F489989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1096 | 483 | 2192 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0000001|Ga0495583_0000001_517596_518423 |
| Length | 275 |
| Sequence | MVVSPQGASVAVATFGRYRHPAASMLSASVQHSEAMRRAERLFQIIQILRRSRQPVTADAMAAELETSKRSVYRDIAALIGQRAPIRGEAGVGYVLEAGYDMPPLMLTPDEIEAAVLGAQWVAGRGDPVLATAANDLIAKIAAAVPEELRPYVLRPATEAARAWKALPDGLDIAQARAWIHAGRKIRLDYRDEKGAVSQRVVWPVTVGYLETVRLLVAWCELRGDFRHFRTDRVEHAEFLDERHGQRPGALRARWERALEEERQRWLANNPGAGC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 194 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 234 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 235 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 236 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 237 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 238 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 239 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 240 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 241 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 242 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 243 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 244 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 245 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 246 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 247 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 248 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 249 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 250 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 251 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 252 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 253 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 254 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 259 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 260 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 261 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 326 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 327 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 331 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 379 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 380 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 382 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 383 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 384 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 387 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 388 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 390 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 391 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 392 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 394 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 395 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 397 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 398 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 399 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 400 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 402 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 404 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 405 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 406 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 407 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 408 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 412 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 415 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 417 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 418 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 419 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 421 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 422 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 423 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 425 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 428 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 429 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 430 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 431 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 432 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 433 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 434 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 435 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 436 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 437 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 438 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 439 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 440 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 441 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 442 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 443 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 444 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 445 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 446 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 447 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 448 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 449 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 450 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 451 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 452 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 453 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 454 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 455 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 456 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 457 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 458 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 459 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 460 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 461 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 462 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 463 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 464 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 465 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 466 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 467 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 468 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 469 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 470 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 471 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 472 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 473 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 474 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 475 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 476 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 477 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 478 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 479 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 480 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 481 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 482 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 483 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.71 |
| Metatranscriptomes | 0.09 |
| Isolates | 5.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26 |
| Nodule | 1.37 |
| Rhizoplane | 2.65 |
| Rhizosphere | 58.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495583_0000001 | 3300046506 | Bacteria | 811973 |
| 2 | ARCol0yngRDRAFT_1002743 | 3300000652 | Bacteria | 1313 |
| 3 | JGI24739J22299_10082974 | 3300001989 | Bacteria | 982 |
| 4 | JGI24737J22298_10001157 | 3300001990 | Bacteria | 9276 |
| 5 | JGI24737J22298_10002048 | 3300001990 | Bacteria | 7217 |
| 6 | JGI24737J22298_10006756 | 3300001990 | Bacteria | 3899 |
| 7 | JGI24735J21928_10004802 | 3300002067 | Bacteria | 4513 |
| 8 | JGI24735J21928_10011300 | 3300002067 | Bacteria | 2834 |
| 9 | JGI24735J21928_10017522 | 3300002067 | Bacteria | 2215 |
| 10 | JGI24735J21928_10031649 | 3300002067 | Bacteria | 1568 |
| 11 | JGI24744J21845_10010918 | 3300002077 | Bacteria | 1859 |
| 12 | JGI25150J39212_1001113 | 3300002774 | Bacteria | 8088 |
| 13 | JGI25406J46586_10000513 | 3300003203 | Bacteria | 18124 |
| 14 | JGI25165J46597_1000007 | 3300003214 | Bacteria | 518996 |
| 15 | JGI25165J46597_1000165 | 3300003214 | Bacteria | 104009 |
| 16 | JGI25153J46596_10000103 | 3300003215 | Bacteria | 96279 |
| 17 | JGI25153J46596_10000253 | 3300003215 | Bacteria | 43821 |
| 18 | JGI25153J46596_10000301 | 3300003215 | Bacteria | 36933 |
| 19 | rootL2_10056079 | 3300003322 | Bacteria | 6635 |
| 20 | rootL2_10085247 | 3300003322 | Bacteria | 2074 |
| 21 | rootL2_10136953 | 3300003322 | Bacteria | 1186 |
| 22 | JGI25160J50197_1002871 | 3300003354 | Bacteria | 7885 |
| 23 | Ga0055526_1002472 | 3300003771 | Bacteria | 12489 |
| 24 | Ga0055526_1023389 | 3300003771 | Bacteria | 2064 |
| 25 | Ga0055526_1030086 | 3300003771 | Bacteria | 1593 |
| 26 | Ga0055526_1046549 | 3300003771 | Bacteria | 1026 |
| 27 | Ga0055537_1000720 | 3300003773 | Bacteria | 17131 |
| 28 | Ga0055537_1001200 | 3300003773 | Bacteria | 10985 |
| 29 | Ga0055537_1005264 | 3300003773 | Bacteria | 3507 |
| 30 | Ga0055524_1000561 | 3300003775 | Bacteria | 27893 |
| 31 | Ga0055524_1010000 | 3300003775 | Bacteria | 3811 |
| 32 | Ga0055524_1051165 | 3300003775 | Bacteria | 935 |
| 33 | Ga0055536_1000883 | 3300003781 | Bacteria | 19500 |
| 34 | Ga0055536_1001272 | 3300003781 | Bacteria | 15547 |
| 35 | Ga0055528_1007152 | 3300003790 | Bacteria | 4977 |
| 36 | Ga0055530_10001417 | 3300003791 | Bacteria | 17611 |
| 37 | Ga0055530_10007674 | 3300003791 | Bacteria | 4491 |
| 38 | Ga0055530_10034337 | 3300003791 | Bacteria | 1297 |
| 39 | Ga0055540_1003607 | 3300003792 | Bacteria | 7388 |
| 40 | Ga0055531_10000274 | 3300003794 | Bacteria | 53225 |
| 41 | Ga0055531_10001047 | 3300003794 | Bacteria | 21808 |
| 42 | Ga0055531_10005338 | 3300003794 | Bacteria | 7540 |
| 43 | Ga0055531_10022251 | 3300003794 | Bacteria | 2423 |
| 44 | Ga0055531_10036703 | 3300003794 | Bacteria | 1505 |
| 45 | Ga0055543_1020464 | 3300004625 | Bacteria | 1215 |
| 46 | Ga0065165_1000256 | 3300005262 | Bacteria | 92230 |
| 47 | Ga0065165_1001164 | 3300005262 | Bacteria | 30599 |
| 48 | Ga0065165_1001167 | 3300005262 | Bacteria | 30545 |
| 49 | Ga0065165_1004950 | 3300005262 | Bacteria | 7841 |
| 50 | Ga0065165_1032813 | 3300005262 | Bacteria | 1623 |
| 51 | Ga0065165_1058454 | 3300005262 | Bacteria | 1065 |
| 52 | Ga0070658_10004018 | 3300005327 | Bacteria | 12053 |
| 53 | Ga0070658_10004565 | 3300005327 | Bacteria | 11251 |
| 54 | Ga0070658_10212129 | 3300005327 | Bacteria | 1636 |
| 55 | Ga0070676_10000416 | 3300005328 | Bacteria | 20088 |
| 56 | Ga0070670_100205126 | 3300005331 | Bacteria | 1713 |
| 57 | Ga0068869_100015254 | 3300005334 | Bacteria | 5150 |
| 58 | Ga0070666_10186306 | 3300005335 | Bacteria | 1457 |
| 59 | Ga0070680_100017794 | 3300005336 | Bacteria | 5606 |
| 60 | Ga0070682_100202918 | 3300005337 | Bacteria | 1400 |
| 61 | Ga0070682_100208451 | 3300005337 | Bacteria | 1384 |
| 62 | Ga0068868_100000013 | 3300005338 | Bacteria | 110536 |
| 63 | Ga0068868_100667725 | 3300005338 | Bacteria | 927 |
| 64 | Ga0070660_100002444 | 3300005339 | Bacteria | 12761 |
| 65 | Ga0070660_100003692 | 3300005339 | Bacteria | 10562 |
| 66 | Ga0070660_100019488 | 3300005339 | Bacteria | 4972 |
| 67 | Ga0070660_100033044 | 3300005339 | Bacteria | 3897 |
| 68 | Ga0070660_100204054 | 3300005339 | Bacteria | 1604 |
| 69 | Ga0070660_100625404 | 3300005339 | Bacteria | 901 |
| 70 | Ga0070661_100097802 | 3300005344 | Bacteria | 2180 |
| 71 | Ga0070661_100188955 | 3300005344 | Bacteria | 1570 |
| 72 | Ga0070668_100019990 | 3300005347 | Bacteria | 5049 |
| 73 | Ga0070669_100765504 | 3300005353 | Bacteria | 819 |
| 74 | Ga0070675_100134826 | 3300005354 | Bacteria | 2107 |
| 75 | Ga0070671_100067672 | 3300005355 | Bacteria | 2978 |
| 76 | Ga0070673_100000002 | 3300005364 | Bacteria | 225084 |
| 77 | Ga0070673_100334229 | 3300005364 | Bacteria | 1341 |
| 78 | Ga0070659_100003649 | 3300005366 | Bacteria | 10967 |
| 79 | Ga0070659_100036509 | 3300005366 | Bacteria | 3831 |
| 80 | Ga0070659_100077774 | 3300005366 | Bacteria | 2646 |
| 81 | Ga0070659_100148389 | 3300005366 | Bacteria | 1912 |
| 82 | Ga0070709_10003406 | 3300005434 | Bacteria | 8539 |
| 83 | Ga0070709_10020120 | 3300005434 | Bacteria | 3868 |
| 84 | Ga0070709_10045772 | 3300005434 | Bacteria | 2718 |
| 85 | Ga0070714_100226508 | 3300005435 | Bacteria | 1721 |
| 86 | Ga0070713_100010463 | 3300005436 | Bacteria | 6700 |
| 87 | Ga0070713_100071899 | 3300005436 | Bacteria | 2925 |
| 88 | Ga0070713_100222146 | 3300005436 | Bacteria | 1714 |
| 89 | Ga0070713_100287196 | 3300005436 | Bacteria | 1511 |
| 90 | Ga0070710_10025371 | 3300005437 | Bacteria | 3139 |
| 91 | Ga0070711_100001130 | 3300005439 | Bacteria | 14272 |
| 92 | Ga0070711_100002277 | 3300005439 | Bacteria | 10885 |
| 93 | Ga0070711_100452971 | 3300005439 | Bacteria | 1051 |
| 94 | Ga0070663_100572479 | 3300005455 | Bacteria | 947 |
| 95 | Ga0070678_100010460 | 3300005456 | Bacteria | 5671 |
| 96 | Ga0070662_100159029 | 3300005457 | Bacteria | 1766 |
| 97 | Ga0070681_10006411 | 3300005458 | Bacteria | 11447 |
| 98 | Ga0070681_10049606 | 3300005458 | Bacteria | 4191 |
| 99 | Ga0070681_10087304 | 3300005458 | Bacteria | 3072 |
| 100 | Ga0068867_100000012 | 3300005459 | Bacteria | 118831 |
| 101 | Ga0068867_100276620 | 3300005459 | Bacteria | 1375 |
| 102 | Ga0070706_100052063 | 3300005467 | Bacteria | 3780 |
| 103 | Ga0070707_100092451 | 3300005468 | Bacteria | 2929 |
| 104 | Ga0070679_100117260 | 3300005530 | Bacteria | 2647 |
| 105 | Ga0070684_100001671 | 3300005535 | Bacteria | 16123 |
| 106 | Ga0070697_100118434 | 3300005536 | Bacteria | 2213 |
| 107 | Ga0068853_100009612 | 3300005539 | Bacteria | 7791 |
| 108 | Ga0068853_100041194 | 3300005539 | Bacteria | 3943 |
| 109 | Ga0068853_100470288 | 3300005539 | Bacteria | 1184 |
| 110 | Ga0070693_100020120 | 3300005547 | Bacteria | 3514 |
| 111 | Ga0070665_100001299 | 3300005548 | Bacteria | 29894 |
| 112 | Ga0070665_100154706 | 3300005548 | Bacteria | 2295 |
| 113 | Ga0070665_100174582 | 3300005548 | Bacteria | 2150 |
| 114 | Ga0070665_100203709 | 3300005548 | Bacteria | 1979 |
| 115 | Ga0070665_100535622 | 3300005548 | Bacteria | 1183 |
| 116 | Ga0068855_100000095 | 3300005563 | Bacteria | 106561 |
| 117 | Ga0068855_100071449 | 3300005563 | Bacteria | 4036 |
| 118 | Ga0068855_100298678 | 3300005563 | Bacteria | 1784 |
| 119 | Ga0068855_100498496 | 3300005563 | Bacteria | 1323 |
| 120 | Ga0068857_100013087 | 3300005577 | Bacteria | 7230 |
| 121 | Ga0068857_100021147 | 3300005577 | Bacteria | 5725 |
| 122 | Ga0068857_100163281 | 3300005577 | Bacteria | 2022 |
| 123 | Ga0068856_100000137 | 3300005614 | Bacteria | 73762 |
| 124 | Ga0068856_100016744 | 3300005614 | Bacteria | 7101 |
| 125 | Ga0068856_100345247 | 3300005614 | Bacteria | 1507 |
| 126 | Ga0068852_100000586 | 3300005616 | Bacteria | 23996 |
| 127 | Ga0068852_100088449 | 3300005616 | Bacteria | 2767 |
| 128 | Ga0068859_100005156 | 3300005617 | Bacteria | 13269 |
| 129 | Ga0068864_100007001 | 3300005618 | Bacteria | 9253 |
| 130 | Ga0068866_10071782 | 3300005718 | Bacteria | 1832 |
| 131 | Ga0068861_100207079 | 3300005719 | Bacteria | 1650 |
| 132 | Ga0068851_10024349 | 3300005834 | Bacteria | 2963 |
| 133 | Ga0068863_100025840 | 3300005841 | Bacteria | 5602 |
| 134 | Ga0068863_100359835 | 3300005841 | Bacteria | 1418 |
| 135 | Ga0068858_100000771 | 3300005842 | Bacteria | 33416 |
| 136 | Ga0068858_100009417 | 3300005842 | Bacteria | 9320 |
| 137 | Ga0068858_100242087 | 3300005842 | Bacteria | 1712 |
| 138 | Ga0068860_100000313 | 3300005843 | Bacteria | 66545 |
| 139 | Ga0068860_101020018 | 3300005843 | Bacteria | 846 |
| 140 | Ga0068862_100015180 | 3300005844 | Bacteria | 6396 |
| 141 | Ga0068862_100015872 | 3300005844 | Bacteria | 6258 |
| 142 | Ga0081455_10002424 | 3300005937 | Bacteria | 22245 |
| 143 | Ga0081455_10017304 | 3300005937 | Bacteria | 6918 |
| 144 | Ga0081540_1024929 | 3300005983 | Bacteria | 3458 |
| 145 | Ga0081540_1028527 | 3300005983 | Bacteria | 3132 |
| 146 | Ga0081540_1059623 | 3300005983 | Bacteria | 1831 |
| 147 | Ga0081540_1072041 | 3300005983 | Bacteria | 1594 |
| 148 | Ga0081540_1142003 | 3300005983 | Bacteria | 962 |
| 149 | Ga0081539_10000801 | 3300005985 | Bacteria | 61178 |
| 150 | Ga0081539_10073132 | 3300005985 | Bacteria | 1830 |
| 151 | Ga0075365_10036163 | 3300006038 | Bacteria | 3199 |
| 152 | Ga0075365_10055263 | 3300006038 | Bacteria | 2634 |
| 153 | Ga0075365_10164151 | 3300006038 | Bacteria | 1549 |
| 154 | Ga0075365_10238357 | 3300006038 | Bacteria | 1277 |
| 155 | Ga0075368_10003536 | 3300006042 | Bacteria | 5233 |
| 156 | Ga0075363_100004455 | 3300006048 | Bacteria | 6132 |
| 157 | Ga0075364_10012640 | 3300006051 | Bacteria | 5171 |
| 158 | Ga0075364_10077984 | 3300006051 | Bacteria | 2187 |
| 159 | Ga0075364_10520688 | 3300006051 | Bacteria | 813 |
| 160 | Ga0070712_100009825 | 3300006175 | Bacteria | 6031 |
| 161 | Ga0075362_10021637 | 3300006177 | Bacteria | 2702 |
| 162 | Ga0075367_10020984 | 3300006178 | Bacteria | 3645 |
| 163 | Ga0075367_10037363 | 3300006178 | Bacteria | 2821 |
| 164 | Ga0075367_10039353 | 3300006178 | Bacteria | 2756 |
| 165 | Ga0075369_10004680 | 3300006186 | Bacteria | 5076 |
| 166 | Ga0075369_10005108 | 3300006186 | Bacteria | 4887 |
| 167 | Ga0075369_10009026 | 3300006186 | Bacteria | 3859 |
| 168 | Ga0075369_10106555 | 3300006186 | Bacteria | 1261 |
| 169 | Ga0075369_10120009 | 3300006186 | Bacteria | 1190 |
| 170 | Ga0075369_10238000 | 3300006186 | Bacteria | 844 |
| 171 | Ga0075366_10008146 | 3300006195 | Bacteria | 5815 |
| 172 | Ga0075366_10086221 | 3300006195 | Bacteria | 1878 |
| 173 | Ga0075366_10161131 | 3300006195 | Bacteria | 1359 |
| 174 | Ga0097621_100061585 | 3300006237 | Bacteria | 3078 |
| 175 | Ga0097621_100144761 | 3300006237 | Bacteria | 2034 |
| 176 | Ga0097621_100872561 | 3300006237 | Bacteria | 837 |
| 177 | Ga0075370_10130135 | 3300006353 | Bacteria | 1468 |
| 178 | Ga0075370_10169650 | 3300006353 | Bacteria | 1282 |
| 179 | Ga0075370_10297882 | 3300006353 | Bacteria | 959 |
| 180 | Ga0075428_100150741 | 3300006844 | Bacteria | 2526 |
| 181 | Ga0075434_100023401 | 3300006871 | Bacteria | 6020 |
| 182 | Ga0068865_100000004 | 3300006881 | Bacteria | 226236 |
| 183 | Ga0068865_100480280 | 3300006881 | Bacteria | 1033 |
| 184 | Ga0097620_100005156 | 3300006931 | Bacteria | 13269 |
| 185 | Ga0075435_100411755 | 3300007076 | Bacteria | 1164 |
| 186 | Ga0099794_10061546 | 3300007265 | Bacteria | 1824 |
| 187 | Ga0099795_10001129 | 3300007788 | Bacteria | 5569 |
| 188 | Ga0099795_10005962 | 3300007788 | Bacteria | 3288 |
| 189 | Ga0099795_10067502 | 3300007788 | Bacteria | 1342 |
| 190 | Ga0105240_10002463 | 3300009093 | Bacteria | 29749 |
| 191 | Ga0105240_10033307 | 3300009093 | Bacteria | 6659 |
| 192 | Ga0105240_10064674 | 3300009093 | Bacteria | 4544 |
| 193 | Ga0105240_10071475 | 3300009093 | Bacteria | 4291 |
| 194 | Ga0105240_10086052 | 3300009093 | Bacteria | 3850 |
| 195 | Ga0105240_10298611 | 3300009093 | Bacteria | 1843 |
| 196 | Ga0105240_10323474 | 3300009093 | Bacteria | 1757 |
| 197 | Ga0105245_10001027 | 3300009098 | Bacteria | 25355 |
| 198 | Ga0105245_10003725 | 3300009098 | Bacteria | 13583 |
| 199 | Ga0105245_11027269 | 3300009098 | Bacteria | 869 |
| 200 | Ga0105247_10043425 | 3300009101 | Bacteria | 2754 |
| 201 | Ga0105247_10503386 | 3300009101 | Bacteria | 883 |
| 202 | Ga0114129_10054829 | 3300009147 | Bacteria | 5588 |
| 203 | Ga0105243_10000146 | 3300009148 | Bacteria | 81008 |
| 204 | Ga0105242_10000497 | 3300009176 | Bacteria | 31053 |
| 205 | Ga0105248_10001758 | 3300009177 | Bacteria | 24108 |
| 206 | Ga0105248_10007949 | 3300009177 | Bacteria | 11658 |
| 207 | Ga0105248_10042051 | 3300009177 | Bacteria | 5125 |
| 208 | Ga0105248_10047211 | 3300009177 | Bacteria | 4829 |
| 209 | Ga0105248_10347630 | 3300009177 | Bacteria | 1669 |
| 210 | Ga0105237_10052574 | 3300009545 | Bacteria | 4088 |
| 211 | Ga0105237_10053748 | 3300009545 | Bacteria | 4039 |
| 212 | Ga0105237_10054084 | 3300009545 | Bacteria | 4023 |
| 213 | Ga0105237_10133176 | 3300009545 | Bacteria | 2480 |
| 214 | Ga0105238_10006268 | 3300009551 | Bacteria | 11820 |
| 215 | Ga0105238_10022426 | 3300009551 | Bacteria | 6435 |
| 216 | Ga0105238_10225558 | 3300009551 | Bacteria | 1850 |
| 217 | Ga0105249_10015630 | 3300009553 | Bacteria | 6720 |
| 218 | Ga0105249_10157228 | 3300009553 | Bacteria | 2193 |
| 219 | Ga0105249_10179246 | 3300009553 | Bacteria | 2060 |
| 220 | Ga0099796_10012567 | 3300010159 | Bacteria | 2395 |
| 221 | Ga0105239_10017503 | 3300010375 | Bacteria | 7926 |
| 222 | Ga0105239_10216274 | 3300010375 | Bacteria | 2149 |
| 223 | Ga0105239_10851949 | 3300010375 | Bacteria | 1045 |
| 224 | Ga0105246_10000138 | 3300011119 | Bacteria | 33809 |
| 225 | Ga0157327_1000745 | 3300012512 | Bacteria | 1841 |
| 226 | Ga0157373_10079649 | 3300013100 | Bacteria | 2311 |
| 227 | Ga0157370_10000096 | 3300013104 | Bacteria | 99163 |
| 228 | Ga0157370_10274931 | 3300013104 | Bacteria | 1556 |
| 229 | Ga0157369_10018692 | 3300013105 | Bacteria | 7770 |
| 230 | Ga0157369_10022918 | 3300013105 | Bacteria | 6962 |
| 231 | Ga0157369_10053822 | 3300013105 | Bacteria | 4348 |
| 232 | Ga0157374_10001104 | 3300013296 | Bacteria | 23221 |
| 233 | Ga0157378_10015726 | 3300013297 | Bacteria | 6625 |
| 234 | Ga0157378_10091415 | 3300013297 | Bacteria | 2767 |
| 235 | Ga0163162_10004509 | 3300013306 | Bacteria | 13410 |
| 236 | Ga0163162_10026231 | 3300013306 | Bacteria | 5759 |
| 237 | Ga0163162_11080978 | 3300013306 | Bacteria | 908 |
| 238 | Ga0157372_10034063 | 3300013307 | Bacteria | 5596 |
| 239 | Ga0157372_10067956 | 3300013307 | Bacteria | 4006 |
| 240 | Ga0157372_10294884 | 3300013307 | Bacteria | 1886 |
| 241 | Ga0157372_10559346 | 3300013307 | Bacteria | 1333 |
| 242 | Ga0157375_10000587 | 3300013308 | Bacteria | 32327 |
| 243 | Ga0163163_10018900 | 3300014325 | Bacteria | 6465 |
| 244 | Ga0163163_10089709 | 3300014325 | Bacteria | 3087 |
| 245 | Ga0163163_10557376 | 3300014325 | Bacteria | 1209 |
| 246 | Ga0157380_10122751 | 3300014326 | Bacteria | 2203 |
| 247 | Ga0157380_10532302 | 3300014326 | Bacteria | 1149 |
| 248 | Ga0182008_10154201 | 3300014497 | Bacteria | 1153 |
| 249 | Ga0157379_10014381 | 3300014968 | Bacteria | 6944 |
| 250 | Ga0157379_10027684 | 3300014968 | Bacteria | 5046 |
| 251 | Ga0157379_10033261 | 3300014968 | Bacteria | 4598 |
| 252 | Ga0157379_10067957 | 3300014968 | Bacteria | 3186 |
| 253 | Ga0157379_10199431 | 3300014968 | Bacteria | 1809 |
| 254 | Ga0157376_10000131 | 3300014969 | Bacteria | 51790 |
| 255 | Ga0163161_10056570 | 3300017792 | Bacteria | 2849 |
| 256 | Ga0213872_10070428 | 3300021361 | Bacteria | 1577 |
| 257 | Ga0213876_10000345 | 3300021384 | Bacteria | 40189 |
| 258 | Ga0213876_10038689 | 3300021384 | Bacteria | 2518 |
| 259 | Ga0209436_112907 | 3300025208 | Bacteria | 1395 |
| 260 | Ga0209437_106743 | 3300025233 | Bacteria | 1899 |
| 261 | Ga0207425_1000094 | 3300025245 | Bacteria | 85629 |
| 262 | Ga0207425_1001939 | 3300025245 | Bacteria | 7787 |
| 263 | Ga0209026_1001831 | 3300025250 | Bacteria | 8716 |
| 264 | Ga0209677_102422 | 3300025253 | Bacteria | 7047 |
| 265 | Ga0209148_1000074 | 3300025254 | Bacteria | 314356 |
| 266 | Ga0209148_1001194 | 3300025254 | Bacteria | 14881 |
| 267 | Ga0209129_1001201 | 3300025258 | Bacteria | 14903 |
| 268 | Ga0209233_1000026 | 3300025261 | Bacteria | 678466 |
| 269 | Ga0209233_1000098 | 3300025261 | Bacteria | 294111 |
| 270 | Ga0209233_1002344 | 3300025261 | Bacteria | 7057 |
| 271 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 272 | Ga0209565_1000618 | 3300025263 | Bacteria | 23421 |
| 273 | Ga0209565_1038534 | 3300025263 | Bacteria | 899 |
| 274 | Ga0209455_1000574 | 3300025272 | Bacteria | 24064 |
| 275 | Ga0209455_1002785 | 3300025272 | Bacteria | 6531 |
| 276 | Ga0209455_1013949 | 3300025272 | Bacteria | 1841 |
| 277 | Ga0209455_1016958 | 3300025272 | Bacteria | 1545 |
| 278 | Ga0209455_1036672 | 3300025272 | Bacteria | 778 |
| 279 | Ga0209673_1000722 | 3300025273 | Bacteria | 45860 |
| 280 | Ga0209673_1001309 | 3300025273 | Bacteria | 25209 |
| 281 | Ga0209673_1016536 | 3300025273 | Bacteria | 2753 |
| 282 | Ga0209673_1027785 | 3300025273 | Bacteria | 1834 |
| 283 | Ga0209676_1000243 | 3300025292 | Bacteria | 117113 |
| 284 | Ga0209676_1000311 | 3300025292 | Bacteria | 95478 |
| 285 | Ga0209676_1004805 | 3300025292 | Bacteria | 7338 |
| 286 | Ga0209025_1000630 | 3300025294 | Bacteria | 62487 |
| 287 | Ga0209564_1000713 | 3300025295 | Bacteria | 48301 |
| 288 | Ga0209564_1000718 | 3300025295 | Bacteria | 47576 |
| 289 | Ga0209564_1000745 | 3300025295 | Bacteria | 46163 |
| 290 | Ga0209564_1003160 | 3300025295 | Bacteria | 11595 |
| 291 | Ga0209564_1006871 | 3300025295 | Bacteria | 6001 |
| 292 | Ga0209564_1008096 | 3300025295 | Bacteria | 5260 |
| 293 | Ga0209564_1009741 | 3300025295 | Bacteria | 4522 |
| 294 | Ga0209564_1032344 | 3300025295 | Bacteria | 1578 |
| 295 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 296 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 297 | Ga0209758_1000108 | 3300025297 | Bacteria | 216541 |
| 298 | Ga0209758_1000239 | 3300025297 | Bacteria | 114761 |
| 299 | Ga0209758_1000252 | 3300025297 | Bacteria | 108214 |
| 300 | Ga0209758_1001566 | 3300025297 | Bacteria | 26231 |
| 301 | Ga0209758_1001570 | 3300025297 | Bacteria | 26195 |
| 302 | Ga0209758_1004632 | 3300025297 | Bacteria | 11268 |
| 303 | Ga0209758_1006280 | 3300025297 | Bacteria | 8638 |
| 304 | Ga0209758_1006552 | 3300025297 | Bacteria | 8293 |
| 305 | Ga0209758_1021049 | 3300025297 | Bacteria | 3057 |
| 306 | Ga0209758_1022902 | 3300025297 | Bacteria | 2844 |
| 307 | Ga0209758_1026731 | 3300025297 | Bacteria | 2488 |
| 308 | Ga0209758_1028026 | 3300025297 | Bacteria | 2393 |
| 309 | Ga0209050_1000244 | 3300025298 | Bacteria | 117105 |
| 310 | Ga0209050_1000342 | 3300025298 | Bacteria | 92644 |
| 311 | Ga0209050_1000375 | 3300025298 | Bacteria | 84503 |
| 312 | Ga0209050_1005517 | 3300025298 | Bacteria | 7905 |
| 313 | Ga0209050_1011876 | 3300025298 | Bacteria | 4069 |
| 314 | Ga0209050_1014540 | 3300025298 | Bacteria | 3381 |
| 315 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 316 | Ga0209256_1001119 | 3300025299 | Bacteria | 30656 |
| 317 | Ga0209256_1002155 | 3300025299 | Bacteria | 16982 |
| 318 | Ga0209256_1002592 | 3300025299 | Bacteria | 14393 |
| 319 | Ga0209256_1008041 | 3300025299 | Bacteria | 4993 |
| 320 | Ga0209256_1010559 | 3300025299 | Bacteria | 3842 |
| 321 | Ga0207426_1000217 | 3300025302 | Bacteria | 136180 |
| 322 | Ga0207426_1000368 | 3300025302 | Bacteria | 79715 |
| 323 | Ga0207426_1016643 | 3300025302 | Bacteria | 2633 |
| 324 | Ga0209051_1000226 | 3300025303 | Bacteria | 94990 |
| 325 | Ga0209051_1003593 | 3300025303 | Bacteria | 10081 |
| 326 | Ga0209257_1000066 | 3300025304 | Bacteria | 344166 |
| 327 | Ga0209257_1000140 | 3300025304 | Bacteria | 201515 |
| 328 | Ga0209257_1001119 | 3300025304 | Bacteria | 34613 |
| 329 | Ga0209257_1002989 | 3300025304 | Bacteria | 15349 |
| 330 | Ga0209257_1003585 | 3300025304 | Bacteria | 13127 |
| 331 | Ga0209257_1004459 | 3300025304 | Bacteria | 10837 |
| 332 | Ga0209257_1017346 | 3300025304 | Bacteria | 2843 |
| 333 | Ga0209257_1019253 | 3300025304 | Bacteria | 2579 |
| 334 | Ga0209257_1023078 | 3300025304 | Bacteria | 2199 |
| 335 | Ga0207692_10092668 | 3300025898 | Bacteria | 1642 |
| 336 | Ga0207642_10150907 | 3300025899 | Bacteria | 1237 |
| 337 | Ga0207680_10208528 | 3300025903 | Bacteria | 1335 |
| 338 | Ga0207647_10025784 | 3300025904 | Bacteria | 3855 |
| 339 | Ga0207647_10152771 | 3300025904 | Bacteria | 1349 |
| 340 | Ga0207647_10359411 | 3300025904 | Bacteria | 824 |
| 341 | Ga0207699_10019120 | 3300025906 | Bacteria | 3646 |
| 342 | Ga0207699_10032628 | 3300025906 | Bacteria | 2935 |
| 343 | Ga0207699_10062902 | 3300025906 | Bacteria | 2239 |
| 344 | Ga0207645_10004384 | 3300025907 | Bacteria | 10452 |
| 345 | Ga0207705_10000055 | 3300025909 | Bacteria | 160436 |
| 346 | Ga0207705_10007178 | 3300025909 | Bacteria | 8207 |
| 347 | Ga0207684_10047574 | 3300025910 | Bacteria | 3637 |
| 348 | Ga0207654_10496656 | 3300025911 | Bacteria | 861 |
| 349 | Ga0207707_10000143 | 3300025912 | Bacteria | 74226 |
| 350 | Ga0207707_10014431 | 3300025912 | Bacteria | 6882 |
| 351 | Ga0207695_10004557 | 3300025913 | Bacteria | 18841 |
| 352 | Ga0207695_10005778 | 3300025913 | Bacteria | 16288 |
| 353 | Ga0207695_10029272 | 3300025913 | Bacteria | 6091 |
| 354 | Ga0207695_10525076 | 3300025913 | Bacteria | 1065 |
| 355 | Ga0207671_10029351 | 3300025914 | Bacteria | 4106 |
| 356 | Ga0207671_10061198 | 3300025914 | Bacteria | 2793 |
| 357 | Ga0207671_10144019 | 3300025914 | Bacteria | 1837 |
| 358 | Ga0207671_10178948 | 3300025914 | Bacteria | 1650 |
| 359 | Ga0207693_10054355 | 3300025915 | Bacteria | 3141 |
| 360 | Ga0207693_10166544 | 3300025915 | Bacteria | 1735 |
| 361 | Ga0207663_10052117 | 3300025916 | Bacteria | 2551 |
| 362 | Ga0207660_10007904 | 3300025917 | Bacteria | 6882 |
| 363 | Ga0207660_10274141 | 3300025917 | Bacteria | 1337 |
| 364 | Ga0207657_10004951 | 3300025919 | Bacteria | 14018 |
| 365 | Ga0207657_10005482 | 3300025919 | Bacteria | 13248 |
| 366 | Ga0207657_10013332 | 3300025919 | Bacteria | 8064 |
| 367 | Ga0207657_10139147 | 3300025919 | Bacteria | 1984 |
| 368 | Ga0207652_10024703 | 3300025921 | Bacteria | 4987 |
| 369 | Ga0207646_10065090 | 3300025922 | Bacteria | 3254 |
| 370 | Ga0207694_10029840 | 3300025924 | Bacteria | 4163 |
| 371 | Ga0207694_10049968 | 3300025924 | Bacteria | 3238 |
| 372 | Ga0207694_10050027 | 3300025924 | Bacteria | 3235 |
| 373 | Ga0207694_10067102 | 3300025924 | Bacteria | 2800 |
| 374 | Ga0207659_10015289 | 3300025926 | Bacteria | 4967 |
| 375 | Ga0207659_10232512 | 3300025926 | Bacteria | 1487 |
| 376 | Ga0207659_10510357 | 3300025926 | Bacteria | 1018 |
| 377 | Ga0207687_10000755 | 3300025927 | Bacteria | 21846 |
| 378 | Ga0207687_10089008 | 3300025927 | Bacteria | 2247 |
| 379 | Ga0207687_10201791 | 3300025927 | Bacteria | 1555 |
| 380 | Ga0207700_10034094 | 3300025928 | Bacteria | 3650 |
| 381 | Ga0207700_10110658 | 3300025928 | Bacteria | 2209 |
| 382 | Ga0207700_10197737 | 3300025928 | Bacteria | 1693 |
| 383 | Ga0207700_10227682 | 3300025928 | Bacteria | 1583 |
| 384 | Ga0207690_10004570 | 3300025932 | Bacteria | 8175 |
| 385 | Ga0207690_10036500 | 3300025932 | Bacteria | 3183 |
| 386 | Ga0207690_10401104 | 3300025932 | Bacteria | 1094 |
| 387 | Ga0207706_10010431 | 3300025933 | Bacteria | 8489 |
| 388 | Ga0207686_10067444 | 3300025934 | Bacteria | 2289 |
| 389 | Ga0207709_10000314 | 3300025935 | Bacteria | 52842 |
| 390 | Ga0207704_10000005 | 3300025938 | Bacteria | 225353 |
| 391 | Ga0207711_10000852 | 3300025941 | Bacteria | 29486 |
| 392 | Ga0207711_10004629 | 3300025941 | Bacteria | 11695 |
| 393 | Ga0207711_10176891 | 3300025941 | Bacteria | 1939 |
| 394 | Ga0207689_10001653 | 3300025942 | Bacteria | 21135 |
| 395 | Ga0207679_10256115 | 3300025945 | Bacteria | 1490 |
| 396 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 397 | Ga0207667_10020014 | 3300025949 | Bacteria | 7455 |
| 398 | Ga0207667_10079777 | 3300025949 | Bacteria | 3392 |
| 399 | Ga0207651_10000007 | 3300025960 | Bacteria | 225286 |
| 400 | Ga0207712_10007902 | 3300025961 | Bacteria | 6720 |
| 401 | Ga0207712_10088953 | 3300025961 | Bacteria | 2269 |
| 402 | Ga0207712_10234109 | 3300025961 | Bacteria | 1476 |
| 403 | Ga0207668_10436882 | 3300025972 | Bacteria | 1114 |
| 404 | Ga0207677_10000085 | 3300026023 | Bacteria | 78393 |
| 405 | Ga0207703_10001689 | 3300026035 | Bacteria | 19855 |
| 406 | Ga0207703_10006205 | 3300026035 | Bacteria | 9564 |
| 407 | Ga0207703_10224453 | 3300026035 | Bacteria | 1681 |
| 408 | Ga0207639_10038697 | 3300026041 | Bacteria | 3549 |
| 409 | Ga0207639_10255690 | 3300026041 | Bacteria | 1530 |
| 410 | Ga0207639_10286758 | 3300026041 | Bacteria | 1450 |
| 411 | Ga0207678_10049937 | 3300026067 | Bacteria | 3615 |
| 412 | Ga0207678_10746243 | 3300026067 | Bacteria | 863 |
| 413 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 414 | Ga0207702_10005342 | 3300026078 | Bacteria | 11261 |
| 415 | Ga0207702_10423659 | 3300026078 | Bacteria | 1287 |
| 416 | Ga0207641_10028640 | 3300026088 | Bacteria | 4603 |
| 417 | Ga0207641_10341334 | 3300026088 | Bacteria | 1425 |
| 418 | Ga0207641_10389758 | 3300026088 | Bacteria | 1336 |
| 419 | Ga0207641_10518373 | 3300026088 | Bacteria | 1159 |
| 420 | Ga0207648_10000005 | 3300026089 | Bacteria | 225083 |
| 421 | Ga0207676_10001553 | 3300026095 | Bacteria | 16924 |
| 422 | Ga0207676_10159444 | 3300026095 | Bacteria | 1953 |
| 423 | Ga0207676_10369365 | 3300026095 | Bacteria | 1332 |
| 424 | Ga0207674_10000989 | 3300026116 | Bacteria | 37099 |
| 425 | Ga0207674_10017443 | 3300026116 | Bacteria | 7835 |
| 426 | Ga0207674_10018135 | 3300026116 | Bacteria | 7658 |
| 427 | Ga0207674_10484544 | 3300026116 | Bacteria | 1195 |
| 428 | Ga0207675_100343902 | 3300026118 | Bacteria | 1461 |
| 429 | Ga0207675_100537927 | 3300026118 | Bacteria | 1166 |
| 430 | Ga0207683_10149323 | 3300026121 | Bacteria | 2108 |
| 431 | Ga0207698_10000294 | 3300026142 | Bacteria | 30242 |
| 432 | Ga0207698_10033871 | 3300026142 | Bacteria | 3716 |
| 433 | Ga0207698_10264407 | 3300026142 | Bacteria | 1582 |
| 434 | Ga0207428_10207164 | 3300027907 | Bacteria | 1474 |
| 435 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 436 | Ga0268266_10126859 | 3300028379 | Bacteria | 2278 |
| 437 | Ga0268266_10154418 | 3300028379 | Bacteria | 2072 |
| 438 | Ga0268266_10166098 | 3300028379 | Bacteria | 2000 |
| 439 | Ga0268266_10235109 | 3300028379 | Bacteria | 1689 |
| 440 | Ga0268266_10545318 | 3300028379 | Bacteria | 1111 |
| 441 | Ga0268265_10023564 | 3300028380 | Bacteria | 4340 |
| 442 | Ga0268265_10036215 | 3300028380 | Bacteria | 3613 |
| 443 | Ga0268265_10453740 | 3300028380 | Bacteria | 1198 |
| 444 | Ga0268264_10000356 | 3300028381 | Bacteria | 68810 |
| 445 | Ga0307517_10176599 | 3300028786 | Bacteria | 1389 |
| 446 | Ga0307515_10033355 | 3300028794 | Bacteria | 8482 |
| 447 | Ga0307511_10034380 | 3300030521 | Bacteria | 4450 |
| 448 | Ga0307512_10191584 | 3300030522 | Bacteria | 1127 |
| 449 | Ga0265330_10010731 | 3300031235 | Bacteria | 4310 |
| 450 | Ga0265330_10063434 | 3300031235 | Bacteria | 1606 |
| 451 | Ga0265332_10151694 | 3300031238 | Bacteria | 969 |
| 452 | Ga0265320_10001345 | 3300031240 | Bacteria | 17924 |
| 453 | Ga0265340_10016299 | 3300031247 | Bacteria | 3849 |
| 454 | Ga0265340_10186514 | 3300031247 | Bacteria | 936 |
| 455 | Ga0265331_10032239 | 3300031250 | Bacteria | 2598 |
| 456 | Ga0265316_10045394 | 3300031344 | Bacteria | 3489 |
| 457 | Ga0307513_10079397 | 3300031456 | Bacteria | 3390 |
| 458 | Ga0307513_10270222 | 3300031456 | Bacteria | 1484 |
| 459 | Ga0307513_10306911 | 3300031456 | Bacteria | 1351 |
| 460 | Ga0307509_10192327 | 3300031507 | Bacteria | 1889 |
| 461 | Ga0307509_10541234 | 3300031507 | Bacteria | 843 |
| 462 | Ga0307408_100064798 | 3300031548 | Bacteria | 2678 |
| 463 | Ga0307508_10001949 | 3300031616 | Bacteria | 22585 |
| 464 | Ga0307508_10262591 | 3300031616 | Bacteria | 1321 |
| 465 | Ga0265314_10071962 | 3300031711 | Bacteria | 2311 |
| 466 | Ga0265314_10073784 | 3300031711 | Bacteria | 2274 |
| 467 | Ga0265342_10003269 | 3300031712 | Bacteria | 13437 |
| 468 | Ga0265342_10028180 | 3300031712 | Bacteria | 3502 |
| 469 | Ga0265342_10089269 | 3300031712 | Bacteria | 1769 |
| 470 | Ga0265342_10122932 | 3300031712 | Bacteria | 1460 |
| 471 | Ga0307516_10000034 | 3300031730 | Bacteria | 155251 |
| 472 | Ga0307516_10005305 | 3300031730 | Bacteria | 15512 |
| 473 | Ga0307516_10126728 | 3300031730 | Bacteria | 2337 |
| 474 | Ga0307405_10414785 | 3300031731 | Bacteria | 1058 |
| 475 | Ga0307412_10355937 | 3300031911 | Bacteria | 1177 |
| 476 | Ga0307412_10421289 | 3300031911 | Bacteria | 1092 |
| 477 | Ga0307414_10021121 | 3300032004 | Bacteria | 4076 |
| 478 | Ga0307414_10197404 | 3300032004 | Bacteria | 1633 |
| 479 | Ga0307510_10103437 | 3300033180 | Bacteria | 2625 |
| 480 | Ga0307510_10129319 | 3300033180 | Bacteria | 2204 |
| 481 | Ga0307510_10167278 | 3300033180 | Bacteria | 1784 |
| 482 | Ga0373934_0135557 | 3300035086 | Bacteria | 1005 |
| 483 | Ga0373944_0080706 | 3300035089 | Bacteria | 1074 |
| 484 | Ga0373923_0182533 | 3300035111 | Bacteria | 965 |
| 485 | Ga0373936_0086972 | 3300035113 | Bacteria | 1307 |
| 486 | Ga0373936_0187711 | 3300035113 | Bacteria | 909 |
| 487 | Ga0373955_0449417 | 3300035172 | Bacteria | 785 |
| 488 | Ga0373935_0005959 | 3300035692 | Bacteria | 7231 |
| 489 | Ga0373927_0002991 | 3300035695 | Bacteria | 12261 |
| 490 | Ga0373927_0014399 | 3300035695 | Bacteria | 5236 |
| 491 | Ga0373927_0049450 | 3300035695 | Bacteria | 2718 |
| 492 | Ga0373933_0285329 | 3300035724 | Bacteria | 1067 |
| 493 | Ga0373947_0040983 | 3300035725 | Bacteria | 2760 |
| 494 | Ga0373937_0047940 | 3300036401 | Bacteria | 3909 |
| 495 | Ga0310112_010758 | 3300036458 | Bacteria | 1307 |
| 496 | Ga0373925_0034633 | 3300037068 | Bacteria | 3722 |
| 497 | Ga0373925_0317917 | 3300037068 | Bacteria | 1259 |
| 498 | Ga0373925_0352501 | 3300037068 | Bacteria | 1195 |
| 499 | Ga0395899_0000026 | 3300037312 | Bacteria | 345291 |
| 500 | Ga0395899_0000713 | 3300037312 | Bacteria | 33291 |
| 501 | Ga0395899_0098311 | 3300037312 | Bacteria | 2114 |
| 502 | Ga0395899_0510502 | 3300037312 | Bacteria | 778 |
| 503 | Ga0395900_0025660 | 3300037418 | Bacteria | 6032 |
| 504 | Ga0395900_0200106 | 3300037418 | Bacteria | 2022 |
| 505 | Ga0395898_0058714 | 3300037466 | Bacteria | 3745 |
| 506 | Ga0395898_0204761 | 3300037466 | Bacteria | 1883 |
| 507 | Ga0395898_0289869 | 3300037466 | Bacteria | 1561 |
| 508 | Ga0395898_0443901 | 3300037466 | Bacteria | 1236 |
| 509 | Ga0395905_0012102 | 3300037471 | Bacteria | 8312 |
| 510 | Ga0395905_0034469 | 3300037471 | Bacteria | 4753 |
| 511 | Ga0395905_0050916 | 3300037471 | Bacteria | 3879 |
| 512 | Ga0395905_0061355 | 3300037471 | Bacteria | 3517 |
| 513 | Ga0395905_0070375 | 3300037471 | Bacteria | 3278 |
| 514 | Ga0395905_0078733 | 3300037471 | Bacteria | 3089 |
| 515 | Ga0395905_0410047 | 3300037471 | Bacteria | 1250 |
| 516 | Ga0395905_0876355 | 3300037471 | Bacteria | 801 |
| 517 | Ga0395901_0029430 | 3300038443 | Bacteria | 5656 |
| 518 | Ga0395901_0029978 | 3300038443 | Bacteria | 5604 |
| 519 | Ga0395901_0104792 | 3300038443 | Bacteria | 2968 |
| 520 | Ga0395901_0192446 | 3300038443 | Bacteria | 2139 |
| 521 | Ga0395901_0395262 | 3300038443 | Bacteria | 1421 |
| 522 | Ga0395901_0418805 | 3300038443 | Bacteria | 1374 |
| 523 | Ga0395901_0688279 | 3300038443 | Bacteria | 1021 |
| 524 | Ga0395901_0794163 | 3300038443 | Bacteria | 936 |
| 525 | Ga0436365_0140106 | 3300039437 | Bacteria | 2084 |
| 526 | Ga0436365_0449154 | 3300039437 | Bacteria | 1607 |
| 527 | Ga0436365_0503144 | 3300039437 | Bacteria | 3811 |
| 528 | Ga0436365_0916510 | 3300039437 | Bacteria | 28669 |
| 529 | Ga0436365_1541345 | 3300039437 | Bacteria | 20116 |
| 530 | Ga0436365_1602753 | 3300039437 | Bacteria | 4159 |
| 531 | Ga0436360_0479997 | 3300039438 | Bacteria | 1343 |
| 532 | Ga0436360_0795172 | 3300039438 | Bacteria | 791 |
| 533 | Ga0436361_0108203 | 3300039447 | Bacteria | 1212 |
| 534 | Ga0436361_0186477 | 3300039447 | Bacteria | 1340 |
| 535 | Ga0436361_0238923 | 3300039447 | Bacteria | 2966 |
| 536 | Ga0436361_0261403 | 3300039447 | Bacteria | 1358 |
| 537 | Ga0436361_0546846 | 3300039447 | Bacteria | 2777 |
| 538 | Ga0436361_0681592 | 3300039447 | Bacteria | 2168 |
| 539 | Ga0436361_0843361 | 3300039447 | Bacteria | 817 |
| 540 | Ga0436363_0168726 | 3300039450 | Bacteria | 4122 |
| 541 | Ga0436363_0599359 | 3300039450 | Bacteria | 7683 |
| 542 | Ga0436363_0885771 | 3300039450 | Bacteria | 980 |
| 543 | Ga0439436_0018407 | 3300041404 | Bacteria | 2088 |
| 544 | Ga0439461_0035617 | 3300041410 | Bacteria | 1056 |
| 545 | Ga0439465_0006377 | 3300041413 | Bacteria | 3746 |
| 546 | Ga0439431_0000187 | 3300041997 | Bacteria | 12043 |
| 547 | Ga0439431_0010651 | 3300041997 | Bacteria | 2088 |
| 548 | Ga0439442_002393 | 3300042002 | Bacteria | 3683 |
| 549 | Ga0439445_0000562 | 3300042004 | Bacteria | 7575 |
| 550 | Ga0439445_0069288 | 3300042004 | Bacteria | 974 |
| 551 | Ga0439448_0002340 | 3300042005 | Bacteria | 5139 |
| 552 | Ga0439448_0024185 | 3300042005 | Bacteria | 1898 |
| 553 | Ga0439432_003177 | 3300042006 | Bacteria | 6113 |
| 554 | Ga0439449_0053381 | 3300042007 | Bacteria | 1494 |
| 555 | Ga0439452_021467 | 3300042010 | Bacteria | 1682 |
| 556 | Ga0439455_0007335 | 3300042012 | Bacteria | 2329 |
| 557 | Ga0439455_0008361 | 3300042012 | Bacteria | 2216 |
| 558 | Ga0439455_0059366 | 3300042012 | Bacteria | 1012 |
| 559 | Ga0439455_0071768 | 3300042012 | Bacteria | 931 |
| 560 | Ga0439455_0102985 | 3300042012 | Bacteria | 790 |
| 561 | Ga0439457_001532 | 3300042014 | Bacteria | 6934 |
| 562 | Ga0450919_010306 | 3300042121 | Bacteria | 1070 |
| 563 | Ga0450923_017278 | 3300042125 | Bacteria | 1368 |
| 564 | Ga0450898_035919 | 3300042134 | Bacteria | 924 |
| 565 | Ga0450910_010396 | 3300042147 | Bacteria | 1325 |
| 566 | Ga0439446_0002031 | 3300042156 | Bacteria | 4791 |
| 567 | Ga0439458_0000986 | 3300042157 | Bacteria | 7274 |
| 568 | Ga0439458_0001013 | 3300042157 | Bacteria | 7188 |
| 569 | Ga0439458_0001992 | 3300042157 | Bacteria | 5069 |
| 570 | Ga0439434_0002604 | 3300042435 | Bacteria | 5251 |
| 571 | Ga0439435_0012758 | 3300042436 | Bacteria | 2044 |
| 572 | Ga0466972_0010990 | 3300044658 | Bacteria | 4545 |
| 573 | Ga0466965_0031586 | 3300044683 | Bacteria | 2583 |
| 574 | Ga0466966_0034352 | 3300044684 | Bacteria | 3279 |
| 575 | Ga0466966_0058072 | 3300044684 | Unclassified | 2446 |
| 576 | Ga0466966_0058718 | 3300044684 | Bacteria | 2431 |
| 577 | Ga0466966_0138559 | 3300044684 | Bacteria | 1487 |
| 578 | Ga0466961_0011581 | 3300044693 | Bacteria | 5637 |
| 579 | Ga0466963_0037193 | 3300044694 | Plasmid | 3177 |
| 580 | Ga0466963_0049597 | 3300044694 | Bacteria | 2777 |
| 581 | Ga0466963_0101375 | 3300044694 | Bacteria | 1971 |
| 582 | Ga0466964_0013581 | 3300044706 | Bacteria | 3089 |
| 583 | Ga0466964_0085777 | 3300044706 | Bacteria | 1360 |
| 584 | Ga0466971_0024553 | 3300044719 | Bacteria | 2690 |
| 585 | Ga0466971_0062460 | 3300044719 | Bacteria | 1685 |
| 586 | Ga0466968_0025710 | 3300044735 | Bacteria | 2413 |
| 587 | Ga0466968_0029848 | 3300044735 | Bacteria | 2257 |
| 588 | Ga0466970_0004968 | 3300044765 | Bacteria | 6570 |
| 589 | Ga0466970_0099144 | 3300044765 | Bacteria | 1586 |
| 590 | Ga0466957_0008884 | 3300044842 | Bacteria | 5725 |
| 591 | Ga0466957_0195426 | 3300044842 | Bacteria | 1327 |
| 592 | Ga0466957_0206052 | 3300044842 | Bacteria | 1293 |
| 593 | Ga0466960_0329898 | 3300044901 | Bacteria | 866 |
| 594 | Ga0466960_0374149 | 3300044901 | Bacteria | 816 |
| 595 | Ga0466959_0005917 | 3300045049 | Bacteria | 8424 |
| 596 | Ga0466959_0042510 | 3300045049 | Bacteria | 3352 |
| 597 | Ga0466959_0075547 | 3300045049 | Bacteria | 2434 |
| 598 | Ga0466959_0099323 | 3300045049 | Bacteria | 2084 |
| 599 | Ga0466959_0296235 | 3300045049 | Bacteria | 1108 |
| 600 | Ga0466959_0428104 | 3300045049 | Bacteria | 898 |
| 601 | Ga0466958_0000048 | 3300045836 | Bacteria | 35635 |
| 602 | Ga0466958_0021853 | 3300045836 | Bacteria | 3742 |
| 603 | Ga0466958_0057198 | 3300045836 | Bacteria | 2370 |
| 604 | Ga0466958_0093525 | 3300045836 | Unclassified | 1862 |
| 605 | Ga0466958_0359931 | 3300045836 | Bacteria | 937 |
| 606 | Ga0466967_0223964 | 3300045976 | Bacteria | 1788 |
| 607 | Ga0466967_0291750 | 3300045976 | Bacteria | 1567 |
| 608 | Ga0495627_000209 | 3300046453 | Bacteria | 63424 |
| 609 | Ga0495590_0002168 | 3300046457 | Bacteria | 8231 |
| 610 | Ga0495629_0418204 | 3300046459 | Bacteria | 910 |
| 611 | Ga0495638_0000326 | 3300046460 | Bacteria | 60360 |
| 612 | Ga0495638_0000434 | 3300046460 | Bacteria | 50529 |
| 613 | Ga0495638_0005521 | 3300046460 | Bacteria | 9392 |
| 614 | Ga0495638_0039729 | 3300046460 | Bacteria | 2985 |
| 615 | Ga0495638_0048119 | 3300046460 | Bacteria | 2670 |
| 616 | Ga0495638_0130212 | 3300046460 | Bacteria | 1478 |
| 617 | Ga0495638_0291070 | 3300046460 | Bacteria | 883 |
| 618 | Ga0495638_0293732 | 3300046460 | Bacteria | 878 |
| 619 | Ga0495641_0159147 | 3300046461 | Bacteria | 1010 |
| 620 | Ga0495651_0009405 | 3300046462 | Bacteria | 7507 |
| 621 | Ga0495651_0022220 | 3300046462 | Bacteria | 4932 |
| 622 | Ga0495650_0000069 | 3300046471 | Bacteria | 261124 |
| 623 | Ga0495650_0031088 | 3300046471 | Bacteria | 2408 |
| 624 | Ga0495650_0116783 | 3300046471 | Bacteria | 985 |
| 625 | Ga0495580_0348313 | 3300046472 | Bacteria | 1004 |
| 626 | Ga0495664_0277789 | 3300046477 | Bacteria | 1012 |
| 627 | Ga0495585_0207160 | 3300046492 | Bacteria | 996 |
| 628 | Ga0495594_0017602 | 3300046499 | Bacteria | 3778 |
| 629 | Ga0495594_0134716 | 3300046499 | Bacteria | 1400 |
| 630 | Ga0495607_0204649 | 3300046501 | Bacteria | 974 |
| 631 | Ga0495583_0094892 | 3300046506 | Bacteria | 1280 |
| 632 | Ga0495606_0016300 | 3300046507 | Bacteria | 5673 |
| 633 | Ga0495606_0349636 | 3300046507 | Bacteria | 785 |
| 634 | Ga0495610_0002007 | 3300046512 | Bacteria | 17407 |
| 635 | Ga0495610_0004447 | 3300046512 | Bacteria | 10361 |
| 636 | Ga0495610_0005291 | 3300046512 | Bacteria | 9230 |
| 637 | Ga0495610_0017507 | 3300046512 | Bacteria | 4083 |
| 638 | Ga0495616_0000115 | 3300046513 | Bacteria | 70371 |
| 639 | Ga0495631_0001223 | 3300046518 | Bacteria | 15856 |
| 640 | Ga0495631_0138305 | 3300046518 | Bacteria | 1046 |
| 641 | Ga0495631_0164379 | 3300046518 | Bacteria | 952 |
| 642 | Ga0495632_0012120 | 3300046519 | Bacteria | 4986 |
| 643 | Ga0495643_0212575 | 3300046522 | Bacteria | 922 |
| 644 | Ga0495643_0227646 | 3300046522 | Bacteria | 881 |
| 645 | Ga0495648_0000165 | 3300046524 | Bacteria | 78462 |
| 646 | Ga0495648_0053168 | 3300046524 | Bacteria | 2455 |
| 647 | Ga0495648_0112343 | 3300046524 | Bacteria | 1480 |
| 648 | Ga0495663_0025072 | 3300046525 | Bacteria | 1737 |
| 649 | Ga0495654_0000024 | 3300046530 | Bacteria | 238195 |
| 650 | Ga0495654_0012651 | 3300046530 | Bacteria | 4529 |
| 651 | Ga0495645_0177873 | 3300046543 | Bacteria | 1460 |
| 652 | Ga0495622_0005431 | 3300046557 | Bacteria | 5915 |
| 653 | Ga0495668_0000456 | 3300046616 | Bacteria | 52300 |
| 654 | Ga0495668_0015595 | 3300046616 | Bacteria | 4432 |
| 655 | Ga0495668_0018797 | 3300046616 | Bacteria | 3993 |
| 656 | Ga0495668_0023744 | 3300046616 | Bacteria | 3493 |
| 657 | Ga0495668_0035943 | 3300046616 | Bacteria | 2777 |
| 658 | Ga0495668_0074400 | 3300046616 | Bacteria | 1865 |
| 659 | Ga0495668_0081140 | 3300046616 | Bacteria | 1780 |
| 660 | Ga0495634_0326474 | 3300046642 | Bacteria | 923 |
| 661 | Ga0495611_0182921 | 3300046648 | Bacteria | 979 |
| 662 | Ga0495625_0000230 | 3300046660 | Bacteria | 88194 |
| 663 | Ga0495625_0004316 | 3300046660 | Bacteria | 13502 |
| 664 | Ga0495625_0006914 | 3300046660 | Bacteria | 10011 |
| 665 | Ga0495625_0018507 | 3300046660 | Bacteria | 5436 |
| 666 | Ga0495625_0039826 | 3300046660 | Bacteria | 3429 |
| 667 | Ga0495625_0073657 | 3300046660 | Bacteria | 2393 |
| 668 | Ga0495659_0131102 | 3300046664 | Bacteria | 994 |
| 669 | Ga0495661_0012280 | 3300046665 | Bacteria | 5785 |
| 670 | Ga0495588_0203650 | 3300046674 | Bacteria | 1045 |
| 671 | Ga0495657_0046244 | 3300046675 | Bacteria | 2949 |
| 672 | Ga0495599_0169263 | 3300046678 | Bacteria | 1348 |
| 673 | Ga0495623_0012870 | 3300046679 | Bacteria | 5419 |
| 674 | Ga0495613_0056042 | 3300046689 | Bacteria | 2895 |
| 675 | Ga0495613_0144755 | 3300046689 | Bacteria | 1697 |
| 676 | Ga0495670_0000029 | 3300046691 | Bacteria | 87662 |
| 677 | Ga0495670_0012601 | 3300046691 | Bacteria | 4158 |
| 678 | Ga0495671_0061171 | 3300046692 | Bacteria | 1858 |
| 679 | Ga0495660_0132991 | 3300046810 | Bacteria | 1246 |
| 680 | Ga0495581_0193504 | 3300047315 | Bacteria | 1190 |
| 681 | Ga0495604_0105632 | 3300047317 | Bacteria | 2061 |
| 682 | Ga0495604_0358796 | 3300047317 | Bacteria | 967 |
| 683 | Ga0495672_0019609 | 3300047320 | Bacteria | 4457 |
| 684 | Ga0495672_0145424 | 3300047320 | Bacteria | 1234 |
| 685 | Ga0495677_0008628 | 3300047445 | Bacteria | 3784 |
| 686 | Ga0495673_0000108 | 3300047469 | Bacteria | 168459 |
| 687 | Ga0495673_0000344 | 3300047469 | Bacteria | 58803 |
| 688 | Ga0495673_0003633 | 3300047469 | Bacteria | 10088 |
| 689 | Ga0495686_0004056 | 3300047472 | Bacteria | 12228 |
| 690 | Ga0495686_0011950 | 3300047472 | Bacteria | 6101 |
| 691 | Ga0495686_0013762 | 3300047472 | Bacteria | 5605 |
| 692 | Ga0495686_0036693 | 3300047472 | Bacteria | 3145 |
| 693 | Ga0495686_0074651 | 3300047472 | Bacteria | 2080 |
| 694 | Ga0495686_0132889 | 3300047472 | Bacteria | 1474 |
| 695 | Ga0495686_0156744 | 3300047472 | Bacteria | 1333 |
| 696 | Ga0495602_0194229 | 3300048088 | Bacteria | 1554 |
| 697 | Ga0495626_0061575 | 3300048091 | Bacteria | 1706 |
| 698 | Ga0496100_0306526 | 3300048903 | Bacteria | 1190 |
| 699 | Ga0496100_0327012 | 3300048903 | Bacteria | 1153 |
| 700 | Ga0496103_0174513 | 3300048906 | Bacteria | 1381 |
| 701 | Ga0496104_0001606 | 3300048907 | Bacteria | 19467 |
| 702 | Ga0496104_0001863 | 3300048907 | Bacteria | 18258 |
| 703 | Ga0496105_0008691 | 3300048908 | Bacteria | 7902 |
| 704 | Ga0496105_0443611 | 3300048908 | Bacteria | 1025 |
| 705 | Ga0496106_0001358 | 3300048909 | Bacteria | 18318 |
| 706 | Ga0496106_0044228 | 3300048909 | Bacteria | 3342 |
| 707 | Ga0496106_0052530 | 3300048909 | Bacteria | 3075 |
| 708 | Ga0496106_0736254 | 3300048909 | Bacteria | 784 |
| 709 | Ga0496107_0006558 | 3300048910 | Bacteria | 8007 |
| 710 | Ga0496107_0403907 | 3300048910 | Bacteria | 1016 |
| 711 | Ga0496108_0204804 | 3300048911 | Bacteria | 1712 |
| 712 | Ga0496108_0205223 | 3300048911 | Bacteria | 1710 |
| 713 | Ga0496110_0113009 | 3300048913 | Bacteria | 2442 |
| 714 | Ga0496110_0216548 | 3300048913 | Bacteria | 1741 |
| 715 | Ga0496111_0294153 | 3300048914 | Bacteria | 1204 |
| 716 | Ga0496111_0412806 | 3300048914 | Bacteria | 997 |
| 717 | Ga0496112_0908806 | 3300048915 | Bacteria | 802 |
| 718 | Ga0496113_0213646 | 3300048916 | Bacteria | 1536 |
| 719 | Ga0496114_0281214 | 3300048917 | Bacteria | 1467 |
| 720 | Ga0496114_0656583 | 3300048917 | Bacteria | 922 |
| 721 | Ga0496115_0000921 | 3300048918 | Bacteria | 21326 |
| 722 | Ga0496115_0001486 | 3300048918 | Bacteria | 16854 |
| 723 | Ga0496115_0004981 | 3300048918 | Bacteria | 9641 |
| 724 | Ga0496115_0020165 | 3300048918 | Bacteria | 5139 |
| 725 | Ga0496115_0101425 | 3300048918 | Bacteria | 2360 |
| 726 | Ga0496116_0000965 | 3300048919 | Bacteria | 35491 |
| 727 | Ga0496116_0143291 | 3300048919 | Bacteria | 1340 |
| 728 | Ga0496117_0013409 | 3300048920 | Bacteria | 7153 |
| 729 | Ga0496117_0034522 | 3300048920 | Bacteria | 3809 |
| 730 | Ga0496117_0105182 | 3300048920 | Bacteria | 1774 |
| 731 | Ga0496117_0106166 | 3300048920 | Bacteria | 1763 |
| 732 | Ga0496117_0144340 | 3300048920 | Bacteria | 1420 |
| 733 | Ga0496117_0148732 | 3300048920 | Bacteria | 1390 |
| 734 | Ga0496118_0003027 | 3300048921 | Bacteria | 21693 |
| 735 | Ga0496118_0010242 | 3300048921 | Bacteria | 9306 |
| 736 | Ga0496118_0020353 | 3300048921 | Bacteria | 5885 |
| 737 | Ga0496118_0028559 | 3300048921 | Bacteria | 4695 |
| 738 | Ga0496118_0039154 | 3300048921 | Bacteria | 3787 |
| 739 | Ga0496118_0070052 | 3300048921 | Bacteria | 2535 |
| 740 | Ga0496118_0084187 | 3300048921 | Bacteria | 2220 |
| 741 | Ga0496118_0120085 | 3300048921 | Bacteria | 1716 |
| 742 | Ga0496119_0024118 | 3300048922 | Bacteria | 4289 |
| 743 | Ga0496119_0035437 | 3300048922 | Bacteria | 3270 |
| 744 | Ga0496119_0051808 | 3300048922 | Bacteria | 2519 |
| 745 | Ga0496119_0064646 | 3300048922 | Bacteria | 2171 |
| 746 | Ga0496119_0119652 | 3300048922 | Bacteria | 1450 |
| 747 | Ga0496121_0001622 | 3300048924 | Bacteria | 37285 |
| 748 | Ga0496121_0007823 | 3300048924 | Bacteria | 12793 |
| 749 | Ga0496121_0023791 | 3300048924 | Bacteria | 5882 |
| 750 | Ga0496121_0028197 | 3300048924 | Bacteria | 5232 |
| 751 | Ga0496121_0036329 | 3300048924 | Bacteria | 4392 |
| 752 | Ga0496121_0126551 | 3300048924 | Bacteria | 1919 |
| 753 | Ga0496121_0161432 | 3300048924 | Bacteria | 1638 |
| 754 | Ga0496121_0208762 | 3300048924 | Bacteria | 1385 |
| 755 | Ga0496121_0244912 | 3300048924 | Bacteria | 1247 |
| 756 | Ga0496121_0289800 | 3300048924 | Bacteria | 1116 |
| 757 | Ga0496121_0366225 | 3300048924 | Bacteria | 955 |
| 758 | Ga0496122_0024545 | 3300048925 | Bacteria | 5272 |
| 759 | Ga0496122_0036640 | 3300048925 | Bacteria | 3962 |
| 760 | Ga0496122_0209236 | 3300048925 | Bacteria | 1132 |
| 761 | Ga0496123_0022020 | 3300048926 | Bacteria | 4930 |
| 762 | Ga0496123_0065829 | 3300048926 | Bacteria | 2299 |
| 763 | Ga0496124_0002957 | 3300048927 | Bacteria | 21339 |
| 764 | Ga0496124_0049091 | 3300048927 | Bacteria | 3602 |
| 765 | Ga0496124_0095992 | 3300048927 | Bacteria | 2409 |
| 766 | Ga0496124_0218398 | 3300048927 | Bacteria | 1436 |
| 767 | Ga0496124_0231950 | 3300048927 | Bacteria | 1379 |
| 768 | Ga0496124_0266812 | 3300048927 | Bacteria | 1256 |
| 769 | Ga0496124_0469553 | 3300048927 | Bacteria | 853 |
| 770 | Ga0496124_0526149 | 3300048927 | Bacteria | 786 |
| 771 | Ga0496125_0001630 | 3300048928 | Bacteria | 31638 |
| 772 | Ga0496125_0056184 | 3300048928 | Bacteria | 3199 |
| 773 | Ga0496125_0083260 | 3300048928 | Bacteria | 2434 |
| 774 | Ga0496125_0089991 | 3300048928 | Bacteria | 2306 |
| 775 | Ga0496125_0095264 | 3300048928 | Bacteria | 2215 |
| 776 | Ga0496125_0099406 | 3300048928 | Bacteria | 2149 |
| 777 | Ga0496125_0137524 | 3300048928 | Bacteria | 1706 |
| 778 | Ga0496125_0242362 | 3300048928 | Bacteria | 1144 |
| 779 | Ga0496125_0281648 | 3300048928 | Bacteria | 1029 |
| 780 | Ga0496125_0295403 | 3300048928 | Bacteria | 995 |
| 781 | Ga0496126_0003803 | 3300048929 | Bacteria | 18741 |
| 782 | Ga0496126_0028894 | 3300048929 | Bacteria | 5275 |
| 783 | Ga0496126_0033555 | 3300048929 | Bacteria | 4827 |
| 784 | Ga0496126_0070139 | 3300048929 | Bacteria | 3123 |
| 785 | Ga0496126_0081503 | 3300048929 | Bacteria | 2860 |
| 786 | Ga0496126_0104438 | 3300048929 | Bacteria | 2475 |
| 787 | Ga0496126_0312538 | 3300048929 | Bacteria | 1293 |
| 788 | Ga0496126_0373969 | 3300048929 | Bacteria | 1161 |
| 789 | Ga0496126_0486006 | 3300048929 | Bacteria | 989 |
| 790 | Ga0495678_003911 | 3300049459 | Bacteria | 8931 |
| 791 | Ga0495682_0081120 | 3300049460 | Bacteria | 1167 |
| 792 | Ga0495682_0131024 | 3300049460 | Bacteria | 897 |
| 793 | Ga0501031_0003114 | 3300049568 | Bacteria | 10626 |
| 794 | Ga0501031_0026710 | 3300049568 | Bacteria | 3763 |
| 795 | Ga0501032_0000762 | 3300049569 | Bacteria | 26183 |
| 796 | Ga0501032_0056815 | 3300049569 | Bacteria | 2630 |
| 797 | Ga0501032_0071436 | 3300049569 | Bacteria | 2313 |
| 798 | Ga0501033_0000136 | 3300049570 | Bacteria | 70952 |
| 799 | Ga0501033_0026715 | 3300049570 | Bacteria | 4342 |
| 800 | Ga0501033_0057089 | 3300049570 | Bacteria | 2886 |
| 801 | Ga0501033_0098622 | 3300049570 | Bacteria | 2133 |
| 802 | Ga0501033_0267830 | 3300049570 | Bacteria | 1208 |
| 803 | Ga0501033_0336784 | 3300049570 | Bacteria | 1058 |
| 804 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 805 | Ga0501034_0008471 | 3300049571 | Bacteria | 10862 |
| 806 | Ga0501034_0025849 | 3300049571 | Bacteria | 5980 |
| 807 | Ga0501034_0099688 | 3300049571 | Bacteria | 2900 |
| 808 | Ga0501034_0134299 | 3300049571 | Bacteria | 2456 |
| 809 | Ga0501034_0146924 | 3300049571 | Bacteria | 2335 |
| 810 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 811 | Ga0501036_0095905 | 3300049572 | Bacteria | 2507 |
| 812 | Ga0501036_0139078 | 3300049572 | Bacteria | 2049 |
| 813 | Ga0501037_0000867 | 3300049573 | Bacteria | 22596 |
| 814 | Ga0501037_0186696 | 3300049573 | Bacteria | 1469 |
| 815 | Ga0501037_0190511 | 3300049573 | Bacteria | 1452 |
| 816 | Ga0501038_0000428 | 3300049574 | Bacteria | 36623 |
| 817 | Ga0501038_0036231 | 3300049574 | Bacteria | 4330 |
| 818 | Ga0501038_0203480 | 3300049574 | Bacteria | 1588 |
| 819 | Ga0501038_0223971 | 3300049574 | Bacteria | 1499 |
| 820 | Ga0501038_0247921 | 3300049574 | Bacteria | 1412 |
| 821 | Ga0501039_0000273 | 3300049575 | Bacteria | 37431 |
| 822 | Ga0501039_0032382 | 3300049575 | Bacteria | 4030 |
| 823 | Ga0501042_0170613 | 3300049578 | Bacteria | 1570 |
| 824 | Ga0501043_0000165 | 3300049579 | Bacteria | 59980 |
| 825 | Ga0501043_0027908 | 3300049579 | Bacteria | 4431 |
| 826 | Ga0501043_0198896 | 3300049579 | Bacteria | 1556 |
| 827 | Ga0501043_0205795 | 3300049579 | Bacteria | 1526 |
| 828 | Ga0501043_0223047 | 3300049579 | Bacteria | 1457 |
| 829 | Ga0501043_0289433 | 3300049579 | Bacteria | 1254 |
| 830 | Ga0501043_0624811 | 3300049579 | Bacteria | 793 |
| 831 | Ga0501046_0000839 | 3300049580 | Bacteria | 29959 |
| 832 | Ga0501046_0516206 | 3300049580 | Bacteria | 854 |
| 833 | Ga0501047_0000340 | 3300049581 | Bacteria | 53278 |
| 834 | Ga0501047_0001905 | 3300049581 | Bacteria | 20058 |
| 835 | Ga0501047_0003425 | 3300049581 | Bacteria | 14995 |
| 836 | Ga0501047_0041364 | 3300049581 | Bacteria | 4454 |
| 837 | Ga0501047_0458913 | 3300049581 | Bacteria | 1103 |
| 838 | Ga0501048_0001309 | 3300049582 | Bacteria | 18872 |
| 839 | Ga0501048_0046616 | 3300049582 | Bacteria | 3094 |
| 840 | Ga0501067_0000457 | 3300049583 | Bacteria | 22383 |
| 841 | Ga0501067_0087210 | 3300049583 | Bacteria | 1732 |
| 842 | Ga0501067_0135039 | 3300049583 | Bacteria | 1373 |
| 843 | Ga0501068_0000839 | 3300049584 | Bacteria | 15999 |
| 844 | Ga0501068_0032662 | 3300049584 | Bacteria | 3095 |
| 845 | Ga0501069_0032150 | 3300049585 | Bacteria | 2888 |
| 846 | Ga0501069_0066434 | 3300049585 | Bacteria | 2017 |
| 847 | Ga0501070_0000971 | 3300049586 | Bacteria | 25732 |
| 848 | Ga0501070_0073648 | 3300049586 | Bacteria | 2826 |
| 849 | Ga0501070_0577973 | 3300049586 | Bacteria | 897 |
| 850 | Ga0501071_0079057 | 3300049587 | Bacteria | 2404 |
| 851 | Ga0501072_0003301 | 3300049588 | Bacteria | 12139 |
| 852 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 853 | Ga0501073_0065517 | 3300049589 | Bacteria | 2533 |
| 854 | Ga0501074_0000167 | 3300049590 | Bacteria | 35108 |
| 855 | Ga0501074_0259375 | 3300049590 | Bacteria | 1236 |
| 856 | Ga0501076_0191321 | 3300049592 | Bacteria | 1670 |
| 857 | Ga0501079_0002302 | 3300049741 | Bacteria | 13814 |
| 858 | Ga0501080_0006603 | 3300049742 | Bacteria | 10426 |
| 859 | Ga0501080_0055199 | 3300049742 | Bacteria | 3700 |
| 860 | Ga0501080_0080214 | 3300049742 | Bacteria | 3033 |
| 861 | Ga0501080_0084313 | 3300049742 | Bacteria | 2952 |
| 862 | Ga0501083_0001812 | 3300049744 | Bacteria | 14636 |
| 863 | Ga0501083_0016896 | 3300049744 | Bacteria | 5097 |
| 864 | Ga0501083_0042452 | 3300049744 | Bacteria | 3083 |
| 865 | Ga0501241_006927 | 3300049758 | Bacteria | 2082 |
| 866 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 867 | Ga0501035_0006052 | 3300049822 | Bacteria | 11395 |
| 868 | Ga0501035_0088777 | 3300049822 | Bacteria | 2723 |
| 869 | Ga0501035_0185286 | 3300049822 | Bacteria | 1792 |
| 870 | Ga0501035_0319208 | 3300049822 | Bacteria | 1305 |
| 871 | Ga0501044_0000414 | 3300049823 | Bacteria | 52784 |
| 872 | Ga0501044_0008740 | 3300049823 | Bacteria | 11085 |
| 873 | Ga0501044_0013526 | 3300049823 | Bacteria | 8821 |
| 874 | Ga0501044_0021563 | 3300049823 | Bacteria | 6869 |
| 875 | Ga0501044_0022908 | 3300049823 | Bacteria | 6650 |
| 876 | Ga0501044_0076769 | 3300049823 | Bacteria | 3389 |
| 877 | Ga0501044_0083517 | 3300049823 | Bacteria | 3230 |
| 878 | Ga0501044_0100473 | 3300049823 | Bacteria | 2911 |
| 879 | Ga0501044_0286077 | 3300049823 | Bacteria | 1581 |
| 880 | Ga0501044_0394898 | 3300049823 | Bacteria | 1296 |
| 881 | Ga0501045_0002539 | 3300049824 | Bacteria | 12434 |
| 882 | nmdc:mga03n38_180079_c1 | 3300050490 | Bacteria | 1082 |
| 883 | nmdc:mga03n38_3129_c1 | 3300050490 | Bacteria | 5263 |
| 884 | nmdc:mga00v17_26492_c1 | 3300050491 | Bacteria | 3380 |
| 885 | nmdc:mga00v17_28827_c1 | 3300050491 | Bacteria | 3254 |
| 886 | nmdc:mga00v17_51403_c1 | 3300050491 | Bacteria | 2506 |
| 887 | nmdc:mga00v17_59417_c1 | 3300050491 | Bacteria | 2346 |
| 888 | nmdc:mga00v17_69035_c1 | 3300050491 | Bacteria | 2186 |
| 889 | nmdc:mga0yw44_179253_c1 | 3300050492 | Bacteria | 1394 |
| 890 | nmdc:mga0yw44_23081_c1 | 3300050492 | Bacteria | 3501 |
| 891 | nmdc:mga0yw44_341776_c1 | 3300050492 | Bacteria | 1007 |
| 892 | nmdc:mga0yw44_4551_c1 | 3300050492 | Bacteria | 6383 |
| 893 | nmdc:mga0yw44_50500_c1 | 3300050492 | Bacteria | 2515 |
| 894 | nmdc:mga0yw44_7729_c1 | 3300050492 | Bacteria | 5309 |
| 895 | nmdc:mga0yw44_84115_c1 | 3300050492 | Bacteria | 2000 |
| 896 | nmdc:mga0k408_14464_c1 | 3300050493 | Bacteria | 4350 |
| 897 | nmdc:mga0k408_199183_c1 | 3300050493 | Bacteria | 1195 |
| 898 | nmdc:mga06z11_138892_c1 | 3300050494 | Bacteria | 1372 |
| 899 | nmdc:mga06z11_4688_c1 | 3300050494 | Bacteria | 5399 |
| 900 | nmdc:mga04h51_98496_c1 | 3300050495 | Bacteria | 1062 |
| 901 | nmdc:mga07m45_32567_c1 | 3300050496 | Bacteria | 2890 |
| 902 | nmdc:mga05p37_650235_c1 | 3300050507 | Bacteria | 1181 |
| 903 | nmdc:mga0rr50_234301_c1 | 3300050513 | Bacteria | 1520 |
| 904 | nmdc:mga08x19_86194_c1 | 3300050514 | Bacteria | 2067 |
| 905 | nmdc:mga0sz30_2586_c1 | 3300050516 | Bacteria | 6435 |
| 906 | nmdc:mga0sz30_4919_c1 | 3300050516 | Bacteria | 4868 |
| 907 | nmdc:mga0sz30_51614_c1 | 3300050516 | Bacteria | 1745 |
| 908 | nmdc:mga0sz30_75666_c1 | 3300050516 | Bacteria | 1453 |
| 909 | Ga0495595_0087546 | 3300053084 | Bacteria | 1491 |
| 910 | Ga0500578_0000056 | 3300053086 | Bacteria | 120189 |
| 911 | Ga0500578_0113492 | 3300053086 | Bacteria | 1707 |
| 912 | Ga0500578_0190611 | 3300053086 | Bacteria | 1259 |
| 913 | Ga0500578_0193464 | 3300053086 | Bacteria | 1248 |
| 914 | Ga0500578_0230005 | 3300053086 | Bacteria | 1124 |
| 915 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 916 | Ga0500643_000548 | 3300053087 | Bacteria | 26252 |
| 917 | Ga0500643_005672 | 3300053087 | Bacteria | 5335 |
| 918 | Ga0500643_010845 | 3300053087 | Bacteria | 3365 |
| 919 | Ga0500643_012763 | 3300053087 | Bacteria | 2996 |
| 920 | Ga0500643_070398 | 3300053087 | Bacteria | 971 |
| 921 | Ga0500644_0000089 | 3300053088 | Bacteria | 56897 |
| 922 | Ga0500644_0028932 | 3300053088 | Bacteria | 1737 |
| 923 | Ga0500644_0044232 | 3300053088 | Bacteria | 1494 |
| 924 | Ga0500647_0093291 | 3300053091 | Bacteria | 1440 |
| 925 | Ga0500647_0178970 | 3300053091 | Bacteria | 974 |
| 926 | Ga0500583_0010766 | 3300053092 | Bacteria | 3412 |
| 927 | Ga0500583_0060762 | 3300053092 | Bacteria | 1783 |
| 928 | Ga0500651_0002004 | 3300053093 | Bacteria | 10570 |
| 929 | Ga0500651_0002704 | 3300053093 | Bacteria | 9450 |
| 930 | Ga0500651_0014869 | 3300053093 | Bacteria | 4768 |
| 931 | Ga0500651_0215834 | 3300053093 | Bacteria | 1127 |
| 932 | Ga0500566_0002605 | 3300053094 | Bacteria | 10733 |
| 933 | Ga0500566_0003780 | 3300053094 | Bacteria | 9033 |
| 934 | Ga0500566_0006460 | 3300053094 | Bacteria | 6955 |
| 935 | Ga0500566_0075920 | 3300053094 | Bacteria | 1879 |
| 936 | Ga0500641_0018004 | 3300053096 | Bacteria | 2652 |
| 937 | Ga0500641_0023374 | 3300053096 | Bacteria | 2377 |
| 938 | Ga0500641_0025472 | 3300053096 | Bacteria | 2289 |
| 939 | Ga0500641_0032761 | 3300053096 | Bacteria | 2058 |
| 940 | Ga0500641_0054141 | 3300053096 | Bacteria | 1658 |
| 941 | Ga0500650_0025917 | 3300053098 | Bacteria | 2625 |
| 942 | Ga0500554_041214 | 3300053102 | Bacteria | 1418 |
| 943 | Ga0500555_027405 | 3300053103 | Bacteria | 1625 |
| 944 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 945 | Ga0500556_0001687 | 3300053104 | Bacteria | 8514 |
| 946 | Ga0500562_000489 | 3300053108 | Bacteria | 9608 |
| 947 | Ga0500562_006991 | 3300053108 | Bacteria | 2846 |
| 948 | Ga0500562_016473 | 3300053108 | Bacteria | 1901 |
| 949 | Ga0500562_027131 | 3300053108 | Bacteria | 1502 |
| 950 | Ga0500594_0000724 | 3300053118 | Bacteria | 7016 |
| 951 | Ga0500594_0086696 | 3300053118 | Bacteria | 944 |
| 952 | Ga0500595_000333 | 3300053119 | Bacteria | 30925 |
| 953 | Ga0500595_000497 | 3300053119 | Bacteria | 23997 |
| 954 | Ga0500595_000553 | 3300053119 | Bacteria | 22382 |
| 955 | Ga0500595_002282 | 3300053119 | Bacteria | 9644 |
| 956 | Ga0500608_000207 | 3300053122 | Bacteria | 23415 |
| 957 | Ga0500608_063928 | 3300053122 | Bacteria | 1756 |
| 958 | Ga0500608_141759 | 3300053122 | Bacteria | 1064 |
| 959 | Ga0500614_015345 | 3300053123 | Bacteria | 1707 |
| 960 | Ga0500614_040520 | 3300053123 | Bacteria | 1182 |
| 961 | Ga0500618_000034 | 3300053125 | Bacteria | 120560 |
| 962 | Ga0500618_006607 | 3300053125 | Bacteria | 3387 |
| 963 | Ga0500628_081385 | 3300053129 | Bacteria | 830 |
| 964 | Ga0500642_0000015 | 3300053130 | Bacteria | 181424 |
| 965 | Ga0500642_0001744 | 3300053130 | Bacteria | 6273 |
| 966 | Ga0500642_0015152 | 3300053130 | Bacteria | 2890 |
| 967 | Ga0500642_0133221 | 3300053130 | Bacteria | 1165 |
| 968 | Ga0500642_0197676 | 3300053130 | Bacteria | 936 |
| 969 | Ga0500652_010728 | 3300053131 | Bacteria | 3151 |
| 970 | Ga0500652_011638 | 3300053131 | Bacteria | 3057 |
| 971 | Ga0500652_083744 | 3300053131 | Bacteria | 1329 |
| 972 | Ga0500655_000460 | 3300053133 | Bacteria | 8332 |
| 973 | Ga0500658_0000793 | 3300053134 | Bacteria | 13099 |
| 974 | Ga0500658_0001085 | 3300053134 | Bacteria | 11126 |
| 975 | Ga0500658_0010451 | 3300053134 | Bacteria | 3424 |
| 976 | Ga0500658_0031805 | 3300053134 | Bacteria | 2066 |
| 977 | Ga0500658_0055776 | 3300053134 | Bacteria | 1628 |
| 978 | Ga0500658_0165245 | 3300053134 | Bacteria | 1003 |
| 979 | Ga0500559_0000112 | 3300053136 | Bacteria | 63817 |
| 980 | Ga0500559_0001714 | 3300053136 | Bacteria | 12043 |
| 981 | Ga0500559_0033232 | 3300053136 | Bacteria | 2220 |
| 982 | Ga0500559_0081897 | 3300053136 | Bacteria | 1468 |
| 983 | Ga0500559_0089806 | 3300053136 | Bacteria | 1405 |
| 984 | Ga0500559_0147656 | 3300053136 | Bacteria | 1103 |
| 985 | Ga0500564_000057 | 3300053138 | Bacteria | 29651 |
| 986 | Ga0500564_150650 | 3300053138 | Bacteria | 992 |
| 987 | Ga0500568_0000536 | 3300053139 | Bacteria | 27978 |
| 988 | Ga0500568_0005756 | 3300053139 | Bacteria | 6345 |
| 989 | Ga0500568_0016371 | 3300053139 | Bacteria | 3298 |
| 990 | Ga0500568_0049176 | 3300053139 | Bacteria | 1665 |
| 991 | Ga0500568_0077254 | 3300053139 | Bacteria | 1267 |
| 992 | Ga0500568_0084110 | 3300053139 | Bacteria | 1205 |
| 993 | Ga0500568_0084443 | 3300053139 | Bacteria | 1202 |
| 994 | Ga0500568_0092354 | 3300053139 | Bacteria | 1141 |
| 995 | Ga0500573_0067724 | 3300053140 | Bacteria | 2040 |
| 996 | Ga0500586_000330 | 3300053145 | Bacteria | 9419 |
| 997 | Ga0500588_0059114 | 3300053146 | Bacteria | 1222 |
| 998 | Ga0500590_000163 | 3300053148 | Bacteria | 19391 |
| 999 | Ga0500590_007211 | 3300053148 | Bacteria | 5474 |
| 1000 | Ga0500590_031070 | 3300053148 | Bacteria | 2769 |
| 1001 | Ga0500590_046959 | 3300053148 | Bacteria | 2206 |
| 1002 | Ga0500603_014424 | 3300053150 | Bacteria | 1846 |
| 1003 | Ga0500603_087833 | 3300053150 | Bacteria | 909 |
| 1004 | Ga0500604_0053896 | 3300053151 | Bacteria | 1247 |
| 1005 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1006 | Ga0500616_0001587 | 3300053153 | Bacteria | 21239 |
| 1007 | Ga0500616_0030013 | 3300053153 | Bacteria | 2988 |
| 1008 | Ga0500616_0118939 | 3300053153 | Bacteria | 1265 |
| 1009 | Ga0500622_0001006 | 3300053156 | Bacteria | 23789 |
| 1010 | Ga0500622_0001762 | 3300053156 | Bacteria | 16622 |
| 1011 | Ga0500622_0006755 | 3300053156 | Bacteria | 6605 |
| 1012 | Ga0500622_0017921 | 3300053156 | Bacteria | 3767 |
| 1013 | Ga0500622_0023088 | 3300053156 | Bacteria | 3296 |
| 1014 | Ga0500622_0026896 | 3300053156 | Bacteria | 3033 |
| 1015 | Ga0500622_0141881 | 3300053156 | Bacteria | 1145 |
| 1016 | Ga0500627_0043782 | 3300053158 | Bacteria | 1931 |
| 1017 | Ga0500627_0081653 | 3300053158 | Bacteria | 1441 |
| 1018 | Ga0500638_016198 | 3300053162 | Bacteria | 3434 |
| 1019 | Ga0500639_060191 | 3300053163 | Bacteria | 1958 |
| 1020 | Ga0500636_0015308 | 3300053177 | Bacteria | 4519 |
| 1021 | Ga0500636_0040450 | 3300053177 | Bacteria | 2757 |
| 1022 | Ga0500637_0000060 | 3300053178 | Bacteria | 38881 |
| 1023 | Ga0500570_004099 | 3300053724 | Bacteria | 7619 |
| 1024 | Ga0500570_077593 | 3300053724 | Bacteria | 1515 |
| 1025 | Ga0500611_021920 | 3300053727 | Bacteria | 1225 |
| 1026 | Ga0500611_027584 | 3300053727 | Bacteria | 1145 |
| 1027 | Ga0500645_000883 | 3300053730 | Bacteria | 17431 |
| 1028 | Ga0500645_029154 | 3300053730 | Bacteria | 1667 |
| 1029 | Ga0500645_064013 | 3300053730 | Bacteria | 1061 |
| 1030 | Ga0500609_000027 | 3300053731 | Bacteria | 21239 |
| 1031 | Ga0500609_002135 | 3300053731 | Bacteria | 2832 |
| 1032 | Ga0500596_001647 | 3300053735 | Bacteria | 4511 |
| 1033 | Ga0500599_002351 | 3300053736 | Bacteria | 2264 |
| 1034 | Ga0501084_0005116 | 3300054114 | Bacteria | 10737 |
| 1035 | Ga0501084_0254685 | 3300054114 | Bacteria | 1482 |
| 1036 | Ga0500661_001013 | 3300055283 | Bacteria | 5278 |
| 1037 | Ga0501082_0004333 | 3300060353 | Bacteria | 12407 |
| 1038 | Ga0501082_0098486 | 3300060353 | Bacteria | 2528 |
| 1039 | Ga0466962_0001247 | 3300061719 | Bacteria | 11734 |
| 1040 | 2509151565 | 2508501128 | Bacteria | 8613869 |
| 1041 | 2511124191 | 2510917020 | Bacteria | 5657507 |
| 1042 | 2513891646 | 2513237141 | Bacteria | 8496279 |
| 1043 | 2517105700 | 2517093001 | Bacteria | 9002274 |
| 1044 | 2524435444 | 2524023205 | Bacteria | 8918781 |
| 1045 | 2585147145 | 2582581279 | Bacteria | 4980720 |
| 1046 | 2585150853 | 2582581280 | Bacteria | 5994497 |
| 1047 | 2585195825 | 2582581293 | Bacteria | 5907401 |
| 1048 | 2585259718 | 2582581305 | Bacteria | 4895574 |
| 1049 | 2587918018 | 2585428106 | Bacteria | 5179711 |
| 1050 | 2603860096 | 2602042107 | Bacteria | 6226103 |
| 1051 | 2643748399 | 2643221545 | Bacteria | 5083237 |
| 1052 | 2643780674 | 2643221552 | Bacteria | 5708754 |
| 1053 | 2643923880 | 2643221583 | Bacteria | 5218014 |
| 1054 | 2643929447 | 2643221584 | Bacteria | 5511711 |
| 1055 | 2643998673 | 2643221598 | Bacteria | 4578346 |
| 1056 | 2644087375 | 2643221614 | Bacteria | 4260023 |
| 1057 | 2644125726 | 2643221622 | Bacteria | 4212502 |
| 1058 | 2644224552 | 2643221640 | Bacteria | 5258820 |
| 1059 | 2644234513 | 2643221642 | Bacteria | 5357871 |
| 1060 | 2644344581 | 2643221661 | Bacteria | 4267604 |
| 1061 | 2644366735 | 2643221666 | Bacteria | 4265935 |
| 1062 | 2644508212 | 2643221691 | Bacteria | 5093099 |
| 1063 | 2745081392 | 2744054633 | Bacteria | 8678936 |
| 1064 | 2792458916 | 2791355048 | Bacteria | 5832535 |
| 1065 | 2819538598 | 2818991435 | Bacteria | 5433759 |
| 1066 | 2819646868 | 2818991454 | Bacteria | 5563326 |
| 1067 | 2824706075 | 2824704595 | Bacteria | 9667483 |
| 1068 | 2824760292 | 2824753945 | Bacteria | 9787441 |
| 1069 | 2824771531 | 2824763712 | Bacteria | 9792355 |
| 1070 | 2824775749 | 2824773399 | Bacteria | 8360218 |
| 1071 | 2841965297 | 2841957949 | Bacteria | 8652217 |
| 1072 | 2842044359 | 2842038055 | Bacteria | 8002051 |
| 1073 | 2842051652 | 2842045827 | Bacteria | 8006841 |
| 1074 | 2843749072 | 2843744320 | Bacteria | 5659202 |
| 1075 | 2849564398 | 2849560528 | Bacteria | 5393480 |
| 1076 | 2849575270 | 2849573788 | Bacteria | 5421256 |
| 1077 | 2851155526 | 2851153111 | Bacteria | 5542585 |
| 1078 | 2857504811 | 2857504554 | Bacteria | 5369913 |
| 1079 | 2857525079 | 2857524615 | Bacteria | 6615449 |
| 1080 | 2874622434 | 2874620515 | Bacteria | 8290088 |
| 1081 | 2876761700 | 2876761206 | Bacteria | 10111113 |
| 1082 | 2884965359 | 2884960567 | Bacteria | 5437054 |
| 1083 | 2893069665 | 2893066018 | Bacteria | 6158120 |
| 1084 | 2898330873 | 2898329390 | Bacteria | 5168154 |
| 1085 | 2904671559 | 2904666416 | Bacteria | 8226587 |
| 1086 | 2904718102 | 2904711408 | Bacteria | 9771557 |
| 1087 | 2919078967 | 2919073203 | Bacteria | 6531949 |
| 1088 | 2928532858 | 2928531327 | Bacteria | 5101314 |
| 1089 | 8006928840 | 8006926726 | Bacteria | 6749210 |
| 1090 | 8016526936 | 8016522445 | Bacteria | 8156687 |
| 1091 | 8016532020 | 8016530956 | Bacteria | 8155261 |
| 1092 | 8016556858 | 8016548790 | Bacteria | 8155074 |
| 1093 | 8016565211 | 8016557553 | Bacteria | 8154380 |
| 1094 | 8016582856 | 8016575299 | Bacteria | 8154085 |
| 1095 | 8016602854 | 8016595262 | Bacteria | 8149947 |
| 1096 | 8019531837 | 8019530166 | Bacteria | 8155624 |
| 1097 | Ga0495583_0000001 | |||
| 1098 | ARCol0yngRDRAFT_1002743 | |||
| 1099 | JGI24739J22299_10082974 | |||
| 1100 | JGI24737J22298_10001157 | |||
| 1101 | JGI24737J22298_10002048 | |||
| 1102 | JGI24737J22298_10006756 | |||
| 1103 | JGI24735J21928_10004802 | |||
| 1104 | JGI24735J21928_10011300 | |||
| 1105 | JGI24735J21928_10017522 | |||
| 1106 | JGI24735J21928_10031649 | |||
| 1107 | JGI24744J21845_10010918 | |||
| 1108 | JGI25150J39212_1001113 | |||
| 1109 | JGI25406J46586_10000513 | |||
| 1110 | JGI25165J46597_1000007 | |||
| 1111 | JGI25165J46597_1000165 | |||
| 1112 | JGI25153J46596_10000103 | |||
| 1113 | JGI25153J46596_10000253 | |||
| 1114 | JGI25153J46596_10000301 | |||
| 1115 | rootL2_10056079 | |||
| 1116 | rootL2_10085247 | |||
| 1117 | rootL2_10136953 | |||
| 1118 | JGI25160J50197_1002871 | |||
| 1119 | Ga0055526_1002472 | |||
| 1120 | Ga0055526_1023389 | |||
| 1121 | Ga0055526_1030086 | |||
| 1122 | Ga0055526_1046549 | |||
| 1123 | Ga0055537_1000720 | |||
| 1124 | Ga0055537_1001200 | |||
| 1125 | Ga0055537_1005264 | |||
| 1126 | Ga0055524_1000561 | |||
| 1127 | Ga0055524_1010000 | |||
| 1128 | Ga0055524_1051165 | |||
| 1129 | Ga0055536_1000883 | |||
| 1130 | Ga0055536_1001272 | |||
| 1131 | Ga0055528_1007152 | |||
| 1132 | Ga0055530_10001417 | |||
| 1133 | Ga0055530_10007674 | |||
| 1134 | Ga0055530_10034337 | |||
| 1135 | Ga0055540_1003607 | |||
| 1136 | Ga0055531_10000274 | |||
| 1137 | Ga0055531_10001047 | |||
| 1138 | Ga0055531_10005338 | |||
| 1139 | Ga0055531_10022251 | |||
| 1140 | Ga0055531_10036703 | |||
| 1141 | Ga0055543_1020464 | |||
| 1142 | Ga0065165_1000256 | |||
| 1143 | Ga0065165_1001164 | |||
| 1144 | Ga0065165_1001167 | |||
| 1145 | Ga0065165_1004950 | |||
| 1146 | Ga0065165_1032813 | |||
| 1147 | Ga0065165_1058454 | |||
| 1148 | Ga0070658_10004018 | |||
| 1149 | Ga0070658_10004565 | |||
| 1150 | Ga0070658_10212129 | |||
| 1151 | Ga0070676_10000416 | |||
| 1152 | Ga0070670_100205126 | |||
| 1153 | Ga0068869_100015254 | |||
| 1154 | Ga0070666_10186306 | |||
| 1155 | Ga0070680_100017794 | |||
| 1156 | Ga0070682_100202918 | |||
| 1157 | Ga0070682_100208451 | |||
| 1158 | Ga0068868_100000013 | |||
| 1159 | Ga0068868_100667725 | |||
| 1160 | Ga0070660_100002444 | |||
| 1161 | Ga0070660_100003692 | |||
| 1162 | Ga0070660_100019488 | |||
| 1163 | Ga0070660_100033044 | |||
| 1164 | Ga0070660_100204054 | |||
| 1165 | Ga0070660_100625404 | |||
| 1166 | Ga0070661_100097802 | |||
| 1167 | Ga0070661_100188955 | |||
| 1168 | Ga0070668_100019990 | |||
| 1169 | Ga0070669_100765504 | |||
| 1170 | Ga0070675_100134826 | |||
| 1171 | Ga0070671_100067672 | |||
| 1172 | Ga0070673_100000002 | |||
| 1173 | Ga0070673_100334229 | |||
| 1174 | Ga0070659_100003649 | |||
| 1175 | Ga0070659_100036509 | |||
| 1176 | Ga0070659_100077774 | |||
| 1177 | Ga0070659_100148389 | |||
| 1178 | Ga0070709_10003406 | |||
| 1179 | Ga0070709_10020120 | |||
| 1180 | Ga0070709_10045772 | |||
| 1181 | Ga0070714_100226508 | |||
| 1182 | Ga0070713_100010463 | |||
| 1183 | Ga0070713_100071899 | |||
| 1184 | Ga0070713_100222146 | |||
| 1185 | Ga0070713_100287196 | |||
| 1186 | Ga0070710_10025371 | |||
| 1187 | Ga0070711_100001130 | |||
| 1188 | Ga0070711_100002277 | |||
| 1189 | Ga0070711_100452971 | |||
| 1190 | Ga0070663_100572479 | |||
| 1191 | Ga0070678_100010460 | |||
| 1192 | Ga0070662_100159029 | |||
| 1193 | Ga0070681_10006411 | |||
| 1194 | Ga0070681_10049606 | |||
| 1195 | Ga0070681_10087304 | |||
| 1196 | Ga0068867_100000012 | |||
| 1197 | Ga0068867_100276620 | |||
| 1198 | Ga0070706_100052063 | |||
| 1199 | Ga0070707_100092451 | |||
| 1200 | Ga0070679_100117260 | |||
| 1201 | Ga0070684_100001671 | |||
| 1202 | Ga0070697_100118434 | |||
| 1203 | Ga0068853_100009612 | |||
| 1204 | Ga0068853_100041194 | |||
| 1205 | Ga0068853_100470288 | |||
| 1206 | Ga0070693_100020120 | |||
| 1207 | Ga0070665_100001299 | |||
| 1208 | Ga0070665_100154706 | |||
| 1209 | Ga0070665_100174582 | |||
| 1210 | Ga0070665_100203709 | |||
| 1211 | Ga0070665_100535622 | |||
| 1212 | Ga0068855_100000095 | |||
| 1213 | Ga0068855_100071449 | |||
| 1214 | Ga0068855_100298678 | |||
| 1215 | Ga0068855_100498496 | |||
| 1216 | Ga0068857_100013087 | |||
| 1217 | Ga0068857_100021147 | |||
| 1218 | Ga0068857_100163281 | |||
| 1219 | Ga0068856_100000137 | |||
| 1220 | Ga0068856_100016744 | |||
| 1221 | Ga0068856_100345247 | |||
| 1222 | Ga0068852_100000586 | |||
| 1223 | Ga0068852_100088449 | |||
| 1224 | Ga0068859_100005156 | |||
| 1225 | Ga0068864_100007001 | |||
| 1226 | Ga0068866_10071782 | |||
| 1227 | Ga0068861_100207079 | |||
| 1228 | Ga0068851_10024349 | |||
| 1229 | Ga0068863_100025840 | |||
| 1230 | Ga0068863_100359835 | |||
| 1231 | Ga0068858_100000771 | |||
| 1232 | Ga0068858_100009417 | |||
| 1233 | Ga0068858_100242087 | |||
| 1234 | Ga0068860_100000313 | |||
| 1235 | Ga0068860_101020018 | |||
| 1236 | Ga0068862_100015180 | |||
| 1237 | Ga0068862_100015872 | |||
| 1238 | Ga0081455_10002424 | |||
| 1239 | Ga0081455_10017304 | |||
| 1240 | Ga0081540_1024929 | |||
| 1241 | Ga0081540_1028527 | |||
| 1242 | Ga0081540_1059623 | |||
| 1243 | Ga0081540_1072041 | |||
| 1244 | Ga0081540_1142003 | |||
| 1245 | Ga0081539_10000801 | |||
| 1246 | Ga0081539_10073132 | |||
| 1247 | Ga0075365_10036163 | |||
| 1248 | Ga0075365_10055263 | |||
| 1249 | Ga0075365_10164151 | |||
| 1250 | Ga0075365_10238357 | |||
| 1251 | Ga0075368_10003536 | |||
| 1252 | Ga0075363_100004455 | |||
| 1253 | Ga0075364_10012640 | |||
| 1254 | Ga0075364_10077984 | |||
| 1255 | Ga0075364_10520688 | |||
| 1256 | Ga0070712_100009825 | |||
| 1257 | Ga0075362_10021637 | |||
| 1258 | Ga0075367_10020984 | |||
| 1259 | Ga0075367_10037363 | |||
| 1260 | Ga0075367_10039353 | |||
| 1261 | Ga0075369_10004680 | |||
| 1262 | Ga0075369_10005108 | |||
| 1263 | Ga0075369_10009026 | |||
| 1264 | Ga0075369_10106555 | |||
| 1265 | Ga0075369_10120009 | |||
| 1266 | Ga0075369_10238000 | |||
| 1267 | Ga0075366_10008146 | |||
| 1268 | Ga0075366_10086221 | |||
| 1269 | Ga0075366_10161131 | |||
| 1270 | Ga0097621_100061585 | |||
| 1271 | Ga0097621_100144761 | |||
| 1272 | Ga0097621_100872561 | |||
| 1273 | Ga0075370_10130135 | |||
| 1274 | Ga0075370_10169650 | |||
| 1275 | Ga0075370_10297882 | |||
| 1276 | Ga0075428_100150741 | |||
| 1277 | Ga0075434_100023401 | |||
| 1278 | Ga0068865_100000004 | |||
| 1279 | Ga0068865_100480280 | |||
| 1280 | Ga0097620_100005156 | |||
| 1281 | Ga0075435_100411755 | |||
| 1282 | Ga0099794_10061546 | |||
| 1283 | Ga0099795_10001129 | |||
| 1284 | Ga0099795_10005962 | |||
| 1285 | Ga0099795_10067502 | |||
| 1286 | Ga0105240_10002463 | |||
| 1287 | Ga0105240_10033307 | |||
| 1288 | Ga0105240_10064674 | |||
| 1289 | Ga0105240_10071475 | |||
| 1290 | Ga0105240_10086052 | |||
| 1291 | Ga0105240_10298611 | |||
| 1292 | Ga0105240_10323474 | |||
| 1293 | Ga0105245_10001027 | |||
| 1294 | Ga0105245_10003725 | |||
| 1295 | Ga0105245_11027269 | |||
| 1296 | Ga0105247_10043425 | |||
| 1297 | Ga0105247_10503386 | |||
| 1298 | Ga0114129_10054829 | |||
| 1299 | Ga0105243_10000146 | |||
| 1300 | Ga0105242_10000497 | |||
| 1301 | Ga0105248_10001758 | |||
| 1302 | Ga0105248_10007949 | |||
| 1303 | Ga0105248_10042051 | |||
| 1304 | Ga0105248_10047211 | |||
| 1305 | Ga0105248_10347630 | |||
| 1306 | Ga0105237_10052574 | |||
| 1307 | Ga0105237_10053748 | |||
| 1308 | Ga0105237_10054084 | |||
| 1309 | Ga0105237_10133176 | |||
| 1310 | Ga0105238_10006268 | |||
| 1311 | Ga0105238_10022426 | |||
| 1312 | Ga0105238_10225558 | |||
| 1313 | Ga0105249_10015630 | |||
| 1314 | Ga0105249_10157228 | |||
| 1315 | Ga0105249_10179246 | |||
| 1316 | Ga0099796_10012567 | |||
| 1317 | Ga0105239_10017503 | |||
| 1318 | Ga0105239_10216274 | |||
| 1319 | Ga0105239_10851949 | |||
| 1320 | Ga0105246_10000138 | |||
| 1321 | Ga0157327_1000745 | |||
| 1322 | Ga0157373_10079649 | |||
| 1323 | Ga0157370_10000096 | |||
| 1324 | Ga0157370_10274931 | |||
| 1325 | Ga0157369_10018692 | |||
| 1326 | Ga0157369_10022918 | |||
| 1327 | Ga0157369_10053822 | |||
| 1328 | Ga0157374_10001104 | |||
| 1329 | Ga0157378_10015726 | |||
| 1330 | Ga0157378_10091415 | |||
| 1331 | Ga0163162_10004509 | |||
| 1332 | Ga0163162_10026231 | |||
| 1333 | Ga0163162_11080978 | |||
| 1334 | Ga0157372_10034063 | |||
| 1335 | Ga0157372_10067956 | |||
| 1336 | Ga0157372_10294884 | |||
| 1337 | Ga0157372_10559346 | |||
| 1338 | Ga0157375_10000587 | |||
| 1339 | Ga0163163_10018900 | |||
| 1340 | Ga0163163_10089709 | |||
| 1341 | Ga0163163_10557376 | |||
| 1342 | Ga0157380_10122751 | |||
| 1343 | Ga0157380_10532302 | |||
| 1344 | Ga0182008_10154201 | |||
| 1345 | Ga0157379_10014381 | |||
| 1346 | Ga0157379_10027684 | |||
| 1347 | Ga0157379_10033261 | |||
| 1348 | Ga0157379_10067957 | |||
| 1349 | Ga0157379_10199431 | |||
| 1350 | Ga0157376_10000131 | |||
| 1351 | Ga0163161_10056570 | |||
| 1352 | Ga0213872_10070428 | |||
| 1353 | Ga0213876_10000345 | |||
| 1354 | Ga0213876_10038689 | |||
| 1355 | Ga0209436_112907 | |||
| 1356 | Ga0209437_106743 | |||
| 1357 | Ga0207425_1000094 | |||
| 1358 | Ga0207425_1001939 | |||
| 1359 | Ga0209026_1001831 | |||
| 1360 | Ga0209677_102422 | |||
| 1361 | Ga0209148_1000074 | |||
| 1362 | Ga0209148_1001194 | |||
| 1363 | Ga0209129_1001201 | |||
| 1364 | Ga0209233_1000026 | |||
| 1365 | Ga0209233_1000098 | |||
| 1366 | Ga0209233_1002344 | |||
| 1367 | Ga0209565_1000007 | |||
| 1368 | Ga0209565_1000618 | |||
| 1369 | Ga0209565_1038534 | |||
| 1370 | Ga0209455_1000574 | |||
| 1371 | Ga0209455_1002785 | |||
| 1372 | Ga0209455_1013949 | |||
| 1373 | Ga0209455_1016958 | |||
| 1374 | Ga0209455_1036672 | |||
| 1375 | Ga0209673_1000722 | |||
| 1376 | Ga0209673_1001309 | |||
| 1377 | Ga0209673_1016536 | |||
| 1378 | Ga0209673_1027785 | |||
| 1379 | Ga0209676_1000243 | |||
| 1380 | Ga0209676_1000311 | |||
| 1381 | Ga0209676_1004805 | |||
| 1382 | Ga0209025_1000630 | |||
| 1383 | Ga0209564_1000713 | |||
| 1384 | Ga0209564_1000718 | |||
| 1385 | Ga0209564_1000745 | |||
| 1386 | Ga0209564_1003160 | |||
| 1387 | Ga0209564_1006871 | |||
| 1388 | Ga0209564_1008096 | |||
| 1389 | Ga0209564_1009741 | |||
| 1390 | Ga0209564_1032344 | |||
| 1391 | Ga0209758_1000002 | |||
| 1392 | Ga0209758_1000015 | |||
| 1393 | Ga0209758_1000108 | |||
| 1394 | Ga0209758_1000239 | |||
| 1395 | Ga0209758_1000252 | |||
| 1396 | Ga0209758_1001566 | |||
| 1397 | Ga0209758_1001570 | |||
| 1398 | Ga0209758_1004632 | |||
| 1399 | Ga0209758_1006280 | |||
| 1400 | Ga0209758_1006552 | |||
| 1401 | Ga0209758_1021049 | |||
| 1402 | Ga0209758_1022902 | |||
| 1403 | Ga0209758_1026731 | |||
| 1404 | Ga0209758_1028026 | |||
| 1405 | Ga0209050_1000244 | |||
| 1406 | Ga0209050_1000342 | |||
| 1407 | Ga0209050_1000375 | |||
| 1408 | Ga0209050_1005517 | |||
| 1409 | Ga0209050_1011876 | |||
| 1410 | Ga0209050_1014540 | |||
| 1411 | Ga0209256_1000008 | |||
| 1412 | Ga0209256_1001119 | |||
| 1413 | Ga0209256_1002155 | |||
| 1414 | Ga0209256_1002592 | |||
| 1415 | Ga0209256_1008041 | |||
| 1416 | Ga0209256_1010559 | |||
| 1417 | Ga0207426_1000217 | |||
| 1418 | Ga0207426_1000368 | |||
| 1419 | Ga0207426_1016643 | |||
| 1420 | Ga0209051_1000226 | |||
| 1421 | Ga0209051_1003593 | |||
| 1422 | Ga0209257_1000066 | |||
| 1423 | Ga0209257_1000140 | |||
| 1424 | Ga0209257_1001119 | |||
| 1425 | Ga0209257_1002989 | |||
| 1426 | Ga0209257_1003585 | |||
| 1427 | Ga0209257_1004459 | |||
| 1428 | Ga0209257_1017346 | |||
| 1429 | Ga0209257_1019253 | |||
| 1430 | Ga0209257_1023078 | |||
| 1431 | Ga0207692_10092668 | |||
| 1432 | Ga0207642_10150907 | |||
| 1433 | Ga0207680_10208528 | |||
| 1434 | Ga0207647_10025784 | |||
| 1435 | Ga0207647_10152771 | |||
| 1436 | Ga0207647_10359411 | |||
| 1437 | Ga0207699_10019120 | |||
| 1438 | Ga0207699_10032628 | |||
| 1439 | Ga0207699_10062902 | |||
| 1440 | Ga0207645_10004384 | |||
| 1441 | Ga0207705_10000055 | |||
| 1442 | Ga0207705_10007178 | |||
| 1443 | Ga0207684_10047574 | |||
| 1444 | Ga0207654_10496656 | |||
| 1445 | Ga0207707_10000143 | |||
| 1446 | Ga0207707_10014431 | |||
| 1447 | Ga0207695_10004557 | |||
| 1448 | Ga0207695_10005778 | |||
| 1449 | Ga0207695_10029272 | |||
| 1450 | Ga0207695_10525076 | |||
| 1451 | Ga0207671_10029351 | |||
| 1452 | Ga0207671_10061198 | |||
| 1453 | Ga0207671_10144019 | |||
| 1454 | Ga0207671_10178948 | |||
| 1455 | Ga0207693_10054355 | |||
| 1456 | Ga0207693_10166544 | |||
| 1457 | Ga0207663_10052117 | |||
| 1458 | Ga0207660_10007904 | |||
| 1459 | Ga0207660_10274141 | |||
| 1460 | Ga0207657_10004951 | |||
| 1461 | Ga0207657_10005482 | |||
| 1462 | Ga0207657_10013332 | |||
| 1463 | Ga0207657_10139147 | |||
| 1464 | Ga0207652_10024703 | |||
| 1465 | Ga0207646_10065090 | |||
| 1466 | Ga0207694_10029840 | |||
| 1467 | Ga0207694_10049968 | |||
| 1468 | Ga0207694_10050027 | |||
| 1469 | Ga0207694_10067102 | |||
| 1470 | Ga0207659_10015289 | |||
| 1471 | Ga0207659_10232512 | |||
| 1472 | Ga0207659_10510357 | |||
| 1473 | Ga0207687_10000755 | |||
| 1474 | Ga0207687_10089008 | |||
| 1475 | Ga0207687_10201791 | |||
| 1476 | Ga0207700_10034094 | |||
| 1477 | Ga0207700_10110658 | |||
| 1478 | Ga0207700_10197737 | |||
| 1479 | Ga0207700_10227682 | |||
| 1480 | Ga0207690_10004570 | |||
| 1481 | Ga0207690_10036500 | |||
| 1482 | Ga0207690_10401104 | |||
| 1483 | Ga0207706_10010431 | |||
| 1484 | Ga0207686_10067444 | |||
| 1485 | Ga0207709_10000314 | |||
| 1486 | Ga0207704_10000005 | |||
| 1487 | Ga0207711_10000852 | |||
| 1488 | Ga0207711_10004629 | |||
| 1489 | Ga0207711_10176891 | |||
| 1490 | Ga0207689_10001653 | |||
| 1491 | Ga0207679_10256115 | |||
| 1492 | Ga0207667_10000016 | |||
| 1493 | Ga0207667_10020014 | |||
| 1494 | Ga0207667_10079777 | |||
| 1495 | Ga0207651_10000007 | |||
| 1496 | Ga0207712_10007902 | |||
| 1497 | Ga0207712_10088953 | |||
| 1498 | Ga0207712_10234109 | |||
| 1499 | Ga0207668_10436882 | |||
| 1500 | Ga0207677_10000085 | |||
| 1501 | Ga0207703_10001689 | |||
| 1502 | Ga0207703_10006205 | |||
| 1503 | Ga0207703_10224453 | |||
| 1504 | Ga0207639_10038697 | |||
| 1505 | Ga0207639_10255690 | |||
| 1506 | Ga0207639_10286758 | |||
| 1507 | Ga0207678_10049937 | |||
| 1508 | Ga0207678_10746243 | |||
| 1509 | Ga0207702_10000063 | |||
| 1510 | Ga0207702_10005342 | |||
| 1511 | Ga0207702_10423659 | |||
| 1512 | Ga0207641_10028640 | |||
| 1513 | Ga0207641_10341334 | |||
| 1514 | Ga0207641_10389758 | |||
| 1515 | Ga0207641_10518373 | |||
| 1516 | Ga0207648_10000005 | |||
| 1517 | Ga0207676_10001553 | |||
| 1518 | Ga0207676_10159444 | |||
| 1519 | Ga0207676_10369365 | |||
| 1520 | Ga0207674_10000989 | |||
| 1521 | Ga0207674_10017443 | |||
| 1522 | Ga0207674_10018135 | |||
| 1523 | Ga0207674_10484544 | |||
| 1524 | Ga0207675_100343902 | |||
| 1525 | Ga0207675_100537927 | |||
| 1526 | Ga0207683_10149323 | |||
| 1527 | Ga0207698_10000294 | |||
| 1528 | Ga0207698_10033871 | |||
| 1529 | Ga0207698_10264407 | |||
| 1530 | Ga0207428_10207164 | |||
| 1531 | Ga0268266_10000003 | |||
| 1532 | Ga0268266_10126859 | |||
| 1533 | Ga0268266_10154418 | |||
| 1534 | Ga0268266_10166098 | |||
| 1535 | Ga0268266_10235109 | |||
| 1536 | Ga0268266_10545318 | |||
| 1537 | Ga0268265_10023564 | |||
| 1538 | Ga0268265_10036215 | |||
| 1539 | Ga0268265_10453740 | |||
| 1540 | Ga0268264_10000356 | |||
| 1541 | Ga0307517_10176599 | |||
| 1542 | Ga0307515_10033355 | |||
| 1543 | Ga0307511_10034380 | |||
| 1544 | Ga0307512_10191584 | |||
| 1545 | Ga0265330_10010731 | |||
| 1546 | Ga0265330_10063434 | |||
| 1547 | Ga0265332_10151694 | |||
| 1548 | Ga0265320_10001345 | |||
| 1549 | Ga0265340_10016299 | |||
| 1550 | Ga0265340_10186514 | |||
| 1551 | Ga0265331_10032239 | |||
| 1552 | Ga0265316_10045394 | |||
| 1553 | Ga0307513_10079397 | |||
| 1554 | Ga0307513_10270222 | |||
| 1555 | Ga0307513_10306911 | |||
| 1556 | Ga0307509_10192327 | |||
| 1557 | Ga0307509_10541234 | |||
| 1558 | Ga0307408_100064798 | |||
| 1559 | Ga0307508_10001949 | |||
| 1560 | Ga0307508_10262591 | |||
| 1561 | Ga0265314_10071962 | |||
| 1562 | Ga0265314_10073784 | |||
| 1563 | Ga0265342_10003269 | |||
| 1564 | Ga0265342_10028180 | |||
| 1565 | Ga0265342_10089269 | |||
| 1566 | Ga0265342_10122932 | |||
| 1567 | Ga0307516_10000034 | |||
| 1568 | Ga0307516_10005305 | |||
| 1569 | Ga0307516_10126728 | |||
| 1570 | Ga0307405_10414785 | |||
| 1571 | Ga0307412_10355937 | |||
| 1572 | Ga0307412_10421289 | |||
| 1573 | Ga0307414_10021121 | |||
| 1574 | Ga0307414_10197404 | |||
| 1575 | Ga0307510_10103437 | |||
| 1576 | Ga0307510_10129319 | |||
| 1577 | Ga0307510_10167278 | |||
| 1578 | Ga0373934_0135557 | |||
| 1579 | Ga0373944_0080706 | |||
| 1580 | Ga0373923_0182533 | |||
| 1581 | Ga0373936_0086972 | |||
| 1582 | Ga0373936_0187711 | |||
| 1583 | Ga0373955_0449417 | |||
| 1584 | Ga0373935_0005959 | |||
| 1585 | Ga0373927_0002991 | |||
| 1586 | Ga0373927_0014399 | |||
| 1587 | Ga0373927_0049450 | |||
| 1588 | Ga0373933_0285329 | |||
| 1589 | Ga0373947_0040983 | |||
| 1590 | Ga0373937_0047940 | |||
| 1591 | Ga0310112_010758 | |||
| 1592 | Ga0373925_0034633 | |||
| 1593 | Ga0373925_0317917 | |||
| 1594 | Ga0373925_0352501 | |||
| 1595 | Ga0395899_0000026 | |||
| 1596 | Ga0395899_0000713 | |||
| 1597 | Ga0395899_0098311 | |||
| 1598 | Ga0395899_0510502 | |||
| 1599 | Ga0395900_0025660 | |||
| 1600 | Ga0395900_0200106 | |||
| 1601 | Ga0395898_0058714 | |||
| 1602 | Ga0395898_0204761 | |||
| 1603 | Ga0395898_0289869 | |||
| 1604 | Ga0395898_0443901 | |||
| 1605 | Ga0395905_0012102 | |||
| 1606 | Ga0395905_0034469 | |||
| 1607 | Ga0395905_0050916 | |||
| 1608 | Ga0395905_0061355 | |||
| 1609 | Ga0395905_0070375 | |||
| 1610 | Ga0395905_0078733 | |||
| 1611 | Ga0395905_0410047 | |||
| 1612 | Ga0395905_0876355 | |||
| 1613 | Ga0395901_0029430 | |||
| 1614 | Ga0395901_0029978 | |||
| 1615 | Ga0395901_0104792 | |||
| 1616 | Ga0395901_0192446 | |||
| 1617 | Ga0395901_0395262 | |||
| 1618 | Ga0395901_0418805 | |||
| 1619 | Ga0395901_0688279 | |||
| 1620 | Ga0395901_0794163 | |||
| 1621 | Ga0436365_0140106 | |||
| 1622 | Ga0436365_0449154 | |||
| 1623 | Ga0436365_0503144 | |||
| 1624 | Ga0436365_0916510 | |||
| 1625 | Ga0436365_1541345 | |||
| 1626 | Ga0436365_1602753 | |||
| 1627 | Ga0436360_0479997 | |||
| 1628 | Ga0436360_0795172 | |||
| 1629 | Ga0436361_0108203 | |||
| 1630 | Ga0436361_0186477 | |||
| 1631 | Ga0436361_0238923 | |||
| 1632 | Ga0436361_0261403 | |||
| 1633 | Ga0436361_0546846 | |||
| 1634 | Ga0436361_0681592 | |||
| 1635 | Ga0436361_0843361 | |||
| 1636 | Ga0436363_0168726 | |||
| 1637 | Ga0436363_0599359 | |||
| 1638 | Ga0436363_0885771 | |||
| 1639 | Ga0439436_0018407 | |||
| 1640 | Ga0439461_0035617 | |||
| 1641 | Ga0439465_0006377 | |||
| 1642 | Ga0439431_0000187 | |||
| 1643 | Ga0439431_0010651 | |||
| 1644 | Ga0439442_002393 | |||
| 1645 | Ga0439445_0000562 | |||
| 1646 | Ga0439445_0069288 | |||
| 1647 | Ga0439448_0002340 | |||
| 1648 | Ga0439448_0024185 | |||
| 1649 | Ga0439432_003177 | |||
| 1650 | Ga0439449_0053381 | |||
| 1651 | Ga0439452_021467 | |||
| 1652 | Ga0439455_0007335 | |||
| 1653 | Ga0439455_0008361 | |||
| 1654 | Ga0439455_0059366 | |||
| 1655 | Ga0439455_0071768 | |||
| 1656 | Ga0439455_0102985 | |||
| 1657 | Ga0439457_001532 | |||
| 1658 | Ga0450919_010306 | |||
| 1659 | Ga0450923_017278 | |||
| 1660 | Ga0450898_035919 | |||
| 1661 | Ga0450910_010396 | |||
| 1662 | Ga0439446_0002031 | |||
| 1663 | Ga0439458_0000986 | |||
| 1664 | Ga0439458_0001013 | |||
| 1665 | Ga0439458_0001992 | |||
| 1666 | Ga0439434_0002604 | |||
| 1667 | Ga0439435_0012758 | |||
| 1668 | Ga0466972_0010990 | |||
| 1669 | Ga0466965_0031586 | |||
| 1670 | Ga0466966_0034352 | |||
| 1671 | Ga0466966_0058072 | |||
| 1672 | Ga0466966_0058718 | |||
| 1673 | Ga0466966_0138559 | |||
| 1674 | Ga0466961_0011581 | |||
| 1675 | Ga0466963_0037193 | |||
| 1676 | Ga0466963_0049597 | |||
| 1677 | Ga0466963_0101375 | |||
| 1678 | Ga0466964_0013581 | |||
| 1679 | Ga0466964_0085777 | |||
| 1680 | Ga0466971_0024553 | |||
| 1681 | Ga0466971_0062460 | |||
| 1682 | Ga0466968_0025710 | |||
| 1683 | Ga0466968_0029848 | |||
| 1684 | Ga0466970_0004968 | |||
| 1685 | Ga0466970_0099144 | |||
| 1686 | Ga0466957_0008884 | |||
| 1687 | Ga0466957_0195426 | |||
| 1688 | Ga0466957_0206052 | |||
| 1689 | Ga0466960_0329898 | |||
| 1690 | Ga0466960_0374149 | |||
| 1691 | Ga0466959_0005917 | |||
| 1692 | Ga0466959_0042510 | |||
| 1693 | Ga0466959_0075547 | |||
| 1694 | Ga0466959_0099323 | |||
| 1695 | Ga0466959_0296235 | |||
| 1696 | Ga0466959_0428104 | |||
| 1697 | Ga0466958_0000048 | |||
| 1698 | Ga0466958_0021853 | |||
| 1699 | Ga0466958_0057198 | |||
| 1700 | Ga0466958_0093525 | |||
| 1701 | Ga0466958_0359931 | |||
| 1702 | Ga0466967_0223964 | |||
| 1703 | Ga0466967_0291750 | |||
| 1704 | Ga0495627_000209 | |||
| 1705 | Ga0495590_0002168 | |||
| 1706 | Ga0495629_0418204 | |||
| 1707 | Ga0495638_0000326 | |||
| 1708 | Ga0495638_0000434 | |||
| 1709 | Ga0495638_0005521 | |||
| 1710 | Ga0495638_0039729 | |||
| 1711 | Ga0495638_0048119 | |||
| 1712 | Ga0495638_0130212 | |||
| 1713 | Ga0495638_0291070 | |||
| 1714 | Ga0495638_0293732 | |||
| 1715 | Ga0495641_0159147 | |||
| 1716 | Ga0495651_0009405 | |||
| 1717 | Ga0495651_0022220 | |||
| 1718 | Ga0495650_0000069 | |||
| 1719 | Ga0495650_0031088 | |||
| 1720 | Ga0495650_0116783 | |||
| 1721 | Ga0495580_0348313 | |||
| 1722 | Ga0495664_0277789 | |||
| 1723 | Ga0495585_0207160 | |||
| 1724 | Ga0495594_0017602 | |||
| 1725 | Ga0495594_0134716 | |||
| 1726 | Ga0495607_0204649 | |||
| 1727 | Ga0495583_0094892 | |||
| 1728 | Ga0495606_0016300 | |||
| 1729 | Ga0495606_0349636 | |||
| 1730 | Ga0495610_0002007 | |||
| 1731 | Ga0495610_0004447 | |||
| 1732 | Ga0495610_0005291 | |||
| 1733 | Ga0495610_0017507 | |||
| 1734 | Ga0495616_0000115 | |||
| 1735 | Ga0495631_0001223 | |||
| 1736 | Ga0495631_0138305 | |||
| 1737 | Ga0495631_0164379 | |||
| 1738 | Ga0495632_0012120 | |||
| 1739 | Ga0495643_0212575 | |||
| 1740 | Ga0495643_0227646 | |||
| 1741 | Ga0495648_0000165 | |||
| 1742 | Ga0495648_0053168 | |||
| 1743 | Ga0495648_0112343 | |||
| 1744 | Ga0495663_0025072 | |||
| 1745 | Ga0495654_0000024 | |||
| 1746 | Ga0495654_0012651 | |||
| 1747 | Ga0495645_0177873 | |||
| 1748 | Ga0495622_0005431 | |||
| 1749 | Ga0495668_0000456 | |||
| 1750 | Ga0495668_0015595 | |||
| 1751 | Ga0495668_0018797 | |||
| 1752 | Ga0495668_0023744 | |||
| 1753 | Ga0495668_0035943 | |||
| 1754 | Ga0495668_0074400 | |||
| 1755 | Ga0495668_0081140 | |||
| 1756 | Ga0495634_0326474 | |||
| 1757 | Ga0495611_0182921 | |||
| 1758 | Ga0495625_0000230 | |||
| 1759 | Ga0495625_0004316 | |||
| 1760 | Ga0495625_0006914 | |||
| 1761 | Ga0495625_0018507 | |||
| 1762 | Ga0495625_0039826 | |||
| 1763 | Ga0495625_0073657 | |||
| 1764 | Ga0495659_0131102 | |||
| 1765 | Ga0495661_0012280 | |||
| 1766 | Ga0495588_0203650 | |||
| 1767 | Ga0495657_0046244 | |||
| 1768 | Ga0495599_0169263 | |||
| 1769 | Ga0495623_0012870 | |||
| 1770 | Ga0495613_0056042 | |||
| 1771 | Ga0495613_0144755 | |||
| 1772 | Ga0495670_0000029 | |||
| 1773 | Ga0495670_0012601 | |||
| 1774 | Ga0495671_0061171 | |||
| 1775 | Ga0495660_0132991 | |||
| 1776 | Ga0495581_0193504 | |||
| 1777 | Ga0495604_0105632 | |||
| 1778 | Ga0495604_0358796 | |||
| 1779 | Ga0495672_0019609 | |||
| 1780 | Ga0495672_0145424 | |||
| 1781 | Ga0495677_0008628 | |||
| 1782 | Ga0495673_0000108 | |||
| 1783 | Ga0495673_0000344 | |||
| 1784 | Ga0495673_0003633 | |||
| 1785 | Ga0495686_0004056 | |||
| 1786 | Ga0495686_0011950 | |||
| 1787 | Ga0495686_0013762 | |||
| 1788 | Ga0495686_0036693 | |||
| 1789 | Ga0495686_0074651 | |||
| 1790 | Ga0495686_0132889 | |||
| 1791 | Ga0495686_0156744 | |||
| 1792 | Ga0495602_0194229 | |||
| 1793 | Ga0495626_0061575 | |||
| 1794 | Ga0496100_0306526 | |||
| 1795 | Ga0496100_0327012 | |||
| 1796 | Ga0496103_0174513 | |||
| 1797 | Ga0496104_0001606 | |||
| 1798 | Ga0496104_0001863 | |||
| 1799 | Ga0496105_0008691 | |||
| 1800 | Ga0496105_0443611 | |||
| 1801 | Ga0496106_0001358 | |||
| 1802 | Ga0496106_0044228 | |||
| 1803 | Ga0496106_0052530 | |||
| 1804 | Ga0496106_0736254 | |||
| 1805 | Ga0496107_0006558 | |||
| 1806 | Ga0496107_0403907 | |||
| 1807 | Ga0496108_0204804 | |||
| 1808 | Ga0496108_0205223 | |||
| 1809 | Ga0496110_0113009 | |||
| 1810 | Ga0496110_0216548 | |||
| 1811 | Ga0496111_0294153 | |||
| 1812 | Ga0496111_0412806 | |||
| 1813 | Ga0496112_0908806 | |||
| 1814 | Ga0496113_0213646 | |||
| 1815 | Ga0496114_0281214 | |||
| 1816 | Ga0496114_0656583 | |||
| 1817 | Ga0496115_0000921 | |||
| 1818 | Ga0496115_0001486 | |||
| 1819 | Ga0496115_0004981 | |||
| 1820 | Ga0496115_0020165 | |||
| 1821 | Ga0496115_0101425 | |||
| 1822 | Ga0496116_0000965 | |||
| 1823 | Ga0496116_0143291 | |||
| 1824 | Ga0496117_0013409 | |||
| 1825 | Ga0496117_0034522 | |||
| 1826 | Ga0496117_0105182 | |||
| 1827 | Ga0496117_0106166 | |||
| 1828 | Ga0496117_0144340 | |||
| 1829 | Ga0496117_0148732 | |||
| 1830 | Ga0496118_0003027 | |||
| 1831 | Ga0496118_0010242 | |||
| 1832 | Ga0496118_0020353 | |||
| 1833 | Ga0496118_0028559 | |||
| 1834 | Ga0496118_0039154 | |||
| 1835 | Ga0496118_0070052 | |||
| 1836 | Ga0496118_0084187 | |||
| 1837 | Ga0496118_0120085 | |||
| 1838 | Ga0496119_0024118 | |||
| 1839 | Ga0496119_0035437 | |||
| 1840 | Ga0496119_0051808 | |||
| 1841 | Ga0496119_0064646 | |||
| 1842 | Ga0496119_0119652 | |||
| 1843 | Ga0496121_0001622 | |||
| 1844 | Ga0496121_0007823 | |||
| 1845 | Ga0496121_0023791 | |||
| 1846 | Ga0496121_0028197 | |||
| 1847 | Ga0496121_0036329 | |||
| 1848 | Ga0496121_0126551 | |||
| 1849 | Ga0496121_0161432 | |||
| 1850 | Ga0496121_0208762 | |||
| 1851 | Ga0496121_0244912 | |||
| 1852 | Ga0496121_0289800 | |||
| 1853 | Ga0496121_0366225 | |||
| 1854 | Ga0496122_0024545 | |||
| 1855 | Ga0496122_0036640 | |||
| 1856 | Ga0496122_0209236 | |||
| 1857 | Ga0496123_0022020 | |||
| 1858 | Ga0496123_0065829 | |||
| 1859 | Ga0496124_0002957 | |||
| 1860 | Ga0496124_0049091 | |||
| 1861 | Ga0496124_0095992 | |||
| 1862 | Ga0496124_0218398 | |||
| 1863 | Ga0496124_0231950 | |||
| 1864 | Ga0496124_0266812 | |||
| 1865 | Ga0496124_0469553 | |||
| 1866 | Ga0496124_0526149 | |||
| 1867 | Ga0496125_0001630 | |||
| 1868 | Ga0496125_0056184 | |||
| 1869 | Ga0496125_0083260 | |||
| 1870 | Ga0496125_0089991 | |||
| 1871 | Ga0496125_0095264 | |||
| 1872 | Ga0496125_0099406 | |||
| 1873 | Ga0496125_0137524 | |||
| 1874 | Ga0496125_0242362 | |||
| 1875 | Ga0496125_0281648 | |||
| 1876 | Ga0496125_0295403 | |||
| 1877 | Ga0496126_0003803 | |||
| 1878 | Ga0496126_0028894 | |||
| 1879 | Ga0496126_0033555 | |||
| 1880 | Ga0496126_0070139 | |||
| 1881 | Ga0496126_0081503 | |||
| 1882 | Ga0496126_0104438 | |||
| 1883 | Ga0496126_0312538 | |||
| 1884 | Ga0496126_0373969 | |||
| 1885 | Ga0496126_0486006 | |||
| 1886 | Ga0495678_003911 | |||
| 1887 | Ga0495682_0081120 | |||
| 1888 | Ga0495682_0131024 | |||
| 1889 | Ga0501031_0003114 | |||
| 1890 | Ga0501031_0026710 | |||
| 1891 | Ga0501032_0000762 | |||
| 1892 | Ga0501032_0056815 | |||
| 1893 | Ga0501032_0071436 | |||
| 1894 | Ga0501033_0000136 | |||
| 1895 | Ga0501033_0026715 | |||
| 1896 | Ga0501033_0057089 | |||
| 1897 | Ga0501033_0098622 | |||
| 1898 | Ga0501033_0267830 | |||
| 1899 | Ga0501033_0336784 | |||
| 1900 | Ga0501034_0000251 | |||
| 1901 | Ga0501034_0008471 | |||
| 1902 | Ga0501034_0025849 | |||
| 1903 | Ga0501034_0099688 | |||
| 1904 | Ga0501034_0134299 | |||
| 1905 | Ga0501034_0146924 | |||
| 1906 | Ga0501036_0000036 | |||
| 1907 | Ga0501036_0095905 | |||
| 1908 | Ga0501036_0139078 | |||
| 1909 | Ga0501037_0000867 | |||
| 1910 | Ga0501037_0186696 | |||
| 1911 | Ga0501037_0190511 | |||
| 1912 | Ga0501038_0000428 | |||
| 1913 | Ga0501038_0036231 | |||
| 1914 | Ga0501038_0203480 | |||
| 1915 | Ga0501038_0223971 | |||
| 1916 | Ga0501038_0247921 | |||
| 1917 | Ga0501039_0000273 | |||
| 1918 | Ga0501039_0032382 | |||
| 1919 | Ga0501042_0170613 | |||
| 1920 | Ga0501043_0000165 | |||
| 1921 | Ga0501043_0027908 | |||
| 1922 | Ga0501043_0198896 | |||
| 1923 | Ga0501043_0205795 | |||
| 1924 | Ga0501043_0223047 | |||
| 1925 | Ga0501043_0289433 | |||
| 1926 | Ga0501043_0624811 | |||
| 1927 | Ga0501046_0000839 | |||
| 1928 | Ga0501046_0516206 | |||
| 1929 | Ga0501047_0000340 | |||
| 1930 | Ga0501047_0001905 | |||
| 1931 | Ga0501047_0003425 | |||
| 1932 | Ga0501047_0041364 | |||
| 1933 | Ga0501047_0458913 | |||
| 1934 | Ga0501048_0001309 | |||
| 1935 | Ga0501048_0046616 | |||
| 1936 | Ga0501067_0000457 | |||
| 1937 | Ga0501067_0087210 | |||
| 1938 | Ga0501067_0135039 | |||
| 1939 | Ga0501068_0000839 | |||
| 1940 | Ga0501068_0032662 | |||
| 1941 | Ga0501069_0032150 | |||
| 1942 | Ga0501069_0066434 | |||
| 1943 | Ga0501070_0000971 | |||
| 1944 | Ga0501070_0073648 | |||
| 1945 | Ga0501070_0577973 | |||
| 1946 | Ga0501071_0079057 | |||
| 1947 | Ga0501072_0003301 | |||
| 1948 | Ga0501073_0000037 | |||
| 1949 | Ga0501073_0065517 | |||
| 1950 | Ga0501074_0000167 | |||
| 1951 | Ga0501074_0259375 | |||
| 1952 | Ga0501076_0191321 | |||
| 1953 | Ga0501079_0002302 | |||
| 1954 | Ga0501080_0006603 | |||
| 1955 | Ga0501080_0055199 | |||
| 1956 | Ga0501080_0080214 | |||
| 1957 | Ga0501080_0084313 | |||
| 1958 | Ga0501083_0001812 | |||
| 1959 | Ga0501083_0016896 | |||
| 1960 | Ga0501083_0042452 | |||
| 1961 | Ga0501241_006927 | |||
| 1962 | Ga0501035_0000142 | |||
| 1963 | Ga0501035_0006052 | |||
| 1964 | Ga0501035_0088777 | |||
| 1965 | Ga0501035_0185286 | |||
| 1966 | Ga0501035_0319208 | |||
| 1967 | Ga0501044_0000414 | |||
| 1968 | Ga0501044_0008740 | |||
| 1969 | Ga0501044_0013526 | |||
| 1970 | Ga0501044_0021563 | |||
| 1971 | Ga0501044_0022908 | |||
| 1972 | Ga0501044_0076769 | |||
| 1973 | Ga0501044_0083517 | |||
| 1974 | Ga0501044_0100473 | |||
| 1975 | Ga0501044_0286077 | |||
| 1976 | Ga0501044_0394898 | |||
| 1977 | Ga0501045_0002539 | |||
| 1978 | nmdc:mga03n38_180079_c1 | |||
| 1979 | nmdc:mga03n38_3129_c1 | |||
| 1980 | nmdc:mga00v17_26492_c1 | |||
| 1981 | nmdc:mga00v17_28827_c1 | |||
| 1982 | nmdc:mga00v17_51403_c1 | |||
| 1983 | nmdc:mga00v17_59417_c1 | |||
| 1984 | nmdc:mga00v17_69035_c1 | |||
| 1985 | nmdc:mga0yw44_179253_c1 | |||
| 1986 | nmdc:mga0yw44_23081_c1 | |||
| 1987 | nmdc:mga0yw44_341776_c1 | |||
| 1988 | nmdc:mga0yw44_4551_c1 | |||
| 1989 | nmdc:mga0yw44_50500_c1 | |||
| 1990 | nmdc:mga0yw44_7729_c1 | |||
| 1991 | nmdc:mga0yw44_84115_c1 | |||
| 1992 | nmdc:mga0k408_14464_c1 | |||
| 1993 | nmdc:mga0k408_199183_c1 | |||
| 1994 | nmdc:mga06z11_138892_c1 | |||
| 1995 | nmdc:mga06z11_4688_c1 | |||
| 1996 | nmdc:mga04h51_98496_c1 | |||
| 1997 | nmdc:mga07m45_32567_c1 | |||
| 1998 | nmdc:mga05p37_650235_c1 | |||
| 1999 | nmdc:mga0rr50_234301_c1 | |||
| 2000 | nmdc:mga08x19_86194_c1 | |||
| 2001 | nmdc:mga0sz30_2586_c1 | |||
| 2002 | nmdc:mga0sz30_4919_c1 | |||
| 2003 | nmdc:mga0sz30_51614_c1 | |||
| 2004 | nmdc:mga0sz30_75666_c1 | |||
| 2005 | Ga0495595_0087546 | |||
| 2006 | Ga0500578_0000056 | |||
| 2007 | Ga0500578_0113492 | |||
| 2008 | Ga0500578_0190611 | |||
| 2009 | Ga0500578_0193464 | |||
| 2010 | Ga0500578_0230005 | |||
| 2011 | Ga0500643_000048 | |||
| 2012 | Ga0500643_000548 | |||
| 2013 | Ga0500643_005672 | |||
| 2014 | Ga0500643_010845 | |||
| 2015 | Ga0500643_012763 | |||
| 2016 | Ga0500643_070398 | |||
| 2017 | Ga0500644_0000089 | |||
| 2018 | Ga0500644_0028932 | |||
| 2019 | Ga0500644_0044232 | |||
| 2020 | Ga0500647_0093291 | |||
| 2021 | Ga0500647_0178970 | |||
| 2022 | Ga0500583_0010766 | |||
| 2023 | Ga0500583_0060762 | |||
| 2024 | Ga0500651_0002004 | |||
| 2025 | Ga0500651_0002704 | |||
| 2026 | Ga0500651_0014869 | |||
| 2027 | Ga0500651_0215834 | |||
| 2028 | Ga0500566_0002605 | |||
| 2029 | Ga0500566_0003780 | |||
| 2030 | Ga0500566_0006460 | |||
| 2031 | Ga0500566_0075920 | |||
| 2032 | Ga0500641_0018004 | |||
| 2033 | Ga0500641_0023374 | |||
| 2034 | Ga0500641_0025472 | |||
| 2035 | Ga0500641_0032761 | |||
| 2036 | Ga0500641_0054141 | |||
| 2037 | Ga0500650_0025917 | |||
| 2038 | Ga0500554_041214 | |||
| 2039 | Ga0500555_027405 | |||
| 2040 | Ga0500556_0000003 | |||
| 2041 | Ga0500556_0001687 | |||
| 2042 | Ga0500562_000489 | |||
| 2043 | Ga0500562_006991 | |||
| 2044 | Ga0500562_016473 | |||
| 2045 | Ga0500562_027131 | |||
| 2046 | Ga0500594_0000724 | |||
| 2047 | Ga0500594_0086696 | |||
| 2048 | Ga0500595_000333 | |||
| 2049 | Ga0500595_000497 | |||
| 2050 | Ga0500595_000553 | |||
| 2051 | Ga0500595_002282 | |||
| 2052 | Ga0500608_000207 | |||
| 2053 | Ga0500608_063928 | |||
| 2054 | Ga0500608_141759 | |||
| 2055 | Ga0500614_015345 | |||
| 2056 | Ga0500614_040520 | |||
| 2057 | Ga0500618_000034 | |||
| 2058 | Ga0500618_006607 | |||
| 2059 | Ga0500628_081385 | |||
| 2060 | Ga0500642_0000015 | |||
| 2061 | Ga0500642_0001744 | |||
| 2062 | Ga0500642_0015152 | |||
| 2063 | Ga0500642_0133221 | |||
| 2064 | Ga0500642_0197676 | |||
| 2065 | Ga0500652_010728 | |||
| 2066 | Ga0500652_011638 | |||
| 2067 | Ga0500652_083744 | |||
| 2068 | Ga0500655_000460 | |||
| 2069 | Ga0500658_0000793 | |||
| 2070 | Ga0500658_0001085 | |||
| 2071 | Ga0500658_0010451 | |||
| 2072 | Ga0500658_0031805 | |||
| 2073 | Ga0500658_0055776 | |||
| 2074 | Ga0500658_0165245 | |||
| 2075 | Ga0500559_0000112 | |||
| 2076 | Ga0500559_0001714 | |||
| 2077 | Ga0500559_0033232 | |||
| 2078 | Ga0500559_0081897 | |||
| 2079 | Ga0500559_0089806 | |||
| 2080 | Ga0500559_0147656 | |||
| 2081 | Ga0500564_000057 | |||
| 2082 | Ga0500564_150650 | |||
| 2083 | Ga0500568_0000536 | |||
| 2084 | Ga0500568_0005756 | |||
| 2085 | Ga0500568_0016371 | |||
| 2086 | Ga0500568_0049176 | |||
| 2087 | Ga0500568_0077254 | |||
| 2088 | Ga0500568_0084110 | |||
| 2089 | Ga0500568_0084443 | |||
| 2090 | Ga0500568_0092354 | |||
| 2091 | Ga0500573_0067724 | |||
| 2092 | Ga0500586_000330 | |||
| 2093 | Ga0500588_0059114 | |||
| 2094 | Ga0500590_000163 | |||
| 2095 | Ga0500590_007211 | |||
| 2096 | Ga0500590_031070 | |||
| 2097 | Ga0500590_046959 | |||
| 2098 | Ga0500603_014424 | |||
| 2099 | Ga0500603_087833 | |||
| 2100 | Ga0500604_0053896 | |||
| 2101 | Ga0500616_0000033 | |||
| 2102 | Ga0500616_0001587 | |||
| 2103 | Ga0500616_0030013 | |||
| 2104 | Ga0500616_0118939 | |||
| 2105 | Ga0500622_0001006 | |||
| 2106 | Ga0500622_0001762 | |||
| 2107 | Ga0500622_0006755 | |||
| 2108 | Ga0500622_0017921 | |||
| 2109 | Ga0500622_0023088 | |||
| 2110 | Ga0500622_0026896 | |||
| 2111 | Ga0500622_0141881 | |||
| 2112 | Ga0500627_0043782 | |||
| 2113 | Ga0500627_0081653 | |||
| 2114 | Ga0500638_016198 | |||
| 2115 | Ga0500639_060191 | |||
| 2116 | Ga0500636_0015308 | |||
| 2117 | Ga0500636_0040450 | |||
| 2118 | Ga0500637_0000060 | |||
| 2119 | Ga0500570_004099 | |||
| 2120 | Ga0500570_077593 | |||
| 2121 | Ga0500611_021920 | |||
| 2122 | Ga0500611_027584 | |||
| 2123 | Ga0500645_000883 | |||
| 2124 | Ga0500645_029154 | |||
| 2125 | Ga0500645_064013 | |||
| 2126 | Ga0500609_000027 | |||
| 2127 | Ga0500609_002135 | |||
| 2128 | Ga0500596_001647 | |||
| 2129 | Ga0500599_002351 | |||
| 2130 | Ga0501084_0005116 | |||
| 2131 | Ga0501084_0254685 | |||
| 2132 | Ga0500661_001013 | |||
| 2133 | Ga0501082_0004333 | |||
| 2134 | Ga0501082_0098486 | |||
| 2135 | Ga0466962_0001247 | |||
| 2136 | 2509151565 | |||
| 2137 | 2511124191 | |||
| 2138 | 2513891646 | |||
| 2139 | 2517105700 | |||
| 2140 | 2524435444 | |||
| 2141 | 2585147145 | |||
| 2142 | 2585150853 | |||
| 2143 | 2585195825 | |||
| 2144 | 2585259718 | |||
| 2145 | 2587918018 | |||
| 2146 | 2603860096 | |||
| 2147 | 2643748399 | |||
| 2148 | 2643780674 | |||
| 2149 | 2643923880 | |||
| 2150 | 2643929447 | |||
| 2151 | 2643998673 | |||
| 2152 | 2644087375 | |||
| 2153 | 2644125726 | |||
| 2154 | 2644224552 | |||
| 2155 | 2644234513 | |||
| 2156 | 2644344581 | |||
| 2157 | 2644366735 | |||
| 2158 | 2644508212 | |||
| 2159 | 2745081392 | |||
| 2160 | 2792458916 | |||
| 2161 | 2819538598 | |||
| 2162 | 2819646868 | |||
| 2163 | 2824706075 | |||
| 2164 | 2824760292 | |||
| 2165 | 2824771531 | |||
| 2166 | 2824775749 | |||
| 2167 | 2841965297 | |||
| 2168 | 2842044359 | |||
| 2169 | 2842051652 | |||
| 2170 | 2843749072 | |||
| 2171 | 2849564398 | |||
| 2172 | 2849575270 | |||
| 2173 | 2851155526 | |||
| 2174 | 2857504811 | |||
| 2175 | 2857525079 | |||
| 2176 | 2874622434 | |||
| 2177 | 2876761700 | |||
| 2178 | 2884965359 | |||
| 2179 | 2893069665 | |||
| 2180 | 2898330873 | |||
| 2181 | 2904671559 | |||
| 2182 | 2904718102 | |||
| 2183 | 2919078967 | |||
| 2184 | 2928532858 | |||
| 2185 | 8006928840 | |||
| 2186 | 8016526936 | |||
| 2187 | 8016532020 | |||
| 2188 | 8016556858 | |||
| 2189 | 8016565211 | |||
| 2190 | 8016582856 | |||
| 2191 | 8016602854 | |||
| 2192 | 8019531837 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hob-assembly2.cif.gz_C | the crystal structure of the zalpha domain from cyprinid herpes virus 3 | 0.9176 | 4 | 48 |
| 4hob-assembly1.cif.gz_A | the crystal structure of the zalpha domain from cyprinid herpes virus 3 | 0.9095 | 4 | 48 |
| 5way-assembly1.cif.gz_B | mgaspn protein, mga regulator from streptococcus pneumoniae | 0.8969 | 2 | 52 |
| 3f72-assembly3.cif.gz_E | crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant | 0.8852 | 6 | 61 |
| 8fi3-assembly1.cif.gz_B | bifunctional ligase/repressor bira from klebsiella pneumoniae complexed with biotin (domain swapped dimer) | 0.885 | 6 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4a0yA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9473 | 1 | 45 | 1.10.10.10 |
| 3v7sA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9456 | 5 | 62 | 1.10.10.10 |
| af_Q2G258_1_64_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9359 | 7 | 62 | 1.10.10.10 |
| 4a12C01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9277 | 1 | 45 | 1.10.10.10 |
| 1j5yA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9275 | 3 | 64 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X3MD42-F1-model_v4 | WYL domain-containing protein | 0.942 | 136 | 212 |
|
| AF-A0A3D2X3X3-F1-model_v4 | YafY family transcriptional regulator | 0.9318 | 138 | 201 |
|
| AF-Q1WLE7-F1-model_v4 | WYL domain-containing protein | 0.9241 | 137 | 223 |
|
| AF-A0A1F6PI14-F1-model_v4 | WYL domain-containing protein | 0.9214 | 138 | 212 |
|
| AF-A0A2N2DEY2-F1-model_v4 | WYL domain-containing protein | 0.9205 | 138 | 212 |
|