

269

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9176 4 48
4hob-assembly1.cif.gz_A the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9095 4 48
5way-assembly1.cif.gz_B mgaspn protein, mga regulator from streptococcus pneumoniae 0.8969 2 52
3f72-assembly3.cif.gz_E crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.8852 6 61
8fi3-assembly1.cif.gz_B bifunctional ligase/repressor bira from klebsiella pneumoniae complexed with biotin (domain swapped dimer) 0.885 6 61
ID Description Score Start End Superfamily
4a0yA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9473 1 45 1.10.10.10
3v7sA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9456 5 62 1.10.10.10
af_Q2G258_1_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9359 7 62 1.10.10.10
4a12C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9277 1 45 1.10.10.10
1j5yA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9275 3 64 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X3MD42-F1-model_v4 WYL domain-containing protein 0.942 136 212
AF-A0A3D2X3X3-F1-model_v4 YafY family transcriptional regulator 0.9318 138 201
AF-Q1WLE7-F1-model_v4 WYL domain-containing protein 0.9241 137 223
AF-A0A1F6PI14-F1-model_v4 WYL domain-containing protein 0.9214 138 212
AF-A0A2N2DEY2-F1-model_v4 WYL domain-containing protein 0.9205 138 212

Map